contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,642,268,774
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 31
| 0
|
n = input()
c = 0
for i in range(len(n)) :
if n[i] == 'l' and n[i + 1] == 'l' :
c += 1
li= []
for i in n :
if i not in li :
li.append(i)
print(li)
l = []
for i in li :
if i == 'h' :
l.append(ord('h')-104)
if i == 'e' :
l.append(ord('e')-100)
if i == 'l' :
l.append(ord('l')-106)
if i == 'o' :
l.append(ord('o')-108)
if l == sorted(l) and c >= 1:
print('YES')
else :
print('NO')
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
n = input()
c = 0
for i in range(len(n)) :
if n[i] == 'l' and n[i + 1] == 'l' :
c += 1
li= []
for i in n :
if i not in li :
li.append(i)
print(li)
l = []
for i in li :
if i == 'h' :
l.append(ord('h')-104)
if i == 'e' :
l.append(ord('e')-100)
if i == 'l' :
l.append(ord('l')-106)
if i == 'o' :
l.append(ord('o')-108)
if l == sorted(l) and c >= 1:
print('YES')
else :
print('NO')
```
| 0
|
611
|
A
|
New Year and Days
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Today is Wednesday, the third day of the week. What's more interesting is that tomorrow is the last day of the year 2015.
Limak is a little polar bear. He enjoyed this year a lot. Now, he is so eager to the coming year 2016.
Limak wants to prove how responsible a bear he is. He is going to regularly save candies for the entire year 2016! He considers various saving plans. He can save one candy either on some fixed day of the week or on some fixed day of the month.
Limak chose one particular plan. He isn't sure how many candies he will save in the 2016 with his plan. Please, calculate it and tell him.
|
The only line of the input is in one of the following two formats:
- "*x* of week" where *x* (1<=≤<=*x*<=≤<=7) denotes the day of the week. The 1-st day is Monday and the 7-th one is Sunday. - "*x* of month" where *x* (1<=≤<=*x*<=≤<=31) denotes the day of the month.
|
Print one integer — the number of candies Limak will save in the year 2016.
|
[
"4 of week\n",
"30 of month\n"
] |
[
"52\n",
"11\n"
] |
Polar bears use the Gregorian calendar. It is the most common calendar and you likely use it too. You can read about it on Wikipedia if you want to – [https://en.wikipedia.org/wiki/Gregorian_calendar](https://en.wikipedia.org/wiki/Gregorian_calendar). The week starts with Monday.
In the first sample Limak wants to save one candy on each Thursday (the 4-th day of the week). There are 52 Thursdays in the 2016. Thus, he will save 52 candies in total.
In the second sample Limak wants to save one candy on the 30-th day of each month. There is the 30-th day in exactly 11 months in the 2016 — all months but February. It means that Limak will save 11 candies in total.
| 500
|
[
{
"input": "4 of week",
"output": "52"
},
{
"input": "30 of month",
"output": "11"
},
{
"input": "17 of month",
"output": "12"
},
{
"input": "31 of month",
"output": "7"
},
{
"input": "6 of week",
"output": "53"
},
{
"input": "1 of week",
"output": "52"
},
{
"input": "2 of week",
"output": "52"
},
{
"input": "3 of week",
"output": "52"
},
{
"input": "5 of week",
"output": "53"
},
{
"input": "7 of week",
"output": "52"
},
{
"input": "1 of month",
"output": "12"
},
{
"input": "2 of month",
"output": "12"
},
{
"input": "3 of month",
"output": "12"
},
{
"input": "4 of month",
"output": "12"
},
{
"input": "5 of month",
"output": "12"
},
{
"input": "6 of month",
"output": "12"
},
{
"input": "7 of month",
"output": "12"
},
{
"input": "8 of month",
"output": "12"
},
{
"input": "9 of month",
"output": "12"
},
{
"input": "10 of month",
"output": "12"
},
{
"input": "11 of month",
"output": "12"
},
{
"input": "12 of month",
"output": "12"
},
{
"input": "13 of month",
"output": "12"
},
{
"input": "14 of month",
"output": "12"
},
{
"input": "15 of month",
"output": "12"
},
{
"input": "16 of month",
"output": "12"
},
{
"input": "18 of month",
"output": "12"
},
{
"input": "19 of month",
"output": "12"
},
{
"input": "20 of month",
"output": "12"
},
{
"input": "21 of month",
"output": "12"
},
{
"input": "22 of month",
"output": "12"
},
{
"input": "23 of month",
"output": "12"
},
{
"input": "24 of month",
"output": "12"
},
{
"input": "25 of month",
"output": "12"
},
{
"input": "26 of month",
"output": "12"
},
{
"input": "27 of month",
"output": "12"
},
{
"input": "28 of month",
"output": "12"
},
{
"input": "29 of month",
"output": "12"
}
] | 1,451,488,670
| 770
|
Python 3
|
OK
|
TESTS
| 38
| 62
| 102,400
|
inp = input().split()
if inp[-1] == 'week':
n = int(inp[0])
if n == 5 or n == 6:
print(53)
else:
print(52)
else:
n = int(inp[0])
if n <= 29:
print(12)
elif n == 30:
print(11)
else:
print(7)
|
Title: New Year and Days
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today is Wednesday, the third day of the week. What's more interesting is that tomorrow is the last day of the year 2015.
Limak is a little polar bear. He enjoyed this year a lot. Now, he is so eager to the coming year 2016.
Limak wants to prove how responsible a bear he is. He is going to regularly save candies for the entire year 2016! He considers various saving plans. He can save one candy either on some fixed day of the week or on some fixed day of the month.
Limak chose one particular plan. He isn't sure how many candies he will save in the 2016 with his plan. Please, calculate it and tell him.
Input Specification:
The only line of the input is in one of the following two formats:
- "*x* of week" where *x* (1<=≤<=*x*<=≤<=7) denotes the day of the week. The 1-st day is Monday and the 7-th one is Sunday. - "*x* of month" where *x* (1<=≤<=*x*<=≤<=31) denotes the day of the month.
Output Specification:
Print one integer — the number of candies Limak will save in the year 2016.
Demo Input:
['4 of week\n', '30 of month\n']
Demo Output:
['52\n', '11\n']
Note:
Polar bears use the Gregorian calendar. It is the most common calendar and you likely use it too. You can read about it on Wikipedia if you want to – [https://en.wikipedia.org/wiki/Gregorian_calendar](https://en.wikipedia.org/wiki/Gregorian_calendar). The week starts with Monday.
In the first sample Limak wants to save one candy on each Thursday (the 4-th day of the week). There are 52 Thursdays in the 2016. Thus, he will save 52 candies in total.
In the second sample Limak wants to save one candy on the 30-th day of each month. There is the 30-th day in exactly 11 months in the 2016 — all months but February. It means that Limak will save 11 candies in total.
|
```python
inp = input().split()
if inp[-1] == 'week':
n = int(inp[0])
if n == 5 or n == 6:
print(53)
else:
print(52)
else:
n = int(inp[0])
if n <= 29:
print(12)
elif n == 30:
print(11)
else:
print(7)
```
| 3
|
|
749
|
C
|
Voting
|
PROGRAMMING
| 1,500
|
[
"greedy",
"implementation",
"two pointers"
] | null | null |
There are *n* employees in Alternative Cake Manufacturing (ACM). They are now voting on some very important question and the leading world media are trying to predict the outcome of the vote.
Each of the employees belongs to one of two fractions: depublicans or remocrats, and these two fractions have opposite opinions on what should be the outcome of the vote. The voting procedure is rather complicated:
1. Each of *n* employees makes a statement. They make statements one by one starting from employees 1 and finishing with employee *n*. If at the moment when it's time for the *i*-th employee to make a statement he no longer has the right to vote, he just skips his turn (and no longer takes part in this voting). 1. When employee makes a statement, he can do nothing or declare that one of the other employees no longer has a right to vote. It's allowed to deny from voting people who already made the statement or people who are only waiting to do so. If someone is denied from voting he no longer participates in the voting till the very end. 1. When all employees are done with their statements, the procedure repeats: again, each employees starting from 1 and finishing with *n* who are still eligible to vote make their statements. 1. The process repeats until there is only one employee eligible to vote remaining and he determines the outcome of the whole voting. Of course, he votes for the decision suitable for his fraction.
You know the order employees are going to vote and that they behave optimal (and they also know the order and who belongs to which fraction). Predict the outcome of the vote.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of employees.
The next line contains *n* characters. The *i*-th character is 'D' if the *i*-th employee is from depublicans fraction or 'R' if he is from remocrats.
|
Print 'D' if the outcome of the vote will be suitable for depublicans and 'R' if remocrats will win.
|
[
"5\nDDRRR\n",
"6\nDDRRRR\n"
] |
[
"D\n",
"R\n"
] |
Consider one of the voting scenarios for the first sample:
1. Employee 1 denies employee 5 to vote. 1. Employee 2 denies employee 3 to vote. 1. Employee 3 has no right to vote and skips his turn (he was denied by employee 2). 1. Employee 4 denies employee 2 to vote. 1. Employee 5 has no right to vote and skips his turn (he was denied by employee 1). 1. Employee 1 denies employee 4. 1. Only employee 1 now has the right to vote so the voting ends with the victory of depublicans.
| 1,500
|
[
{
"input": "5\nDDRRR",
"output": "D"
},
{
"input": "6\nDDRRRR",
"output": "R"
},
{
"input": "1\nD",
"output": "D"
},
{
"input": "1\nR",
"output": "R"
},
{
"input": "2\nDR",
"output": "D"
},
{
"input": "3\nRDD",
"output": "D"
},
{
"input": "3\nDRD",
"output": "D"
},
{
"input": "4\nDRRD",
"output": "D"
},
{
"input": "4\nDRRR",
"output": "R"
},
{
"input": "4\nRDRD",
"output": "R"
},
{
"input": "5\nDRDRR",
"output": "D"
},
{
"input": "4\nRRRR",
"output": "R"
},
{
"input": "5\nRDDRD",
"output": "D"
},
{
"input": "5\nDDRRD",
"output": "D"
},
{
"input": "5\nDRRRD",
"output": "R"
},
{
"input": "5\nDDDDD",
"output": "D"
},
{
"input": "6\nDRRDDR",
"output": "D"
},
{
"input": "7\nRDRDRDD",
"output": "R"
},
{
"input": "7\nRDRDDRD",
"output": "D"
},
{
"input": "7\nRRRDDDD",
"output": "R"
},
{
"input": "8\nRRRDDDDD",
"output": "D"
},
{
"input": "9\nRRRDDDDDR",
"output": "R"
},
{
"input": "9\nRRDDDRRDD",
"output": "R"
},
{
"input": "9\nRRDDDRDRD",
"output": "D"
},
{
"input": "10\nDDRRRDRRDD",
"output": "D"
},
{
"input": "11\nDRDRRDDRDDR",
"output": "D"
},
{
"input": "12\nDRDRDRDRRDRD",
"output": "D"
},
{
"input": "13\nDRDDDDRRRRDDR",
"output": "D"
},
{
"input": "14\nDDRDRRDRDRDDDD",
"output": "D"
},
{
"input": "15\nDDRRRDDRDRRRDRD",
"output": "D"
},
{
"input": "50\nDDDRDRDDDDRRRRDDDDRRRDRRRDDDRRRRDRDDDRRDRRDDDRDDDD",
"output": "D"
},
{
"input": "50\nDRDDDDDDDRDRDDRRRDRDRDRDDDRRDRRDRDRRDDDRDDRDRDRDDR",
"output": "D"
},
{
"input": "100\nRDRRDRDDDDRDRRDDRDRRDDRRDDRRRDRRRDDDRDDRDDRRDRDRRRDRDRRRDRRDDDRDDRRRDRDRRRDDRDRDDDDDDDRDRRDDDDDDRRDD",
"output": "D"
},
{
"input": "100\nRRDRRDDDDDDDRDRRRDRDRDDDRDDDRDDRDRRDRRRDRRDRRRRRRRDRRRRRRDDDRRDDRRRDRRRDDRRDRRDDDDDRRDRDDRDDRRRDRRDD",
"output": "R"
},
{
"input": "6\nRDDRDR",
"output": "D"
},
{
"input": "6\nDRRDRD",
"output": "R"
},
{
"input": "8\nDDDRRRRR",
"output": "R"
},
{
"input": "7\nRRRDDDD",
"output": "R"
},
{
"input": "7\nRDDRRDD",
"output": "D"
},
{
"input": "9\nRDDDRRDRR",
"output": "R"
},
{
"input": "5\nRDRDD",
"output": "R"
},
{
"input": "5\nRRDDD",
"output": "R"
},
{
"input": "8\nRDDRDRRD",
"output": "R"
},
{
"input": "10\nDRRRDDRDRD",
"output": "R"
},
{
"input": "7\nDRRDDRR",
"output": "R"
},
{
"input": "12\nRDDDRRDRRDDR",
"output": "D"
},
{
"input": "7\nRDRDDDR",
"output": "D"
},
{
"input": "7\nDDRRRDR",
"output": "R"
},
{
"input": "10\nDRRDRDRDRD",
"output": "R"
},
{
"input": "21\nDDDDRRRRRDRDRDRDRDRDR",
"output": "R"
},
{
"input": "11\nRDDDDDRRRRR",
"output": "D"
},
{
"input": "10\nRDDDRRRDDR",
"output": "D"
},
{
"input": "4\nRDDR",
"output": "R"
},
{
"input": "7\nRDRDDRD",
"output": "D"
},
{
"input": "8\nRDDDRRRD",
"output": "R"
},
{
"input": "16\nDRRDRDRDRDDRDRDR",
"output": "R"
},
{
"input": "8\nDRRDRDRD",
"output": "R"
},
{
"input": "6\nRDDDRR",
"output": "D"
},
{
"input": "10\nDDRRRRRDDD",
"output": "D"
},
{
"input": "7\nDDRRRRD",
"output": "R"
},
{
"input": "12\nRDDRDRDRRDRD",
"output": "D"
},
{
"input": "9\nDDRRRDRDR",
"output": "R"
},
{
"input": "20\nRDDRDRDRDRRDRDRDRDDR",
"output": "D"
},
{
"input": "7\nRRDDDRD",
"output": "D"
},
{
"input": "12\nDRRRRRRDDDDD",
"output": "R"
},
{
"input": "12\nRDRDDRDRDRDR",
"output": "D"
},
{
"input": "6\nDDDDDD",
"output": "D"
},
{
"input": "10\nRRRDDRDDDD",
"output": "R"
},
{
"input": "40\nRDDDRDDDRDRRDRDRRRRRDRDRDRDRRDRDRDRRDDDD",
"output": "R"
},
{
"input": "50\nRRDDDRRDRRRDDRDDDDDRDDRRRRRRDRDDRDDDRDRRDDRDDDRDRD",
"output": "D"
},
{
"input": "5\nRDRDR",
"output": "R"
},
{
"input": "9\nDRRDRDDRR",
"output": "R"
},
{
"input": "6\nDRRRDD",
"output": "R"
},
{
"input": "10\nDDDDRRRRRR",
"output": "D"
},
{
"input": "9\nRRDDDDRRD",
"output": "D"
}
] | 1,678,883,369
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 144
| 124
| 7,782,400
|
n = int(input())
s = list(input())
r, d =0, 0
while(True):
t=0
for i in range(n):
if s[i]=='D':
if d>0:
s[i]='0'
d-=1
t+=1
else:
r+=1
if s[i]=='R':
if r>0:
s[i]='0'
r-=1
t+=1
else:
d+=1
if t==0:
for i in range(n):
if s[i]!='0':
print(s[i])
exit()
|
Title: Voting
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* employees in Alternative Cake Manufacturing (ACM). They are now voting on some very important question and the leading world media are trying to predict the outcome of the vote.
Each of the employees belongs to one of two fractions: depublicans or remocrats, and these two fractions have opposite opinions on what should be the outcome of the vote. The voting procedure is rather complicated:
1. Each of *n* employees makes a statement. They make statements one by one starting from employees 1 and finishing with employee *n*. If at the moment when it's time for the *i*-th employee to make a statement he no longer has the right to vote, he just skips his turn (and no longer takes part in this voting). 1. When employee makes a statement, he can do nothing or declare that one of the other employees no longer has a right to vote. It's allowed to deny from voting people who already made the statement or people who are only waiting to do so. If someone is denied from voting he no longer participates in the voting till the very end. 1. When all employees are done with their statements, the procedure repeats: again, each employees starting from 1 and finishing with *n* who are still eligible to vote make their statements. 1. The process repeats until there is only one employee eligible to vote remaining and he determines the outcome of the whole voting. Of course, he votes for the decision suitable for his fraction.
You know the order employees are going to vote and that they behave optimal (and they also know the order and who belongs to which fraction). Predict the outcome of the vote.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of employees.
The next line contains *n* characters. The *i*-th character is 'D' if the *i*-th employee is from depublicans fraction or 'R' if he is from remocrats.
Output Specification:
Print 'D' if the outcome of the vote will be suitable for depublicans and 'R' if remocrats will win.
Demo Input:
['5\nDDRRR\n', '6\nDDRRRR\n']
Demo Output:
['D\n', 'R\n']
Note:
Consider one of the voting scenarios for the first sample:
1. Employee 1 denies employee 5 to vote. 1. Employee 2 denies employee 3 to vote. 1. Employee 3 has no right to vote and skips his turn (he was denied by employee 2). 1. Employee 4 denies employee 2 to vote. 1. Employee 5 has no right to vote and skips his turn (he was denied by employee 1). 1. Employee 1 denies employee 4. 1. Only employee 1 now has the right to vote so the voting ends with the victory of depublicans.
|
```python
n = int(input())
s = list(input())
r, d =0, 0
while(True):
t=0
for i in range(n):
if s[i]=='D':
if d>0:
s[i]='0'
d-=1
t+=1
else:
r+=1
if s[i]=='R':
if r>0:
s[i]='0'
r-=1
t+=1
else:
d+=1
if t==0:
for i in range(n):
if s[i]!='0':
print(s[i])
exit()
```
| 3
|
|
157
|
B
|
Trace
|
PROGRAMMING
| 1,000
|
[
"geometry",
"sortings"
] | null | null |
One day, as Sherlock Holmes was tracking down one very important criminal, he found a wonderful painting on the wall. This wall could be represented as a plane. The painting had several concentric circles that divided the wall into several parts. Some parts were painted red and all the other were painted blue. Besides, any two neighboring parts were painted different colors, that is, the red and the blue color were alternating, i. e. followed one after the other. The outer area of the wall (the area that lied outside all circles) was painted blue. Help Sherlock Holmes determine the total area of red parts of the wall.
Let us remind you that two circles are called concentric if their centers coincide. Several circles are called concentric if any two of them are concentric.
|
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=100). The second line contains *n* space-separated integers *r**i* (1<=≤<=*r**i*<=≤<=1000) — the circles' radii. It is guaranteed that all circles are different.
|
Print the single real number — total area of the part of the wall that is painted red. The answer is accepted if absolute or relative error doesn't exceed 10<=-<=4.
|
[
"1\n1\n",
"3\n1 4 2\n"
] |
[
"3.1415926536\n",
"40.8407044967\n"
] |
In the first sample the picture is just one circle of radius 1. Inner part of the circle is painted red. The area of the red part equals π × 1<sup class="upper-index">2</sup> = π.
In the second sample there are three circles of radii 1, 4 and 2. Outside part of the second circle is painted blue. Part between the second and the third circles is painted red. Part between the first and the third is painted blue. And, finally, the inner part of the first circle is painted red. Overall there are two red parts: the ring between the second and the third circles and the inner part of the first circle. Total area of the red parts is equal (π × 4<sup class="upper-index">2</sup> - π × 2<sup class="upper-index">2</sup>) + π × 1<sup class="upper-index">2</sup> = π × 12 + π = 13π
| 1,000
|
[
{
"input": "1\n1",
"output": "3.1415926536"
},
{
"input": "3\n1 4 2",
"output": "40.8407044967"
},
{
"input": "4\n4 1 3 2",
"output": "31.4159265359"
},
{
"input": "4\n100 10 2 1",
"output": "31111.1920484997"
},
{
"input": "10\n10 9 8 7 6 5 4 3 2 1",
"output": "172.7875959474"
},
{
"input": "1\n1000",
"output": "3141592.6535897931"
},
{
"input": "8\n8 1 7 2 6 3 5 4",
"output": "113.0973355292"
},
{
"input": "100\n1000 999 998 997 996 995 994 993 992 991 990 989 988 987 986 985 984 983 982 981 980 979 978 977 976 975 974 973 972 971 970 969 968 967 966 965 964 963 962 961 960 959 958 957 956 955 954 953 952 951 950 949 948 947 946 945 944 943 942 941 940 939 938 937 936 935 934 933 932 931 930 929 928 927 926 925 924 923 922 921 920 919 918 917 916 915 914 913 912 911 910 909 908 907 906 905 904 903 902 901",
"output": "298608.3817237098"
},
{
"input": "6\n109 683 214 392 678 10",
"output": "397266.9574170437"
},
{
"input": "2\n151 400",
"output": "431023.3704798660"
},
{
"input": "6\n258 877 696 425 663 934",
"output": "823521.3902487604"
},
{
"input": "9\n635 707 108 234 52 180 910 203 782",
"output": "1100144.9065826489"
},
{
"input": "8\n885 879 891 428 522 176 135 983",
"output": "895488.9947571954"
},
{
"input": "3\n269 918 721",
"output": "1241695.6467754442"
},
{
"input": "7\n920 570 681 428 866 935 795",
"output": "1469640.1849419588"
},
{
"input": "2\n517 331",
"output": "495517.1260654109"
},
{
"input": "2\n457 898",
"output": "1877274.3981158488"
},
{
"input": "8\n872 704 973 612 183 274 739 253",
"output": "1780774.0965755312"
},
{
"input": "74\n652 446 173 457 760 847 670 25 196 775 998 279 656 809 883 148 969 884 792 502 641 800 663 938 362 339 545 608 107 184 834 666 149 458 864 72 199 658 618 987 126 723 806 643 689 958 626 904 944 415 427 498 628 331 636 261 281 276 478 220 513 595 510 384 354 561 469 462 799 449 747 109 903 456",
"output": "1510006.5089479341"
},
{
"input": "76\n986 504 673 158 87 332 124 218 714 235 212 122 878 370 938 81 686 323 386 348 410 468 875 107 50 960 82 834 234 663 651 422 794 633 294 771 945 607 146 913 950 858 297 88 882 725 247 872 645 749 799 987 115 394 380 382 971 429 593 426 652 353 351 233 868 598 889 116 71 376 916 464 414 976 138 903",
"output": "1528494.7817143100"
},
{
"input": "70\n12 347 748 962 514 686 192 159 990 4 10 788 602 542 946 215 523 727 799 717 955 796 529 465 897 103 181 515 495 153 710 179 747 145 16 585 943 998 923 708 156 399 770 547 775 285 9 68 713 722 570 143 913 416 663 624 925 218 64 237 797 138 942 213 188 818 780 840 480 758",
"output": "1741821.4892636713"
},
{
"input": "26\n656 508 45 189 561 366 96 486 547 386 703 570 780 689 264 26 11 74 466 76 421 48 982 886 215 650",
"output": "1818821.9252031571"
},
{
"input": "52\n270 658 808 249 293 707 700 78 791 167 92 772 807 502 830 991 945 102 968 376 556 578 326 980 688 368 280 853 646 256 666 638 424 737 321 996 925 405 199 680 953 541 716 481 727 143 577 919 892 355 346 298",
"output": "1272941.9273080483"
},
{
"input": "77\n482 532 200 748 692 697 171 863 586 547 301 149 326 812 147 698 303 691 527 805 681 387 619 947 598 453 167 799 840 508 893 688 643 974 998 341 804 230 538 669 271 404 477 759 943 596 949 235 880 160 151 660 832 82 969 539 708 889 258 81 224 655 790 144 462 582 646 256 445 52 456 920 67 819 631 484 534",
"output": "2045673.1891262225"
},
{
"input": "27\n167 464 924 575 775 97 944 390 297 315 668 296 533 829 851 406 702 366 848 512 71 197 321 900 544 529 116",
"output": "1573959.9105970615"
},
{
"input": "38\n488 830 887 566 720 267 583 102 65 200 884 220 263 858 510 481 316 804 754 568 412 166 374 869 356 977 145 421 500 58 664 252 745 70 381 927 670 772",
"output": "1479184.3434235646"
},
{
"input": "64\n591 387 732 260 840 397 563 136 571 876 831 953 799 493 579 13 559 872 53 678 256 232 969 993 847 14 837 365 547 997 604 199 834 529 306 443 739 49 19 276 343 835 904 588 900 870 439 576 975 955 518 117 131 347 800 83 432 882 869 709 32 950 314 450",
"output": "1258248.6984672088"
},
{
"input": "37\n280 281 169 68 249 389 977 101 360 43 448 447 368 496 125 507 747 392 338 270 916 150 929 428 118 266 589 470 774 852 263 644 187 817 808 58 637",
"output": "1495219.0323274869"
},
{
"input": "97\n768 569 306 968 437 779 227 561 412 60 44 807 234 645 169 858 580 396 343 145 842 723 416 80 456 247 81 150 297 116 760 964 312 558 101 850 549 650 299 868 121 435 579 705 118 424 302 812 970 397 659 565 916 183 933 459 6 593 518 717 326 305 744 470 75 981 824 221 294 324 194 293 251 446 481 215 338 861 528 829 921 945 540 89 450 178 24 460 990 392 148 219 934 615 932 340 937",
"output": "1577239.7333274092"
},
{
"input": "94\n145 703 874 425 277 652 239 496 458 658 339 842 564 699 893 352 625 980 432 121 798 872 499 859 850 721 414 825 543 843 304 111 342 45 219 311 50 748 465 902 781 822 504 985 919 656 280 310 917 438 464 527 491 713 906 329 635 777 223 810 501 535 156 252 806 112 971 719 103 443 165 98 579 554 244 996 221 560 301 51 977 422 314 858 528 772 448 626 185 194 536 66 577 677",
"output": "1624269.3753516484"
},
{
"input": "97\n976 166 649 81 611 927 480 231 998 711 874 91 969 521 531 414 993 790 317 981 9 261 437 332 173 573 904 777 882 990 658 878 965 64 870 896 271 732 431 53 761 943 418 602 708 949 930 130 512 240 363 458 673 319 131 784 224 48 919 126 208 212 911 59 677 535 450 273 479 423 79 807 336 18 72 290 724 28 123 605 287 228 350 897 250 392 885 655 746 417 643 114 813 378 355 635 905",
"output": "1615601.7212203942"
},
{
"input": "91\n493 996 842 9 748 178 1 807 841 519 796 998 84 670 778 143 707 208 165 893 154 943 336 150 761 881 434 112 833 55 412 682 552 945 758 189 209 600 354 325 440 844 410 20 136 665 88 791 688 17 539 821 133 236 94 606 483 446 429 60 960 476 915 134 137 852 754 908 276 482 117 252 297 903 981 203 829 811 471 135 188 667 710 393 370 302 874 872 551 457 692",
"output": "1806742.5014501044"
},
{
"input": "95\n936 736 17 967 229 607 589 291 242 244 29 698 800 566 630 667 90 416 11 94 812 838 668 520 678 111 490 823 199 973 681 676 683 721 262 896 682 713 402 691 874 44 95 704 56 322 822 887 639 433 406 35 988 61 176 496 501 947 440 384 372 959 577 370 754 802 1 945 427 116 746 408 308 391 397 730 493 183 203 871 831 862 461 565 310 344 504 378 785 137 279 123 475 138 415",
"output": "1611115.5269110680"
},
{
"input": "90\n643 197 42 218 582 27 66 704 195 445 641 675 285 639 503 686 242 327 57 955 848 287 819 992 756 749 363 48 648 736 580 117 752 921 923 372 114 313 202 337 64 497 399 25 883 331 24 871 917 8 517 486 323 529 325 92 891 406 864 402 263 773 931 253 625 31 17 271 140 131 232 586 893 525 846 54 294 562 600 801 214 55 768 683 389 738 314 284 328 804",
"output": "1569819.2914796301"
},
{
"input": "98\n29 211 984 75 333 96 840 21 352 168 332 433 130 944 215 210 620 442 363 877 91 491 513 955 53 82 351 19 998 706 702 738 770 453 344 117 893 590 723 662 757 16 87 546 312 669 568 931 224 374 927 225 751 962 651 587 361 250 256 240 282 600 95 64 384 589 813 783 39 918 412 648 506 283 886 926 443 173 946 241 310 33 622 565 261 360 547 339 943 367 354 25 479 743 385 485 896 741",
"output": "2042921.1539616778"
},
{
"input": "93\n957 395 826 67 185 4 455 880 683 654 463 84 258 878 553 592 124 585 9 133 20 609 43 452 725 125 801 537 700 685 771 155 566 376 19 690 383 352 174 208 177 416 304 1000 533 481 87 509 358 233 681 22 507 659 36 859 952 259 138 271 594 779 576 782 119 69 608 758 283 616 640 523 710 751 34 106 774 92 874 568 864 660 998 992 474 679 180 409 15 297 990 689 501",
"output": "1310703.8710041976"
},
{
"input": "97\n70 611 20 30 904 636 583 262 255 501 604 660 212 128 199 138 545 576 506 528 12 410 77 888 783 972 431 188 338 485 148 793 907 678 281 922 976 680 252 724 253 920 177 361 721 798 960 572 99 622 712 466 608 49 612 345 266 751 63 594 40 695 532 789 520 930 825 929 48 59 405 135 109 735 508 186 495 772 375 587 201 324 447 610 230 947 855 318 856 956 313 810 931 175 668 183 688",
"output": "1686117.9099228707"
},
{
"input": "96\n292 235 391 180 840 172 218 997 166 287 329 20 886 325 400 471 182 356 448 337 417 319 58 106 366 764 393 614 90 831 924 314 667 532 64 874 3 434 350 352 733 795 78 640 967 63 47 879 635 272 145 569 468 792 153 761 770 878 281 467 209 208 298 37 700 18 334 93 5 750 412 779 523 517 360 649 447 328 311 653 57 578 767 460 647 663 50 670 151 13 511 580 625 907 227 89",
"output": "1419726.5608617242"
},
{
"input": "100\n469 399 735 925 62 153 707 723 819 529 200 624 57 708 245 384 889 11 639 638 260 419 8 142 403 298 204 169 887 388 241 983 885 267 643 943 417 237 452 562 6 839 149 742 832 896 100 831 712 754 679 743 135 222 445 680 210 955 220 63 960 487 514 824 481 584 441 997 795 290 10 45 510 678 844 503 407 945 850 84 858 934 500 320 936 663 736 592 161 670 606 465 864 969 293 863 868 393 899 744",
"output": "1556458.0979239127"
},
{
"input": "100\n321 200 758 415 190 710 920 992 873 898 814 259 359 66 971 210 838 545 663 652 684 277 36 756 963 459 335 484 462 982 532 423 131 703 307 229 391 938 253 847 542 975 635 928 220 980 222 567 557 181 366 824 900 180 107 979 112 564 525 413 300 422 876 615 737 343 902 8 654 628 469 913 967 785 893 314 909 215 912 262 20 709 363 915 997 954 986 454 596 124 74 159 660 550 787 418 895 786 293 50",
"output": "1775109.8050211088"
},
{
"input": "100\n859 113 290 762 701 63 188 431 810 485 671 673 99 658 194 227 511 435 941 212 551 124 89 222 42 321 657 815 898 171 216 482 707 567 724 491 414 942 820 351 48 653 685 312 586 24 20 627 602 498 533 173 463 262 621 466 119 299 580 964 510 987 40 698 521 998 847 651 746 215 808 563 785 837 631 772 404 923 682 244 232 214 390 350 968 771 517 900 70 543 934 554 681 368 642 575 891 728 478 317",
"output": "1447969.4788174964"
},
{
"input": "100\n941 283 349 457 52 837 299 284 796 305 893 624 101 972 738 204 121 70 17 704 836 791 95 111 162 952 472 724 733 580 878 177 705 804 11 211 463 417 288 409 410 485 896 755 921 267 164 656 505 765 539 439 535 19 991 689 220 474 114 944 884 144 926 849 486 566 117 35 749 499 797 303 362 905 690 890 976 66 590 183 234 683 39 297 769 787 376 541 571 759 495 200 261 352 73 493 831 442 273 339",
"output": "1597889.4218394549"
},
{
"input": "100\n110 868 147 888 291 282 916 542 917 337 235 595 498 621 814 249 261 713 445 666 142 275 319 49 900 543 333 606 487 670 620 769 852 258 230 867 603 491 714 839 879 37 21 74 590 190 397 506 499 967 152 862 200 107 145 23 614 167 857 475 79 598 270 906 626 116 89 59 651 846 723 201 50 699 522 408 634 132 226 414 824 764 513 586 526 238 556 162 667 173 684 415 527 743 10 442 552 274 350 822",
"output": "1567230.6191330721"
},
{
"input": "100\n901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000",
"output": "298608.3817237098"
}
] | 1,651,690,939
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 44
| 92
| 0
|
from math import pi
n = int(input())
circles = list(map(int, input().split(' ')))
circles.sort()
circles.reverse()
s = 0
for i in range(1, len(circles) + 1):
if i % 2 == 0:
s -= circles[i - 1] ** 2 * pi
else:
s += circles[i - 1] ** 2 * pi
print(s)
|
Title: Trace
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, as Sherlock Holmes was tracking down one very important criminal, he found a wonderful painting on the wall. This wall could be represented as a plane. The painting had several concentric circles that divided the wall into several parts. Some parts were painted red and all the other were painted blue. Besides, any two neighboring parts were painted different colors, that is, the red and the blue color were alternating, i. e. followed one after the other. The outer area of the wall (the area that lied outside all circles) was painted blue. Help Sherlock Holmes determine the total area of red parts of the wall.
Let us remind you that two circles are called concentric if their centers coincide. Several circles are called concentric if any two of them are concentric.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=100). The second line contains *n* space-separated integers *r**i* (1<=≤<=*r**i*<=≤<=1000) — the circles' radii. It is guaranteed that all circles are different.
Output Specification:
Print the single real number — total area of the part of the wall that is painted red. The answer is accepted if absolute or relative error doesn't exceed 10<=-<=4.
Demo Input:
['1\n1\n', '3\n1 4 2\n']
Demo Output:
['3.1415926536\n', '40.8407044967\n']
Note:
In the first sample the picture is just one circle of radius 1. Inner part of the circle is painted red. The area of the red part equals π × 1<sup class="upper-index">2</sup> = π.
In the second sample there are three circles of radii 1, 4 and 2. Outside part of the second circle is painted blue. Part between the second and the third circles is painted red. Part between the first and the third is painted blue. And, finally, the inner part of the first circle is painted red. Overall there are two red parts: the ring between the second and the third circles and the inner part of the first circle. Total area of the red parts is equal (π × 4<sup class="upper-index">2</sup> - π × 2<sup class="upper-index">2</sup>) + π × 1<sup class="upper-index">2</sup> = π × 12 + π = 13π
|
```python
from math import pi
n = int(input())
circles = list(map(int, input().split(' ')))
circles.sort()
circles.reverse()
s = 0
for i in range(1, len(circles) + 1):
if i % 2 == 0:
s -= circles[i - 1] ** 2 * pi
else:
s += circles[i - 1] ** 2 * pi
print(s)
```
| 3
|
|
891
|
A
|
Pride
|
PROGRAMMING
| 1,500
|
[
"brute force",
"dp",
"greedy",
"math",
"number theory"
] | null | null |
You have an array *a* with length *n*, you can perform operations. Each operation is like this: choose two adjacent elements from *a*, say *x* and *y*, and replace one of them with *gcd*(*x*,<=*y*), where *gcd* denotes the [greatest common divisor](https://en.wikipedia.org/wiki/Greatest_common_divisor).
What is the minimum number of operations you need to make all of the elements equal to 1?
|
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=2000) — the number of elements in the array.
The second line contains *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array.
|
Print -1, if it is impossible to turn all numbers to 1. Otherwise, print the minimum number of operations needed to make all numbers equal to 1.
|
[
"5\n2 2 3 4 6\n",
"4\n2 4 6 8\n",
"3\n2 6 9\n"
] |
[
"5\n",
"-1\n",
"4\n"
] |
In the first sample you can turn all numbers to 1 using the following 5 moves:
- [2, 2, 3, 4, 6]. - [2, 1, 3, 4, 6] - [2, 1, 3, 1, 6] - [2, 1, 1, 1, 6] - [1, 1, 1, 1, 6] - [1, 1, 1, 1, 1]
We can prove that in this case it is not possible to make all numbers one using less than 5 moves.
| 500
|
[
{
"input": "5\n2 2 3 4 6",
"output": "5"
},
{
"input": "4\n2 4 6 8",
"output": "-1"
},
{
"input": "3\n2 6 9",
"output": "4"
},
{
"input": "15\n10 10 10 10 10 10 21 21 21 21 21 21 21 21 21",
"output": "15"
},
{
"input": "12\n10 10 14 14 14 14 14 14 14 14 21 21",
"output": "20"
},
{
"input": "5\n10 10 14 21 21",
"output": "6"
},
{
"input": "9\n10 10 10 10 10 14 14 21 21",
"output": "11"
},
{
"input": "9\n10 10 10 10 10 10 10 10 21",
"output": "9"
},
{
"input": "13\n10 10 10 15 15 15 15 15 15 15 15 21 21",
"output": "21"
},
{
"input": "15\n10 10 10 10 10 10 10 10 10 10 10 10 15 15 21",
"output": "17"
},
{
"input": "4\n1 1 1 1",
"output": "0"
},
{
"input": "1\n3",
"output": "-1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n1000000000 1000000000",
"output": "-1"
},
{
"input": "1\n1000000000",
"output": "-1"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "3\n42 15 35",
"output": "4"
},
{
"input": "3\n6 10 15",
"output": "4"
},
{
"input": "4\n2 1 1 1",
"output": "1"
},
{
"input": "5\n2 1 1 1 2",
"output": "2"
},
{
"input": "3\n30 14 21",
"output": "4"
},
{
"input": "3\n15 6 10",
"output": "4"
},
{
"input": "4\n1 1 1 2",
"output": "1"
},
{
"input": "5\n1 1 1 2 2",
"output": "2"
},
{
"input": "4\n2 6 9 1",
"output": "3"
},
{
"input": "6\n2 3 4 1 1 1",
"output": "3"
},
{
"input": "15\n2 6 6 6 3 3 3 15 5 5 5 7 5 5 5",
"output": "15"
},
{
"input": "5\n2 3 2 6 9",
"output": "5"
},
{
"input": "6\n6 15 10 6 15 10",
"output": "7"
}
] | 1,633,789,055
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 30
| 108
| 23,347,200
|
from math import gcd
n, a = int(input()), [int(x) for x in input().split()]
pre = a
if 1 in a:
print(n - 1)
else:
for j in range(2, n + 1):
u = []
for k in range(n - j + 1):
u.append(gcd(pre[k], a[k + j - 1]))
if 1 in u:
print(n + j - 2)
break
pre = u
else:
print(-1)
|
Title: Pride
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have an array *a* with length *n*, you can perform operations. Each operation is like this: choose two adjacent elements from *a*, say *x* and *y*, and replace one of them with *gcd*(*x*,<=*y*), where *gcd* denotes the [greatest common divisor](https://en.wikipedia.org/wiki/Greatest_common_divisor).
What is the minimum number of operations you need to make all of the elements equal to 1?
Input Specification:
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=2000) — the number of elements in the array.
The second line contains *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array.
Output Specification:
Print -1, if it is impossible to turn all numbers to 1. Otherwise, print the minimum number of operations needed to make all numbers equal to 1.
Demo Input:
['5\n2 2 3 4 6\n', '4\n2 4 6 8\n', '3\n2 6 9\n']
Demo Output:
['5\n', '-1\n', '4\n']
Note:
In the first sample you can turn all numbers to 1 using the following 5 moves:
- [2, 2, 3, 4, 6]. - [2, 1, 3, 4, 6] - [2, 1, 3, 1, 6] - [2, 1, 1, 1, 6] - [1, 1, 1, 1, 6] - [1, 1, 1, 1, 1]
We can prove that in this case it is not possible to make all numbers one using less than 5 moves.
|
```python
from math import gcd
n, a = int(input()), [int(x) for x in input().split()]
pre = a
if 1 in a:
print(n - 1)
else:
for j in range(2, n + 1):
u = []
for k in range(n - j + 1):
u.append(gcd(pre[k], a[k + j - 1]))
if 1 in u:
print(n + j - 2)
break
pre = u
else:
print(-1)
```
| 0
|
|
887
|
A
|
Div. 64
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Top-model Izabella participates in the competition. She wants to impress judges and show her mathematical skills.
Her problem is following: for given string, consisting of only 0 and 1, tell if it's possible to remove some digits in such a way, that remaining number is a representation of some positive integer, divisible by 64, in the binary numerical system.
|
In the only line given a non-empty binary string *s* with length up to 100.
|
Print «yes» (without quotes) if it's possible to remove digits required way and «no» otherwise.
|
[
"100010001\n",
"100\n"
] |
[
"yes",
"no"
] |
In the first test case, you can get string 1 000 000 after removing two ones which is a representation of number 64 in the binary numerical system.
You can read more about binary numeral system representation here: [https://en.wikipedia.org/wiki/Binary_system](https://en.wikipedia.org/wiki/Binary_system)
| 500
|
[
{
"input": "100010001",
"output": "yes"
},
{
"input": "100",
"output": "no"
},
{
"input": "0000001000000",
"output": "yes"
},
{
"input": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "no"
},
{
"input": "1111111111111111111111111111111111111111111111111111111111111111111111110111111111111111111111111111",
"output": "no"
},
{
"input": "0111111101111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "no"
},
{
"input": "1111011111111111111111111111110111110111111111111111111111011111111111111110111111111111111111111111",
"output": "no"
},
{
"input": "1111111111101111111111111111111111111011111111111111111111111101111011111101111111111101111111111111",
"output": "yes"
},
{
"input": "0110111111111111111111011111111110110111110111111111111111111111111111111111111110111111111111111111",
"output": "yes"
},
{
"input": "1100110001111011001101101000001110111110011110111110010100011000100101000010010111100000010001001101",
"output": "yes"
},
{
"input": "000000",
"output": "no"
},
{
"input": "0001000",
"output": "no"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "no"
},
{
"input": "1000000",
"output": "yes"
},
{
"input": "0",
"output": "no"
},
{
"input": "1",
"output": "no"
},
{
"input": "10000000000",
"output": "yes"
},
{
"input": "0000000000",
"output": "no"
},
{
"input": "0010000",
"output": "no"
},
{
"input": "000000011",
"output": "no"
},
{
"input": "000000000",
"output": "no"
},
{
"input": "00000000",
"output": "no"
},
{
"input": "000000000011",
"output": "no"
},
{
"input": "0000000",
"output": "no"
},
{
"input": "00000000011",
"output": "no"
},
{
"input": "000000001",
"output": "no"
},
{
"input": "000000000000000000000000000",
"output": "no"
},
{
"input": "0000001",
"output": "no"
},
{
"input": "00000001",
"output": "no"
},
{
"input": "00000000100",
"output": "no"
},
{
"input": "00000000000000000000",
"output": "no"
},
{
"input": "0000000000000000000",
"output": "no"
},
{
"input": "00001000",
"output": "no"
},
{
"input": "0000000000010",
"output": "no"
},
{
"input": "000000000010",
"output": "no"
},
{
"input": "000000000000010",
"output": "no"
},
{
"input": "0100000",
"output": "no"
},
{
"input": "00010000",
"output": "no"
},
{
"input": "00000000000000000",
"output": "no"
},
{
"input": "00000000000",
"output": "no"
},
{
"input": "000001000",
"output": "no"
},
{
"input": "000000000000",
"output": "no"
},
{
"input": "100000000000000",
"output": "yes"
},
{
"input": "000010000",
"output": "no"
},
{
"input": "00000100",
"output": "no"
},
{
"input": "0001100000",
"output": "no"
},
{
"input": "000000000000000000000000001",
"output": "no"
},
{
"input": "000000100",
"output": "no"
},
{
"input": "0000000000001111111111",
"output": "no"
},
{
"input": "00000010",
"output": "no"
},
{
"input": "0001110000",
"output": "no"
},
{
"input": "0000000000000000000000",
"output": "no"
},
{
"input": "000000010010",
"output": "no"
},
{
"input": "0000100",
"output": "no"
},
{
"input": "0000000001",
"output": "no"
},
{
"input": "000000111",
"output": "no"
},
{
"input": "0000000000000",
"output": "no"
},
{
"input": "000000000000000000",
"output": "no"
},
{
"input": "0000000000000000000000000",
"output": "no"
},
{
"input": "000000000000000",
"output": "no"
},
{
"input": "0010000000000100",
"output": "yes"
},
{
"input": "0000001000",
"output": "no"
},
{
"input": "00000000000000000001",
"output": "no"
},
{
"input": "100000000",
"output": "yes"
},
{
"input": "000000000001",
"output": "no"
},
{
"input": "0000011001",
"output": "no"
},
{
"input": "000",
"output": "no"
},
{
"input": "000000000000000000000",
"output": "no"
},
{
"input": "0000000000011",
"output": "no"
},
{
"input": "0000000000000000",
"output": "no"
},
{
"input": "00000000000000001",
"output": "no"
},
{
"input": "00000000000000",
"output": "no"
},
{
"input": "0000000000000000010",
"output": "no"
},
{
"input": "00000000000000000000000000000000000000000000000000000000",
"output": "no"
},
{
"input": "000011000",
"output": "no"
},
{
"input": "00000011",
"output": "no"
},
{
"input": "0000000000001100",
"output": "no"
},
{
"input": "00000",
"output": "no"
},
{
"input": "000000000000000000000000000111111111111111",
"output": "no"
},
{
"input": "000000010",
"output": "no"
},
{
"input": "00000000111",
"output": "no"
},
{
"input": "000000000000001",
"output": "no"
},
{
"input": "0000000000000011111111111111111",
"output": "no"
},
{
"input": "0000000010",
"output": "no"
},
{
"input": "0000000000000000000000000000000000000000000000000",
"output": "no"
},
{
"input": "00000000010",
"output": "no"
},
{
"input": "101000000000",
"output": "yes"
},
{
"input": "00100000",
"output": "no"
},
{
"input": "00000000000001",
"output": "no"
},
{
"input": "0000000000100",
"output": "no"
},
{
"input": "0000",
"output": "no"
},
{
"input": "00000000000111",
"output": "no"
},
{
"input": "0000000000000011",
"output": "no"
},
{
"input": "0000000000000000000000000000000000000000",
"output": "no"
},
{
"input": "0000000000000010",
"output": "no"
},
{
"input": "0010101010",
"output": "no"
},
{
"input": "0000000000000001",
"output": "no"
},
{
"input": "1010101",
"output": "no"
}
] | 1,509,831,055
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 13
| 62
| 0
|
str = input()
counter = 0; mark = 0
for item in str:
if item == '0' and mark == 1:
counter += 1
elif item == '1' and mark == 0:
mark = 1
if counter >= 6 and len(str) > 7:
print("yes")
else:
print("no")
|
Title: Div. 64
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Top-model Izabella participates in the competition. She wants to impress judges and show her mathematical skills.
Her problem is following: for given string, consisting of only 0 and 1, tell if it's possible to remove some digits in such a way, that remaining number is a representation of some positive integer, divisible by 64, in the binary numerical system.
Input Specification:
In the only line given a non-empty binary string *s* with length up to 100.
Output Specification:
Print «yes» (without quotes) if it's possible to remove digits required way and «no» otherwise.
Demo Input:
['100010001\n', '100\n']
Demo Output:
['yes', 'no']
Note:
In the first test case, you can get string 1 000 000 after removing two ones which is a representation of number 64 in the binary numerical system.
You can read more about binary numeral system representation here: [https://en.wikipedia.org/wiki/Binary_system](https://en.wikipedia.org/wiki/Binary_system)
|
```python
str = input()
counter = 0; mark = 0
for item in str:
if item == '0' and mark == 1:
counter += 1
elif item == '1' and mark == 0:
mark = 1
if counter >= 6 and len(str) > 7:
print("yes")
else:
print("no")
```
| 0
|
|
863
|
B
|
Kayaking
|
PROGRAMMING
| 1,500
|
[
"brute force",
"greedy",
"sortings"
] | null | null |
Vadim is really keen on travelling. Recently he heard about kayaking activity near his town and became very excited about it, so he joined a party of kayakers.
Now the party is ready to start its journey, but firstly they have to choose kayaks. There are 2·*n* people in the group (including Vadim), and they have exactly *n*<=-<=1 tandem kayaks (each of which, obviously, can carry two people) and 2 single kayaks. *i*-th person's weight is *w**i*, and weight is an important matter in kayaking — if the difference between the weights of two people that sit in the same tandem kayak is too large, then it can crash. And, of course, people want to distribute their seats in kayaks in order to minimize the chances that kayaks will crash.
Formally, the instability of a single kayak is always 0, and the instability of a tandem kayak is the absolute difference between weights of the people that are in this kayak. Instability of the whole journey is the total instability of all kayaks.
Help the party to determine minimum possible total instability!
|
The first line contains one number *n* (2<=≤<=*n*<=≤<=50).
The second line contains 2·*n* integer numbers *w*1, *w*2, ..., *w*2*n*, where *w**i* is weight of person *i* (1<=≤<=*w**i*<=≤<=1000).
|
Print minimum possible total instability.
|
[
"2\n1 2 3 4\n",
"4\n1 3 4 6 3 4 100 200\n"
] |
[
"1\n",
"5\n"
] |
none
| 0
|
[
{
"input": "2\n1 2 3 4",
"output": "1"
},
{
"input": "4\n1 3 4 6 3 4 100 200",
"output": "5"
},
{
"input": "3\n305 139 205 406 530 206",
"output": "102"
},
{
"input": "3\n610 750 778 6 361 407",
"output": "74"
},
{
"input": "5\n97 166 126 164 154 98 221 7 51 47",
"output": "35"
},
{
"input": "50\n1 1 2 2 1 3 2 2 1 1 1 1 2 3 3 1 2 1 3 3 2 1 2 3 1 1 2 1 3 1 3 1 3 3 3 1 1 1 3 3 2 2 2 2 3 2 2 2 2 3 1 3 3 3 3 1 3 3 1 3 3 3 3 2 3 1 3 3 1 1 1 3 1 2 2 2 1 1 1 3 1 2 3 2 1 3 3 2 2 1 3 1 3 1 2 2 1 2 3 2",
"output": "0"
},
{
"input": "50\n5 5 5 5 4 2 2 3 2 2 4 1 5 5 1 2 4 2 4 2 5 2 2 2 2 3 2 4 2 5 5 4 3 1 2 3 3 5 4 2 2 5 2 4 5 5 4 4 1 5 5 3 2 2 5 1 3 3 2 4 4 5 1 2 3 4 4 1 3 3 3 5 1 2 4 4 4 4 2 5 2 5 3 2 4 5 5 2 1 1 2 4 5 3 2 1 2 4 4 4",
"output": "1"
},
{
"input": "50\n499 780 837 984 481 526 944 482 862 136 265 605 5 631 974 967 574 293 969 467 573 845 102 224 17 873 648 120 694 996 244 313 404 129 899 583 541 314 525 496 443 857 297 78 575 2 430 137 387 319 382 651 594 411 845 746 18 232 6 289 889 81 174 175 805 1000 799 950 475 713 951 685 729 925 262 447 139 217 788 514 658 572 784 185 112 636 10 251 621 218 210 89 597 553 430 532 264 11 160 476",
"output": "368"
},
{
"input": "50\n873 838 288 87 889 364 720 410 565 651 577 356 740 99 549 592 994 385 777 435 486 118 887 440 749 533 356 790 413 681 267 496 475 317 88 660 374 186 61 437 729 860 880 538 277 301 667 180 60 393 955 540 896 241 362 146 74 680 734 767 851 337 751 860 542 735 444 793 340 259 495 903 743 961 964 966 87 275 22 776 368 701 835 732 810 735 267 988 352 647 924 183 1 924 217 944 322 252 758 597",
"output": "393"
},
{
"input": "50\n297 787 34 268 439 629 600 398 425 833 721 908 830 636 64 509 420 647 499 675 427 599 396 119 798 742 577 355 22 847 389 574 766 453 196 772 808 261 106 844 726 975 173 992 874 89 775 616 678 52 69 591 181 573 258 381 665 301 589 379 362 146 790 842 765 100 229 916 938 97 340 793 758 177 736 396 247 562 571 92 923 861 165 748 345 703 431 930 101 761 862 595 505 393 126 846 431 103 596 21",
"output": "387"
},
{
"input": "50\n721 631 587 746 692 406 583 90 388 16 161 948 921 70 387 426 39 398 517 724 879 377 906 502 359 950 798 408 846 718 911 845 57 886 9 668 537 632 344 762 19 193 658 447 870 173 98 156 592 519 183 539 274 393 962 615 551 626 148 183 769 763 829 120 796 761 14 744 537 231 696 284 581 688 611 826 703 145 224 600 965 613 791 275 984 375 402 281 851 580 992 8 816 454 35 532 347 250 242 637",
"output": "376"
},
{
"input": "50\n849 475 37 120 754 183 758 374 543 198 896 691 11 607 198 343 761 660 239 669 628 259 223 182 216 158 20 565 454 884 137 923 156 22 310 77 267 707 582 169 120 308 439 309 59 152 206 696 210 177 296 887 559 22 154 553 142 247 491 692 473 572 461 206 532 319 503 164 328 365 541 366 300 392 486 257 863 432 877 404 520 69 418 99 519 239 374 927 601 103 226 316 423 219 240 26 455 101 184 61",
"output": "351"
},
{
"input": "3\n1 2 10 11 100 100",
"output": "1"
},
{
"input": "17\n814 744 145 886 751 1000 272 914 270 529 467 164 410 369 123 424 991 12 702 582 561 858 746 950 598 393 606 498 648 686 455 873 728 858",
"output": "318"
},
{
"input": "45\n476 103 187 696 463 457 588 632 763 77 391 721 95 124 378 812 980 193 694 898 859 572 721 274 605 264 929 615 257 918 42 493 1 3 697 349 990 800 82 535 382 816 943 735 11 272 562 323 653 370 766 332 666 130 704 604 645 717 267 255 37 470 925 941 376 611 332 758 504 40 477 263 708 434 38 596 650 990 714 662 572 467 949 799 648 581 545 828 508 636",
"output": "355"
},
{
"input": "2\n55 5 25 51",
"output": "4"
},
{
"input": "25\n89 50 640 463 858 301 522 241 923 378 892 822 550 17 42 66 706 779 657 840 273 222 444 459 94 925 437 159 182 727 92 851 742 215 653 891 782 533 29 128 133 883 317 475 165 994 802 434 744 973",
"output": "348"
},
{
"input": "4\n35 48 71 44 78 79 57 48",
"output": "10"
},
{
"input": "3\n58 89 73 15 5 47",
"output": "21"
},
{
"input": "2\n1 20 99 100",
"output": "1"
}
] | 1,672,082,713
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
n = int(input())
import functools
weight = list(map(int, input().split(" ")))
weight.sort()
print(weight)
weight2 = weight.copy()
total = 0
diff = []
for i in range(n):
diff.append(weight[i * 2 + 1] - weight[i * 2])
print(functools.reduce(lambda a, b: a + b, diff) - max(diff))
"""
for i in range(n-1):
diff = []
for j in range(len(weight2)-1):
diff.append(weight2[j+1]-weight2[j])
temp = min(diff)
print(weight2[diff.index(temp)])
weight2.pop(diff.index(temp))
weight2.pop(diff.index(temp))
print(temp)
print(weight2)
total += temp
print(total)
"""
|
Title: Kayaking
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vadim is really keen on travelling. Recently he heard about kayaking activity near his town and became very excited about it, so he joined a party of kayakers.
Now the party is ready to start its journey, but firstly they have to choose kayaks. There are 2·*n* people in the group (including Vadim), and they have exactly *n*<=-<=1 tandem kayaks (each of which, obviously, can carry two people) and 2 single kayaks. *i*-th person's weight is *w**i*, and weight is an important matter in kayaking — if the difference between the weights of two people that sit in the same tandem kayak is too large, then it can crash. And, of course, people want to distribute their seats in kayaks in order to minimize the chances that kayaks will crash.
Formally, the instability of a single kayak is always 0, and the instability of a tandem kayak is the absolute difference between weights of the people that are in this kayak. Instability of the whole journey is the total instability of all kayaks.
Help the party to determine minimum possible total instability!
Input Specification:
The first line contains one number *n* (2<=≤<=*n*<=≤<=50).
The second line contains 2·*n* integer numbers *w*1, *w*2, ..., *w*2*n*, where *w**i* is weight of person *i* (1<=≤<=*w**i*<=≤<=1000).
Output Specification:
Print minimum possible total instability.
Demo Input:
['2\n1 2 3 4\n', '4\n1 3 4 6 3 4 100 200\n']
Demo Output:
['1\n', '5\n']
Note:
none
|
```python
n = int(input())
import functools
weight = list(map(int, input().split(" ")))
weight.sort()
print(weight)
weight2 = weight.copy()
total = 0
diff = []
for i in range(n):
diff.append(weight[i * 2 + 1] - weight[i * 2])
print(functools.reduce(lambda a, b: a + b, diff) - max(diff))
"""
for i in range(n-1):
diff = []
for j in range(len(weight2)-1):
diff.append(weight2[j+1]-weight2[j])
temp = min(diff)
print(weight2[diff.index(temp)])
weight2.pop(diff.index(temp))
weight2.pop(diff.index(temp))
print(temp)
print(weight2)
total += temp
print(total)
"""
```
| 0
|
|
955
|
A
|
Feed the cat
|
PROGRAMMING
| 1,100
|
[
"greedy",
"math"
] | null | null |
After waking up at *hh*:*mm*, Andrew realised that he had forgotten to feed his only cat for yet another time (guess why there's only one cat). The cat's current hunger level is *H* points, moreover each minute without food increases his hunger by *D* points.
At any time Andrew can visit the store where tasty buns are sold (you can assume that is doesn't take time to get to the store and back). One such bun costs *C* roubles and decreases hunger by *N* points. Since the demand for bakery drops heavily in the evening, there is a special 20% discount for buns starting from 20:00 (note that the cost might become rational). Of course, buns cannot be sold by parts.
Determine the minimum amount of money Andrew has to spend in order to feed his cat. The cat is considered fed if its hunger level is less than or equal to zero.
|
The first line contains two integers *hh* and *mm* (00<=≤<=*hh*<=≤<=23,<=00<=≤<=*mm*<=≤<=59) — the time of Andrew's awakening.
The second line contains four integers *H*, *D*, *C* and *N* (1<=≤<=*H*<=≤<=105,<=1<=≤<=*D*,<=*C*,<=*N*<=≤<=102).
|
Output the minimum amount of money to within three decimal digits. You answer is considered correct, if its absolute or relative error does not exceed 10<=-<=4.
Formally, let your answer be *a*, and the jury's answer be *b*. Your answer is considered correct if .
|
[
"19 00\n255 1 100 1\n",
"17 41\n1000 6 15 11\n"
] |
[
"25200.0000\n",
"1365.0000\n"
] |
In the first sample Andrew can visit the store at exactly 20:00. The cat's hunger will be equal to 315, hence it will be necessary to purchase 315 buns. The discount makes the final answer 25200 roubles.
In the second sample it's optimal to visit the store right after he wakes up. Then he'll have to buy 91 bins per 15 roubles each and spend a total of 1365 roubles.
| 500
|
[
{
"input": "19 00\n255 1 100 1",
"output": "25200.0000"
},
{
"input": "17 41\n1000 6 15 11",
"output": "1365.0000"
},
{
"input": "16 34\n61066 14 50 59",
"output": "43360.0000"
},
{
"input": "18 18\n23331 86 87 41",
"output": "49590.0000"
},
{
"input": "10 48\n68438 8 18 29",
"output": "36187.2000"
},
{
"input": "08 05\n63677 9 83 25",
"output": "186252.0000"
},
{
"input": "00 00\n100000 100 100 100",
"output": "100000.0000"
},
{
"input": "20 55\n100000 100 100 100",
"output": "80000.0000"
},
{
"input": "23 59\n100000 100 100 100",
"output": "80000.0000"
},
{
"input": "00 00\n1 100 100 100",
"output": "100.0000"
},
{
"input": "21 26\n33193 54 97 66",
"output": "39032.8000"
},
{
"input": "20 45\n33756 24 21 1",
"output": "567100.8000"
},
{
"input": "14 33\n92062 59 89 72",
"output": "110146.4000"
},
{
"input": "01 24\n92730 5 35 29",
"output": "94920.0000"
},
{
"input": "20 58\n93398 43 86 99",
"output": "64947.2000"
},
{
"input": "23 04\n37170 81 32 64",
"output": "14873.6000"
},
{
"input": "01 38\n70542 27 74 26",
"output": "200836.0000"
},
{
"input": "04 28\n38505 65 25 95",
"output": "10150.0000"
},
{
"input": "00 10\n33077 21 40 22",
"output": "60160.0000"
},
{
"input": "10 44\n66449 67 90 83",
"output": "72090.0000"
},
{
"input": "05 51\n10220 5 33 48",
"output": "7029.0000"
},
{
"input": "20 19\n68886 28 48 94",
"output": "28147.2000"
},
{
"input": "01 49\n11621 55 78 46",
"output": "19734.0000"
},
{
"input": "21 28\n78549 91 4 98",
"output": "2566.4000"
},
{
"input": "18 06\n88580 22 35 59",
"output": "43232.0000"
},
{
"input": "22 28\n55507 53 61 11",
"output": "246293.6000"
},
{
"input": "18 58\n22434 84 91 59",
"output": "34143.2000"
},
{
"input": "15 36\n32466 27 22 15",
"output": "46464.0000"
},
{
"input": "17 31\n9603 53 73 74",
"output": "9490.0000"
},
{
"input": "14 53\n76530 92 4 22",
"output": "13916.0000"
},
{
"input": "18 31\n10753 23 30 74",
"output": "4152.0000"
},
{
"input": "17 43\n16290 46 90 94",
"output": "15660.0000"
},
{
"input": "18 38\n3652 11 53 94",
"output": "2067.0000"
},
{
"input": "19 57\n3 4 7 6",
"output": "7.0000"
}
] | 1,521,828,639
| 5,739
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 6
| 93
| 7,065,600
|
import math
ho,mi = map(int,input().split())
h,d,c,n = map(int,input().split())
nr = int(h / n) + 1
nc = nr * c
des = False
if (ho >= 20 and ho <= 23) :
des = True
if(not des) :
dif = (60-mi)
dif += (19 - ho)*60
h += (dif*d)
rate = math.ceil(h/n) *.8
tc = rate * c
if ( tc < nc) :
print (tc)
else :
print(nc)
else :
print(nc)
|
Title: Feed the cat
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After waking up at *hh*:*mm*, Andrew realised that he had forgotten to feed his only cat for yet another time (guess why there's only one cat). The cat's current hunger level is *H* points, moreover each minute without food increases his hunger by *D* points.
At any time Andrew can visit the store where tasty buns are sold (you can assume that is doesn't take time to get to the store and back). One such bun costs *C* roubles and decreases hunger by *N* points. Since the demand for bakery drops heavily in the evening, there is a special 20% discount for buns starting from 20:00 (note that the cost might become rational). Of course, buns cannot be sold by parts.
Determine the minimum amount of money Andrew has to spend in order to feed his cat. The cat is considered fed if its hunger level is less than or equal to zero.
Input Specification:
The first line contains two integers *hh* and *mm* (00<=≤<=*hh*<=≤<=23,<=00<=≤<=*mm*<=≤<=59) — the time of Andrew's awakening.
The second line contains four integers *H*, *D*, *C* and *N* (1<=≤<=*H*<=≤<=105,<=1<=≤<=*D*,<=*C*,<=*N*<=≤<=102).
Output Specification:
Output the minimum amount of money to within three decimal digits. You answer is considered correct, if its absolute or relative error does not exceed 10<=-<=4.
Formally, let your answer be *a*, and the jury's answer be *b*. Your answer is considered correct if .
Demo Input:
['19 00\n255 1 100 1\n', '17 41\n1000 6 15 11\n']
Demo Output:
['25200.0000\n', '1365.0000\n']
Note:
In the first sample Andrew can visit the store at exactly 20:00. The cat's hunger will be equal to 315, hence it will be necessary to purchase 315 buns. The discount makes the final answer 25200 roubles.
In the second sample it's optimal to visit the store right after he wakes up. Then he'll have to buy 91 bins per 15 roubles each and spend a total of 1365 roubles.
|
```python
import math
ho,mi = map(int,input().split())
h,d,c,n = map(int,input().split())
nr = int(h / n) + 1
nc = nr * c
des = False
if (ho >= 20 and ho <= 23) :
des = True
if(not des) :
dif = (60-mi)
dif += (19 - ho)*60
h += (dif*d)
rate = math.ceil(h/n) *.8
tc = rate * c
if ( tc < nc) :
print (tc)
else :
print(nc)
else :
print(nc)
```
| 0
|
|
4
|
A
|
Watermelon
|
PROGRAMMING
| 800
|
[
"brute force",
"math"
] |
A. Watermelon
|
1
|
64
|
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
|
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
|
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
|
[
"8\n"
] |
[
"YES\n"
] |
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
| 0
|
[
{
"input": "8",
"output": "YES"
},
{
"input": "5",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "3",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "1",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "10",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "53",
"output": "NO"
},
{
"input": "77",
"output": "NO"
},
{
"input": "32",
"output": "YES"
},
{
"input": "44",
"output": "YES"
},
{
"input": "98",
"output": "YES"
},
{
"input": "99",
"output": "NO"
},
{
"input": "90",
"output": "YES"
},
{
"input": "67",
"output": "NO"
},
{
"input": "100",
"output": "YES"
},
{
"input": "88",
"output": "YES"
}
] | 1,689,807,504
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 20
| 124
| 0
|
W=int(input())
while not 1<=W<=100:
W=int(input())
if W%2==1 :
print("NO")
elif W==2 :
print("NO")
else :
print("YES")
|
Title: Watermelon
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
Input Specification:
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Output Specification:
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
Demo Input:
['8\n']
Demo Output:
['YES\n']
Note:
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
|
```python
W=int(input())
while not 1<=W<=100:
W=int(input())
if W%2==1 :
print("NO")
elif W==2 :
print("NO")
else :
print("YES")
```
| 3.938
|
749
|
A
|
Bachgold Problem
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"math",
"number theory"
] | null | null |
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*.
|
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000).
|
The first line of the output contains a single integer *k* — maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
|
[
"5\n",
"6\n"
] |
[
"2\n2 3\n",
"3\n2 2 2\n"
] |
none
| 500
|
[
{
"input": "5",
"output": "2\n2 3"
},
{
"input": "6",
"output": "3\n2 2 2"
},
{
"input": "2",
"output": "1\n2"
},
{
"input": "3",
"output": "1\n3"
},
{
"input": "99999",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "100000",
"output": "50000\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7",
"output": "3\n2 2 3"
},
{
"input": "4",
"output": "2\n2 2"
},
{
"input": "8",
"output": "4\n2 2 2 2"
},
{
"input": "9",
"output": "4\n2 2 2 3"
},
{
"input": "99995",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99996",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "10",
"output": "5\n2 2 2 2 2"
},
{
"input": "11",
"output": "5\n2 2 2 2 3"
},
{
"input": "99997",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99998",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "12",
"output": "6\n2 2 2 2 2 2"
},
{
"input": "13",
"output": "6\n2 2 2 2 2 3"
},
{
"input": "99993",
"output": "49996\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99994",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "14",
"output": "7\n2 2 2 2 2 2 2"
},
{
"input": "15",
"output": "7\n2 2 2 2 2 2 3"
},
{
"input": "53",
"output": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "57",
"output": "28\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "61",
"output": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "774",
"output": "387\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "202",
"output": "101\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2"
},
{
"input": "530",
"output": "265\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7166",
"output": "3583\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "9294",
"output": "4647\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "2422",
"output": "1211\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "15326",
"output": "7663\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "11454",
"output": "5727\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "14878",
"output": "7439\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "90672",
"output": "45336\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99544",
"output": "49772\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "90472",
"output": "45236\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "23",
"output": "11\n2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "93",
"output": "46\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "19",
"output": "9\n2 2 2 2 2 2 2 2 3"
},
{
"input": "11110",
"output": "5555\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
}
] | 1,680,896,415
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 41
| 93
| 716,800
|
import sys
import math
import bisect
import heapq
import itertools
from sys import stdin,stdout
from math import gcd,floor,sqrt,log
from collections import defaultdict, Counter, deque
from bisect import bisect_left,bisect_right, insort_left, insort_right
mod=1000000007
def get_ints(): return map(int, sys.stdin.readline().strip().split())
def get_list(): return list(map(int, sys.stdin.readline().strip().split()))
def get_string(): return sys.stdin.readline().strip()
def get_int(): return int(sys.stdin.readline().strip())
def get_list_strings(): return list(map(str, sys.stdin.readline().strip().split()))
def solve():
n = get_int()
if n < 4:
print(1)
print(n)
else:
primes = [2]*(n//2)
primes[-1] += (n&1)
print(len(primes))
print(*primes)
if __name__ == "__main__":
solve()
|
Title: Bachgold Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*.
Input Specification:
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000).
Output Specification:
The first line of the output contains a single integer *k* — maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
Demo Input:
['5\n', '6\n']
Demo Output:
['2\n2 3\n', '3\n2 2 2\n']
Note:
none
|
```python
import sys
import math
import bisect
import heapq
import itertools
from sys import stdin,stdout
from math import gcd,floor,sqrt,log
from collections import defaultdict, Counter, deque
from bisect import bisect_left,bisect_right, insort_left, insort_right
mod=1000000007
def get_ints(): return map(int, sys.stdin.readline().strip().split())
def get_list(): return list(map(int, sys.stdin.readline().strip().split()))
def get_string(): return sys.stdin.readline().strip()
def get_int(): return int(sys.stdin.readline().strip())
def get_list_strings(): return list(map(str, sys.stdin.readline().strip().split()))
def solve():
n = get_int()
if n < 4:
print(1)
print(n)
else:
primes = [2]*(n//2)
primes[-1] += (n&1)
print(len(primes))
print(*primes)
if __name__ == "__main__":
solve()
```
| 3
|
|
427
|
A
|
Police Recruits
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups.
Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime.
If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated.
Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated.
|
The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers.
If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time.
|
Print a single integer, the number of crimes which will go untreated.
|
[
"3\n-1 -1 1\n",
"8\n1 -1 1 -1 -1 1 1 1\n",
"11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n"
] |
[
"2\n",
"1\n",
"8\n"
] |
Lets consider the second example:
1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired.
The answer is one, as one crime (on step 5) will go untreated.
| 500
|
[
{
"input": "3\n-1 -1 1",
"output": "2"
},
{
"input": "8\n1 -1 1 -1 -1 1 1 1",
"output": "1"
},
{
"input": "11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1",
"output": "8"
},
{
"input": "7\n-1 -1 1 1 -1 -1 1",
"output": "2"
},
{
"input": "21\n-1 -1 -1 -1 -1 3 2 -1 6 -1 -1 2 1 -1 2 2 1 6 5 -1 5",
"output": "5"
},
{
"input": "98\n-1 -1 1 -1 -1 -1 -1 1 -1 -1 1 -1 -1 1 -1 1 1 1 -1 1 1 1 1 1 -1 1 -1 -1 -1 -1 1 -1 -1 1 1 -1 1 1 1 -1 -1 -1 -1 -1 -1 1 -1 -1 -1 1 -1 1 -1 1 -1 1 1 1 1 1 1 1 -1 -1 1 1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 1 -1 1 1 1 -1 1 1 -1 -1 -1 1 1 1 -1 -1 -1 1 -1 1 1",
"output": "13"
},
{
"input": "3\n-1 5 4",
"output": "1"
},
{
"input": "146\n4 -1 -1 -1 -1 -1 -1 -1 -1 -1 4 -1 3 -1 3 -1 -1 1 4 -1 2 -1 -1 3 -1 -1 -1 4 1 -1 -1 -1 4 -1 -1 -1 -1 -1 -1 3 2 -1 3 2 4 5 2 4 1 5 -1 -1 2 -1 -1 1 -1 5 3 -1 1 2 2 3 5 3 -1 -1 3 -1 -1 3 5 5 -1 -1 5 -1 4 4 1 -1 -1 -1 2 1 -1 -1 -1 2 5 3 -1 -1 -1 3 -1 5 4 -1 1 -1 -1 3 -1 -1 3 1 1 2 -1 -1 -1 1 3 1 -1 2 -1 -1 5 5 -1 -1 3 4 5 1 -1 2 -1 -1 -1 3 -1 5 3 2 -1 2 -1 -1 5 -1 3 -1",
"output": "5"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n-1",
"output": "1"
},
{
"input": "2\n1 -1",
"output": "0"
},
{
"input": "2\n-1 1",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n-1 -1",
"output": "2"
},
{
"input": "4\n10 -1 -1 -1",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "4\n-1 -1 1 1",
"output": "2"
}
] | 1,698,211,618
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 63
| 93
| 8,704,000
|
def solve(x):
recruit = 0
untreated = 0
for i in range(len(x)):
if (int(x[i]) == -1) and recruit <=0:
untreated +=1
if(int(x[i]) == -1) and recruit>0:
recruit-=1
if (int(x[i])>0 and int(x[i])<=10):
recruit +=int(x[i])
# print("untreated:",untreated)
# print("Recruit:",recruit)
return untreated
if __name__ == '__main__':
# test = [1,-1,1,-1,-1,1,1,1]
# test = [-1,-1,1]
# test = [-1,-1,2,-1,-1,-1,-1,-1,-1,-1,-1]
n = int(input())
test = input().split()
# print(test)
# test=int(input().split(" "))
# test = []
# for i in range(n):
# test.append(input())
# print(test)
ans = solve(test)
print(ans)
# test()
# for i in range
|
Title: Police Recruits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups.
Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime.
If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated.
Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated.
Input Specification:
The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers.
If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time.
Output Specification:
Print a single integer, the number of crimes which will go untreated.
Demo Input:
['3\n-1 -1 1\n', '8\n1 -1 1 -1 -1 1 1 1\n', '11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n']
Demo Output:
['2\n', '1\n', '8\n']
Note:
Lets consider the second example:
1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired.
The answer is one, as one crime (on step 5) will go untreated.
|
```python
def solve(x):
recruit = 0
untreated = 0
for i in range(len(x)):
if (int(x[i]) == -1) and recruit <=0:
untreated +=1
if(int(x[i]) == -1) and recruit>0:
recruit-=1
if (int(x[i])>0 and int(x[i])<=10):
recruit +=int(x[i])
# print("untreated:",untreated)
# print("Recruit:",recruit)
return untreated
if __name__ == '__main__':
# test = [1,-1,1,-1,-1,1,1,1]
# test = [-1,-1,1]
# test = [-1,-1,2,-1,-1,-1,-1,-1,-1,-1,-1]
n = int(input())
test = input().split()
# print(test)
# test=int(input().split(" "))
# test = []
# for i in range(n):
# test.append(input())
# print(test)
ans = solve(test)
print(ans)
# test()
# for i in range
```
| 3
|
|
977
|
A
|
Wrong Subtraction
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Little girl Tanya is learning how to decrease a number by one, but she does it wrong with a number consisting of two or more digits. Tanya subtracts one from a number by the following algorithm:
- if the last digit of the number is non-zero, she decreases the number by one; - if the last digit of the number is zero, she divides the number by 10 (i.e. removes the last digit).
You are given an integer number $n$. Tanya will subtract one from it $k$ times. Your task is to print the result after all $k$ subtractions.
It is guaranteed that the result will be positive integer number.
|
The first line of the input contains two integer numbers $n$ and $k$ ($2 \le n \le 10^9$, $1 \le k \le 50$) — the number from which Tanya will subtract and the number of subtractions correspondingly.
|
Print one integer number — the result of the decreasing $n$ by one $k$ times.
It is guaranteed that the result will be positive integer number.
|
[
"512 4\n",
"1000000000 9\n"
] |
[
"50\n",
"1\n"
] |
The first example corresponds to the following sequence: $512 \rightarrow 511 \rightarrow 510 \rightarrow 51 \rightarrow 50$.
| 0
|
[
{
"input": "512 4",
"output": "50"
},
{
"input": "1000000000 9",
"output": "1"
},
{
"input": "131203 11",
"output": "12"
},
{
"input": "999999999 50",
"output": "9999"
},
{
"input": "999999999 49",
"output": "99990"
},
{
"input": "131203 9",
"output": "130"
},
{
"input": "900000000 16",
"output": "1"
},
{
"input": "909090909 50",
"output": "3"
},
{
"input": "1001 2",
"output": "100"
},
{
"input": "5 2",
"output": "3"
},
{
"input": "2 1",
"output": "1"
}
] | 1,700,333,797
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 11
| 62
| 0
|
x, y = map(int, input().split(" "))
for i in range(y):
if x % 10 != 0:
x = x - 1
elif x % 10 == 0:
x = x / 10
print(int(x))
|
Title: Wrong Subtraction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little girl Tanya is learning how to decrease a number by one, but she does it wrong with a number consisting of two or more digits. Tanya subtracts one from a number by the following algorithm:
- if the last digit of the number is non-zero, she decreases the number by one; - if the last digit of the number is zero, she divides the number by 10 (i.e. removes the last digit).
You are given an integer number $n$. Tanya will subtract one from it $k$ times. Your task is to print the result after all $k$ subtractions.
It is guaranteed that the result will be positive integer number.
Input Specification:
The first line of the input contains two integer numbers $n$ and $k$ ($2 \le n \le 10^9$, $1 \le k \le 50$) — the number from which Tanya will subtract and the number of subtractions correspondingly.
Output Specification:
Print one integer number — the result of the decreasing $n$ by one $k$ times.
It is guaranteed that the result will be positive integer number.
Demo Input:
['512 4\n', '1000000000 9\n']
Demo Output:
['50\n', '1\n']
Note:
The first example corresponds to the following sequence: $512 \rightarrow 511 \rightarrow 510 \rightarrow 51 \rightarrow 50$.
|
```python
x, y = map(int, input().split(" "))
for i in range(y):
if x % 10 != 0:
x = x - 1
elif x % 10 == 0:
x = x / 10
print(int(x))
```
| 3
|
|
175
|
A
|
Robot Bicorn Attack
|
PROGRAMMING
| 1,400
|
[
"brute force",
"implementation"
] | null | null |
Vasya plays Robot Bicorn Attack.
The game consists of three rounds. For each one a non-negative integer amount of points is given. The result of the game is the sum of obtained points. Vasya has already played three rounds and wrote obtained points one by one (without leading zeros) into the string *s*. Vasya decided to brag about his achievement to the friends. However, he has forgotten how many points he got for each round. The only thing he remembers is the string *s*.
Help Vasya to find out what is the maximum amount of points he could get. Take into account that Vasya played Robot Bicorn Attack for the first time, so he could not get more than 1000000 (106) points for one round.
|
The only line of input contains non-empty string *s* obtained by Vasya. The string consists of digits only. The string length does not exceed 30 characters.
|
Print the only number — the maximum amount of points Vasya could get. If Vasya is wrong and the string could not be obtained according to the rules then output number -1.
|
[
"1234\n",
"9000\n",
"0009\n"
] |
[
"37\n",
"90\n",
"-1\n"
] |
In the first example the string must be split into numbers 1, 2 and 34.
In the second example the string must be split into numbers 90, 0 and 0.
In the third example the string is incorrect, because after splitting the string into 3 numbers number 00 or 09 will be obtained, but numbers cannot have leading zeroes.
| 500
|
[
{
"input": "1234",
"output": "37"
},
{
"input": "9000",
"output": "90"
},
{
"input": "0009",
"output": "-1"
},
{
"input": "100000010000001000000",
"output": "3000000"
},
{
"input": "1000000011",
"output": "1000011"
},
{
"input": "9991",
"output": "109"
},
{
"input": "1000001999",
"output": "101000"
},
{
"input": "100000010000011000000",
"output": "-1"
},
{
"input": "100000010000001000001",
"output": "-1"
},
{
"input": "102",
"output": "3"
},
{
"input": "100",
"output": "1"
},
{
"input": "000",
"output": "0"
},
{
"input": "001",
"output": "1"
},
{
"input": "090",
"output": "9"
},
{
"input": "999999999999999999999999999999",
"output": "-1"
},
{
"input": "12345678901234567",
"output": "947035"
},
{
"input": "12635000000127683",
"output": "-1"
},
{
"input": "428595000000042345353",
"output": "-1"
},
{
"input": "48726340000000",
"output": "-1"
},
{
"input": "93246310000000",
"output": "1932463"
},
{
"input": "00123456",
"output": "123456"
},
{
"input": "001234567",
"output": "-1"
},
{
"input": "0891249843934",
"output": "1735183"
},
{
"input": "04234581000000",
"output": "1423458"
},
{
"input": "10000000999999",
"output": "1999999"
},
{
"input": "69284626624",
"output": "935092"
},
{
"input": "6061357",
"output": "61363"
},
{
"input": "1215",
"output": "27"
},
{
"input": "5305167573651040691",
"output": "-1"
},
{
"input": "948245431759126577",
"output": "1506581"
},
{
"input": "3699951264723380749",
"output": "-1"
},
{
"input": "97862382",
"output": "978633"
},
{
"input": "4073734152",
"output": "737433"
},
{
"input": "9123396793",
"output": "913138"
},
{
"input": "52027725398636318",
"output": "1413743"
},
{
"input": "03990796938958",
"output": "-1"
},
{
"input": "460657644093588",
"output": "1105338"
},
{
"input": "8793853284967905230",
"output": "-1"
},
{
"input": "298036933890712",
"output": "1232638"
},
{
"input": "80796461750373352",
"output": "1498819"
},
{
"input": "2376843019069559343",
"output": "-1"
},
{
"input": "7464340065209674219",
"output": "-1"
},
{
"input": "1551627800131899383",
"output": "-1"
},
{
"input": "20973541540356666047",
"output": "-1"
},
{
"input": "31587335978612",
"output": "1565978"
},
{
"input": "744503034",
"output": "744537"
},
{
"input": "15533274860535679",
"output": "939616"
},
{
"input": "58308242321837",
"output": "1006337"
},
{
"input": "9929120076123816",
"output": "323868"
},
{
"input": "623650711335",
"output": "773700"
},
{
"input": "1066168753173",
"output": "981936"
},
{
"input": "5353645507305053",
"output": "1091147"
},
{
"input": "111111111111111111111111111111",
"output": "-1"
},
{
"input": "1000000999888777666",
"output": "2777554"
},
{
"input": "1000001999888777666",
"output": "-1"
},
{
"input": "9998881000001777666",
"output": "-1"
},
{
"input": "9999991000000999999",
"output": "2999998"
},
{
"input": "9999999999991000000",
"output": "2999998"
},
{
"input": "1000000999999999999",
"output": "2999998"
},
{
"input": "123",
"output": "6"
},
{
"input": "132",
"output": "6"
},
{
"input": "213",
"output": "6"
},
{
"input": "231",
"output": "6"
},
{
"input": "312",
"output": "6"
},
{
"input": "321",
"output": "6"
},
{
"input": "666",
"output": "18"
},
{
"input": "012894600",
"output": "894612"
},
{
"input": "01289400",
"output": "289401"
},
{
"input": "429496729742949672974294967297",
"output": "-1"
},
{
"input": "429496729700",
"output": "959414"
},
{
"input": "429496729701",
"output": "959415"
},
{
"input": "1",
"output": "-1"
},
{
"input": "55",
"output": "-1"
},
{
"input": "99",
"output": "-1"
},
{
"input": "9991999999999999",
"output": "2009989"
},
{
"input": "999199999999099",
"output": "1999297"
},
{
"input": "9991990199999999",
"output": "2000189"
},
{
"input": "99999900999999",
"output": "1999998"
},
{
"input": "4444440044444",
"output": "488888"
},
{
"input": "0089",
"output": "89"
},
{
"input": "00243",
"output": "243"
},
{
"input": "008743",
"output": "8743"
},
{
"input": "0042764",
"output": "42764"
},
{
"input": "00912838",
"output": "912838"
},
{
"input": "001000000",
"output": "1000000"
},
{
"input": "001000001",
"output": "-1"
},
{
"input": "12435900",
"output": "435903"
},
{
"input": "28492300",
"output": "849232"
},
{
"input": "99999900",
"output": "999999"
},
{
"input": "931863000",
"output": "863094"
},
{
"input": "23566000",
"output": "566005"
},
{
"input": "100000000",
"output": "1000000"
},
{
"input": "100000100",
"output": "100010"
},
{
"input": "3246870032",
"output": "870362"
},
{
"input": "04354640947",
"output": "645301"
},
{
"input": "0734620342343",
"output": "1076963"
},
{
"input": "09999990",
"output": "999999"
},
{
"input": "010000000",
"output": "1000000"
},
{
"input": "010000001",
"output": "1000001"
},
{
"input": "01000001000000",
"output": "1100000"
},
{
"input": "1844674407370955161600",
"output": "-1"
},
{
"input": "184467440737105516141111",
"output": "-1"
},
{
"input": "1844674407371055161600",
"output": "-1"
},
{
"input": "1111111111111111111111111",
"output": "-1"
},
{
"input": "999999999999999999999",
"output": "-1"
},
{
"input": "100000110000011000001",
"output": "-1"
},
{
"input": "0018446744073709551616",
"output": "-1"
},
{
"input": "429596729610000001000",
"output": "-1"
},
{
"input": "123456789123456789123456789123",
"output": "-1"
},
{
"input": "011",
"output": "2"
},
{
"input": "10000100001000",
"output": "21000"
},
{
"input": "091",
"output": "10"
},
{
"input": "1234567891012131416123222443",
"output": "-1"
},
{
"input": "429496729642949672964294967296",
"output": "-1"
},
{
"input": "214748364821474836482147483648",
"output": "-1"
},
{
"input": "10000001073741824001000000",
"output": "-1"
},
{
"input": "5000000000",
"output": "-1"
},
{
"input": "999955555555555555555555",
"output": "-1"
},
{
"input": "1844674407371055161699",
"output": "-1"
},
{
"input": "99999999999999999999999999999",
"output": "-1"
},
{
"input": "009",
"output": "9"
},
{
"input": "1844674407370955161611",
"output": "-1"
},
{
"input": "000000999",
"output": "-1"
},
{
"input": "003",
"output": "3"
},
{
"input": "0000000009000000000",
"output": "-1"
},
{
"input": "010",
"output": "1"
},
{
"input": "0",
"output": "-1"
},
{
"input": "000009000000",
"output": "-1"
},
{
"input": "21371283283242384239423423123",
"output": "-1"
},
{
"input": "100000010004294967300",
"output": "-1"
},
{
"input": "429596729600",
"output": "969314"
},
{
"input": "429496729510000001000000",
"output": "-1"
},
{
"input": "2147483648010000010000",
"output": "-1"
},
{
"input": "349967407479541078587181768161",
"output": "-1"
}
] | 1,449,601,132
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 15
| 77
| 0
|
s = input().strip()
n = len(s)
big = 10 ** 6
result = -1
for i in range(1, n):
if s[0] == '0' and i > 1:
break
a = int(s[:i])
if a > big:
break
for j in range(i + 1, n):
if s[i] == '0' and j - i > 1:
break
b = int(s[i:j])
if b > big:
break
if s[j] == '0' and n - j > 1:
continue
c = int(s[j:])
if c > big:
break
result = max(result, a + b + c)
print(result)
|
Title: Robot Bicorn Attack
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya plays Robot Bicorn Attack.
The game consists of three rounds. For each one a non-negative integer amount of points is given. The result of the game is the sum of obtained points. Vasya has already played three rounds and wrote obtained points one by one (without leading zeros) into the string *s*. Vasya decided to brag about his achievement to the friends. However, he has forgotten how many points he got for each round. The only thing he remembers is the string *s*.
Help Vasya to find out what is the maximum amount of points he could get. Take into account that Vasya played Robot Bicorn Attack for the first time, so he could not get more than 1000000 (106) points for one round.
Input Specification:
The only line of input contains non-empty string *s* obtained by Vasya. The string consists of digits only. The string length does not exceed 30 characters.
Output Specification:
Print the only number — the maximum amount of points Vasya could get. If Vasya is wrong and the string could not be obtained according to the rules then output number -1.
Demo Input:
['1234\n', '9000\n', '0009\n']
Demo Output:
['37\n', '90\n', '-1\n']
Note:
In the first example the string must be split into numbers 1, 2 and 34.
In the second example the string must be split into numbers 90, 0 and 0.
In the third example the string is incorrect, because after splitting the string into 3 numbers number 00 or 09 will be obtained, but numbers cannot have leading zeroes.
|
```python
s = input().strip()
n = len(s)
big = 10 ** 6
result = -1
for i in range(1, n):
if s[0] == '0' and i > 1:
break
a = int(s[:i])
if a > big:
break
for j in range(i + 1, n):
if s[i] == '0' and j - i > 1:
break
b = int(s[i:j])
if b > big:
break
if s[j] == '0' and n - j > 1:
continue
c = int(s[j:])
if c > big:
break
result = max(result, a + b + c)
print(result)
```
| 0
|
|
208
|
A
|
Dubstep
|
PROGRAMMING
| 900
|
[
"strings"
] | null | null |
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
|
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
|
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
|
[
"WUBWUBABCWUB\n",
"WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n"
] |
[
"ABC ",
"WE ARE THE CHAMPIONS MY FRIEND "
] |
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
| 500
|
[
{
"input": "WUBWUBABCWUB",
"output": "ABC "
},
{
"input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB",
"output": "WE ARE THE CHAMPIONS MY FRIEND "
},
{
"input": "WUBWUBWUBSR",
"output": "SR "
},
{
"input": "RWUBWUBWUBLWUB",
"output": "R L "
},
{
"input": "ZJWUBWUBWUBJWUBWUBWUBL",
"output": "ZJ J L "
},
{
"input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB",
"output": "C B E Q "
},
{
"input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB",
"output": "JKD WBIRAQKF YE WV "
},
{
"input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB",
"output": "KSDHEMIXUJ R S H "
},
{
"input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB",
"output": "OG X I KO "
},
{
"input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH",
"output": "Q QQ I WW JOPJPBRH "
},
{
"input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB",
"output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C "
},
{
"input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV",
"output": "E IQMJNIQ GZZBQZAUHYP PMR DCV "
},
{
"input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB",
"output": "FV BPS RXNETCJ JDMBH B V B "
},
{
"input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL",
"output": "FBQ IDFSY CTWDM SXO QI L "
},
{
"input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL",
"output": "I QLHD YIIKZDFQ CX U K NL "
},
{
"input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE",
"output": "K UPDYXGOKU AGOAH IZD IY V P E "
},
{
"input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB",
"output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ "
},
{
"input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB",
"output": "PAMJGY XGPQM TKGSXUY E N H E "
},
{
"input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB",
"output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB "
},
{
"input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM",
"output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M "
},
{
"input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW",
"output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W "
},
{
"input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG",
"output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G "
},
{
"input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN",
"output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N "
},
{
"input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG",
"output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG "
},
{
"input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB",
"output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L "
},
{
"input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB",
"output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U "
},
{
"input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB",
"output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ "
},
{
"input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB",
"output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J "
},
{
"input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO",
"output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O "
},
{
"input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR",
"output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R "
},
{
"input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB",
"output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM "
},
{
"input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB",
"output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H "
},
{
"input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB",
"output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S "
},
{
"input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB",
"output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J "
},
{
"input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF",
"output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F "
},
{
"input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY",
"output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y "
},
{
"input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB",
"output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO "
},
{
"input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW",
"output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W "
},
{
"input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD",
"output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D "
},
{
"input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB",
"output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A "
},
{
"input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB",
"output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y "
},
{
"input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB",
"output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R "
},
{
"input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY",
"output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y "
},
{
"input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE",
"output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E "
},
{
"input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS",
"output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S "
},
{
"input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP",
"output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP "
},
{
"input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB",
"output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y "
},
{
"input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL",
"output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL "
},
{
"input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO",
"output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O "
},
{
"input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU",
"output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU "
},
{
"input": "A",
"output": "A "
},
{
"input": "WUBA",
"output": "A "
},
{
"input": "WUBWUBA",
"output": "A "
},
{
"input": "AWUBWUBWUB",
"output": "A "
},
{
"input": "AWUBBWUBCWUBD",
"output": "A B C D "
},
{
"input": "WUBWWUBWUBWUBUWUBWUBBWUB",
"output": "W U B "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "WUWUBBWWUBUB",
"output": "WU BW UB "
},
{
"input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB",
"output": "WUAB "
},
{
"input": "ZWUB",
"output": "Z "
},
{
"input": "WU",
"output": "WU "
},
{
"input": "UB",
"output": "UB "
},
{
"input": "U",
"output": "U "
},
{
"input": "WUBW",
"output": "W "
},
{
"input": "WUBWU",
"output": "WU "
},
{
"input": "WUWUB",
"output": "WU "
},
{
"input": "UBWUB",
"output": "UB "
},
{
"input": "WUWUBUBWUBUWUB",
"output": "WU UB U "
},
{
"input": "WUBWWUBAWUB",
"output": "W A "
},
{
"input": "WUUUUU",
"output": "WUUUUU "
}
] | 1,689,091,662
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 71
| 92
| 0
|
s=input()
m=s.replace("WUB"," ")
print(m)
|
Title: Dubstep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
Input Specification:
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
Output Specification:
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
Demo Input:
['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n']
Demo Output:
['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND ']
Note:
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
|
```python
s=input()
m=s.replace("WUB"," ")
print(m)
```
| 3
|
|
200
|
B
|
Drinks
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
|
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
|
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
|
[
"3\n50 50 100\n",
"4\n0 25 50 75\n"
] |
[
"66.666666666667\n",
"37.500000000000\n"
] |
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
| 500
|
[
{
"input": "3\n50 50 100",
"output": "66.666666666667"
},
{
"input": "4\n0 25 50 75",
"output": "37.500000000000"
},
{
"input": "3\n0 1 8",
"output": "3.000000000000"
},
{
"input": "5\n96 89 93 95 70",
"output": "88.600000000000"
},
{
"input": "7\n62 41 78 4 38 39 75",
"output": "48.142857142857"
},
{
"input": "13\n2 22 7 0 1 17 3 17 11 2 21 26 22",
"output": "11.615384615385"
},
{
"input": "21\n5 4 11 7 0 5 45 21 0 14 51 6 0 16 10 19 8 9 7 12 18",
"output": "12.761904761905"
},
{
"input": "26\n95 70 93 74 94 70 91 70 39 79 80 57 87 75 37 93 48 67 51 90 85 26 23 64 66 84",
"output": "69.538461538462"
},
{
"input": "29\n84 99 72 96 83 92 95 98 97 93 76 84 99 93 81 76 93 99 99 100 95 100 96 95 97 100 71 98 94",
"output": "91.551724137931"
},
{
"input": "33\n100 99 100 100 99 99 99 100 100 100 99 99 99 100 100 100 100 99 100 99 100 100 97 100 100 100 100 100 100 100 98 98 100",
"output": "99.515151515152"
},
{
"input": "34\n14 9 10 5 4 26 18 23 0 1 0 20 18 15 2 2 3 5 14 1 9 4 2 15 7 1 7 19 10 0 0 11 0 2",
"output": "8.147058823529"
},
{
"input": "38\n99 98 100 100 99 92 99 99 98 84 88 94 86 99 93 100 98 99 65 98 85 84 64 97 96 89 79 96 91 84 99 93 72 96 94 97 96 93",
"output": "91.921052631579"
},
{
"input": "52\n100 94 99 98 99 99 99 95 97 97 98 100 100 98 97 100 98 90 100 99 97 94 90 98 100 100 90 99 100 95 98 95 94 85 97 94 96 94 99 99 99 98 100 100 94 99 99 100 98 87 100 100",
"output": "97.019230769231"
},
{
"input": "58\n10 70 12 89 1 82 100 53 40 100 21 69 92 91 67 66 99 77 25 48 8 63 93 39 46 79 82 14 44 42 1 79 0 69 56 73 67 17 59 4 65 80 20 60 77 52 3 61 16 76 33 18 46 100 28 59 9 6",
"output": "50.965517241379"
},
{
"input": "85\n7 8 1 16 0 15 1 7 0 11 15 6 2 12 2 8 9 8 2 0 3 7 15 7 1 8 5 7 2 26 0 3 11 1 8 10 31 0 7 6 1 8 1 0 9 14 4 8 7 16 9 1 0 16 10 9 6 1 1 4 2 7 4 5 4 1 20 6 16 16 1 1 10 17 8 12 14 19 3 8 1 7 10 23 10",
"output": "7.505882352941"
},
{
"input": "74\n5 3 0 7 13 10 12 10 18 5 0 18 2 13 7 17 2 7 5 2 40 19 0 2 2 3 0 45 4 20 0 4 2 8 1 19 3 9 17 1 15 0 16 1 9 4 0 9 32 2 6 18 11 18 1 15 16 12 7 19 5 3 9 28 26 8 3 10 33 29 4 13 28 6",
"output": "10.418918918919"
},
{
"input": "98\n42 9 21 11 9 11 22 12 52 20 10 6 56 9 26 27 1 29 29 14 38 17 41 21 7 45 15 5 29 4 51 20 6 8 34 17 13 53 30 45 0 10 16 41 4 5 6 4 14 2 31 6 0 11 13 3 3 43 13 36 51 0 7 16 28 23 8 36 30 22 8 54 21 45 39 4 50 15 1 30 17 8 18 10 2 20 16 50 6 68 15 6 38 7 28 8 29 41",
"output": "20.928571428571"
},
{
"input": "99\n60 65 40 63 57 44 30 84 3 10 39 53 40 45 72 20 76 11 61 32 4 26 97 55 14 57 86 96 34 69 52 22 26 79 31 4 21 35 82 47 81 28 72 70 93 84 40 4 69 39 83 58 30 7 32 73 74 12 92 23 61 88 9 58 70 32 75 40 63 71 46 55 39 36 14 97 32 16 95 41 28 20 85 40 5 50 50 50 75 6 10 64 38 19 77 91 50 72 96",
"output": "49.191919191919"
},
{
"input": "99\n100 88 40 30 81 80 91 98 69 73 88 96 79 58 14 100 87 84 52 91 83 88 72 83 99 35 54 80 46 79 52 72 85 32 99 39 79 79 45 83 88 50 75 75 50 59 65 75 97 63 92 58 89 46 93 80 89 33 69 86 99 99 66 85 72 74 79 98 85 95 46 63 77 97 49 81 89 39 70 76 68 91 90 56 31 93 51 87 73 95 74 69 87 95 57 68 49 95 92",
"output": "73.484848484848"
},
{
"input": "100\n18 15 17 0 3 3 0 4 1 8 2 22 7 21 5 0 0 8 3 16 1 0 2 9 9 3 10 8 17 20 5 4 8 12 2 3 1 1 3 2 23 0 1 0 5 7 4 0 1 3 3 4 25 2 2 14 8 4 9 3 0 11 0 3 12 3 14 16 7 7 14 1 17 9 0 35 42 12 3 1 25 9 3 8 5 3 2 8 22 14 11 6 3 9 6 8 7 7 4 6",
"output": "7.640000000000"
},
{
"input": "100\n88 77 65 87 100 63 91 96 92 89 77 95 76 80 84 83 100 71 85 98 26 54 74 78 69 59 96 86 88 91 95 26 52 88 64 70 84 81 76 84 94 82 100 66 97 98 43 94 59 94 100 80 98 73 69 83 94 70 74 79 91 31 62 88 69 55 62 97 40 64 62 83 87 85 50 90 69 72 67 49 100 51 69 96 81 90 83 91 86 34 79 69 100 66 97 98 47 97 74 100",
"output": "77.660000000000"
},
{
"input": "100\n91 92 90 91 98 84 85 96 83 98 99 87 94 70 87 75 86 90 89 88 82 83 91 94 88 86 90 99 100 98 97 75 95 99 95 100 91 92 76 93 95 97 88 93 95 81 96 89 88 100 98 87 90 96 100 99 58 90 96 77 92 82 100 100 93 93 98 99 79 88 97 95 98 66 96 83 96 100 99 92 98 98 92 93 100 97 98 100 98 97 100 100 94 90 99 100 98 79 80 81",
"output": "91.480000000000"
},
{
"input": "1\n0",
"output": "0.000000000000"
},
{
"input": "1\n100",
"output": "100.000000000000"
},
{
"input": "1\n78",
"output": "78.000000000000"
},
{
"input": "2\n0 100",
"output": "50.000000000000"
},
{
"input": "2\n100 100",
"output": "100.000000000000"
},
{
"input": "5\n0 0 0 0 1",
"output": "0.200000000000"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99",
"output": "99.990000000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "0.010000000000"
},
{
"input": "5\n100 100 100 100 100",
"output": "100.000000000000"
}
] | 1,692,978,776
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 62
| 0
|
x = int(input())
total = 0
for i in range(x):
j = int(input())
total += j
print(total/x)
|
Title: Drinks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
Output Specification:
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
Demo Input:
['3\n50 50 100\n', '4\n0 25 50 75\n']
Demo Output:
['66.666666666667\n', '37.500000000000\n']
Note:
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
|
```python
x = int(input())
total = 0
for i in range(x):
j = int(input())
total += j
print(total/x)
```
| -1
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Emuskald considers himself a master of flow algorithms. Now he has completed his most ingenious program yet — it calculates the maximum flow in an undirected graph. The graph consists of *n* vertices and *m* edges. Vertices are numbered from 1 to *n*. Vertices 1 and *n* being the source and the sink respectively.
However, his max-flow algorithm seems to have a little flaw — it only finds the flow volume for each edge, but not its direction. Help him find for each edge the direction of the flow through this edges. Note, that the resulting flow should be correct maximum flow.
More formally. You are given an undirected graph. For each it's undirected edge (*a**i*, *b**i*) you are given the flow volume *c**i*. You should direct all edges in such way that the following conditions hold:
1. for each vertex *v* (1<=<<=*v*<=<<=*n*), sum of *c**i* of incoming edges is equal to the sum of *c**i* of outcoming edges; 1. vertex with number 1 has no incoming edges; 1. the obtained directed graph does not have cycles.
|
The first line of input contains two space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=2·105, *n*<=-<=1<=≤<=*m*<=≤<=2·105), the number of vertices and edges in the graph. The following *m* lines contain three space-separated integers *a**i*, *b**i* and *c**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*, 1<=≤<=*c**i*<=≤<=104), which means that there is an undirected edge from *a**i* to *b**i* with flow volume *c**i*.
It is guaranteed that there are no two edges connecting the same vertices; the given graph is connected; a solution always exists.
|
Output *m* lines, each containing one integer *d**i*, which should be 0 if the direction of the *i*-th edge is *a**i*<=→<=*b**i* (the flow goes from vertex *a**i* to vertex *b**i*) and should be 1 otherwise. The edges are numbered from 1 to *m* in the order they are given in the input.
If there are several solutions you can print any of them.
|
[
"3 3\n3 2 10\n1 2 10\n3 1 5\n",
"4 5\n1 2 10\n1 3 10\n2 3 5\n4 2 15\n3 4 5\n"
] |
[
"1\n0\n1\n",
"0\n0\n1\n1\n0\n"
] |
In the first test case, 10 flow units pass through path <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/609340f155794c4e9eebcd9cdfa23c73cf982f28.png" style="max-width: 100.0%;max-height: 100.0%;"/>, and 5 flow units pass directly from source to sink: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/04481aced8a9d501ae5d785ab654c542ff5497a1.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
| 0
|
[
{
"input": "3 3\n3 2 10\n1 2 10\n3 1 5",
"output": "1\n0\n1"
},
{
"input": "4 5\n1 2 10\n1 3 10\n2 3 5\n4 2 15\n3 4 5",
"output": "0\n0\n1\n1\n0"
},
{
"input": "10 17\n8 1 1\n4 8 2\n7 10 8\n1 4 1\n5 4 3\n6 9 6\n3 5 4\n1 9 1\n3 9 5\n7 1 1\n1 2 1\n1 3 1\n6 7 7\n8 2 1\n1 10 1\n1 5 1\n6 1 1",
"output": "1\n1\n0\n0\n1\n1\n1\n0\n0\n1\n0\n0\n0\n1\n0\n0\n1"
},
{
"input": "10 20\n3 8 41\n1 2 21\n9 1 31\n1 3 53\n5 9 67\n10 1 8\n6 1 16\n5 2 21\n1 7 50\n5 4 38\n6 4 16\n4 8 16\n5 10 93\n9 10 126\n8 9 16\n4 1 38\n5 7 50\n3 9 12\n1 5 10\n5 8 41",
"output": "0\n0\n1\n0\n0\n1\n1\n1\n0\n1\n0\n0\n0\n0\n0\n1\n1\n0\n0\n1"
},
{
"input": "2 1\n1 2 1",
"output": "0"
},
{
"input": "2 1\n2 1 1",
"output": "1"
},
{
"input": "3 2\n1 2 1\n2 3 1",
"output": "0\n0"
},
{
"input": "4 4\n4 3 5000\n1 2 10000\n3 1 5000\n4 2 10000",
"output": "1\n0\n1\n1"
},
{
"input": "3 3\n3 1 10000\n2 1 10000\n3 2 10000",
"output": "1\n1\n1"
},
{
"input": "3 3\n3 2 10000\n2 1 10000\n3 1 10000",
"output": "1\n1\n1"
},
{
"input": "10 17\n9 1 8\n7 10 1\n5 4 4\n1 10 1\n3 10 1\n10 5 1\n6 3 6\n10 4 1\n4 6 5\n7 5 3\n2 10 1\n9 3 7\n9 10 1\n8 10 1\n10 6 1\n2 7 2\n2 8 1",
"output": "1\n0\n1\n0\n0\n1\n1\n1\n1\n1\n0\n0\n0\n0\n1\n1\n0"
},
{
"input": "5 6\n1 3 10\n2 1 10\n3 5 10\n1 4 10\n2 5 10\n4 5 10",
"output": "0\n1\n0\n0\n0\n0"
},
{
"input": "5 6\n2 1 8\n5 2 8\n5 3 4\n4 1 9\n3 1 4\n5 4 9",
"output": "1\n1\n1\n1\n1\n1"
},
{
"input": "10 23\n10 5 94\n6 9 20\n10 2 79\n3 9 63\n1 6 80\n7 8 21\n3 5 6\n3 1 94\n2 5 21\n1 2 100\n1 7 79\n6 10 59\n8 1 60\n10 3 37\n9 1 37\n4 8 40\n7 10 100\n6 4 41\n5 1 79\n8 10 79\n9 10 80\n10 4 60\n4 1 59",
"output": "1\n1\n1\n0\n0\n1\n1\n1\n0\n0\n0\n0\n1\n1\n1\n0\n0\n0\n1\n0\n0\n1\n1"
},
{
"input": "9 9\n1 2 1\n2 3 1\n3 4 1\n4 5 1\n5 6 1\n6 7 1\n7 9 1\n8 9 1\n1 8 1",
"output": "0\n0\n0\n0\n0\n0\n0\n0\n0"
},
{
"input": "6 6\n1 2 1\n2 6 1\n1 3 1\n3 4 1\n4 5 1\n5 6 1",
"output": "0\n0\n0\n0\n0\n0"
}
] | 1,636,670,434
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 5
| 2,000
| 67,174,400
|
from collections import deque
class Node:
def __init__(self, val):
self.val = val
self.fout = 0
self.fin = 0
self.vis = False
# debugging only
def __repr__(self):
return f"node {self.val}:" + ("" if self.vis else " not") + " visited\n"
class Edge:
def __init__(self, to, direction, cost, index):
self.to = to
self.direction = direction
self.cost = cost
self.index = index
# debugging only
def __repr__(self):
return f"Edge to {self.to}, dir: {self.direction}, @ cost: {self.cost}\n"
###########################
def bfs():
global SRC, SINK, nodes, E
direction_taken = [0] * E
Q = deque()
Q.append(nodes[SRC])
while len(Q):
curr = Q.popleft()
curr.vis = True
for edge in edges[curr.val]:
w = nodes[edge.to]
if not w.vis:
w.fin += edge.cost
direction_taken[edge.index] = edge.direction
# by handshaking lemma, we have double counted fout
if edge.to != SINK and w.fin == (w.fout // 2):
Q.append(w)
for d in direction_taken:
print(d)
parse = lambda: map(int, input().split())
V, E = parse()
SRC = 1
SINK = V
nodes = []
edges = []
for i in range(V + 1):
edges.append([])
nodes.append(Node(i))
FORWARD = 0
BACKWARD = 1
for i in range(E):
u, v, c = parse()
edges[u].append(Edge(v, FORWARD, cost=c, index=i))
edges[v].append(Edge(u, BACKWARD, cost=c, index=i))
nodes[u].fout += c
nodes[v].fout += c
bfs()
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Emuskald considers himself a master of flow algorithms. Now he has completed his most ingenious program yet — it calculates the maximum flow in an undirected graph. The graph consists of *n* vertices and *m* edges. Vertices are numbered from 1 to *n*. Vertices 1 and *n* being the source and the sink respectively.
However, his max-flow algorithm seems to have a little flaw — it only finds the flow volume for each edge, but not its direction. Help him find for each edge the direction of the flow through this edges. Note, that the resulting flow should be correct maximum flow.
More formally. You are given an undirected graph. For each it's undirected edge (*a**i*, *b**i*) you are given the flow volume *c**i*. You should direct all edges in such way that the following conditions hold:
1. for each vertex *v* (1<=<<=*v*<=<<=*n*), sum of *c**i* of incoming edges is equal to the sum of *c**i* of outcoming edges; 1. vertex with number 1 has no incoming edges; 1. the obtained directed graph does not have cycles.
Input Specification:
The first line of input contains two space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=2·105, *n*<=-<=1<=≤<=*m*<=≤<=2·105), the number of vertices and edges in the graph. The following *m* lines contain three space-separated integers *a**i*, *b**i* and *c**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*, 1<=≤<=*c**i*<=≤<=104), which means that there is an undirected edge from *a**i* to *b**i* with flow volume *c**i*.
It is guaranteed that there are no two edges connecting the same vertices; the given graph is connected; a solution always exists.
Output Specification:
Output *m* lines, each containing one integer *d**i*, which should be 0 if the direction of the *i*-th edge is *a**i*<=→<=*b**i* (the flow goes from vertex *a**i* to vertex *b**i*) and should be 1 otherwise. The edges are numbered from 1 to *m* in the order they are given in the input.
If there are several solutions you can print any of them.
Demo Input:
['3 3\n3 2 10\n1 2 10\n3 1 5\n', '4 5\n1 2 10\n1 3 10\n2 3 5\n4 2 15\n3 4 5\n']
Demo Output:
['1\n0\n1\n', '0\n0\n1\n1\n0\n']
Note:
In the first test case, 10 flow units pass through path <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/609340f155794c4e9eebcd9cdfa23c73cf982f28.png" style="max-width: 100.0%;max-height: 100.0%;"/>, and 5 flow units pass directly from source to sink: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/04481aced8a9d501ae5d785ab654c542ff5497a1.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
|
```python
from collections import deque
class Node:
def __init__(self, val):
self.val = val
self.fout = 0
self.fin = 0
self.vis = False
# debugging only
def __repr__(self):
return f"node {self.val}:" + ("" if self.vis else " not") + " visited\n"
class Edge:
def __init__(self, to, direction, cost, index):
self.to = to
self.direction = direction
self.cost = cost
self.index = index
# debugging only
def __repr__(self):
return f"Edge to {self.to}, dir: {self.direction}, @ cost: {self.cost}\n"
###########################
def bfs():
global SRC, SINK, nodes, E
direction_taken = [0] * E
Q = deque()
Q.append(nodes[SRC])
while len(Q):
curr = Q.popleft()
curr.vis = True
for edge in edges[curr.val]:
w = nodes[edge.to]
if not w.vis:
w.fin += edge.cost
direction_taken[edge.index] = edge.direction
# by handshaking lemma, we have double counted fout
if edge.to != SINK and w.fin == (w.fout // 2):
Q.append(w)
for d in direction_taken:
print(d)
parse = lambda: map(int, input().split())
V, E = parse()
SRC = 1
SINK = V
nodes = []
edges = []
for i in range(V + 1):
edges.append([])
nodes.append(Node(i))
FORWARD = 0
BACKWARD = 1
for i in range(E):
u, v, c = parse()
edges[u].append(Edge(v, FORWARD, cost=c, index=i))
edges[v].append(Edge(u, BACKWARD, cost=c, index=i))
nodes[u].fout += c
nodes[v].fout += c
bfs()
```
| 0
|
|
612
|
B
|
HDD is Outdated Technology
|
PROGRAMMING
| 1,200
|
[
"implementation",
"math"
] | null | null |
HDD hard drives group data by sectors. All files are split to fragments and each of them are written in some sector of hard drive. Note the fragments can be written in sectors in arbitrary order.
One of the problems of HDD hard drives is the following: the magnetic head should move from one sector to another to read some file.
Find the time need to read file split to *n* fragments. The *i*-th sector contains the *f**i*-th fragment of the file (1<=≤<=*f**i*<=≤<=*n*). Note different sectors contains the different fragments. At the start the magnetic head is in the position that contains the first fragment. The file are reading in the following manner: at first the first fragment is read, then the magnetic head moves to the sector that contains the second fragment, then the second fragment is read and so on until the *n*-th fragment is read. The fragments are read in the order from the first to the *n*-th.
It takes |*a*<=-<=*b*| time units to move the magnetic head from the sector *a* to the sector *b*. Reading a fragment takes no time.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of fragments.
The second line contains *n* different integers *f**i* (1<=≤<=*f**i*<=≤<=*n*) — the number of the fragment written in the *i*-th sector.
|
Print the only integer — the number of time units needed to read the file.
|
[
"3\n3 1 2\n",
"5\n1 3 5 4 2\n"
] |
[
"3\n",
"10\n"
] |
In the second example the head moves in the following way:
- 1->2 means movement from the sector 1 to the sector 5, i.e. it takes 4 time units - 2->3 means movement from the sector 5 to the sector 2, i.e. it takes 3 time units - 3->4 means movement from the sector 2 to the sector 4, i.e. it takes 2 time units - 4->5 means movement from the sector 4 to the sector 3, i.e. it takes 1 time units
So the answer to the second example is 4 + 3 + 2 + 1 = 10.
| 0
|
[
{
"input": "3\n3 1 2",
"output": "3"
},
{
"input": "5\n1 3 5 4 2",
"output": "10"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "10\n8 2 10 3 4 6 1 7 9 5",
"output": "40"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "9"
},
{
"input": "10\n1 3 5 7 9 10 8 6 4 2",
"output": "45"
},
{
"input": "100\n11 9 35 34 51 74 16 67 26 21 14 80 84 79 7 61 28 3 53 43 42 5 56 36 69 30 22 88 1 27 65 91 46 31 59 50 17 96 25 18 64 55 78 2 63 24 95 48 93 13 38 76 89 94 15 90 45 81 52 87 83 73 44 49 23 82 85 75 86 33 47 19 58 97 37 20 40 10 92 4 6 68 77 54 71 12 62 60 100 39 41 99 72 29 57 8 70 32 66 98",
"output": "3580"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "99"
},
{
"input": "100\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 100 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2",
"output": "4950"
}
] | 1,585,312,147
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 17
| 1,000
| 10,547,200
|
n=int(input());a=list(map(int,input().split()));p=0
for i in range(n-1):p=p+abs(a.index(i+1)-a.index(i+2))
print(p)
|
Title: HDD is Outdated Technology
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
HDD hard drives group data by sectors. All files are split to fragments and each of them are written in some sector of hard drive. Note the fragments can be written in sectors in arbitrary order.
One of the problems of HDD hard drives is the following: the magnetic head should move from one sector to another to read some file.
Find the time need to read file split to *n* fragments. The *i*-th sector contains the *f**i*-th fragment of the file (1<=≤<=*f**i*<=≤<=*n*). Note different sectors contains the different fragments. At the start the magnetic head is in the position that contains the first fragment. The file are reading in the following manner: at first the first fragment is read, then the magnetic head moves to the sector that contains the second fragment, then the second fragment is read and so on until the *n*-th fragment is read. The fragments are read in the order from the first to the *n*-th.
It takes |*a*<=-<=*b*| time units to move the magnetic head from the sector *a* to the sector *b*. Reading a fragment takes no time.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of fragments.
The second line contains *n* different integers *f**i* (1<=≤<=*f**i*<=≤<=*n*) — the number of the fragment written in the *i*-th sector.
Output Specification:
Print the only integer — the number of time units needed to read the file.
Demo Input:
['3\n3 1 2\n', '5\n1 3 5 4 2\n']
Demo Output:
['3\n', '10\n']
Note:
In the second example the head moves in the following way:
- 1->2 means movement from the sector 1 to the sector 5, i.e. it takes 4 time units - 2->3 means movement from the sector 5 to the sector 2, i.e. it takes 3 time units - 3->4 means movement from the sector 2 to the sector 4, i.e. it takes 2 time units - 4->5 means movement from the sector 4 to the sector 3, i.e. it takes 1 time units
So the answer to the second example is 4 + 3 + 2 + 1 = 10.
|
```python
n=int(input());a=list(map(int,input().split()));p=0
for i in range(n-1):p=p+abs(a.index(i+1)-a.index(i+2))
print(p)
```
| 0
|
|
729
|
B
|
Spotlights
|
PROGRAMMING
| 1,200
|
[
"dp",
"implementation"
] | null | null |
Theater stage is a rectangular field of size *n*<=×<=*m*. The director gave you the stage's plan which actors will follow. For each cell it is stated in the plan if there would be an actor in this cell or not.
You are to place a spotlight on the stage in some good position. The spotlight will project light in one of the four directions (if you look at the stage from above) — left, right, up or down. Thus, the spotlight's position is a cell it is placed to and a direction it shines.
A position is good if two conditions hold:
- there is no actor in the cell the spotlight is placed to; - there is at least one actor in the direction the spotlight projects.
Count the number of good positions for placing the spotlight. Two positions of spotlight are considered to be different if the location cells or projection direction differ.
|
The first line contains two positive integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and the number of columns in the plan.
The next *n* lines contain *m* integers, 0 or 1 each — the description of the plan. Integer 1, means there will be an actor in the corresponding cell, while 0 means the cell will remain empty. It is guaranteed that there is at least one actor in the plan.
|
Print one integer — the number of good positions for placing the spotlight.
|
[
"2 4\n0 1 0 0\n1 0 1 0\n",
"4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0\n"
] |
[
"9\n",
"20\n"
] |
In the first example the following positions are good:
1. the (1, 1) cell and right direction; 1. the (1, 1) cell and down direction; 1. the (1, 3) cell and left direction; 1. the (1, 3) cell and down direction; 1. the (1, 4) cell and left direction; 1. the (2, 2) cell and left direction; 1. the (2, 2) cell and up direction; 1. the (2, 2) and right direction; 1. the (2, 4) cell and left direction.
Therefore, there are 9 good positions in this example.
| 1,000
|
[
{
"input": "2 4\n0 1 0 0\n1 0 1 0",
"output": "9"
},
{
"input": "4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0",
"output": "20"
},
{
"input": "1 5\n1 1 0 0 0",
"output": "3"
},
{
"input": "2 10\n0 0 0 0 0 0 0 1 0 0\n1 0 0 0 0 0 0 0 0 0",
"output": "20"
},
{
"input": "3 1\n1\n0\n0",
"output": "2"
},
{
"input": "5 7\n0 0 0 0 0 0 1\n0 0 0 0 0 0 1\n0 0 0 1 0 0 0\n0 0 0 0 0 0 0\n0 0 0 0 0 0 0",
"output": "25"
},
{
"input": "10 20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "4"
},
{
"input": "5 7\n0 0 0 0 0 0 0\n0 1 1 1 1 0 1\n0 1 1 1 1 1 1\n0 0 0 0 0 0 0\n0 1 1 1 1 0 1",
"output": "26"
},
{
"input": "10 20\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "121"
},
{
"input": "1 2\n0 1",
"output": "1"
},
{
"input": "1 2\n1 0",
"output": "1"
},
{
"input": "1 2\n1 1",
"output": "0"
},
{
"input": "2 1\n1\n0",
"output": "1"
},
{
"input": "2 1\n0\n1",
"output": "1"
},
{
"input": "2 1\n1\n1",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "4 4\n1 1 1 1\n1 0 0 1\n1 0 0 1\n1 1 1 1",
"output": "16"
}
] | 1,662,570,931
| 2,147,483,647
|
PyPy 3-64
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 6
| 1,000
| 18,329,600
|
from collections import deque,Counter
from math import *
import sys
import random
from bisect import *
from functools import reduce
from sys import stdin
import copy
input = lambda: sys.stdin.readline().rstrip()
def count(i,j,grid):
dirs = [[1,0],[-1,0],[0,1],[0,-1]]
ans = 0
for x,y in dirs:
dx,dy = i+x,j+y
peek = 0
while dx>=0 and dy>=0 and dx<len(grid) and dy<len(grid[0]):
if grid[dx][dy] == 1:
peek = 1
break
dx,dy = dx+x,dy+y
ans+=peek
return ans
n,m = map(int,input().split())
grid = []
for i in range(n):
arr = list(map(int,input().split()))
grid.append(arr)
ans = 0
for i in range(n):
for j in range(m):
if grid[i][j] == 0:
ans += count(i,j,grid)
print(ans)
|
Title: Spotlights
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Theater stage is a rectangular field of size *n*<=×<=*m*. The director gave you the stage's plan which actors will follow. For each cell it is stated in the plan if there would be an actor in this cell or not.
You are to place a spotlight on the stage in some good position. The spotlight will project light in one of the four directions (if you look at the stage from above) — left, right, up or down. Thus, the spotlight's position is a cell it is placed to and a direction it shines.
A position is good if two conditions hold:
- there is no actor in the cell the spotlight is placed to; - there is at least one actor in the direction the spotlight projects.
Count the number of good positions for placing the spotlight. Two positions of spotlight are considered to be different if the location cells or projection direction differ.
Input Specification:
The first line contains two positive integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and the number of columns in the plan.
The next *n* lines contain *m* integers, 0 or 1 each — the description of the plan. Integer 1, means there will be an actor in the corresponding cell, while 0 means the cell will remain empty. It is guaranteed that there is at least one actor in the plan.
Output Specification:
Print one integer — the number of good positions for placing the spotlight.
Demo Input:
['2 4\n0 1 0 0\n1 0 1 0\n', '4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0\n']
Demo Output:
['9\n', '20\n']
Note:
In the first example the following positions are good:
1. the (1, 1) cell and right direction; 1. the (1, 1) cell and down direction; 1. the (1, 3) cell and left direction; 1. the (1, 3) cell and down direction; 1. the (1, 4) cell and left direction; 1. the (2, 2) cell and left direction; 1. the (2, 2) cell and up direction; 1. the (2, 2) and right direction; 1. the (2, 4) cell and left direction.
Therefore, there are 9 good positions in this example.
|
```python
from collections import deque,Counter
from math import *
import sys
import random
from bisect import *
from functools import reduce
from sys import stdin
import copy
input = lambda: sys.stdin.readline().rstrip()
def count(i,j,grid):
dirs = [[1,0],[-1,0],[0,1],[0,-1]]
ans = 0
for x,y in dirs:
dx,dy = i+x,j+y
peek = 0
while dx>=0 and dy>=0 and dx<len(grid) and dy<len(grid[0]):
if grid[dx][dy] == 1:
peek = 1
break
dx,dy = dx+x,dy+y
ans+=peek
return ans
n,m = map(int,input().split())
grid = []
for i in range(n):
arr = list(map(int,input().split()))
grid.append(arr)
ans = 0
for i in range(n):
for j in range(m):
if grid[i][j] == 0:
ans += count(i,j,grid)
print(ans)
```
| 0
|
|
47
|
B
|
Coins
|
PROGRAMMING
| 1,200
|
[
"implementation"
] |
B. Coins
|
2
|
256
|
One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal.
|
The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(> or < sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A<B.
|
It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights.
|
[
"A>B\nC<B\nA>C\n",
"A<B\nB>C\nC>A\n"
] |
[
"CBA",
"ACB"
] |
none
| 1,000
|
[
{
"input": "A>B\nC<B\nA>C",
"output": "CBA"
},
{
"input": "A<B\nB>C\nC>A",
"output": "ACB"
},
{
"input": "A<C\nB<A\nB>C",
"output": "Impossible"
},
{
"input": "A<B\nA<C\nB>C",
"output": "ACB"
},
{
"input": "B>A\nC<B\nC>A",
"output": "ACB"
},
{
"input": "A>B\nB>C\nC<A",
"output": "CBA"
},
{
"input": "A>C\nA>B\nB<C",
"output": "BCA"
},
{
"input": "C<B\nB>A\nA<C",
"output": "ACB"
},
{
"input": "C<B\nA>B\nC<A",
"output": "CBA"
},
{
"input": "C>B\nB>A\nA<C",
"output": "ABC"
},
{
"input": "C<B\nB<A\nC>A",
"output": "Impossible"
},
{
"input": "B<C\nC<A\nA>B",
"output": "BCA"
},
{
"input": "A>B\nC<B\nC<A",
"output": "CBA"
},
{
"input": "B>A\nC>B\nA>C",
"output": "Impossible"
},
{
"input": "B<A\nC>B\nC>A",
"output": "BAC"
},
{
"input": "A<B\nC>B\nA<C",
"output": "ABC"
},
{
"input": "A<B\nC<A\nB<C",
"output": "Impossible"
},
{
"input": "A>C\nC<B\nB>A",
"output": "CAB"
},
{
"input": "C>A\nA<B\nB>C",
"output": "ACB"
},
{
"input": "C>A\nC<B\nB>A",
"output": "ACB"
},
{
"input": "B>C\nB>A\nA<C",
"output": "ACB"
},
{
"input": "C<B\nC<A\nB<A",
"output": "CBA"
},
{
"input": "A<C\nA<B\nB>C",
"output": "ACB"
},
{
"input": "B>A\nA>C\nB>C",
"output": "CAB"
},
{
"input": "B<A\nA<C\nC<B",
"output": "Impossible"
},
{
"input": "A<C\nB>C\nA>B",
"output": "Impossible"
},
{
"input": "B>A\nC<A\nC>B",
"output": "Impossible"
},
{
"input": "A>C\nC>B\nB<A",
"output": "BCA"
},
{
"input": "B<C\nB<A\nA>C",
"output": "BCA"
},
{
"input": "A>B\nC>B\nA<C",
"output": "BAC"
},
{
"input": "C<B\nC<A\nB<A",
"output": "CBA"
},
{
"input": "A<C\nA>B\nB>C",
"output": "Impossible"
},
{
"input": "B>A\nB>C\nA<C",
"output": "ACB"
},
{
"input": "B>C\nC<A\nB<A",
"output": "CBA"
},
{
"input": "C>A\nB>A\nB>C",
"output": "ACB"
},
{
"input": "B<A\nB>C\nA<C",
"output": "Impossible"
},
{
"input": "B<C\nA<B\nC>A",
"output": "ABC"
},
{
"input": "C<B\nB>A\nA>C",
"output": "CAB"
},
{
"input": "A>B\nC>A\nB<C",
"output": "BAC"
},
{
"input": "A>B\nB>C\nC<A",
"output": "CBA"
},
{
"input": "B>C\nC>A\nA>B",
"output": "Impossible"
},
{
"input": "B<A\nB>C\nC<A",
"output": "CBA"
},
{
"input": "C>B\nB>A\nC>A",
"output": "ABC"
},
{
"input": "A>C\nA>B\nB>C",
"output": "CBA"
},
{
"input": "B<C\nA>B\nA<C",
"output": "BAC"
},
{
"input": "C>A\nC<B\nB>A",
"output": "ACB"
},
{
"input": "C>B\nA<B\nC<A",
"output": "Impossible"
},
{
"input": "A<C\nC<B\nA>B",
"output": "Impossible"
},
{
"input": "B>C\nA<B\nA<C",
"output": "ACB"
},
{
"input": "C>A\nA<B\nC>B",
"output": "ABC"
}
] | 1,596,148,810
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 50
| 310
| 20,172,800
|
a = input()
b = input()
c = input()
ans = dict()
weights = [a, b, c]
w1 = w2 = w3 = 0
for i in weights:
if 'A>' in i or '<A' in i:
w1 += 1
if 'B>' in i or '<B' in i:
w2 += 1
if 'C>' in i or '<C' in i:
w3 += 1
total = [w1, w2, w3]
if 2 not in total or 1 not in total or 0 not in total:
print('Impossible')
else:
if w1 == 2:
heaviest = 'A'
elif w1 == 1:
mid = 'A'
else:
small = 'A'
if w2 == 2:
heaviest = 'B'
elif w2 == 1:
mid = 'B'
else:
small = 'B'
if w3 == 2:
heaviest = 'C'
elif w3 == 1:
mid = 'C'
else:
small = 'C'
print(small+mid+heaviest,)
|
Title: Coins
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal.
Input Specification:
The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(> or < sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A<B.
Output Specification:
It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights.
Demo Input:
['A>B\nC<B\nA>C\n', 'A<B\nB>C\nC>A\n']
Demo Output:
['CBA', 'ACB']
Note:
none
|
```python
a = input()
b = input()
c = input()
ans = dict()
weights = [a, b, c]
w1 = w2 = w3 = 0
for i in weights:
if 'A>' in i or '<A' in i:
w1 += 1
if 'B>' in i or '<B' in i:
w2 += 1
if 'C>' in i or '<C' in i:
w3 += 1
total = [w1, w2, w3]
if 2 not in total or 1 not in total or 0 not in total:
print('Impossible')
else:
if w1 == 2:
heaviest = 'A'
elif w1 == 1:
mid = 'A'
else:
small = 'A'
if w2 == 2:
heaviest = 'B'
elif w2 == 1:
mid = 'B'
else:
small = 'B'
if w3 == 2:
heaviest = 'C'
elif w3 == 1:
mid = 'C'
else:
small = 'C'
print(small+mid+heaviest,)
```
| 3.884925
|
664
|
A
|
Complicated GCD
|
PROGRAMMING
| 800
|
[
"math",
"number theory"
] | null | null |
Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm.
Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type!
|
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100).
|
Output one integer — greatest common divisor of all integers from *a* to *b* inclusive.
|
[
"1 2\n",
"61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n"
] |
[
"1\n",
"61803398874989484820458683436563811772030917980576\n"
] |
none
| 500
|
[
{
"input": "1 2",
"output": "1"
},
{
"input": "61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576",
"output": "61803398874989484820458683436563811772030917980576"
},
{
"input": "1 100",
"output": "1"
},
{
"input": "100 100000",
"output": "1"
},
{
"input": "12345 67890123456789123457",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158 8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158",
"output": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158"
},
{
"input": "1 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "8328748239473982794239847237438782379810988324751 9328748239473982794239847237438782379810988324751",
"output": "1"
},
{
"input": "1029398958432734901284327523909481928483573793 1029398958432734901284327523909481928483573794",
"output": "1"
},
{
"input": "10000 1000000000",
"output": "1"
},
{
"input": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "11210171722243 65715435710585778347",
"output": "1"
},
{
"input": "2921881079263974825226940825843 767693191032295360887755303860323261471",
"output": "1"
},
{
"input": "8025352957265704896940312528736939363590612908210603 96027920417708260814607687034511406492969694925539085",
"output": "1"
},
{
"input": "23510978780782786207241069904470895053213996267165977112058175452757132930 210352653280909370107314249722987050753257161175393375412301228883856435481424",
"output": "1"
},
{
"input": "8150070767079366215626260746398623663859344142817267779361251788637547414925170226504788118262 49924902262298336032630839998470954964895251605110946547855439236151401194070172107435992986913614",
"output": "1"
},
{
"input": "15943150466658398903 15943150466658398903",
"output": "15943150466658398903"
},
{
"input": "410470228200245407491525399055972 410470228200245407491525399055972",
"output": "410470228200245407491525399055972"
},
{
"input": "51894705655711504622197349350106792045098781545973899451307 51894705655711504622197349350106792045098781545973899451307",
"output": "51894705655711504622197349350106792045098781545973899451307"
},
{
"input": "60353594589897438036015726222485085035927634677598681595162804007836722215668410 60353594589897438036015726222485085035927634677598681595162804007836722215668410",
"output": "60353594589897438036015726222485085035927634677598681595162804007836722215668410"
},
{
"input": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535 761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535",
"output": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535"
},
{
"input": "1 2000000000",
"output": "1"
},
{
"input": "13 1928834874",
"output": "1"
},
{
"input": "87 2938984237482934238",
"output": "1"
},
{
"input": "213 413",
"output": "1"
},
{
"input": "3 4",
"output": "1"
}
] | 1,584,589,160
| 2,147,483,647
|
PyPy 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include<bits/stdc++.h>
using namespace std;
int main()
{
int a, b;
cin>>a>>b;
(a==b)?cout<<a:cout<<1;
}
|
Title: Complicated GCD
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm.
Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type!
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100).
Output Specification:
Output one integer — greatest common divisor of all integers from *a* to *b* inclusive.
Demo Input:
['1 2\n', '61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n']
Demo Output:
['1\n', '61803398874989484820458683436563811772030917980576\n']
Note:
none
|
```python
#include<bits/stdc++.h>
using namespace std;
int main()
{
int a, b;
cin>>a>>b;
(a==b)?cout<<a:cout<<1;
}
```
| -1
|
|
705
|
A
|
Hulk
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings.
Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on...
For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on.
Please help Dr. Banner.
|
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate.
|
Print Dr.Banner's feeling in one line.
|
[
"1\n",
"2\n",
"3\n"
] |
[
"I hate it\n",
"I hate that I love it\n",
"I hate that I love that I hate it\n"
] |
none
| 500
|
[
{
"input": "1",
"output": "I hate it"
},
{
"input": "2",
"output": "I hate that I love it"
},
{
"input": "3",
"output": "I hate that I love that I hate it"
},
{
"input": "4",
"output": "I hate that I love that I hate that I love it"
},
{
"input": "5",
"output": "I hate that I love that I hate that I love that I hate it"
},
{
"input": "10",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "18",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "19",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it"
},
{
"input": "76",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "77",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "81",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "82",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "85",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "86",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "100",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "99",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "98",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "33",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it"
},
{
"input": "34",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "57",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "100",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
}
] | 1,699,700,321
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 46
| 0
|
n = int(input())
str = ""
i = 1
while i < n:
if i % 2 != 0:
print("I hate",end=" ")
if i % 2 == 0:
print("I love",end=" ")
print("that",end=" ")
i += 1
if n % 2 == 0:
print("I love it")
else:
print("I hate it")
|
Title: Hulk
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings.
Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on...
For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on.
Please help Dr. Banner.
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate.
Output Specification:
Print Dr.Banner's feeling in one line.
Demo Input:
['1\n', '2\n', '3\n']
Demo Output:
['I hate it\n', 'I hate that I love it\n', 'I hate that I love that I hate it\n']
Note:
none
|
```python
n = int(input())
str = ""
i = 1
while i < n:
if i % 2 != 0:
print("I hate",end=" ")
if i % 2 == 0:
print("I love",end=" ")
print("that",end=" ")
i += 1
if n % 2 == 0:
print("I love it")
else:
print("I hate it")
```
| 3
|
|
70
|
A
|
Cookies
|
PROGRAMMING
| 1,300
|
[
"math"
] |
A. Cookies
|
1
|
256
|
Fangy collects cookies. Once he decided to take a box and put cookies into it in some way. If we take a square *k*<=×<=*k* in size, divided into blocks 1<=×<=1 in size and paint there the main diagonal together with cells, which lie above it, then the painted area will be equal to the area occupied by one cookie *k* in size. Fangy also has a box with a square base 2*n*<=×<=2*n*, divided into blocks 1<=×<=1 in size. In a box the cookies should not overlap, and they should not be turned over or rotated. See cookies of sizes 2 and 4 respectively on the figure:
To stack the cookies the little walrus uses the following algorithm. He takes out of the repository the largest cookie which can fit in some place in the box and puts it there. Everything could be perfect but alas, in the repository the little walrus has infinitely many cookies of size 2 and larger, and there are no cookies of size 1, therefore, empty cells will remain in the box. Fangy wants to know how many empty cells will be left in the end.
|
The first line contains a single integer *n* (0<=≤<=*n*<=≤<=1000).
|
Print the single number, equal to the number of empty cells in the box. The answer should be printed modulo 106<=+<=3.
|
[
"3\n"
] |
[
"9"
] |
If the box possesses the base of 2<sup class="upper-index">3</sup> × 2<sup class="upper-index">3</sup> (as in the example), then the cookies will be put there in the following manner:
| 500
|
[
{
"input": "3",
"output": "9"
},
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "3"
},
{
"input": "4",
"output": "27"
},
{
"input": "6",
"output": "243"
},
{
"input": "11",
"output": "59049"
},
{
"input": "14",
"output": "594320"
},
{
"input": "15",
"output": "782957"
},
{
"input": "7",
"output": "729"
},
{
"input": "0",
"output": "1"
},
{
"input": "1000",
"output": "691074"
},
{
"input": "657",
"output": "874011"
},
{
"input": "561",
"output": "842553"
},
{
"input": "823",
"output": "858672"
},
{
"input": "850",
"output": "557186"
},
{
"input": "298",
"output": "999535"
},
{
"input": "262",
"output": "946384"
},
{
"input": "910",
"output": "678945"
},
{
"input": "617",
"output": "247876"
},
{
"input": "857",
"output": "562128"
},
{
"input": "69",
"output": "327984"
},
{
"input": "589",
"output": "889192"
},
{
"input": "928",
"output": "794863"
},
{
"input": "696",
"output": "695035"
},
{
"input": "226",
"output": "376094"
}
] | 1,657,782,987
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 30
| 0
|
from math import ceil
x = int(input())
print(ceil(3**(n-1))%1000003)
|
Title: Cookies
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Fangy collects cookies. Once he decided to take a box and put cookies into it in some way. If we take a square *k*<=×<=*k* in size, divided into blocks 1<=×<=1 in size and paint there the main diagonal together with cells, which lie above it, then the painted area will be equal to the area occupied by one cookie *k* in size. Fangy also has a box with a square base 2*n*<=×<=2*n*, divided into blocks 1<=×<=1 in size. In a box the cookies should not overlap, and they should not be turned over or rotated. See cookies of sizes 2 and 4 respectively on the figure:
To stack the cookies the little walrus uses the following algorithm. He takes out of the repository the largest cookie which can fit in some place in the box and puts it there. Everything could be perfect but alas, in the repository the little walrus has infinitely many cookies of size 2 and larger, and there are no cookies of size 1, therefore, empty cells will remain in the box. Fangy wants to know how many empty cells will be left in the end.
Input Specification:
The first line contains a single integer *n* (0<=≤<=*n*<=≤<=1000).
Output Specification:
Print the single number, equal to the number of empty cells in the box. The answer should be printed modulo 106<=+<=3.
Demo Input:
['3\n']
Demo Output:
['9']
Note:
If the box possesses the base of 2<sup class="upper-index">3</sup> × 2<sup class="upper-index">3</sup> (as in the example), then the cookies will be put there in the following manner:
|
```python
from math import ceil
x = int(input())
print(ceil(3**(n-1))%1000003)
```
| -1
|
271
|
A
|
Beautiful Year
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
It seems like the year of 2013 came only yesterday. Do you know a curious fact? The year of 2013 is the first year after the old 1987 with only distinct digits.
Now you are suggested to solve the following problem: given a year number, find the minimum year number which is strictly larger than the given one and has only distinct digits.
|
The single line contains integer *y* (1000<=≤<=*y*<=≤<=9000) — the year number.
|
Print a single integer — the minimum year number that is strictly larger than *y* and all it's digits are distinct. It is guaranteed that the answer exists.
|
[
"1987\n",
"2013\n"
] |
[
"2013\n",
"2014\n"
] |
none
| 500
|
[
{
"input": "1987",
"output": "2013"
},
{
"input": "2013",
"output": "2014"
},
{
"input": "1000",
"output": "1023"
},
{
"input": "1001",
"output": "1023"
},
{
"input": "1234",
"output": "1235"
},
{
"input": "5555",
"output": "5601"
},
{
"input": "9000",
"output": "9012"
},
{
"input": "1111",
"output": "1203"
},
{
"input": "8999",
"output": "9012"
},
{
"input": "4572",
"output": "4573"
},
{
"input": "6666",
"output": "6701"
},
{
"input": "2001",
"output": "2013"
},
{
"input": "3000",
"output": "3012"
},
{
"input": "7712",
"output": "7801"
},
{
"input": "8088",
"output": "8091"
},
{
"input": "1594",
"output": "1596"
},
{
"input": "6016",
"output": "6017"
},
{
"input": "8800",
"output": "8901"
},
{
"input": "3331",
"output": "3401"
},
{
"input": "5090",
"output": "5091"
},
{
"input": "2342",
"output": "2345"
},
{
"input": "2334",
"output": "2340"
},
{
"input": "1123",
"output": "1203"
},
{
"input": "8989",
"output": "9012"
},
{
"input": "8977",
"output": "9012"
},
{
"input": "6869",
"output": "6870"
},
{
"input": "8999",
"output": "9012"
}
] | 1,698,558,288
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 27
| 154
| 0
|
year = int(input())
ans = str(year + 1)
while len(set(ans)) != 4:
ans = int(ans)
ans += 1
ans = str(ans)
print(ans)
|
Title: Beautiful Year
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It seems like the year of 2013 came only yesterday. Do you know a curious fact? The year of 2013 is the first year after the old 1987 with only distinct digits.
Now you are suggested to solve the following problem: given a year number, find the minimum year number which is strictly larger than the given one and has only distinct digits.
Input Specification:
The single line contains integer *y* (1000<=≤<=*y*<=≤<=9000) — the year number.
Output Specification:
Print a single integer — the minimum year number that is strictly larger than *y* and all it's digits are distinct. It is guaranteed that the answer exists.
Demo Input:
['1987\n', '2013\n']
Demo Output:
['2013\n', '2014\n']
Note:
none
|
```python
year = int(input())
ans = str(year + 1)
while len(set(ans)) != 4:
ans = int(ans)
ans += 1
ans = str(ans)
print(ans)
```
| 3
|
|
181
|
A
|
Series of Crimes
|
PROGRAMMING
| 800
|
[
"brute force",
"geometry",
"implementation"
] | null | null |
The Berland capital is shaken with three bold crimes committed by the Pihsters, a notorious criminal gang.
The Berland capital's map is represented by an *n*<=×<=*m* rectangular table. Each cell of the table on the map represents some districts of the capital.
The capital's main detective Polycarpus took a map and marked there the districts where the first three robberies had been committed as asterisks. Deduction tells Polycarpus that the fourth robbery will be committed in such district, that all four robbed districts will form the vertices of some rectangle, parallel to the sides of the map.
Polycarpus is good at deduction but he's hopeless at math. So he asked you to find the district where the fourth robbery will be committed.
|
The first line contains two space-separated integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of rows and columns in the table, correspondingly.
Each of the next *n* lines contains *m* characters — the description of the capital's map. Each character can either be a "." (dot), or an "*" (asterisk). A character equals "*" if the corresponding district has been robbed. Otherwise, it equals ".".
It is guaranteed that the map has exactly three characters "*" and we can always find the fourth district that meets the problem requirements.
|
Print two integers — the number of the row and the number of the column of the city district that is the fourth one to be robbed. The rows are numbered starting from one from top to bottom and the columns are numbered starting from one from left to right.
|
[
"3 2\n.*\n..\n**\n",
"3 3\n*.*\n*..\n...\n"
] |
[
"1 1\n",
"2 3\n"
] |
none
| 500
|
[
{
"input": "3 2\n.*\n..\n**",
"output": "1 1"
},
{
"input": "2 5\n*....\n*...*",
"output": "1 5"
},
{
"input": "7 2\n..\n**\n..\n..\n..\n..\n.*",
"output": "7 1"
},
{
"input": "7 2\n*.\n..\n..\n..\n..\n..\n**",
"output": "1 2"
},
{
"input": "2 10\n*......*..\n.......*..",
"output": "2 1"
},
{
"input": "10 3\n*..\n...\n...\n...\n...\n...\n...\n...\n...\n**.",
"output": "1 2"
},
{
"input": "100 2\n*.\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n**",
"output": "1 2"
},
{
"input": "99 3\n**.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n*..",
"output": "99 2"
},
{
"input": "98 3\n...\n.*.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n.**",
"output": "2 3"
},
{
"input": "99 3\n**.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n*..",
"output": "99 2"
},
{
"input": "98 3\n...\n.*.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n.**",
"output": "2 3"
},
{
"input": "2 100\n...................................................................................................*\n*..................................................................................................*",
"output": "1 1"
},
{
"input": "2 2\n*.\n**",
"output": "1 2"
},
{
"input": "2 2\n**\n.*",
"output": "2 1"
},
{
"input": "2 3\n*.*\n..*",
"output": "2 1"
}
] | 1,616,429,889
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
n,m=map(int,raw_input().split())
r=n*[0]
c=m*[0]
for i in range(n):
s=raw_input()
for j in range(m):
if s[j]=='*':
r[i]+=1
c[j]+=1
print r.index(1)+1,c.index(1)+1
|
Title: Series of Crimes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Berland capital is shaken with three bold crimes committed by the Pihsters, a notorious criminal gang.
The Berland capital's map is represented by an *n*<=×<=*m* rectangular table. Each cell of the table on the map represents some districts of the capital.
The capital's main detective Polycarpus took a map and marked there the districts where the first three robberies had been committed as asterisks. Deduction tells Polycarpus that the fourth robbery will be committed in such district, that all four robbed districts will form the vertices of some rectangle, parallel to the sides of the map.
Polycarpus is good at deduction but he's hopeless at math. So he asked you to find the district where the fourth robbery will be committed.
Input Specification:
The first line contains two space-separated integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of rows and columns in the table, correspondingly.
Each of the next *n* lines contains *m* characters — the description of the capital's map. Each character can either be a "." (dot), or an "*" (asterisk). A character equals "*" if the corresponding district has been robbed. Otherwise, it equals ".".
It is guaranteed that the map has exactly three characters "*" and we can always find the fourth district that meets the problem requirements.
Output Specification:
Print two integers — the number of the row and the number of the column of the city district that is the fourth one to be robbed. The rows are numbered starting from one from top to bottom and the columns are numbered starting from one from left to right.
Demo Input:
['3 2\n.*\n..\n**\n', '3 3\n*.*\n*..\n...\n']
Demo Output:
['1 1\n', '2 3\n']
Note:
none
|
```python
n,m=map(int,raw_input().split())
r=n*[0]
c=m*[0]
for i in range(n):
s=raw_input()
for j in range(m):
if s[j]=='*':
r[i]+=1
c[j]+=1
print r.index(1)+1,c.index(1)+1
```
| -1
|
|
3
|
A
|
Shortest path of the king
|
PROGRAMMING
| 1,000
|
[
"greedy",
"shortest paths"
] |
A. Shortest path of the king
|
1
|
64
|
The king is left alone on the chessboard. In spite of this loneliness, he doesn't lose heart, because he has business of national importance. For example, he has to pay an official visit to square *t*. As the king is not in habit of wasting his time, he wants to get from his current position *s* to square *t* in the least number of moves. Help him to do this.
In one move the king can get to the square that has a common side or a common vertex with the square the king is currently in (generally there are 8 different squares he can move to).
|
The first line contains the chessboard coordinates of square *s*, the second line — of square *t*.
Chessboard coordinates consist of two characters, the first one is a lowercase Latin letter (from a to h), the second one is a digit from 1 to 8.
|
In the first line print *n* — minimum number of the king's moves. Then in *n* lines print the moves themselves. Each move is described with one of the 8: L, R, U, D, LU, LD, RU or RD.
L, R, U, D stand respectively for moves left, right, up and down (according to the picture), and 2-letter combinations stand for diagonal moves. If the answer is not unique, print any of them.
|
[
"a8\nh1\n"
] |
[
"7\nRD\nRD\nRD\nRD\nRD\nRD\nRD\n"
] |
none
| 0
|
[
{
"input": "a8\nh1",
"output": "7\nRD\nRD\nRD\nRD\nRD\nRD\nRD"
},
{
"input": "b2\nb4",
"output": "2\nU\nU"
},
{
"input": "a5\na5",
"output": "0"
},
{
"input": "h1\nb2",
"output": "6\nLU\nL\nL\nL\nL\nL"
},
{
"input": "c5\nh2",
"output": "5\nRD\nRD\nRD\nR\nR"
},
{
"input": "e1\nf2",
"output": "1\nRU"
},
{
"input": "g4\nd2",
"output": "3\nLD\nLD\nL"
},
{
"input": "a8\nb2",
"output": "6\nRD\nD\nD\nD\nD\nD"
},
{
"input": "d4\nh2",
"output": "4\nRD\nRD\nR\nR"
},
{
"input": "c5\na2",
"output": "3\nLD\nLD\nD"
},
{
"input": "h5\nf8",
"output": "3\nLU\nLU\nU"
},
{
"input": "e6\nb6",
"output": "3\nL\nL\nL"
},
{
"input": "a6\ng4",
"output": "6\nRD\nRD\nR\nR\nR\nR"
},
{
"input": "f7\nc2",
"output": "5\nLD\nLD\nLD\nD\nD"
},
{
"input": "b7\nh8",
"output": "6\nRU\nR\nR\nR\nR\nR"
},
{
"input": "g7\nd6",
"output": "3\nLD\nL\nL"
},
{
"input": "c8\na3",
"output": "5\nLD\nLD\nD\nD\nD"
},
{
"input": "h8\nf1",
"output": "7\nLD\nLD\nD\nD\nD\nD\nD"
},
{
"input": "d1\nb7",
"output": "6\nLU\nLU\nU\nU\nU\nU"
},
{
"input": "a7\ne5",
"output": "4\nRD\nRD\nR\nR"
},
{
"input": "d6\nb1",
"output": "5\nLD\nLD\nD\nD\nD"
},
{
"input": "f5\ng5",
"output": "1\nR"
},
{
"input": "h4\nd1",
"output": "4\nLD\nLD\nLD\nL"
},
{
"input": "b3\na5",
"output": "2\nLU\nU"
},
{
"input": "d2\nf1",
"output": "2\nRD\nR"
},
{
"input": "f1\nc5",
"output": "4\nLU\nLU\nLU\nU"
},
{
"input": "a8\nh1",
"output": "7\nRD\nRD\nRD\nRD\nRD\nRD\nRD"
},
{
"input": "c7\ne5",
"output": "2\nRD\nRD"
},
{
"input": "e7\nb1",
"output": "6\nLD\nLD\nLD\nD\nD\nD"
},
{
"input": "g8\na8",
"output": "6\nL\nL\nL\nL\nL\nL"
},
{
"input": "g6\nf2",
"output": "4\nLD\nD\nD\nD"
},
{
"input": "g4\nc4",
"output": "4\nL\nL\nL\nL"
},
{
"input": "g2\na6",
"output": "6\nLU\nLU\nLU\nLU\nL\nL"
},
{
"input": "f8\nf8",
"output": "0"
},
{
"input": "f5\nd2",
"output": "3\nLD\nLD\nD"
}
] | 1,671,701,840
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 62
| 0
|
s=input()
t=input()
xdiff=ord(s[0])-ord(t[0])
ydiff=int(s[1])-int(t[1])
xchar="L"
ychar="D"
if xdiff<0:
xchar="R"
if ydiff<0:
ychar="U"
xdiff=abs(xdiff)
ydiff=abs(ydiff)
count=max(xdiff,ydiff)+(abs(xdiff-ydiff))
print(count)
for i in range(min(xdiff, ydiff)):
print(xchar+ychar)
if xdiff>ydiff:
for i in range(xdiff-ydiff):
print(xchar)
if ydiff>xdiff:
for i in range(ydiff-xdiff):
print(ychar)
|
Title: Shortest path of the king
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
The king is left alone on the chessboard. In spite of this loneliness, he doesn't lose heart, because he has business of national importance. For example, he has to pay an official visit to square *t*. As the king is not in habit of wasting his time, he wants to get from his current position *s* to square *t* in the least number of moves. Help him to do this.
In one move the king can get to the square that has a common side or a common vertex with the square the king is currently in (generally there are 8 different squares he can move to).
Input Specification:
The first line contains the chessboard coordinates of square *s*, the second line — of square *t*.
Chessboard coordinates consist of two characters, the first one is a lowercase Latin letter (from a to h), the second one is a digit from 1 to 8.
Output Specification:
In the first line print *n* — minimum number of the king's moves. Then in *n* lines print the moves themselves. Each move is described with one of the 8: L, R, U, D, LU, LD, RU or RD.
L, R, U, D stand respectively for moves left, right, up and down (according to the picture), and 2-letter combinations stand for diagonal moves. If the answer is not unique, print any of them.
Demo Input:
['a8\nh1\n']
Demo Output:
['7\nRD\nRD\nRD\nRD\nRD\nRD\nRD\n']
Note:
none
|
```python
s=input()
t=input()
xdiff=ord(s[0])-ord(t[0])
ydiff=int(s[1])-int(t[1])
xchar="L"
ychar="D"
if xdiff<0:
xchar="R"
if ydiff<0:
ychar="U"
xdiff=abs(xdiff)
ydiff=abs(ydiff)
count=max(xdiff,ydiff)+(abs(xdiff-ydiff))
print(count)
for i in range(min(xdiff, ydiff)):
print(xchar+ychar)
if xdiff>ydiff:
for i in range(xdiff-ydiff):
print(xchar)
if ydiff>xdiff:
for i in range(ydiff-xdiff):
print(ychar)
```
| 0
|
665
|
C
|
Simple Strings
|
PROGRAMMING
| 1,300
|
[
"dp",
"greedy",
"strings"
] | null | null |
zscoder loves simple strings! A string *t* is called simple if every pair of adjacent characters are distinct. For example ab, aba, zscoder are simple whereas aa, add are not simple.
zscoder is given a string *s*. He wants to change a minimum number of characters so that the string *s* becomes simple. Help him with this task!
|
The only line contains the string *s* (1<=≤<=|*s*|<=≤<=2·105) — the string given to zscoder. The string *s* consists of only lowercase English letters.
|
Print the simple string *s*' — the string *s* after the minimal number of changes. If there are multiple solutions, you may output any of them.
Note that the string *s*' should also consist of only lowercase English letters.
|
[
"aab\n",
"caaab\n",
"zscoder\n"
] |
[
"bab\n",
"cabab\n",
"zscoder\n"
] |
none
| 0
|
[
{
"input": "aab",
"output": "bab"
},
{
"input": "caaab",
"output": "cabab"
},
{
"input": "zscoder",
"output": "zscoder"
},
{
"input": "u",
"output": "u"
},
{
"input": "h",
"output": "h"
},
{
"input": "dtottttotd",
"output": "dtotataotd"
},
{
"input": "rxxxrrxrxxxxxrrrrrxxxxrrrrxrxxrxxrxrxrrrxrrxrrxrxxxrxrrxrrxrxrxxxxxrxxxxrrrxrxxrxxrxxxrrrrrxrrxrrxrr",
"output": "rxaxraxrxaxaxrararxaxararaxrxarxarxrxrarxraxraxrxaxrxraxraxrxrxaxaxrxaxararxrxarxarxaxrararxraxraxra"
},
{
"input": "aazz",
"output": "baza"
},
{
"input": "zz",
"output": "za"
},
{
"input": "gg",
"output": "ga"
},
{
"input": "qasdasd",
"output": "qasdasd"
},
{
"input": "aa",
"output": "ba"
},
{
"input": "ab",
"output": "ab"
},
{
"input": "zza",
"output": "zba"
},
{
"input": "g",
"output": "g"
},
{
"input": "nnop",
"output": "naop"
},
{
"input": "xx",
"output": "xa"
}
] | 1,559,475,212
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 77
| 0
|
str1=input()
l1=list(str1)
for i in range(len(l1)-2):
if(l1[i]==l1[i+1]==l1[i+2]):
l1[i+1]=chr(ord(l1[i+1])+1)
else:
if(l1[i]==l1[i+1] and l1[i+1]!=l1[i+2]):
x=chr(ord(l1[i+2])+1)
print(x)
if(l1[i+1]!=x):
l1[i+1]=x
else:
l1[i+1]=chr(ord(l1[i+2])+2)
str2=""
for i in l1:
str2=str2+i
print(str2)
|
Title: Simple Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
zscoder loves simple strings! A string *t* is called simple if every pair of adjacent characters are distinct. For example ab, aba, zscoder are simple whereas aa, add are not simple.
zscoder is given a string *s*. He wants to change a minimum number of characters so that the string *s* becomes simple. Help him with this task!
Input Specification:
The only line contains the string *s* (1<=≤<=|*s*|<=≤<=2·105) — the string given to zscoder. The string *s* consists of only lowercase English letters.
Output Specification:
Print the simple string *s*' — the string *s* after the minimal number of changes. If there are multiple solutions, you may output any of them.
Note that the string *s*' should also consist of only lowercase English letters.
Demo Input:
['aab\n', 'caaab\n', 'zscoder\n']
Demo Output:
['bab\n', 'cabab\n', 'zscoder\n']
Note:
none
|
```python
str1=input()
l1=list(str1)
for i in range(len(l1)-2):
if(l1[i]==l1[i+1]==l1[i+2]):
l1[i+1]=chr(ord(l1[i+1])+1)
else:
if(l1[i]==l1[i+1] and l1[i+1]!=l1[i+2]):
x=chr(ord(l1[i+2])+1)
print(x)
if(l1[i+1]!=x):
l1[i+1]=x
else:
l1[i+1]=chr(ord(l1[i+2])+2)
str2=""
for i in l1:
str2=str2+i
print(str2)
```
| 0
|
|
961
|
A
|
Tetris
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
You are given a following process.
There is a platform with $n$ columns. $1 \times 1$ squares are appearing one after another in some columns on this platform. If there are no squares in the column, a square will occupy the bottom row. Otherwise a square will appear at the top of the highest square of this column.
When all of the $n$ columns have at least one square in them, the bottom row is being removed. You will receive $1$ point for this, and all the squares left will fall down one row.
You task is to calculate the amount of points you will receive.
|
The first line of input contain 2 integer numbers $n$ and $m$ ($1 \le n, m \le 1000$) — the length of the platform and the number of the squares.
The next line contain $m$ integer numbers $c_1, c_2, \dots, c_m$ ($1 \le c_i \le n$) — column in which $i$-th square will appear.
|
Print one integer — the amount of points you will receive.
|
[
"3 9\n1 1 2 2 2 3 1 2 3\n"
] |
[
"2\n"
] |
In the sample case the answer will be equal to $2$ because after the appearing of $6$-th square will be removed one row (counts of the squares on the platform will look like $[2~ 3~ 1]$, and after removing one row will be $[1~ 2~ 0]$).
After the appearing of $9$-th square counts will be $[2~ 3~ 1]$, and after removing one row it will look like $[1~ 2~ 0]$.
So the answer will be equal to $2$.
| 0
|
[
{
"input": "3 9\n1 1 2 2 2 3 1 2 3",
"output": "2"
},
{
"input": "1 7\n1 1 1 1 1 1 1",
"output": "7"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "3 5\n1 1 1 2 3",
"output": "1"
},
{
"input": "4 6\n4 4 4 4 4 4",
"output": "0"
},
{
"input": "4 6\n2 3 4 4 4 4",
"output": "0"
},
{
"input": "3 12\n1 1 1 1 2 2 2 2 3 3 3 3",
"output": "4"
},
{
"input": "8 8\n2 2 3 4 5 6 7 8",
"output": "0"
},
{
"input": "100 1\n50",
"output": "0"
},
{
"input": "2 1\n2",
"output": "0"
},
{
"input": "2 1\n1",
"output": "0"
},
{
"input": "2 4\n1 2 1 1",
"output": "1"
},
{
"input": "3 4\n3 2 2 2",
"output": "0"
},
{
"input": "2 2\n2 2",
"output": "0"
},
{
"input": "2 5\n2 1 1 2 1",
"output": "2"
},
{
"input": "15 3\n13 14 15",
"output": "0"
},
{
"input": "4 9\n1 2 3 1 2 3 1 2 3",
"output": "0"
},
{
"input": "100 3\n1 2 3",
"output": "0"
},
{
"input": "1000 10\n999 999 998 34 454 546 343 35 34 1000",
"output": "0"
},
{
"input": "4 2\n1 2",
"output": "0"
}
] | 1,580,809,629
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 29
| 187
| 0
|
n, m = map(int, input().split())
l = list(map(int, input().split()))
w = []
for i in range(n):
w.append(l.count(i + 1))
w.sort()
print(w[0])
|
Title: Tetris
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a following process.
There is a platform with $n$ columns. $1 \times 1$ squares are appearing one after another in some columns on this platform. If there are no squares in the column, a square will occupy the bottom row. Otherwise a square will appear at the top of the highest square of this column.
When all of the $n$ columns have at least one square in them, the bottom row is being removed. You will receive $1$ point for this, and all the squares left will fall down one row.
You task is to calculate the amount of points you will receive.
Input Specification:
The first line of input contain 2 integer numbers $n$ and $m$ ($1 \le n, m \le 1000$) — the length of the platform and the number of the squares.
The next line contain $m$ integer numbers $c_1, c_2, \dots, c_m$ ($1 \le c_i \le n$) — column in which $i$-th square will appear.
Output Specification:
Print one integer — the amount of points you will receive.
Demo Input:
['3 9\n1 1 2 2 2 3 1 2 3\n']
Demo Output:
['2\n']
Note:
In the sample case the answer will be equal to $2$ because after the appearing of $6$-th square will be removed one row (counts of the squares on the platform will look like $[2~ 3~ 1]$, and after removing one row will be $[1~ 2~ 0]$).
After the appearing of $9$-th square counts will be $[2~ 3~ 1]$, and after removing one row it will look like $[1~ 2~ 0]$.
So the answer will be equal to $2$.
|
```python
n, m = map(int, input().split())
l = list(map(int, input().split()))
w = []
for i in range(n):
w.append(l.count(i + 1))
w.sort()
print(w[0])
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Память компьютера состоит из *n* ячеек, которые выстроены в ряд. Пронумеруем ячейки от 1 до *n* слева направо. Про каждую ячейку известно, свободна она или принадлежит какому-либо процессу (в таком случае известен процесс, которому она принадлежит).
Для каждого процесса известно, что принадлежащие ему ячейки занимают в памяти непрерывный участок. С помощью операций вида «переписать данные из занятой ячейки в свободную, а занятую теперь считать свободной» требуется расположить все принадлежащие процессам ячейки в начале памяти компьютера. Другими словами, любая свободная ячейка должна располагаться правее (иметь больший номер) любой занятой.
Вам необходимо найти минимальное количество операций переписывания данных из одной ячейки в другую, с помощью которых можно достичь описанных условий. Допустимо, что относительный порядок ячеек в памяти для каждого из процессов изменится после дефрагментации, но относительный порядок самих процессов должен остаться без изменений. Это значит, что если все ячейки, принадлежащие процессу *i*, находились в памяти раньше всех ячеек процесса *j*, то и после перемещений это условие должно выполняться.
Считайте, что номера всех процессов уникальны, хотя бы одна ячейка памяти занята каким-либо процессом.
|
В первой строке входных данных записано число *n* (1<=≤<=*n*<=≤<=200<=000) — количество ячеек в памяти компьютера.
Во второй строке входных данных следуют *n* целых чисел *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*), где *a**i* равно либо 0 (это означает, что *i*-я ячейка памяти свободна), либо номеру процесса, которому принадлежит *i*-я ячейка памяти. Гарантируется, что хотя бы одно значение *a**i* не равно 0.
Процессы пронумерованы целыми числами от 1 до *n* в произвольном порядке. При этом процессы не обязательно пронумерованы последовательными числами.
|
Выведите одно целое число — минимальное количество операций, которое нужно сделать для дефрагментации памяти.
|
[
"4\n0 2 2 1\n",
"8\n0 8 8 8 0 4 4 2\n"
] |
[
"2\n",
"4\n"
] |
В первом тестовом примере достаточно двух операций:
1. Переписать данные из третьей ячейки в первую. После этого память компьютера примет вид: 2 2 0 1. 1. Переписать данные из четвертой ячейки в третью. После этого память компьютера примет вид: 2 2 1 0.
| 0
|
[
{
"input": "4\n0 2 2 1",
"output": "2"
},
{
"input": "8\n0 8 8 8 0 4 4 2",
"output": "4"
},
{
"input": "5\n0 0 0 1 1",
"output": "2"
},
{
"input": "6\n0 0 0 3 0 0",
"output": "1"
},
{
"input": "10\n0 10 10 0 0 3 3 0 0 0",
"output": "3"
},
{
"input": "10\n0 9 9 9 9 0 8 8 8 8",
"output": "3"
},
{
"input": "15\n0 0 6 6 0 0 0 0 4 0 0 0 9 0 0",
"output": "4"
},
{
"input": "21\n0 11 11 11 11 0 7 0 12 12 12 12 12 0 19 19 19 0 1 1 1",
"output": "11"
},
{
"input": "24\n0 0 6 6 6 0 22 22 0 23 23 0 19 19 19 19 0 0 17 0 0 3 3 3",
"output": "14"
},
{
"input": "15\n1 1 1 1 5 5 5 4 4 4 3 3 3 2 7",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "21\n11 0 0 0 0 7 0 12 0 0 0 0 0 19 0 0 0 1 0 0 0",
"output": "4"
},
{
"input": "24\n6 6 0 0 0 22 0 0 23 0 0 19 0 0 0 0 17 17 0 3 3 0 0 0",
"output": "7"
},
{
"input": "6\n4 4 2 6 6 6",
"output": "0"
}
] | 1,458,982,439
| 6,839
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
PRETESTS
| 7
| 2,000
| 13,209,600
|
n = int(input())
a = list(map(int,input().split()))
x = 0
k = 0
z = 0
while z != n:
if a[k] != 0:
k += 1
if k == n:
break
else:
z = k
while a[z] == 0:
z += 1
if z == n:
break
if z != n:
b = a[z]
l = z
while a[l] == b:
l += 1
if l == n:
break
l -= 1
a[l],a[k] = a[k],a[l]
x += 1
#print(a)
print(x)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Память компьютера состоит из *n* ячеек, которые выстроены в ряд. Пронумеруем ячейки от 1 до *n* слева направо. Про каждую ячейку известно, свободна она или принадлежит какому-либо процессу (в таком случае известен процесс, которому она принадлежит).
Для каждого процесса известно, что принадлежащие ему ячейки занимают в памяти непрерывный участок. С помощью операций вида «переписать данные из занятой ячейки в свободную, а занятую теперь считать свободной» требуется расположить все принадлежащие процессам ячейки в начале памяти компьютера. Другими словами, любая свободная ячейка должна располагаться правее (иметь больший номер) любой занятой.
Вам необходимо найти минимальное количество операций переписывания данных из одной ячейки в другую, с помощью которых можно достичь описанных условий. Допустимо, что относительный порядок ячеек в памяти для каждого из процессов изменится после дефрагментации, но относительный порядок самих процессов должен остаться без изменений. Это значит, что если все ячейки, принадлежащие процессу *i*, находились в памяти раньше всех ячеек процесса *j*, то и после перемещений это условие должно выполняться.
Считайте, что номера всех процессов уникальны, хотя бы одна ячейка памяти занята каким-либо процессом.
Input Specification:
В первой строке входных данных записано число *n* (1<=≤<=*n*<=≤<=200<=000) — количество ячеек в памяти компьютера.
Во второй строке входных данных следуют *n* целых чисел *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*), где *a**i* равно либо 0 (это означает, что *i*-я ячейка памяти свободна), либо номеру процесса, которому принадлежит *i*-я ячейка памяти. Гарантируется, что хотя бы одно значение *a**i* не равно 0.
Процессы пронумерованы целыми числами от 1 до *n* в произвольном порядке. При этом процессы не обязательно пронумерованы последовательными числами.
Output Specification:
Выведите одно целое число — минимальное количество операций, которое нужно сделать для дефрагментации памяти.
Demo Input:
['4\n0 2 2 1\n', '8\n0 8 8 8 0 4 4 2\n']
Demo Output:
['2\n', '4\n']
Note:
В первом тестовом примере достаточно двух операций:
1. Переписать данные из третьей ячейки в первую. После этого память компьютера примет вид: 2 2 0 1. 1. Переписать данные из четвертой ячейки в третью. После этого память компьютера примет вид: 2 2 1 0.
|
```python
n = int(input())
a = list(map(int,input().split()))
x = 0
k = 0
z = 0
while z != n:
if a[k] != 0:
k += 1
if k == n:
break
else:
z = k
while a[z] == 0:
z += 1
if z == n:
break
if z != n:
b = a[z]
l = z
while a[l] == b:
l += 1
if l == n:
break
l -= 1
a[l],a[k] = a[k],a[l]
x += 1
#print(a)
print(x)
```
| 0
|
|
32
|
B
|
Borze
|
PROGRAMMING
| 800
|
[
"expression parsing",
"implementation"
] |
B. Borze
|
2
|
256
|
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
|
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
|
Output the decoded ternary number. It can have leading zeroes.
|
[
".-.--\n",
"--.\n",
"-..-.--\n"
] |
[
"012",
"20",
"1012"
] |
none
| 1,000
|
[
{
"input": ".-.--",
"output": "012"
},
{
"input": "--.",
"output": "20"
},
{
"input": "-..-.--",
"output": "1012"
},
{
"input": "---..",
"output": "210"
},
{
"input": "..--.---..",
"output": "0020210"
},
{
"input": "-.....----.",
"output": "10000220"
},
{
"input": ".",
"output": "0"
},
{
"input": "-.",
"output": "1"
},
{
"input": "--",
"output": "2"
},
{
"input": "..",
"output": "00"
},
{
"input": "--.",
"output": "20"
},
{
"input": ".--.",
"output": "020"
},
{
"input": ".-.-..",
"output": "0110"
},
{
"input": "----.-.",
"output": "2201"
},
{
"input": "-..--.-.",
"output": "10201"
},
{
"input": "..--..--.",
"output": "0020020"
},
{
"input": "-.-.---.--..-..-.-.-..-..-.--.",
"output": "112120010111010120"
},
{
"input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.",
"output": "21112220010101011012011011221011"
},
{
"input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------",
"output": "11020111110111222212021020002022111100201121222020012022110010222"
},
{
"input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..",
"output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110"
},
{
"input": ".-..-.-.---.-----.--.---...-.--.-.-....-..",
"output": "01011212212021001201100010"
},
{
"input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..",
"output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210"
},
{
"input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.",
"output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220"
},
{
"input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----",
"output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122"
},
{
"input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..",
"output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110"
},
{
"input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.",
"output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020"
},
{
"input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..",
"output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200"
},
{
"input": "-.---...----...--.--...-.--.----",
"output": "121002200020200012022"
},
{
"input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.",
"output": "202020212012111010201021100001021221200011222112012201012220"
}
] | 1,651,078,247
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 30
| 154
| 0
|
flag = True
s = input()
while flag == True:
if '--' in s:
s = s.replace('--', '2')
elif '-.' in s:
s = s.replace('-.', '1')
elif '.' in s:
s = s.replace('.', '0')
else:
flag = False
print(s)
|
Title: Borze
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
Input Specification:
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output Specification:
Output the decoded ternary number. It can have leading zeroes.
Demo Input:
['.-.--\n', '--.\n', '-..-.--\n']
Demo Output:
['012', '20', '1012']
Note:
none
|
```python
flag = True
s = input()
while flag == True:
if '--' in s:
s = s.replace('--', '2')
elif '-.' in s:
s = s.replace('-.', '1')
elif '.' in s:
s = s.replace('.', '0')
else:
flag = False
print(s)
```
| 3.9615
|
488
|
A
|
Giga Tower
|
PROGRAMMING
| 1,100
|
[
"brute force"
] | null | null |
Giga Tower is the tallest and deepest building in Cyberland. There are 17<=777<=777<=777 floors, numbered from <=-<=8<=888<=888<=888 to 8<=888<=888<=888. In particular, there is floor 0 between floor <=-<=1 and floor 1. Every day, thousands of tourists come to this place to enjoy the wonderful view.
In Cyberland, it is believed that the number "8" is a lucky number (that's why Giga Tower has 8<=888<=888<=888 floors above the ground), and, an integer is lucky, if and only if its decimal notation contains at least one digit "8". For example, 8,<=<=-<=180,<=808 are all lucky while 42,<=<=-<=10 are not. In the Giga Tower, if you write code at a floor with lucky floor number, good luck will always be with you (Well, this round is #278, also lucky, huh?).
Tourist Henry goes to the tower to seek good luck. Now he is at the floor numbered *a*. He wants to find the minimum positive integer *b*, such that, if he walks *b* floors higher, he will arrive at a floor with a lucky number.
|
The only line of input contains an integer *a* (<=-<=109<=≤<=*a*<=≤<=109).
|
Print the minimum *b* in a line.
|
[
"179\n",
"-1\n",
"18\n"
] |
[
"1\n",
"9\n",
"10\n"
] |
For the first sample, he has to arrive at the floor numbered 180.
For the second sample, he will arrive at 8.
Note that *b* should be positive, so the answer for the third sample is 10, not 0.
| 500
|
[
{
"input": "179",
"output": "1"
},
{
"input": "-1",
"output": "9"
},
{
"input": "18",
"output": "10"
},
{
"input": "-410058385",
"output": "1"
},
{
"input": "-586825624",
"output": "1"
},
{
"input": "852318890",
"output": "1"
},
{
"input": "919067153",
"output": "5"
},
{
"input": "690422411",
"output": "7"
},
{
"input": "-408490162",
"output": "1"
},
{
"input": "-8",
"output": "16"
},
{
"input": "-6",
"output": "14"
},
{
"input": "-4",
"output": "12"
},
{
"input": "-2",
"output": "10"
},
{
"input": "0",
"output": "8"
},
{
"input": "2",
"output": "6"
},
{
"input": "4",
"output": "4"
},
{
"input": "6",
"output": "2"
},
{
"input": "8",
"output": "10"
},
{
"input": "1000000000",
"output": "8"
},
{
"input": "-1000000000",
"output": "2"
},
{
"input": "88888",
"output": "1"
},
{
"input": "89",
"output": "9"
},
{
"input": "-80000000",
"output": "2"
},
{
"input": "-8888",
"output": "1"
},
{
"input": "-17",
"output": "9"
},
{
"input": "78",
"output": "2"
},
{
"input": "-19",
"output": "1"
},
{
"input": "-999999998",
"output": "9"
},
{
"input": "-999999997",
"output": "8"
},
{
"input": "999999997",
"output": "1"
},
{
"input": "811111111",
"output": "1"
},
{
"input": "-8",
"output": "16"
},
{
"input": "-5",
"output": "13"
},
{
"input": "-7",
"output": "15"
},
{
"input": "1000000000",
"output": "8"
}
] | 1,684,321,083
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 46
| 0
|
a = int(input())
a += 1
k = 1
while "8" not in str(a):
k += 1
a += 1
print(k)
|
Title: Giga Tower
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Giga Tower is the tallest and deepest building in Cyberland. There are 17<=777<=777<=777 floors, numbered from <=-<=8<=888<=888<=888 to 8<=888<=888<=888. In particular, there is floor 0 between floor <=-<=1 and floor 1. Every day, thousands of tourists come to this place to enjoy the wonderful view.
In Cyberland, it is believed that the number "8" is a lucky number (that's why Giga Tower has 8<=888<=888<=888 floors above the ground), and, an integer is lucky, if and only if its decimal notation contains at least one digit "8". For example, 8,<=<=-<=180,<=808 are all lucky while 42,<=<=-<=10 are not. In the Giga Tower, if you write code at a floor with lucky floor number, good luck will always be with you (Well, this round is #278, also lucky, huh?).
Tourist Henry goes to the tower to seek good luck. Now he is at the floor numbered *a*. He wants to find the minimum positive integer *b*, such that, if he walks *b* floors higher, he will arrive at a floor with a lucky number.
Input Specification:
The only line of input contains an integer *a* (<=-<=109<=≤<=*a*<=≤<=109).
Output Specification:
Print the minimum *b* in a line.
Demo Input:
['179\n', '-1\n', '18\n']
Demo Output:
['1\n', '9\n', '10\n']
Note:
For the first sample, he has to arrive at the floor numbered 180.
For the second sample, he will arrive at 8.
Note that *b* should be positive, so the answer for the third sample is 10, not 0.
|
```python
a = int(input())
a += 1
k = 1
while "8" not in str(a):
k += 1
a += 1
print(k)
```
| 3
|
|
139
|
A
|
Petr and Book
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
One Sunday Petr went to a bookshop and bought a new book on sports programming. The book had exactly *n* pages.
Petr decided to start reading it starting from the next day, that is, from Monday. Petr's got a very tight schedule and for each day of the week he knows how many pages he will be able to read on that day. Some days are so busy that Petr will have no time to read whatsoever. However, we know that he will be able to read at least one page a week.
Assuming that Petr will not skip days and will read as much as he can every day, determine on which day of the week he will read the last page of the book.
|
The first input line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of pages in the book.
The second line contains seven non-negative space-separated integers that do not exceed 1000 — those integers represent how many pages Petr can read on Monday, Tuesday, Wednesday, Thursday, Friday, Saturday and Sunday correspondingly. It is guaranteed that at least one of those numbers is larger than zero.
|
Print a single number — the number of the day of the week, when Petr will finish reading the book. The days of the week are numbered starting with one in the natural order: Monday, Tuesday, Wednesday, Thursday, Friday, Saturday, Sunday.
|
[
"100\n15 20 20 15 10 30 45\n",
"2\n1 0 0 0 0 0 0\n"
] |
[
"6\n",
"1\n"
] |
Note to the first sample:
By the end of Monday and therefore, by the beginning of Tuesday Petr has 85 pages left. He has 65 pages left by Wednesday, 45 by Thursday, 30 by Friday, 20 by Saturday and on Saturday Petr finishes reading the book (and he also has time to read 10 pages of something else).
Note to the second sample:
On Monday of the first week Petr will read the first page. On Monday of the second week Petr will read the second page and will finish reading the book.
| 500
|
[
{
"input": "100\n15 20 20 15 10 30 45",
"output": "6"
},
{
"input": "2\n1 0 0 0 0 0 0",
"output": "1"
},
{
"input": "100\n100 200 100 200 300 400 500",
"output": "1"
},
{
"input": "3\n1 1 1 1 1 1 1",
"output": "3"
},
{
"input": "1\n1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "20\n5 3 7 2 1 6 4",
"output": "6"
},
{
"input": "10\n5 1 1 1 1 1 5",
"output": "6"
},
{
"input": "50\n10 1 10 1 10 1 10",
"output": "1"
},
{
"input": "77\n11 11 11 11 11 11 10",
"output": "1"
},
{
"input": "1\n1000 1000 1000 1000 1000 1000 1000",
"output": "1"
},
{
"input": "1000\n100 100 100 100 100 100 100",
"output": "3"
},
{
"input": "999\n10 20 10 20 30 20 10",
"output": "3"
},
{
"input": "433\n109 58 77 10 39 125 15",
"output": "7"
},
{
"input": "1\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "5\n1 0 1 0 1 0 1",
"output": "1"
},
{
"input": "997\n1 1 0 0 1 0 1",
"output": "1"
},
{
"input": "1000\n1 1 1 1 1 1 1",
"output": "6"
},
{
"input": "1000\n1000 1000 1000 1000 1000 1000 1000",
"output": "1"
},
{
"input": "1000\n1 0 0 0 0 0 0",
"output": "1"
},
{
"input": "1000\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "1000\n1 0 0 1 0 0 1",
"output": "1"
},
{
"input": "509\n105 23 98 0 7 0 155",
"output": "2"
},
{
"input": "7\n1 1 1 1 1 1 1",
"output": "7"
},
{
"input": "2\n1 1 0 0 0 0 0",
"output": "2"
},
{
"input": "1\n0 0 0 0 0 1 0",
"output": "6"
},
{
"input": "10\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "5\n0 0 0 0 0 6 0",
"output": "6"
},
{
"input": "3\n0 1 0 0 0 0 0",
"output": "2"
},
{
"input": "10\n0 0 0 0 0 0 10",
"output": "7"
},
{
"input": "28\n1 2 3 4 5 6 7",
"output": "7"
},
{
"input": "100\n5 5 5 5 5 5 5",
"output": "6"
},
{
"input": "4\n1 0 0 0 0 0 1",
"output": "7"
},
{
"input": "2\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "7\n0 0 0 0 0 0 7",
"output": "7"
},
{
"input": "7\n2 1 1 1 1 1 0",
"output": "6"
},
{
"input": "2\n0 0 1 1 0 0 0",
"output": "4"
},
{
"input": "6\n1 1 1 1 1 1 0",
"output": "6"
},
{
"input": "5\n1 1 1 0 0 1 1",
"output": "7"
},
{
"input": "100\n10 20 30 10 10 10 10",
"output": "7"
},
{
"input": "1\n0 0 0 1 0 0 0",
"output": "4"
},
{
"input": "70\n10 10 10 10 10 10 10",
"output": "7"
},
{
"input": "22\n1 2 3 4 5 6 10",
"output": "7"
},
{
"input": "5\n0 0 0 1 0 0 0",
"output": "4"
},
{
"input": "2\n0 0 0 1 0 0 0",
"output": "4"
},
{
"input": "6\n1 0 0 0 0 0 2",
"output": "7"
},
{
"input": "10\n1 2 2 1 2 1 1",
"output": "7"
},
{
"input": "5\n0 0 0 0 0 0 10",
"output": "7"
},
{
"input": "4\n0 1 1 0 0 0 0",
"output": "3"
},
{
"input": "100\n0 0 0 0 0 1 0",
"output": "6"
}
] | 1,693,701,762
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
n=int(input())
alist=(input().split())
a=[int(x) for x in alist]
for i in range(1,7):
a[i]+=a[i-1]
print(a)
m=n%a[6]
if m==0:
print(7)
else:
for i in range(7):
if m <= a[i]:
print(i + 1)
break
|
Title: Petr and Book
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One Sunday Petr went to a bookshop and bought a new book on sports programming. The book had exactly *n* pages.
Petr decided to start reading it starting from the next day, that is, from Monday. Petr's got a very tight schedule and for each day of the week he knows how many pages he will be able to read on that day. Some days are so busy that Petr will have no time to read whatsoever. However, we know that he will be able to read at least one page a week.
Assuming that Petr will not skip days and will read as much as he can every day, determine on which day of the week he will read the last page of the book.
Input Specification:
The first input line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of pages in the book.
The second line contains seven non-negative space-separated integers that do not exceed 1000 — those integers represent how many pages Petr can read on Monday, Tuesday, Wednesday, Thursday, Friday, Saturday and Sunday correspondingly. It is guaranteed that at least one of those numbers is larger than zero.
Output Specification:
Print a single number — the number of the day of the week, when Petr will finish reading the book. The days of the week are numbered starting with one in the natural order: Monday, Tuesday, Wednesday, Thursday, Friday, Saturday, Sunday.
Demo Input:
['100\n15 20 20 15 10 30 45\n', '2\n1 0 0 0 0 0 0\n']
Demo Output:
['6\n', '1\n']
Note:
Note to the first sample:
By the end of Monday and therefore, by the beginning of Tuesday Petr has 85 pages left. He has 65 pages left by Wednesday, 45 by Thursday, 30 by Friday, 20 by Saturday and on Saturday Petr finishes reading the book (and he also has time to read 10 pages of something else).
Note to the second sample:
On Monday of the first week Petr will read the first page. On Monday of the second week Petr will read the second page and will finish reading the book.
|
```python
n=int(input())
alist=(input().split())
a=[int(x) for x in alist]
for i in range(1,7):
a[i]+=a[i-1]
print(a)
m=n%a[6]
if m==0:
print(7)
else:
for i in range(7):
if m <= a[i]:
print(i + 1)
break
```
| 0
|
|
659
|
C
|
Tanya and Toys
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation"
] | null | null |
In Berland recently a new collection of toys went on sale. This collection consists of 109 types of toys, numbered with integers from 1 to 109. A toy from the new collection of the *i*-th type costs *i* bourles.
Tania has managed to collect *n* different types of toys *a*1,<=*a*2,<=...,<=*a**n* from the new collection. Today is Tanya's birthday, and her mother decided to spend no more than *m* bourles on the gift to the daughter. Tanya will choose several different types of toys from the new collection as a gift. Of course, she does not want to get a type of toy which she already has.
Tanya wants to have as many distinct types of toys in her collection as possible as the result. The new collection is too diverse, and Tanya is too little, so she asks you to help her in this.
|
The first line contains two integers *n* (1<=≤<=*n*<=≤<=100<=000) and *m* (1<=≤<=*m*<=≤<=109) — the number of types of toys that Tanya already has and the number of bourles that her mom is willing to spend on buying new toys.
The next line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the types of toys that Tanya already has.
|
In the first line print a single integer *k* — the number of different types of toys that Tanya should choose so that the number of different types of toys in her collection is maximum possible. Of course, the total cost of the selected toys should not exceed *m*.
In the second line print *k* distinct space-separated integers *t*1,<=*t*2,<=...,<=*t**k* (1<=≤<=*t**i*<=≤<=109) — the types of toys that Tanya should choose.
If there are multiple answers, you may print any of them. Values of *t**i* can be printed in any order.
|
[
"3 7\n1 3 4\n",
"4 14\n4 6 12 8\n"
] |
[
"2\n2 5 \n",
"4\n7 2 3 1\n"
] |
In the first sample mom should buy two toys: one toy of the 2-nd type and one toy of the 5-th type. At any other purchase for 7 bourles (assuming that the toys of types 1, 3 and 4 have already been bought), it is impossible to buy two and more toys.
| 1,000
|
[
{
"input": "3 7\n1 3 4",
"output": "2\n2 5 "
},
{
"input": "4 14\n4 6 12 8",
"output": "4\n1 2 3 5 "
},
{
"input": "5 6\n97746 64770 31551 96547 65684",
"output": "3\n1 2 3 "
},
{
"input": "10 10\n94125 56116 29758 94024 29289 31663 99794 35076 25328 58656",
"output": "4\n1 2 3 4 "
},
{
"input": "30 38\n9560 64176 75619 53112 54160 68775 12655 13118 99502 89757 78434 42521 19210 1927 34097 5416 56110 44786 59126 44266 79240 65567 54602 25325 37171 2879 89291 89121 39568 28162",
"output": "8\n1 2 3 4 5 6 7 8 "
},
{
"input": "1 999999298\n85187",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "1 999999119\n34421",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "1 1000000000\n1",
"output": "44719\n2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "1 1000000000\n44720",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "1 1000000000\n44719",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "1 1000000000\n44721",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "3 1000000000\n123456789 234567891 345678912",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "2 5\n999999999 1000000000",
"output": "2\n1 2 "
},
{
"input": "2 1000000000\n1 1000000000",
"output": "44719\n2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "3 100000\n1000000000 100000000 1",
"output": "445\n2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 ..."
},
{
"input": "5 5\n100000000 200000000 300000000 400000000 1000000000",
"output": "2\n1 2 "
},
{
"input": "6 3\n1 2 3 4 5 6",
"output": "0"
},
{
"input": "2 1\n1 2",
"output": "0"
},
{
"input": "1 1000000000\n1000000000",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "5 1000000\n1000000000 100000000 10000000 99999999 123456789",
"output": "1413\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "2 10000000\n1234567 123456",
"output": "4471\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "1 1\n1000000000",
"output": "1\n1 "
},
{
"input": "1 1000000000\n9999999",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "5 10000\n1000000000 888888888 777777777 666666666 959595959",
"output": "140\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 "
},
{
"input": "3 1\n1000000000 999999999 999999998",
"output": "1\n1 "
},
{
"input": "5 100000000\n100000000 999999999 1 2 3",
"output": "14138\n4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 15..."
},
{
"input": "3 55\n100000000 1000000000 999999999",
"output": "10\n1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "2 10\n5 10000009",
"output": "4\n1 2 3 4 "
},
{
"input": "3 10000000\n999999999 999999998 999999997",
"output": "4471\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "1 1100\n1000000000",
"output": "46\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 "
},
{
"input": "1 40\n1000000000",
"output": "8\n1 2 3 4 5 6 7 8 "
}
] | 1,662,215,405
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 5
| 92
| 4,403,200
|
n,m=[int(x) for x in input().split()]
a=[int(x) for x in input().split()]
i=1
L=[]
c=a[0]
ind=0
while m>0 and ind<n-1:
if i<c:
if m>=i:
L.append(i)
m-=i
i+=1
else:
break
elif i>=c:
i+=1
ind+=1
c=a[ind]
i=0
while m>0:
if m>a[-1]:
L.append(a[n-1]+1+i)
m-=a[n-1]+1+i
i+=1
else:
break
i+=1
print(len(L))
for i in L:
print(i,end=" ")
|
Title: Tanya and Toys
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In Berland recently a new collection of toys went on sale. This collection consists of 109 types of toys, numbered with integers from 1 to 109. A toy from the new collection of the *i*-th type costs *i* bourles.
Tania has managed to collect *n* different types of toys *a*1,<=*a*2,<=...,<=*a**n* from the new collection. Today is Tanya's birthday, and her mother decided to spend no more than *m* bourles on the gift to the daughter. Tanya will choose several different types of toys from the new collection as a gift. Of course, she does not want to get a type of toy which she already has.
Tanya wants to have as many distinct types of toys in her collection as possible as the result. The new collection is too diverse, and Tanya is too little, so she asks you to help her in this.
Input Specification:
The first line contains two integers *n* (1<=≤<=*n*<=≤<=100<=000) and *m* (1<=≤<=*m*<=≤<=109) — the number of types of toys that Tanya already has and the number of bourles that her mom is willing to spend on buying new toys.
The next line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the types of toys that Tanya already has.
Output Specification:
In the first line print a single integer *k* — the number of different types of toys that Tanya should choose so that the number of different types of toys in her collection is maximum possible. Of course, the total cost of the selected toys should not exceed *m*.
In the second line print *k* distinct space-separated integers *t*1,<=*t*2,<=...,<=*t**k* (1<=≤<=*t**i*<=≤<=109) — the types of toys that Tanya should choose.
If there are multiple answers, you may print any of them. Values of *t**i* can be printed in any order.
Demo Input:
['3 7\n1 3 4\n', '4 14\n4 6 12 8\n']
Demo Output:
['2\n2 5 \n', '4\n7 2 3 1\n']
Note:
In the first sample mom should buy two toys: one toy of the 2-nd type and one toy of the 5-th type. At any other purchase for 7 bourles (assuming that the toys of types 1, 3 and 4 have already been bought), it is impossible to buy two and more toys.
|
```python
n,m=[int(x) for x in input().split()]
a=[int(x) for x in input().split()]
i=1
L=[]
c=a[0]
ind=0
while m>0 and ind<n-1:
if i<c:
if m>=i:
L.append(i)
m-=i
i+=1
else:
break
elif i>=c:
i+=1
ind+=1
c=a[ind]
i=0
while m>0:
if m>a[-1]:
L.append(a[n-1]+1+i)
m-=a[n-1]+1+i
i+=1
else:
break
i+=1
print(len(L))
for i in L:
print(i,end=" ")
```
| 0
|
|
579
|
A
|
Raising Bacteria
|
PROGRAMMING
| 1,000
|
[
"bitmasks"
] | null | null |
You are a lover of bacteria. You want to raise some bacteria in a box.
Initially, the box is empty. Each morning, you can put any number of bacteria into the box. And each night, every bacterium in the box will split into two bacteria. You hope to see exactly *x* bacteria in the box at some moment.
What is the minimum number of bacteria you need to put into the box across those days?
|
The only line containing one integer *x* (1<=≤<=*x*<=≤<=109).
|
The only line containing one integer: the answer.
|
[
"5\n",
"8\n"
] |
[
"2\n",
"1\n"
] |
For the first sample, we can add one bacterium in the box in the first day morning and at the third morning there will be 4 bacteria in the box. Now we put one more resulting 5 in the box. We added 2 bacteria in the process so the answer is 2.
For the second sample, we can put one in the first morning and in the 4-th morning there will be 8 in the box. So the answer is 1.
| 250
|
[
{
"input": "5",
"output": "2"
},
{
"input": "8",
"output": "1"
},
{
"input": "536870911",
"output": "29"
},
{
"input": "1",
"output": "1"
},
{
"input": "343000816",
"output": "14"
},
{
"input": "559980448",
"output": "12"
},
{
"input": "697681824",
"output": "14"
},
{
"input": "41313494",
"output": "14"
},
{
"input": "673935585",
"output": "13"
},
{
"input": "117422204",
"output": "19"
},
{
"input": "954746654",
"output": "15"
},
{
"input": "536838144",
"output": "14"
},
{
"input": "1000000000",
"output": "13"
},
{
"input": "2",
"output": "1"
},
{
"input": "3",
"output": "2"
},
{
"input": "4",
"output": "1"
},
{
"input": "6",
"output": "2"
},
{
"input": "7",
"output": "3"
},
{
"input": "9",
"output": "2"
},
{
"input": "10",
"output": "2"
},
{
"input": "999999999",
"output": "21"
},
{
"input": "999999998",
"output": "20"
},
{
"input": "999999997",
"output": "20"
},
{
"input": "999999996",
"output": "19"
},
{
"input": "999999995",
"output": "20"
},
{
"input": "999999994",
"output": "19"
},
{
"input": "999999993",
"output": "19"
},
{
"input": "999999992",
"output": "18"
},
{
"input": "999999991",
"output": "20"
},
{
"input": "999999990",
"output": "19"
},
{
"input": "536870910",
"output": "28"
},
{
"input": "536870912",
"output": "1"
},
{
"input": "536870913",
"output": "2"
},
{
"input": "536870914",
"output": "2"
},
{
"input": "22",
"output": "3"
},
{
"input": "14",
"output": "3"
}
] | 1,697,482,619
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 31
| 0
|
b = int(input())
if b % 2 == 0: print(1)
else: print(2)
|
Title: Raising Bacteria
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are a lover of bacteria. You want to raise some bacteria in a box.
Initially, the box is empty. Each morning, you can put any number of bacteria into the box. And each night, every bacterium in the box will split into two bacteria. You hope to see exactly *x* bacteria in the box at some moment.
What is the minimum number of bacteria you need to put into the box across those days?
Input Specification:
The only line containing one integer *x* (1<=≤<=*x*<=≤<=109).
Output Specification:
The only line containing one integer: the answer.
Demo Input:
['5\n', '8\n']
Demo Output:
['2\n', '1\n']
Note:
For the first sample, we can add one bacterium in the box in the first day morning and at the third morning there will be 4 bacteria in the box. Now we put one more resulting 5 in the box. We added 2 bacteria in the process so the answer is 2.
For the second sample, we can put one in the first morning and in the 4-th morning there will be 8 in the box. So the answer is 1.
|
```python
b = int(input())
if b % 2 == 0: print(1)
else: print(2)
```
| 0
|
|
998
|
A
|
Balloons
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms",
"implementation"
] | null | null |
There are quite a lot of ways to have fun with inflatable balloons. For example, you can fill them with water and see what happens.
Grigory and Andrew have the same opinion. So, once upon a time, they went to the shop and bought $n$ packets with inflatable balloons, where $i$-th of them has exactly $a_i$ balloons inside.
They want to divide the balloons among themselves. In addition, there are several conditions to hold:
- Do not rip the packets (both Grigory and Andrew should get unbroken packets); - Distribute all packets (every packet should be given to someone); - Give both Grigory and Andrew at least one packet; - To provide more fun, the total number of balloons in Grigory's packets should not be equal to the total number of balloons in Andrew's packets.
Help them to divide the balloons or determine that it's impossible under these conditions.
|
The first line of input contains a single integer $n$ ($1 \le n \le 10$) — the number of packets with balloons.
The second line contains $n$ integers: $a_1$, $a_2$, $\ldots$, $a_n$ ($1 \le a_i \le 1000$) — the number of balloons inside the corresponding packet.
|
If it's impossible to divide the balloons satisfying the conditions above, print $-1$.
Otherwise, print an integer $k$ — the number of packets to give to Grigory followed by $k$ distinct integers from $1$ to $n$ — the indices of those. The order of packets doesn't matter.
If there are multiple ways to divide balloons, output any of them.
|
[
"3\n1 2 1\n",
"2\n5 5\n",
"1\n10\n"
] |
[
"2\n1 2\n",
"-1\n",
"-1\n"
] |
In the first test Grigory gets $3$ balloons in total while Andrey gets $1$.
In the second test there's only one way to divide the packets which leads to equal numbers of balloons.
In the third test one of the boys won't get a packet at all.
| 500
|
[
{
"input": "3\n1 2 1",
"output": "1\n1"
},
{
"input": "2\n5 5",
"output": "-1"
},
{
"input": "1\n10",
"output": "-1"
},
{
"input": "1\n1",
"output": "-1"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "1\n1"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 9",
"output": "1\n1"
},
{
"input": "10\n26 723 970 13 422 968 875 329 234 983",
"output": "1\n4"
},
{
"input": "3\n3 2 1",
"output": "1\n3"
},
{
"input": "10\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "1\n1"
},
{
"input": "10\n1 9 7 6 2 4 7 8 1 3",
"output": "1\n1"
},
{
"input": "2\n9 6",
"output": "1\n2"
},
{
"input": "2\n89 7",
"output": "1\n2"
},
{
"input": "2\n101 807",
"output": "1\n1"
},
{
"input": "5\n8 7 4 8 3",
"output": "1\n5"
},
{
"input": "5\n55 62 70 100 90",
"output": "1\n1"
},
{
"input": "5\n850 840 521 42 169",
"output": "1\n4"
},
{
"input": "6\n7 1 4 1 6 1",
"output": "1\n2"
},
{
"input": "6\n36 80 38 88 79 69",
"output": "1\n1"
},
{
"input": "6\n108 318 583 10 344 396",
"output": "1\n4"
},
{
"input": "9\n10 9 10 10 8 3 5 10 2",
"output": "1\n9"
},
{
"input": "9\n90 31 28 63 57 57 27 62 42",
"output": "1\n7"
},
{
"input": "9\n665 646 152 829 190 64 555 536 321",
"output": "1\n6"
},
{
"input": "10\n99 62 10 47 53 9 83 33 15 24",
"output": "1\n6"
},
{
"input": "4\n600 200 100 300",
"output": "1\n3"
},
{
"input": "2\n4 5",
"output": "1\n1"
},
{
"input": "2\n5 12",
"output": "1\n1"
},
{
"input": "2\n1 2",
"output": "1\n1"
},
{
"input": "3\n1 1 2",
"output": "1\n1"
},
{
"input": "2\n3 2",
"output": "1\n2"
},
{
"input": "3\n1 4 5",
"output": "1\n1"
},
{
"input": "4\n5 5 5 5",
"output": "1\n1"
},
{
"input": "1\n5",
"output": "-1"
},
{
"input": "3\n5 5 5",
"output": "1\n1"
},
{
"input": "5\n5 5 5 5 5",
"output": "1\n1"
},
{
"input": "4\n2 7 10 1",
"output": "1\n4"
},
{
"input": "3\n1 1 1",
"output": "1\n1"
},
{
"input": "4\n8 4 2 2",
"output": "1\n3"
},
{
"input": "2\n3 4",
"output": "1\n1"
},
{
"input": "4\n1 1 3 1",
"output": "1\n1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "1\n1"
},
{
"input": "2\n18 19",
"output": "1\n1"
},
{
"input": "2\n17 18",
"output": "1\n1"
},
{
"input": "2\n1 3",
"output": "1\n1"
},
{
"input": "4\n5 5 4 4",
"output": "1\n3"
},
{
"input": "2\n10 11",
"output": "1\n1"
},
{
"input": "2\n10 20",
"output": "1\n1"
},
{
"input": "2\n2 1",
"output": "1\n2"
},
{
"input": "4\n2 3 2 3",
"output": "1\n1"
},
{
"input": "2\n5 6",
"output": "1\n1"
}
] | 1,530,688,131
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 77
| 0
|
n = int(input())
ar = input().split()
mi = ar.index(min(ar))
print("-1" if (n == 2 and ar[0] == ar[1]) or n<2 else "1 " + str(mi))
|
Title: Balloons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are quite a lot of ways to have fun with inflatable balloons. For example, you can fill them with water and see what happens.
Grigory and Andrew have the same opinion. So, once upon a time, they went to the shop and bought $n$ packets with inflatable balloons, where $i$-th of them has exactly $a_i$ balloons inside.
They want to divide the balloons among themselves. In addition, there are several conditions to hold:
- Do not rip the packets (both Grigory and Andrew should get unbroken packets); - Distribute all packets (every packet should be given to someone); - Give both Grigory and Andrew at least one packet; - To provide more fun, the total number of balloons in Grigory's packets should not be equal to the total number of balloons in Andrew's packets.
Help them to divide the balloons or determine that it's impossible under these conditions.
Input Specification:
The first line of input contains a single integer $n$ ($1 \le n \le 10$) — the number of packets with balloons.
The second line contains $n$ integers: $a_1$, $a_2$, $\ldots$, $a_n$ ($1 \le a_i \le 1000$) — the number of balloons inside the corresponding packet.
Output Specification:
If it's impossible to divide the balloons satisfying the conditions above, print $-1$.
Otherwise, print an integer $k$ — the number of packets to give to Grigory followed by $k$ distinct integers from $1$ to $n$ — the indices of those. The order of packets doesn't matter.
If there are multiple ways to divide balloons, output any of them.
Demo Input:
['3\n1 2 1\n', '2\n5 5\n', '1\n10\n']
Demo Output:
['2\n1 2\n', '-1\n', '-1\n']
Note:
In the first test Grigory gets $3$ balloons in total while Andrey gets $1$.
In the second test there's only one way to divide the packets which leads to equal numbers of balloons.
In the third test one of the boys won't get a packet at all.
|
```python
n = int(input())
ar = input().split()
mi = ar.index(min(ar))
print("-1" if (n == 2 and ar[0] == ar[1]) or n<2 else "1 " + str(mi))
```
| 0
|
|
255
|
C
|
Almost Arithmetical Progression
|
PROGRAMMING
| 1,500
|
[
"brute force",
"dp"
] | null | null |
Gena loves sequences of numbers. Recently, he has discovered a new type of sequences which he called an almost arithmetical progression. A sequence is an almost arithmetical progression, if its elements can be represented as:
- *a*1<==<=*p*, where *p* is some integer; - *a**i*<==<=*a**i*<=-<=1<=+<=(<=-<=1)*i*<=+<=1·*q* (*i*<=><=1), where *q* is some integer.
Right now Gena has a piece of paper with sequence *b*, consisting of *n* integers. Help Gena, find there the longest subsequence of integers that is an almost arithmetical progression.
Sequence *s*1,<=<=*s*2,<=<=...,<=<=*s**k* is a subsequence of sequence *b*1,<=<=*b*2,<=<=...,<=<=*b**n*, if there is such increasing sequence of indexes *i*1,<=*i*2,<=...,<=*i**k* (1<=<=≤<=<=*i*1<=<=<<=<=*i*2<=<=<<=... <=<=<<=<=*i**k*<=<=≤<=<=*n*), that *b**i**j*<=<==<=<=*s**j*. In other words, sequence *s* can be obtained from *b* by crossing out some elements.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=4000). The next line contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=106).
|
Print a single integer — the length of the required longest subsequence.
|
[
"2\n3 5\n",
"4\n10 20 10 30\n"
] |
[
"2\n",
"3\n"
] |
In the first test the sequence actually is the suitable subsequence.
In the second test the following subsequence fits: 10, 20, 10.
| 1,500
|
[
{
"input": "2\n3 5",
"output": "2"
},
{
"input": "4\n10 20 10 30",
"output": "3"
},
{
"input": "5\n4 4 3 5 1",
"output": "2"
},
{
"input": "6\n2 3 2 2 1 3",
"output": "4"
},
{
"input": "8\n2 2 5 3 4 3 3 2",
"output": "3"
},
{
"input": "2\n468 335",
"output": "2"
},
{
"input": "1\n170",
"output": "1"
},
{
"input": "5\n479 359 963 465 706",
"output": "2"
},
{
"input": "6\n282 828 962 492 996 943",
"output": "2"
},
{
"input": "8\n437 392 605 903 154 293 383 422",
"output": "2"
},
{
"input": "42\n68 35 1 70 25 79 59 63 65 6 46 82 28 62 92 96 43 28 37 92 5 3 54 93 83 22 17 19 96 48 27 72 39 70 13 68 100 36 95 4 12 23",
"output": "4"
},
{
"input": "73\n531 626 701 57 708 511 54 441 297 697 411 253 397 652 21 59 851 561 539 461 629 894 275 417 127 505 433 243 963 247 5 368 969 541 408 485 319 117 441 131 265 357 1 659 267 983 643 285 913 782 813 569 99 781 297 636 645 341 6 17 601 129 509 197 226 105 241 737 86 128 762 647 849",
"output": "4"
},
{
"input": "49\n516 161 416 850 361 861 833 233 281 798 225 771 841 111 481 617 463 305 743 945 833 141 70 617 511 522 840 505 753 544 931 213 626 567 137 687 221 942 951 881 617 129 761 225 849 915 96 801 164",
"output": "4"
}
] | 1,672,291,577
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 14
| 93
| 1,843,200
|
from collections import Counter
def ss(a,x1,x2):
count = 0
term = 0
for i in a:
if count==0:
if i==x1:
count+=1
term = 2
elif i==x2:
count+=1
term = 1
if term==1:
if i==x1:
count+=1
term = 2
if term==2:
if i==x2:
count+=1
term = 1
return count
n = int(input())
a = list(map(int,input().split()))
d = Counter(a)
s = list(set(a))
freq = []
for i in s:
freq.append(d[i])
S = []
for x,y in sorted(zip(freq,s),reverse = True):
S.append(y)
max_l = d[s[0]]
for i in range(len(s)):
for j in range(i+1,len(s)):
if d[s[i]]+d[s[j]]<=max_l:
break
L = ss(a,s[i],s[j])
if L>max_l:
max_l = L
print(max_l)
|
Title: Almost Arithmetical Progression
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gena loves sequences of numbers. Recently, he has discovered a new type of sequences which he called an almost arithmetical progression. A sequence is an almost arithmetical progression, if its elements can be represented as:
- *a*1<==<=*p*, where *p* is some integer; - *a**i*<==<=*a**i*<=-<=1<=+<=(<=-<=1)*i*<=+<=1·*q* (*i*<=><=1), where *q* is some integer.
Right now Gena has a piece of paper with sequence *b*, consisting of *n* integers. Help Gena, find there the longest subsequence of integers that is an almost arithmetical progression.
Sequence *s*1,<=<=*s*2,<=<=...,<=<=*s**k* is a subsequence of sequence *b*1,<=<=*b*2,<=<=...,<=<=*b**n*, if there is such increasing sequence of indexes *i*1,<=*i*2,<=...,<=*i**k* (1<=<=≤<=<=*i*1<=<=<<=<=*i*2<=<=<<=... <=<=<<=<=*i**k*<=<=≤<=<=*n*), that *b**i**j*<=<==<=<=*s**j*. In other words, sequence *s* can be obtained from *b* by crossing out some elements.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=4000). The next line contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=106).
Output Specification:
Print a single integer — the length of the required longest subsequence.
Demo Input:
['2\n3 5\n', '4\n10 20 10 30\n']
Demo Output:
['2\n', '3\n']
Note:
In the first test the sequence actually is the suitable subsequence.
In the second test the following subsequence fits: 10, 20, 10.
|
```python
from collections import Counter
def ss(a,x1,x2):
count = 0
term = 0
for i in a:
if count==0:
if i==x1:
count+=1
term = 2
elif i==x2:
count+=1
term = 1
if term==1:
if i==x1:
count+=1
term = 2
if term==2:
if i==x2:
count+=1
term = 1
return count
n = int(input())
a = list(map(int,input().split()))
d = Counter(a)
s = list(set(a))
freq = []
for i in s:
freq.append(d[i])
S = []
for x,y in sorted(zip(freq,s),reverse = True):
S.append(y)
max_l = d[s[0]]
for i in range(len(s)):
for j in range(i+1,len(s)):
if d[s[i]]+d[s[j]]<=max_l:
break
L = ss(a,s[i],s[j])
if L>max_l:
max_l = L
print(max_l)
```
| 0
|
|
90
|
A
|
Cableway
|
PROGRAMMING
| 1,000
|
[
"greedy",
"math"
] |
A. Cableway
|
2
|
256
|
A group of university students wants to get to the top of a mountain to have a picnic there. For that they decided to use a cableway.
A cableway is represented by some cablecars, hanged onto some cable stations by a cable. A cable is scrolled cyclically between the first and the last cable stations (the first of them is located at the bottom of the mountain and the last one is located at the top). As the cable moves, the cablecar attached to it move as well.
The number of cablecars is divisible by three and they are painted three colors: red, green and blue, in such manner that after each red cablecar goes a green one, after each green cablecar goes a blue one and after each blue cablecar goes a red one. Each cablecar can transport no more than two people, the cablecars arrive with the periodicity of one minute (i. e. every minute) and it takes exactly 30 minutes for a cablecar to get to the top.
All students are divided into three groups: *r* of them like to ascend only in the red cablecars, *g* of them prefer only the green ones and *b* of them prefer only the blue ones. A student never gets on a cablecar painted a color that he doesn't like,
The first cablecar to arrive (at the moment of time 0) is painted red. Determine the least time it will take all students to ascend to the mountain top.
|
The first line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=100). It is guaranteed that *r*<=+<=*g*<=+<=*b*<=><=0, it means that the group consists of at least one student.
|
Print a single number — the minimal time the students need for the whole group to ascend to the top of the mountain.
|
[
"1 3 2\n",
"3 2 1\n"
] |
[
"34",
"33"
] |
Let's analyze the first sample.
At the moment of time 0 a red cablecar comes and one student from the *r* group get on it and ascends to the top at the moment of time 30.
At the moment of time 1 a green cablecar arrives and two students from the *g* group get on it; they get to the top at the moment of time 31.
At the moment of time 2 comes the blue cablecar and two students from the *b* group get on it. They ascend to the top at the moment of time 32.
At the moment of time 3 a red cablecar arrives but the only student who is left doesn't like red and the cablecar leaves empty.
At the moment of time 4 a green cablecar arrives and one student from the *g* group gets on it. He ascends to top at the moment of time 34.
Thus, all the students are on the top, overall the ascension took exactly 34 minutes.
| 500
|
[
{
"input": "1 3 2",
"output": "34"
},
{
"input": "3 2 1",
"output": "33"
},
{
"input": "3 5 2",
"output": "37"
},
{
"input": "10 10 10",
"output": "44"
},
{
"input": "29 7 24",
"output": "72"
},
{
"input": "28 94 13",
"output": "169"
},
{
"input": "90 89 73",
"output": "163"
},
{
"input": "0 0 1",
"output": "32"
},
{
"input": "0 0 2",
"output": "32"
},
{
"input": "0 1 0",
"output": "31"
},
{
"input": "0 1 1",
"output": "32"
},
{
"input": "0 1 2",
"output": "32"
},
{
"input": "0 2 0",
"output": "31"
},
{
"input": "0 2 1",
"output": "32"
},
{
"input": "0 2 2",
"output": "32"
},
{
"input": "1 0 0",
"output": "30"
},
{
"input": "1 0 1",
"output": "32"
},
{
"input": "1 0 2",
"output": "32"
},
{
"input": "1 1 0",
"output": "31"
},
{
"input": "1 1 1",
"output": "32"
},
{
"input": "1 1 2",
"output": "32"
},
{
"input": "1 2 0",
"output": "31"
},
{
"input": "1 2 1",
"output": "32"
},
{
"input": "1 2 2",
"output": "32"
},
{
"input": "2 0 0",
"output": "30"
},
{
"input": "2 0 1",
"output": "32"
},
{
"input": "2 0 2",
"output": "32"
},
{
"input": "2 1 0",
"output": "31"
},
{
"input": "2 1 1",
"output": "32"
},
{
"input": "2 1 2",
"output": "32"
},
{
"input": "2 2 0",
"output": "31"
},
{
"input": "2 2 1",
"output": "32"
},
{
"input": "2 2 2",
"output": "32"
},
{
"input": "4 5 2",
"output": "37"
},
{
"input": "5 7 8",
"output": "41"
},
{
"input": "13 25 19",
"output": "67"
},
{
"input": "29 28 30",
"output": "74"
},
{
"input": "45 52 48",
"output": "106"
},
{
"input": "68 72 58",
"output": "136"
},
{
"input": "89 92 90",
"output": "166"
},
{
"input": "99 97 98",
"output": "177"
},
{
"input": "89 97 2",
"output": "175"
},
{
"input": "96 3 92",
"output": "171"
},
{
"input": "1 99 87",
"output": "178"
},
{
"input": "95 2 3",
"output": "171"
},
{
"input": "2 97 3",
"output": "175"
},
{
"input": "2 2 99",
"output": "179"
},
{
"input": "100 100 100",
"output": "179"
},
{
"input": "100 0 100",
"output": "179"
},
{
"input": "0 100 100",
"output": "179"
},
{
"input": "100 100 0",
"output": "178"
},
{
"input": "100 0 0",
"output": "177"
},
{
"input": "0 100 0",
"output": "178"
},
{
"input": "0 0 100",
"output": "179"
},
{
"input": "5 4 5",
"output": "38"
}
] | 1,598,986,683
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 55
| 218
| 0
|
from math import ceil
a,b,c = map(int,input().split())
x,y,z = ceil(a/2),ceil(b/2),ceil(c/2)
maxi = max(x,y,z)
if maxi == z:
print(32+3*ceil((c-2)/2))
elif maxi == y:
print(31+3*ceil((b-2)/2))
elif maxi == x:
print(30+3*ceil((a-2)/2))
|
Title: Cableway
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A group of university students wants to get to the top of a mountain to have a picnic there. For that they decided to use a cableway.
A cableway is represented by some cablecars, hanged onto some cable stations by a cable. A cable is scrolled cyclically between the first and the last cable stations (the first of them is located at the bottom of the mountain and the last one is located at the top). As the cable moves, the cablecar attached to it move as well.
The number of cablecars is divisible by three and they are painted three colors: red, green and blue, in such manner that after each red cablecar goes a green one, after each green cablecar goes a blue one and after each blue cablecar goes a red one. Each cablecar can transport no more than two people, the cablecars arrive with the periodicity of one minute (i. e. every minute) and it takes exactly 30 minutes for a cablecar to get to the top.
All students are divided into three groups: *r* of them like to ascend only in the red cablecars, *g* of them prefer only the green ones and *b* of them prefer only the blue ones. A student never gets on a cablecar painted a color that he doesn't like,
The first cablecar to arrive (at the moment of time 0) is painted red. Determine the least time it will take all students to ascend to the mountain top.
Input Specification:
The first line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=100). It is guaranteed that *r*<=+<=*g*<=+<=*b*<=><=0, it means that the group consists of at least one student.
Output Specification:
Print a single number — the minimal time the students need for the whole group to ascend to the top of the mountain.
Demo Input:
['1 3 2\n', '3 2 1\n']
Demo Output:
['34', '33']
Note:
Let's analyze the first sample.
At the moment of time 0 a red cablecar comes and one student from the *r* group get on it and ascends to the top at the moment of time 30.
At the moment of time 1 a green cablecar arrives and two students from the *g* group get on it; they get to the top at the moment of time 31.
At the moment of time 2 comes the blue cablecar and two students from the *b* group get on it. They ascend to the top at the moment of time 32.
At the moment of time 3 a red cablecar arrives but the only student who is left doesn't like red and the cablecar leaves empty.
At the moment of time 4 a green cablecar arrives and one student from the *g* group gets on it. He ascends to top at the moment of time 34.
Thus, all the students are on the top, overall the ascension took exactly 34 minutes.
|
```python
from math import ceil
a,b,c = map(int,input().split())
x,y,z = ceil(a/2),ceil(b/2),ceil(c/2)
maxi = max(x,y,z)
if maxi == z:
print(32+3*ceil((c-2)/2))
elif maxi == y:
print(31+3*ceil((b-2)/2))
elif maxi == x:
print(30+3*ceil((a-2)/2))
```
| 3.9455
|
805
|
A
|
Fake NP
|
PROGRAMMING
| 1,000
|
[
"greedy",
"math"
] | null | null |
Tavak and Seyyed are good friends. Seyyed is very funny and he told Tavak to solve the following problem instead of longest-path.
You are given *l* and *r*. For all integers from *l* to *r*, inclusive, we wrote down all of their integer divisors except 1. Find the integer that we wrote down the maximum number of times.
Solve the problem to show that it's not a NP problem.
|
The first line contains two integers *l* and *r* (2<=≤<=*l*<=≤<=*r*<=≤<=109).
|
Print single integer, the integer that appears maximum number of times in the divisors.
If there are multiple answers, print any of them.
|
[
"19 29\n",
"3 6\n"
] |
[
"2\n",
"3\n"
] |
Definition of a divisor: [https://www.mathsisfun.com/definitions/divisor-of-an-integer-.html](https://www.mathsisfun.com/definitions/divisor-of-an-integer-.html)
The first example: from 19 to 29 these numbers are divisible by 2: {20, 22, 24, 26, 28}.
The second example: from 3 to 6 these numbers are divisible by 3: {3, 6}.
| 500
|
[
{
"input": "19 29",
"output": "2"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "39 91",
"output": "2"
},
{
"input": "76 134",
"output": "2"
},
{
"input": "93 95",
"output": "2"
},
{
"input": "17 35",
"output": "2"
},
{
"input": "94 95",
"output": "2"
},
{
"input": "51 52",
"output": "2"
},
{
"input": "47 52",
"output": "2"
},
{
"input": "38 98",
"output": "2"
},
{
"input": "30 37",
"output": "2"
},
{
"input": "56 92",
"output": "2"
},
{
"input": "900000000 1000000000",
"output": "2"
},
{
"input": "37622224 162971117",
"output": "2"
},
{
"input": "760632746 850720703",
"output": "2"
},
{
"input": "908580370 968054552",
"output": "2"
},
{
"input": "951594860 953554446",
"output": "2"
},
{
"input": "347877978 913527175",
"output": "2"
},
{
"input": "620769961 988145114",
"output": "2"
},
{
"input": "820844234 892579936",
"output": "2"
},
{
"input": "741254764 741254768",
"output": "2"
},
{
"input": "80270976 80270977",
"output": "2"
},
{
"input": "392602363 392602367",
"output": "2"
},
{
"input": "519002744 519002744",
"output": "519002744"
},
{
"input": "331900277 331900277",
"output": "331900277"
},
{
"input": "419873015 419873018",
"output": "2"
},
{
"input": "349533413 349533413",
"output": "349533413"
},
{
"input": "28829775 28829776",
"output": "2"
},
{
"input": "568814539 568814539",
"output": "568814539"
},
{
"input": "720270740 720270743",
"output": "2"
},
{
"input": "871232720 871232722",
"output": "2"
},
{
"input": "305693653 305693653",
"output": "305693653"
},
{
"input": "634097178 634097179",
"output": "2"
},
{
"input": "450868287 450868290",
"output": "2"
},
{
"input": "252662256 252662260",
"output": "2"
},
{
"input": "575062045 575062049",
"output": "2"
},
{
"input": "273072892 273072894",
"output": "2"
},
{
"input": "770439256 770439256",
"output": "770439256"
},
{
"input": "2 1000000000",
"output": "2"
},
{
"input": "6 8",
"output": "2"
},
{
"input": "2 879190747",
"output": "2"
},
{
"input": "5 5",
"output": "5"
},
{
"input": "999999937 999999937",
"output": "999999937"
},
{
"input": "3 3",
"output": "3"
},
{
"input": "5 100",
"output": "2"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 18",
"output": "2"
},
{
"input": "7 7",
"output": "7"
},
{
"input": "39916801 39916801",
"output": "39916801"
},
{
"input": "3 8",
"output": "2"
},
{
"input": "13 13",
"output": "13"
},
{
"input": "4 8",
"output": "2"
},
{
"input": "3 12",
"output": "2"
},
{
"input": "6 12",
"output": "2"
},
{
"input": "999999103 999999103",
"output": "999999103"
},
{
"input": "100000007 100000007",
"output": "100000007"
},
{
"input": "3 99",
"output": "2"
},
{
"input": "999999733 999999733",
"output": "999999733"
},
{
"input": "5 10",
"output": "2"
},
{
"input": "982451653 982451653",
"output": "982451653"
},
{
"input": "999900001 1000000000",
"output": "2"
},
{
"input": "999727999 999727999",
"output": "999727999"
},
{
"input": "2 999999999",
"output": "2"
},
{
"input": "242 244",
"output": "2"
},
{
"input": "3 10",
"output": "2"
},
{
"input": "15 27",
"output": "2"
},
{
"input": "998244353 998244353",
"output": "998244353"
},
{
"input": "5 15",
"output": "2"
},
{
"input": "999999797 999999797",
"output": "999999797"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "999999929 999999929",
"output": "999999929"
},
{
"input": "3 111111",
"output": "2"
},
{
"input": "12 18",
"output": "2"
},
{
"input": "479001599 479001599",
"output": "479001599"
},
{
"input": "10000019 10000019",
"output": "10000019"
},
{
"input": "715827883 715827883",
"output": "715827883"
},
{
"input": "999992977 999992977",
"output": "999992977"
},
{
"input": "11 11",
"output": "11"
},
{
"input": "29 29",
"output": "29"
},
{
"input": "1000003 1000003",
"output": "1000003"
},
{
"input": "6 15",
"output": "2"
},
{
"input": "1200007 1200007",
"output": "1200007"
},
{
"input": "3 1000000000",
"output": "2"
},
{
"input": "990000023 990000023",
"output": "990000023"
},
{
"input": "1717 1717",
"output": "1717"
},
{
"input": "141650963 141650963",
"output": "141650963"
},
{
"input": "1002523 1002523",
"output": "1002523"
},
{
"input": "900000011 900000011",
"output": "900000011"
},
{
"input": "104729 104729",
"output": "104729"
},
{
"input": "4 12",
"output": "2"
},
{
"input": "100003 100003",
"output": "100003"
},
{
"input": "17 17",
"output": "17"
},
{
"input": "10 100",
"output": "2"
}
] | 1,614,505,971
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 62
| 0
|
l, r = map(int, input().split())
m = []
dict = {}
for i in range(l, r + 1):
for k in range(2, i + 1):
if i % k == 0:
m.append(k)
for i in set(m):
dict[i] = m.count(i)
print(dict.get(max(dict.values())))
|
Title: Fake NP
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Tavak and Seyyed are good friends. Seyyed is very funny and he told Tavak to solve the following problem instead of longest-path.
You are given *l* and *r*. For all integers from *l* to *r*, inclusive, we wrote down all of their integer divisors except 1. Find the integer that we wrote down the maximum number of times.
Solve the problem to show that it's not a NP problem.
Input Specification:
The first line contains two integers *l* and *r* (2<=≤<=*l*<=≤<=*r*<=≤<=109).
Output Specification:
Print single integer, the integer that appears maximum number of times in the divisors.
If there are multiple answers, print any of them.
Demo Input:
['19 29\n', '3 6\n']
Demo Output:
['2\n', '3\n']
Note:
Definition of a divisor: [https://www.mathsisfun.com/definitions/divisor-of-an-integer-.html](https://www.mathsisfun.com/definitions/divisor-of-an-integer-.html)
The first example: from 19 to 29 these numbers are divisible by 2: {20, 22, 24, 26, 28}.
The second example: from 3 to 6 these numbers are divisible by 3: {3, 6}.
|
```python
l, r = map(int, input().split())
m = []
dict = {}
for i in range(l, r + 1):
for k in range(2, i + 1):
if i % k == 0:
m.append(k)
for i in set(m):
dict[i] = m.count(i)
print(dict.get(max(dict.values())))
```
| 0
|
|
239
|
A
|
Two Bags of Potatoes
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation",
"math"
] | null | null |
Valera had two bags of potatoes, the first of these bags contains *x* (*x*<=≥<=1) potatoes, and the second — *y* (*y*<=≥<=1) potatoes. Valera — very scattered boy, so the first bag of potatoes (it contains *x* potatoes) Valera lost. Valera remembers that the total amount of potatoes (*x*<=+<=*y*) in the two bags, firstly, was not gerater than *n*, and, secondly, was divisible by *k*.
Help Valera to determine how many potatoes could be in the first bag. Print all such possible numbers in ascending order.
|
The first line of input contains three integers *y*, *k*, *n* (1<=≤<=*y*,<=*k*,<=*n*<=≤<=109; <=≤<=105).
|
Print the list of whitespace-separated integers — all possible values of *x* in ascending order. You should print each possible value of *x* exactly once.
If there are no such values of *x* print a single integer -1.
|
[
"10 1 10\n",
"10 6 40\n"
] |
[
"-1\n",
"2 8 14 20 26 \n"
] |
none
| 500
|
[
{
"input": "10 1 10",
"output": "-1"
},
{
"input": "10 6 40",
"output": "2 8 14 20 26 "
},
{
"input": "10 1 20",
"output": "1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "1 10000 1000000000",
"output": "9999 19999 29999 39999 49999 59999 69999 79999 89999 99999 109999 119999 129999 139999 149999 159999 169999 179999 189999 199999 209999 219999 229999 239999 249999 259999 269999 279999 289999 299999 309999 319999 329999 339999 349999 359999 369999 379999 389999 399999 409999 419999 429999 439999 449999 459999 469999 479999 489999 499999 509999 519999 529999 539999 549999 559999 569999 579999 589999 599999 609999 619999 629999 639999 649999 659999 669999 679999 689999 699999 709999 719999 729999 739999 7499..."
},
{
"input": "84817 1 33457",
"output": "-1"
},
{
"input": "21 37 99",
"output": "16 53 "
},
{
"input": "78 7 15",
"output": "-1"
},
{
"input": "74 17 27",
"output": "-1"
},
{
"input": "79 23 43",
"output": "-1"
},
{
"input": "32 33 3",
"output": "-1"
},
{
"input": "55 49 44",
"output": "-1"
},
{
"input": "64 59 404",
"output": "54 113 172 231 290 "
},
{
"input": "61 69 820",
"output": "8 77 146 215 284 353 422 491 560 629 698 "
},
{
"input": "17 28 532",
"output": "11 39 67 95 123 151 179 207 235 263 291 319 347 375 403 431 459 487 515 "
},
{
"input": "46592 52 232",
"output": "-1"
},
{
"input": "1541 58 648",
"output": "-1"
},
{
"input": "15946 76 360",
"output": "-1"
},
{
"input": "30351 86 424",
"output": "-1"
},
{
"input": "1 2 37493",
"output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161 163 165 167 169 171 173 175 177 179 181 183 185 187 189 191 193 195 197 199 201 203 205 207 209 211 213 215 217 219 221 223 225 227 229 231 233 235 237 239 241 243 245 247 249 251 253 255 257 259 261 263 265 267 269 271 273 275 277 279 281 28..."
},
{
"input": "1 3 27764",
"output": "2 5 8 11 14 17 20 23 26 29 32 35 38 41 44 47 50 53 56 59 62 65 68 71 74 77 80 83 86 89 92 95 98 101 104 107 110 113 116 119 122 125 128 131 134 137 140 143 146 149 152 155 158 161 164 167 170 173 176 179 182 185 188 191 194 197 200 203 206 209 212 215 218 221 224 227 230 233 236 239 242 245 248 251 254 257 260 263 266 269 272 275 278 281 284 287 290 293 296 299 302 305 308 311 314 317 320 323 326 329 332 335 338 341 344 347 350 353 356 359 362 365 368 371 374 377 380 383 386 389 392 395 398 401 404 407 410..."
},
{
"input": "10 4 9174",
"output": "2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 102 106 110 114 118 122 126 130 134 138 142 146 150 154 158 162 166 170 174 178 182 186 190 194 198 202 206 210 214 218 222 226 230 234 238 242 246 250 254 258 262 266 270 274 278 282 286 290 294 298 302 306 310 314 318 322 326 330 334 338 342 346 350 354 358 362 366 370 374 378 382 386 390 394 398 402 406 410 414 418 422 426 430 434 438 442 446 450 454 458 462 466 470 474 478 482 486 490 494 498 502 506 510 514 518 522 526 530 534 53..."
},
{
"input": "33 7 4971",
"output": "2 9 16 23 30 37 44 51 58 65 72 79 86 93 100 107 114 121 128 135 142 149 156 163 170 177 184 191 198 205 212 219 226 233 240 247 254 261 268 275 282 289 296 303 310 317 324 331 338 345 352 359 366 373 380 387 394 401 408 415 422 429 436 443 450 457 464 471 478 485 492 499 506 513 520 527 534 541 548 555 562 569 576 583 590 597 604 611 618 625 632 639 646 653 660 667 674 681 688 695 702 709 716 723 730 737 744 751 758 765 772 779 786 793 800 807 814 821 828 835 842 849 856 863 870 877 884 891 898 905 912 919..."
},
{
"input": "981 1 3387",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "386 1 2747",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "123 2 50000",
"output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161 163 165 167 169 171 173 175 177 179 181 183 185 187 189 191 193 195 197 199 201 203 205 207 209 211 213 215 217 219 221 223 225 227 229 231 233 235 237 239 241 243 245 247 249 251 253 255 257 259 261 263 265 267 269 271 273 275 277 279 281 28..."
},
{
"input": "3123 100 10000000",
"output": "77 177 277 377 477 577 677 777 877 977 1077 1177 1277 1377 1477 1577 1677 1777 1877 1977 2077 2177 2277 2377 2477 2577 2677 2777 2877 2977 3077 3177 3277 3377 3477 3577 3677 3777 3877 3977 4077 4177 4277 4377 4477 4577 4677 4777 4877 4977 5077 5177 5277 5377 5477 5577 5677 5777 5877 5977 6077 6177 6277 6377 6477 6577 6677 6777 6877 6977 7077 7177 7277 7377 7477 7577 7677 7777 7877 7977 8077 8177 8277 8377 8477 8577 8677 8777 8877 8977 9077 9177 9277 9377 9477 9577 9677 9777 9877 9977 10077 10177 10277 1037..."
},
{
"input": "2 10000 1000000000",
"output": "9998 19998 29998 39998 49998 59998 69998 79998 89998 99998 109998 119998 129998 139998 149998 159998 169998 179998 189998 199998 209998 219998 229998 239998 249998 259998 269998 279998 289998 299998 309998 319998 329998 339998 349998 359998 369998 379998 389998 399998 409998 419998 429998 439998 449998 459998 469998 479998 489998 499998 509998 519998 529998 539998 549998 559998 569998 579998 589998 599998 609998 619998 629998 639998 649998 659998 669998 679998 689998 699998 709998 719998 729998 739998 7499..."
},
{
"input": "3 10000 1000000000",
"output": "9997 19997 29997 39997 49997 59997 69997 79997 89997 99997 109997 119997 129997 139997 149997 159997 169997 179997 189997 199997 209997 219997 229997 239997 249997 259997 269997 279997 289997 299997 309997 319997 329997 339997 349997 359997 369997 379997 389997 399997 409997 419997 429997 439997 449997 459997 469997 479997 489997 499997 509997 519997 529997 539997 549997 559997 569997 579997 589997 599997 609997 619997 629997 639997 649997 659997 669997 679997 689997 699997 709997 719997 729997 739997 7499..."
},
{
"input": "12312223 10000 1000000000",
"output": "7777 17777 27777 37777 47777 57777 67777 77777 87777 97777 107777 117777 127777 137777 147777 157777 167777 177777 187777 197777 207777 217777 227777 237777 247777 257777 267777 277777 287777 297777 307777 317777 327777 337777 347777 357777 367777 377777 387777 397777 407777 417777 427777 437777 447777 457777 467777 477777 487777 497777 507777 517777 527777 537777 547777 557777 567777 577777 587777 597777 607777 617777 627777 637777 647777 657777 667777 677777 687777 697777 707777 717777 727777 737777 7477..."
},
{
"input": "500000000 1000000000 1000000000",
"output": "500000000 "
},
{
"input": "1 1000000000 1000000000",
"output": "999999999 "
},
{
"input": "10 6 11",
"output": "-1"
},
{
"input": "2 100 10",
"output": "-1"
},
{
"input": "1 100000007 1000000000",
"output": "100000006 200000013 300000020 400000027 500000034 600000041 700000048 800000055 900000062 "
},
{
"input": "1 999999999 1000000000",
"output": "999999998 "
},
{
"input": "100000000 1000000000 1000000000",
"output": "900000000 "
},
{
"input": "11 2 12",
"output": "1 "
},
{
"input": "31 10 39",
"output": "-1"
},
{
"input": "48 6 50",
"output": "-1"
},
{
"input": "500000000 500000000 1000000000",
"output": "500000000 "
},
{
"input": "1 1000000000 999999999",
"output": "-1"
},
{
"input": "4 2 10",
"output": "2 4 6 "
},
{
"input": "1000000000 1 1",
"output": "-1"
},
{
"input": "1000000000 1 100000",
"output": "-1"
},
{
"input": "1000000000 1 10",
"output": "-1"
},
{
"input": "10 5 14",
"output": "-1"
},
{
"input": "500000000 499999999 1000000000",
"output": "499999998 "
},
{
"input": "1 999999997 1000000000",
"output": "999999996 "
}
] | 1,602,962,385
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 216
| 0
|
def two_bags():
info = list(map(int,input().split()))
k = info[1]
posible = []
while k < info[2]:
if k>info[0]:
posible.append(k-info[0])
k += info[1]
if len(posible)== 0:
print(-1)
else:
for valor in posible:
print(valor, end=" ")
two_bags()
|
Title: Two Bags of Potatoes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera had two bags of potatoes, the first of these bags contains *x* (*x*<=≥<=1) potatoes, and the second — *y* (*y*<=≥<=1) potatoes. Valera — very scattered boy, so the first bag of potatoes (it contains *x* potatoes) Valera lost. Valera remembers that the total amount of potatoes (*x*<=+<=*y*) in the two bags, firstly, was not gerater than *n*, and, secondly, was divisible by *k*.
Help Valera to determine how many potatoes could be in the first bag. Print all such possible numbers in ascending order.
Input Specification:
The first line of input contains three integers *y*, *k*, *n* (1<=≤<=*y*,<=*k*,<=*n*<=≤<=109; <=≤<=105).
Output Specification:
Print the list of whitespace-separated integers — all possible values of *x* in ascending order. You should print each possible value of *x* exactly once.
If there are no such values of *x* print a single integer -1.
Demo Input:
['10 1 10\n', '10 6 40\n']
Demo Output:
['-1\n', '2 8 14 20 26 \n']
Note:
none
|
```python
def two_bags():
info = list(map(int,input().split()))
k = info[1]
posible = []
while k < info[2]:
if k>info[0]:
posible.append(k-info[0])
k += info[1]
if len(posible)== 0:
print(-1)
else:
for valor in posible:
print(valor, end=" ")
two_bags()
```
| 0
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,688,391,178
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 31
| 0
|
string = input()
lst = []
for letter in string:
if letter not in lst:
lst.append(letter)
if len(lst)<(len(string)-1):
print("YES")
else:
print("NO")
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
string = input()
lst = []
for letter in string:
if letter not in lst:
lst.append(letter)
if len(lst)<(len(string)-1):
print("YES")
else:
print("NO")
```
| 0
|
257
|
B
|
Playing Cubes
|
PROGRAMMING
| 1,300
|
[
"games",
"greedy",
"implementation"
] | null | null |
Petya and Vasya decided to play a little. They found *n* red cubes and *m* blue cubes. The game goes like that: the players take turns to choose a cube of some color (red or blue) and put it in a line from left to right (overall the line will have *n*<=+<=*m* cubes). Petya moves first. Petya's task is to get as many pairs of neighbouring cubes of the same color as possible. Vasya's task is to get as many pairs of neighbouring cubes of different colors as possible.
The number of Petya's points in the game is the number of pairs of neighboring cubes of the same color in the line, the number of Vasya's points in the game is the number of neighbouring cubes of the different color in the line. Your task is to calculate the score at the end of the game (Petya's and Vasya's points, correspondingly), if both boys are playing optimally well. To "play optimally well" first of all means to maximize the number of one's points, and second — to minimize the number of the opponent's points.
|
The only line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the number of red and blue cubes, correspondingly.
|
On a single line print two space-separated integers — the number of Petya's and Vasya's points correspondingly provided that both players play optimally well.
|
[
"3 1\n",
"2 4\n"
] |
[
"2 1\n",
"3 2\n"
] |
In the first test sample the optimal strategy for Petya is to put the blue cube in the line. After that there will be only red cubes left, so by the end of the game the line of cubes from left to right will look as [blue, red, red, red]. So, Petya gets 2 points and Vasya gets 1 point.
If Petya would choose the red cube during his first move, then, provided that both boys play optimally well, Petya would get 1 point and Vasya would get 2 points.
| 500
|
[
{
"input": "3 1",
"output": "2 1"
},
{
"input": "2 4",
"output": "3 2"
},
{
"input": "1 1",
"output": "0 1"
},
{
"input": "2 1",
"output": "1 1"
},
{
"input": "4 4",
"output": "3 4"
},
{
"input": "10 7",
"output": "9 7"
},
{
"input": "5 13",
"output": "12 5"
},
{
"input": "7 11",
"output": "10 7"
},
{
"input": "1 2",
"output": "1 1"
},
{
"input": "10 10",
"output": "9 10"
},
{
"input": "50 30",
"output": "49 30"
},
{
"input": "80 120",
"output": "119 80"
},
{
"input": "304 122",
"output": "303 122"
},
{
"input": "500 800",
"output": "799 500"
},
{
"input": "900 1000",
"output": "999 900"
},
{
"input": "1 1000",
"output": "999 1"
},
{
"input": "997 9",
"output": "996 9"
},
{
"input": "341 678",
"output": "677 341"
},
{
"input": "784 913",
"output": "912 784"
},
{
"input": "57 888",
"output": "887 57"
},
{
"input": "100000 100000",
"output": "99999 100000"
},
{
"input": "10000 100000",
"output": "99999 10000"
},
{
"input": "9999 99999",
"output": "99998 9999"
},
{
"input": "12 100000",
"output": "99999 12"
},
{
"input": "9999 31411",
"output": "31410 9999"
},
{
"input": "12930 98391",
"output": "98390 12930"
},
{
"input": "98813 893",
"output": "98812 893"
},
{
"input": "99801 38179",
"output": "99800 38179"
},
{
"input": "831 69318",
"output": "69317 831"
},
{
"input": "99999 99997",
"output": "99998 99997"
},
{
"input": "74 99",
"output": "98 74"
},
{
"input": "159 259",
"output": "258 159"
},
{
"input": "245 317",
"output": "316 245"
},
{
"input": "947 883",
"output": "946 883"
},
{
"input": "7131 3165",
"output": "7130 3165"
},
{
"input": "11536 12192",
"output": "12191 11536"
},
{
"input": "25938 40897",
"output": "40896 25938"
},
{
"input": "81314 31958",
"output": "81313 31958"
},
{
"input": "294 83621",
"output": "83620 294"
},
{
"input": "64896 18105",
"output": "64895 18105"
}
] | 1,662,147,850
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 404
| 135,270,400
|
from collections import defaultdict, deque
from functools import lru_cache
from heapq import heappush, heappop
from typing import Counter
import math
hpop = heappop
hpush = heappush
"""
num = int(input())
arr = list(map(int, input().split()))
a,b = map(int, input().split())
graph = defaultdict(list)
for i in range(#)
graph[a].append(b)
graph[b].append(a)
MOD = 10**9 + 7
"""
def solution():
def dp(start,m,n):
same_count = 0
cur = start
i = 1
while m > 0 and n > 0:
cur = not cur if i % 2 else cur
same_count += (i % 2 == 0)
i += 1
if cur:
m -= 1
else:
n -= 1
if m:
same_count += m - 1 + (cur == True)
if n:
same_count += n - 1 + (cur == False)
return same_count
m,n = map(int, input().split())
res = max(dp(True,m-1,n), dp(False,m,n-1))
print(res, m+n-1-res)
def main():
t = 1
#t = int(input())
# n + 1 diffrences
for _ in range(t):
solution()
import sys
import threading
sys.setrecursionlimit(1 << 30)
threading.stack_size(1 << 27)
thread = threading.Thread(target=main)
thread.start(); thread.join()
#main()
|
Title: Playing Cubes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya and Vasya decided to play a little. They found *n* red cubes and *m* blue cubes. The game goes like that: the players take turns to choose a cube of some color (red or blue) and put it in a line from left to right (overall the line will have *n*<=+<=*m* cubes). Petya moves first. Petya's task is to get as many pairs of neighbouring cubes of the same color as possible. Vasya's task is to get as many pairs of neighbouring cubes of different colors as possible.
The number of Petya's points in the game is the number of pairs of neighboring cubes of the same color in the line, the number of Vasya's points in the game is the number of neighbouring cubes of the different color in the line. Your task is to calculate the score at the end of the game (Petya's and Vasya's points, correspondingly), if both boys are playing optimally well. To "play optimally well" first of all means to maximize the number of one's points, and second — to minimize the number of the opponent's points.
Input Specification:
The only line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the number of red and blue cubes, correspondingly.
Output Specification:
On a single line print two space-separated integers — the number of Petya's and Vasya's points correspondingly provided that both players play optimally well.
Demo Input:
['3 1\n', '2 4\n']
Demo Output:
['2 1\n', '3 2\n']
Note:
In the first test sample the optimal strategy for Petya is to put the blue cube in the line. After that there will be only red cubes left, so by the end of the game the line of cubes from left to right will look as [blue, red, red, red]. So, Petya gets 2 points and Vasya gets 1 point.
If Petya would choose the red cube during his first move, then, provided that both boys play optimally well, Petya would get 1 point and Vasya would get 2 points.
|
```python
from collections import defaultdict, deque
from functools import lru_cache
from heapq import heappush, heappop
from typing import Counter
import math
hpop = heappop
hpush = heappush
"""
num = int(input())
arr = list(map(int, input().split()))
a,b = map(int, input().split())
graph = defaultdict(list)
for i in range(#)
graph[a].append(b)
graph[b].append(a)
MOD = 10**9 + 7
"""
def solution():
def dp(start,m,n):
same_count = 0
cur = start
i = 1
while m > 0 and n > 0:
cur = not cur if i % 2 else cur
same_count += (i % 2 == 0)
i += 1
if cur:
m -= 1
else:
n -= 1
if m:
same_count += m - 1 + (cur == True)
if n:
same_count += n - 1 + (cur == False)
return same_count
m,n = map(int, input().split())
res = max(dp(True,m-1,n), dp(False,m,n-1))
print(res, m+n-1-res)
def main():
t = 1
#t = int(input())
# n + 1 diffrences
for _ in range(t):
solution()
import sys
import threading
sys.setrecursionlimit(1 << 30)
threading.stack_size(1 << 27)
thread = threading.Thread(target=main)
thread.start(); thread.join()
#main()
```
| 3
|
|
432
|
A
|
Choosing Teams
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
|
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
|
Print a single number — the answer to the problem.
|
[
"5 2\n0 4 5 1 0\n",
"6 4\n0 1 2 3 4 5\n",
"6 5\n0 0 0 0 0 0\n"
] |
[
"1\n",
"0\n",
"2\n"
] |
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
| 500
|
[
{
"input": "5 2\n0 4 5 1 0",
"output": "1"
},
{
"input": "6 4\n0 1 2 3 4 5",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "3 4\n0 1 0",
"output": "1"
},
{
"input": "3 4\n0 2 0",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "12 2\n0 1 2 3 4 0 1 2 3 4 0 1",
"output": "3"
},
{
"input": "15 2\n0 1 2 3 4 0 1 2 3 4 0 1 2 3 4",
"output": "4"
},
{
"input": "13 1\n5 0 5 0 1 5 0 4 1 1 1 4 1",
"output": "3"
},
{
"input": "20 1\n5 0 4 2 2 3 2 1 2 4 1 3 5 5 5 4 4 1 3 0",
"output": "5"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "6 3\n4 4 4 4 4 4",
"output": "0"
},
{
"input": "1 4\n1",
"output": "0"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "2 3\n0 0",
"output": "0"
}
] | 1,667,394,822
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 35
| 61
| 1,638,400
|
nk = list(map(int, input().split()))
n = nk[0]
k = nk[1]
count = 0
y = list(map(int, input().split()))
for i in y:
if k + i <= 5:
count += 1
print(count // 3)
|
Title: Choosing Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
Input Specification:
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['5 2\n0 4 5 1 0\n', '6 4\n0 1 2 3 4 5\n', '6 5\n0 0 0 0 0 0\n']
Demo Output:
['1\n', '0\n', '2\n']
Note:
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
|
```python
nk = list(map(int, input().split()))
n = nk[0]
k = nk[1]
count = 0
y = list(map(int, input().split()))
for i in y:
if k + i <= 5:
count += 1
print(count // 3)
```
| 3
|
|
597
|
C
|
Subsequences
|
PROGRAMMING
| 1,900
|
[
"data structures",
"dp"
] | null | null |
For the given sequence with *n* different elements find the number of increasing subsequences with *k*<=+<=1 elements. It is guaranteed that the answer is not greater than 8·1018.
|
First line contain two integer values *n* and *k* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*k*<=≤<=10) — the length of sequence and the number of elements in increasing subsequences.
Next *n* lines contains one integer *a**i* (1<=≤<=*a**i*<=≤<=*n*) each — elements of sequence. All values *a**i* are different.
|
Print one integer — the answer to the problem.
|
[
"5 2\n1\n2\n3\n5\n4\n"
] |
[
"7\n"
] |
none
| 1,500
|
[
{
"input": "5 2\n1\n2\n3\n5\n4",
"output": "7"
},
{
"input": "1 0\n1",
"output": "1"
},
{
"input": "2 1\n1\n2",
"output": "1"
},
{
"input": "2 1\n2\n1",
"output": "0"
},
{
"input": "3 2\n1\n2\n3",
"output": "1"
},
{
"input": "3 1\n1\n3\n2",
"output": "2"
},
{
"input": "3 1\n2\n1\n3",
"output": "2"
},
{
"input": "3 1\n2\n3\n1",
"output": "1"
},
{
"input": "3 1\n3\n1\n2",
"output": "1"
},
{
"input": "3 2\n3\n2\n1",
"output": "0"
},
{
"input": "10 2\n6\n10\n9\n7\n1\n2\n8\n5\n4\n3",
"output": "5"
},
{
"input": "100 7\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10\n11\n12\n13\n14\n15\n16\n17\n18\n19\n20\n21\n22\n23\n24\n25\n26\n27\n28\n29\n30\n31\n32\n33\n34\n35\n36\n37\n38\n39\n40\n41\n42\n43\n44\n45\n46\n47\n48\n49\n50\n51\n52\n53\n54\n55\n56\n57\n58\n59\n60\n61\n62\n63\n64\n65\n66\n67\n68\n69\n70\n71\n72\n73\n74\n75\n76\n77\n78\n79\n80\n81\n82\n83\n84\n85\n86\n87\n88\n89\n90\n91\n92\n93\n94\n95\n96\n97\n98\n99\n100",
"output": "186087894300"
}
] | 1,449,617,736
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 17
| 1,000
| 2,150,400
|
def solve (a, p, n, k):
for i in range(n - 1):
for j in range(i + 1, n):
if a[i] < a[j]:
for m in range(k):
p[j][m + 1] += p[i][m]
cnt = 0
for i in range(n):
cnt += p[i][k]
return cnt
n, k = map(int, input().split())
a = [0] * n
p = [0] * n
for i in range(n):
a[i] = int(input())
p[i] = [0] * (k + 1)
# ������������� ���-�� ������� ������ 1,
#�������������� �� i-�� ��-��
p[i][0] = 1
print (str(solve(a, p, n, k)))
|
Title: Subsequences
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
For the given sequence with *n* different elements find the number of increasing subsequences with *k*<=+<=1 elements. It is guaranteed that the answer is not greater than 8·1018.
Input Specification:
First line contain two integer values *n* and *k* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*k*<=≤<=10) — the length of sequence and the number of elements in increasing subsequences.
Next *n* lines contains one integer *a**i* (1<=≤<=*a**i*<=≤<=*n*) each — elements of sequence. All values *a**i* are different.
Output Specification:
Print one integer — the answer to the problem.
Demo Input:
['5 2\n1\n2\n3\n5\n4\n']
Demo Output:
['7\n']
Note:
none
|
```python
def solve (a, p, n, k):
for i in range(n - 1):
for j in range(i + 1, n):
if a[i] < a[j]:
for m in range(k):
p[j][m + 1] += p[i][m]
cnt = 0
for i in range(n):
cnt += p[i][k]
return cnt
n, k = map(int, input().split())
a = [0] * n
p = [0] * n
for i in range(n):
a[i] = int(input())
p[i] = [0] * (k + 1)
# ������������� ���-�� ������� ������ 1,
#�������������� �� i-�� ��-��
p[i][0] = 1
print (str(solve(a, p, n, k)))
```
| 0
|
|
245
|
A
|
System Administrator
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Polycarpus is a system administrator. There are two servers under his strict guidance — *a* and *b*. To stay informed about the servers' performance, Polycarpus executes commands "ping a" and "ping b". Each ping command sends exactly ten packets to the server specified in the argument of the command. Executing a program results in two integers *x* and *y* (*x*<=+<=*y*<==<=10; *x*,<=*y*<=≥<=0). These numbers mean that *x* packets successfully reached the corresponding server through the network and *y* packets were lost.
Today Polycarpus has performed overall *n* ping commands during his workday. Now for each server Polycarpus wants to know whether the server is "alive" or not. Polycarpus thinks that the server is "alive", if at least half of the packets that we send to this server reached it successfully along the network.
Help Polycarpus, determine for each server, whether it is "alive" or not by the given commands and their results.
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of commands Polycarpus has fulfilled. Each of the following *n* lines contains three integers — the description of the commands. The *i*-th of these lines contains three space-separated integers *t**i*, *x**i*, *y**i* (1<=≤<=*t**i*<=≤<=2; *x**i*,<=*y**i*<=≥<=0; *x**i*<=+<=*y**i*<==<=10). If *t**i*<==<=1, then the *i*-th command is "ping a", otherwise the *i*-th command is "ping b". Numbers *x**i*, *y**i* represent the result of executing this command, that is, *x**i* packets reached the corresponding server successfully and *y**i* packets were lost.
It is guaranteed that the input has at least one "ping a" command and at least one "ping b" command.
|
In the first line print string "LIVE" (without the quotes) if server *a* is "alive", otherwise print "DEAD" (without the quotes).
In the second line print the state of server *b* in the similar format.
|
[
"2\n1 5 5\n2 6 4\n",
"3\n1 0 10\n2 0 10\n1 10 0\n"
] |
[
"LIVE\nLIVE\n",
"LIVE\nDEAD\n"
] |
Consider the first test case. There 10 packets were sent to server *a*, 5 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network. Overall there were 10 packets sent to server *b*, 6 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network.
Consider the second test case. There were overall 20 packages sent to server *a*, 10 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network. Overall 10 packets were sent to server *b*, 0 of them reached it. Therefore, less than half of all packets sent to this server successfully reached it through the network.
| 0
|
[
{
"input": "2\n1 5 5\n2 6 4",
"output": "LIVE\nLIVE"
},
{
"input": "3\n1 0 10\n2 0 10\n1 10 0",
"output": "LIVE\nDEAD"
},
{
"input": "10\n1 3 7\n2 4 6\n1 2 8\n2 5 5\n2 10 0\n2 10 0\n1 8 2\n2 2 8\n2 10 0\n1 1 9",
"output": "DEAD\nLIVE"
},
{
"input": "11\n1 8 2\n1 6 4\n1 9 1\n1 7 3\n2 0 10\n2 0 10\n1 8 2\n2 2 8\n2 6 4\n2 7 3\n2 9 1",
"output": "LIVE\nDEAD"
},
{
"input": "12\n1 5 5\n1 0 10\n1 4 6\n1 2 8\n1 2 8\n1 5 5\n1 9 1\n2 9 1\n1 5 5\n1 1 9\n2 9 1\n2 7 3",
"output": "DEAD\nLIVE"
},
{
"input": "13\n1 8 2\n1 4 6\n1 5 5\n1 5 5\n2 10 0\n2 9 1\n1 3 7\n2 6 4\n2 6 4\n2 5 5\n1 7 3\n2 3 7\n2 9 1",
"output": "LIVE\nLIVE"
},
{
"input": "14\n1 7 3\n1 0 10\n1 7 3\n1 1 9\n2 2 8\n2 0 10\n1 1 9\n2 8 2\n2 6 4\n1 3 7\n1 3 7\n2 6 4\n2 1 9\n2 7 3",
"output": "DEAD\nDEAD"
}
] | 1,698,708,407
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 62
| 0
|
n = int(input())
l1 = [0,0]
l2 = [0,0]
for _ in range(n):
a,s,f = map(int,input().split())
if a == 1:
l1[0] += s
l1[1] += f
elif a == 2:
l2[0] += s
l2[1] += f
if l1[0]/l1[1] >= 0.5:
print("LIVE")
else:
print("DEAD")
if l2[0]/l2[1] >= 0.5:
print("LIVE")
else:
print("DEA")
|
Title: System Administrator
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus is a system administrator. There are two servers under his strict guidance — *a* and *b*. To stay informed about the servers' performance, Polycarpus executes commands "ping a" and "ping b". Each ping command sends exactly ten packets to the server specified in the argument of the command. Executing a program results in two integers *x* and *y* (*x*<=+<=*y*<==<=10; *x*,<=*y*<=≥<=0). These numbers mean that *x* packets successfully reached the corresponding server through the network and *y* packets were lost.
Today Polycarpus has performed overall *n* ping commands during his workday. Now for each server Polycarpus wants to know whether the server is "alive" or not. Polycarpus thinks that the server is "alive", if at least half of the packets that we send to this server reached it successfully along the network.
Help Polycarpus, determine for each server, whether it is "alive" or not by the given commands and their results.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of commands Polycarpus has fulfilled. Each of the following *n* lines contains three integers — the description of the commands. The *i*-th of these lines contains three space-separated integers *t**i*, *x**i*, *y**i* (1<=≤<=*t**i*<=≤<=2; *x**i*,<=*y**i*<=≥<=0; *x**i*<=+<=*y**i*<==<=10). If *t**i*<==<=1, then the *i*-th command is "ping a", otherwise the *i*-th command is "ping b". Numbers *x**i*, *y**i* represent the result of executing this command, that is, *x**i* packets reached the corresponding server successfully and *y**i* packets were lost.
It is guaranteed that the input has at least one "ping a" command and at least one "ping b" command.
Output Specification:
In the first line print string "LIVE" (without the quotes) if server *a* is "alive", otherwise print "DEAD" (without the quotes).
In the second line print the state of server *b* in the similar format.
Demo Input:
['2\n1 5 5\n2 6 4\n', '3\n1 0 10\n2 0 10\n1 10 0\n']
Demo Output:
['LIVE\nLIVE\n', 'LIVE\nDEAD\n']
Note:
Consider the first test case. There 10 packets were sent to server *a*, 5 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network. Overall there were 10 packets sent to server *b*, 6 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network.
Consider the second test case. There were overall 20 packages sent to server *a*, 10 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network. Overall 10 packets were sent to server *b*, 0 of them reached it. Therefore, less than half of all packets sent to this server successfully reached it through the network.
|
```python
n = int(input())
l1 = [0,0]
l2 = [0,0]
for _ in range(n):
a,s,f = map(int,input().split())
if a == 1:
l1[0] += s
l1[1] += f
elif a == 2:
l2[0] += s
l2[1] += f
if l1[0]/l1[1] >= 0.5:
print("LIVE")
else:
print("DEAD")
if l2[0]/l2[1] >= 0.5:
print("LIVE")
else:
print("DEA")
```
| 0
|
|
515
|
C
|
Drazil and Factorial
|
PROGRAMMING
| 1,400
|
[
"greedy",
"math",
"sortings"
] | null | null |
Drazil is playing a math game with Varda.
Let's define for positive integer *x* as a product of factorials of its digits. For example, .
First, they choose a decimal number *a* consisting of *n* digits that contains at least one digit larger than 1. This number may possibly start with leading zeroes. Then they should find maximum positive number *x* satisfying following two conditions:
1. *x* doesn't contain neither digit 0 nor digit 1.
2. = .
Help friends find such number.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=15) — the number of digits in *a*.
The second line contains *n* digits of *a*. There is at least one digit in *a* that is larger than 1. Number *a* may possibly contain leading zeroes.
|
Output a maximum possible integer satisfying the conditions above. There should be no zeroes and ones in this number decimal representation.
|
[
"4\n1234\n",
"3\n555\n"
] |
[
"33222\n",
"555\n"
] |
In the first case, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f5a4207f23215fddce977ab5ea9e9d2e7578fb52.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "4\n1234",
"output": "33222"
},
{
"input": "3\n555",
"output": "555"
},
{
"input": "15\n012345781234578",
"output": "7777553333222222222222"
},
{
"input": "1\n8",
"output": "7222"
},
{
"input": "10\n1413472614",
"output": "75333332222222"
},
{
"input": "8\n68931246",
"output": "77553333332222222"
},
{
"input": "7\n4424368",
"output": "75333332222222222"
},
{
"input": "6\n576825",
"output": "7755532222"
},
{
"input": "5\n97715",
"output": "7775332"
},
{
"input": "3\n915",
"output": "75332"
},
{
"input": "2\n26",
"output": "532"
},
{
"input": "1\n4",
"output": "322"
},
{
"input": "15\n028745260720699",
"output": "7777755533333332222222222"
},
{
"input": "13\n5761790121605",
"output": "7775555333322"
},
{
"input": "10\n3312667105",
"output": "755533332"
},
{
"input": "1\n7",
"output": "7"
},
{
"input": "15\n989898989898989",
"output": "777777777777777333333333333333322222222222222222222222222222"
},
{
"input": "15\n000000000000007",
"output": "7"
},
{
"input": "15\n999999999999990",
"output": "77777777777777333333333333333333333333333322222222222222"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "1\n3",
"output": "3"
},
{
"input": "1\n4",
"output": "322"
},
{
"input": "1\n5",
"output": "5"
},
{
"input": "1\n6",
"output": "53"
},
{
"input": "1\n7",
"output": "7"
},
{
"input": "1\n9",
"output": "7332"
},
{
"input": "2\n09",
"output": "7332"
},
{
"input": "13\n1337251172966",
"output": "777555333333222"
},
{
"input": "15\n987654329876543",
"output": "777777555533333333332222222222222"
},
{
"input": "9\n234567899",
"output": "777755333333322222222"
},
{
"input": "2\n99",
"output": "77333322"
},
{
"input": "2\n66",
"output": "5533"
},
{
"input": "3\n999",
"output": "777333333222"
},
{
"input": "5\n99999",
"output": "77777333333333322222"
},
{
"input": "9\n123456789",
"output": "77755333332222222"
},
{
"input": "9\n987654321",
"output": "77755333332222222"
},
{
"input": "3\n666",
"output": "555333"
},
{
"input": "2\n26",
"output": "532"
},
{
"input": "6\n555777",
"output": "777555"
},
{
"input": "10\n1234567899",
"output": "777755333333322222222"
},
{
"input": "4\n6666",
"output": "55553333"
},
{
"input": "4\n9754",
"output": "775333222"
},
{
"input": "2\n95",
"output": "75332"
},
{
"input": "14\n11122233344455",
"output": "55333333222222222"
},
{
"input": "12\n836544897832",
"output": "77777553333333222222222222222"
}
] | 1,657,454,520
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 45
| 77
| 0
|
input()
ss = input()
s = [int(i) for i in ss]
c = []
ans = ''
fact = 1
from math import factorial
for i in s:
fact *= factorial(i)
first = [7 , 5 , 3 , 2]
for i in first:
while fact%factorial(i) == 0:
c.append(i)
fact //= factorial(i)
c.sort(reverse=True)
for i in c:
ans += str(i)
print(ans)
|
Title: Drazil and Factorial
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Drazil is playing a math game with Varda.
Let's define for positive integer *x* as a product of factorials of its digits. For example, .
First, they choose a decimal number *a* consisting of *n* digits that contains at least one digit larger than 1. This number may possibly start with leading zeroes. Then they should find maximum positive number *x* satisfying following two conditions:
1. *x* doesn't contain neither digit 0 nor digit 1.
2. = .
Help friends find such number.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=15) — the number of digits in *a*.
The second line contains *n* digits of *a*. There is at least one digit in *a* that is larger than 1. Number *a* may possibly contain leading zeroes.
Output Specification:
Output a maximum possible integer satisfying the conditions above. There should be no zeroes and ones in this number decimal representation.
Demo Input:
['4\n1234\n', '3\n555\n']
Demo Output:
['33222\n', '555\n']
Note:
In the first case, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f5a4207f23215fddce977ab5ea9e9d2e7578fb52.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
input()
ss = input()
s = [int(i) for i in ss]
c = []
ans = ''
fact = 1
from math import factorial
for i in s:
fact *= factorial(i)
first = [7 , 5 , 3 , 2]
for i in first:
while fact%factorial(i) == 0:
c.append(i)
fact //= factorial(i)
c.sort(reverse=True)
for i in c:
ans += str(i)
print(ans)
```
| 3
|
|
893
|
B
|
Beautiful Divisors
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation"
] | null | null |
Recently Luba learned about a special kind of numbers that she calls beautiful numbers. The number is called beautiful iff its binary representation consists of *k*<=+<=1 consecutive ones, and then *k* consecutive zeroes.
Some examples of beautiful numbers:
- 12 (110); - 1102 (610); - 11110002 (12010); - 1111100002 (49610).
More formally, the number is beautiful iff there exists some positive integer *k* such that the number is equal to (2*k*<=-<=1)<=*<=(2*k*<=-<=1).
Luba has got an integer number *n*, and she wants to find its greatest beautiful divisor. Help her to find it!
|
The only line of input contains one number *n* (1<=≤<=*n*<=≤<=105) — the number Luba has got.
|
Output one number — the greatest beautiful divisor of Luba's number. It is obvious that the answer always exists.
|
[
"3\n",
"992\n"
] |
[
"1\n",
"496\n"
] |
none
| 0
|
[
{
"input": "3",
"output": "1"
},
{
"input": "992",
"output": "496"
},
{
"input": "81142",
"output": "1"
},
{
"input": "76920",
"output": "120"
},
{
"input": "2016",
"output": "2016"
},
{
"input": "1",
"output": "1"
},
{
"input": "6",
"output": "6"
},
{
"input": "32640",
"output": "32640"
},
{
"input": "12096",
"output": "2016"
},
{
"input": "55948",
"output": "1"
},
{
"input": "47262",
"output": "6"
},
{
"input": "22876",
"output": "28"
},
{
"input": "96120",
"output": "120"
},
{
"input": "42160",
"output": "496"
},
{
"input": "38304",
"output": "2016"
},
{
"input": "89408",
"output": "8128"
},
{
"input": "97920",
"output": "32640"
},
{
"input": "55493",
"output": "1"
},
{
"input": "38021",
"output": "1"
},
{
"input": "21445",
"output": "1"
},
{
"input": "100000",
"output": "1"
},
{
"input": "497",
"output": "1"
},
{
"input": "240",
"output": "120"
},
{
"input": "21204",
"output": "6"
},
{
"input": "65536",
"output": "1"
},
{
"input": "364",
"output": "28"
},
{
"input": "1024",
"output": "1"
},
{
"input": "36",
"output": "6"
},
{
"input": "28",
"output": "28"
},
{
"input": "14400",
"output": "120"
},
{
"input": "10080",
"output": "2016"
},
{
"input": "9",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "42",
"output": "6"
},
{
"input": "83160",
"output": "120"
},
{
"input": "65534",
"output": "1"
},
{
"input": "1026",
"output": "6"
},
{
"input": "1025",
"output": "1"
},
{
"input": "1027",
"output": "1"
},
{
"input": "2018",
"output": "1"
},
{
"input": "2020",
"output": "1"
},
{
"input": "123",
"output": "1"
},
{
"input": "150",
"output": "6"
},
{
"input": "5",
"output": "1"
},
{
"input": "66",
"output": "6"
},
{
"input": "12768",
"output": "28"
},
{
"input": "156",
"output": "6"
},
{
"input": "99990",
"output": "6"
},
{
"input": "248",
"output": "1"
}
] | 1,667,585,322
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 5
| 46
| 0
|
n=int(input())
for i in range(1,n):
if (2**i-1)*(2**(i-1))<=n:
if n%(2**i-1)*(2**(i-1))==0:
m=(2**i-1)*(2**(i-1))
else:
break
print(m)
|
Title: Beautiful Divisors
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently Luba learned about a special kind of numbers that she calls beautiful numbers. The number is called beautiful iff its binary representation consists of *k*<=+<=1 consecutive ones, and then *k* consecutive zeroes.
Some examples of beautiful numbers:
- 12 (110); - 1102 (610); - 11110002 (12010); - 1111100002 (49610).
More formally, the number is beautiful iff there exists some positive integer *k* such that the number is equal to (2*k*<=-<=1)<=*<=(2*k*<=-<=1).
Luba has got an integer number *n*, and she wants to find its greatest beautiful divisor. Help her to find it!
Input Specification:
The only line of input contains one number *n* (1<=≤<=*n*<=≤<=105) — the number Luba has got.
Output Specification:
Output one number — the greatest beautiful divisor of Luba's number. It is obvious that the answer always exists.
Demo Input:
['3\n', '992\n']
Demo Output:
['1\n', '496\n']
Note:
none
|
```python
n=int(input())
for i in range(1,n):
if (2**i-1)*(2**(i-1))<=n:
if n%(2**i-1)*(2**(i-1))==0:
m=(2**i-1)*(2**(i-1))
else:
break
print(m)
```
| -1
|
|
34
|
A
|
Reconnaissance 2
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Reconnaissance 2
|
2
|
256
|
*n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit.
|
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction.
|
Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle.
|
[
"5\n10 12 13 15 10\n",
"4\n10 20 30 40\n"
] |
[
"5 1\n",
"1 2\n"
] |
none
| 500
|
[
{
"input": "5\n10 12 13 15 10",
"output": "5 1"
},
{
"input": "4\n10 20 30 40",
"output": "1 2"
},
{
"input": "6\n744 359 230 586 944 442",
"output": "2 3"
},
{
"input": "5\n826 747 849 687 437",
"output": "1 2"
},
{
"input": "5\n999 999 993 969 999",
"output": "1 2"
},
{
"input": "5\n4 24 6 1 15",
"output": "3 4"
},
{
"input": "2\n511 32",
"output": "1 2"
},
{
"input": "3\n907 452 355",
"output": "2 3"
},
{
"input": "4\n303 872 764 401",
"output": "4 1"
},
{
"input": "10\n684 698 429 694 956 812 594 170 937 764",
"output": "1 2"
},
{
"input": "20\n646 840 437 946 640 564 936 917 487 752 844 734 468 969 674 646 728 642 514 695",
"output": "7 8"
},
{
"input": "30\n996 999 998 984 989 1000 996 993 1000 983 992 999 999 1000 979 992 987 1000 996 1000 1000 989 981 996 995 999 999 989 999 1000",
"output": "12 13"
},
{
"input": "50\n93 27 28 4 5 78 59 24 19 134 31 128 118 36 90 32 32 1 44 32 33 13 31 10 12 25 38 50 25 12 4 22 28 53 48 83 4 25 57 31 71 24 8 7 28 86 23 80 101 58",
"output": "16 17"
},
{
"input": "88\n1000 1000 1000 1000 1000 998 998 1000 1000 1000 1000 999 999 1000 1000 1000 999 1000 997 999 997 1000 999 998 1000 999 1000 1000 1000 999 1000 999 999 1000 1000 999 1000 999 1000 1000 998 1000 1000 1000 998 998 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 999 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 998 1000 1000 998 1000 999 1000 1000 1000 1000",
"output": "1 2"
},
{
"input": "99\n4 4 21 6 5 3 13 2 6 1 3 4 1 3 1 9 11 1 6 17 4 5 20 4 1 9 5 11 3 4 14 1 3 3 1 4 3 5 27 1 1 2 10 7 11 4 19 7 11 6 11 13 3 1 10 7 2 1 16 1 9 4 29 13 2 12 14 2 21 1 9 8 26 12 12 5 2 14 7 8 8 8 9 4 12 2 6 6 7 16 8 14 2 10 20 15 3 7 4",
"output": "1 2"
},
{
"input": "100\n713 572 318 890 577 657 646 146 373 783 392 229 455 871 20 593 573 336 26 381 280 916 907 732 820 713 111 840 570 446 184 711 481 399 788 647 492 15 40 530 549 506 719 782 126 20 778 996 712 761 9 74 812 418 488 175 103 585 900 3 604 521 109 513 145 708 990 361 682 827 791 22 596 780 596 385 450 643 158 496 876 975 319 783 654 895 891 361 397 81 682 899 347 623 809 557 435 279 513 438",
"output": "86 87"
},
{
"input": "100\n31 75 86 68 111 27 22 22 26 30 54 163 107 75 160 122 14 23 17 26 27 20 43 58 59 71 21 148 9 32 43 91 133 286 132 70 90 156 84 14 77 93 23 18 13 72 18 131 33 28 72 175 30 86 249 20 14 208 28 57 63 199 6 10 24 30 62 267 43 479 60 28 138 1 45 3 19 47 7 166 116 117 50 140 28 14 95 85 93 43 61 15 2 70 10 51 7 95 9 25",
"output": "7 8"
},
{
"input": "100\n896 898 967 979 973 709 961 968 806 967 896 967 826 975 936 903 986 856 851 931 852 971 786 837 949 978 686 936 952 909 965 749 908 916 943 973 983 975 939 886 964 928 960 976 907 788 994 773 949 871 947 980 945 985 726 981 887 943 907 990 931 874 840 867 948 951 961 904 888 901 976 967 994 921 828 970 972 722 755 970 860 855 914 869 714 899 969 978 898 862 642 939 904 936 819 934 884 983 955 964",
"output": "1 2"
},
{
"input": "100\n994 927 872 970 815 986 952 996 965 1000 877 986 978 999 950 990 936 997 993 960 921 860 895 869 943 998 983 968 973 953 999 990 995 871 853 979 973 963 953 938 997 989 993 964 960 973 946 975 1000 962 920 746 989 957 904 965 920 979 966 961 1000 993 975 952 846 971 991 979 985 969 984 973 956 1000 952 778 983 974 956 927 995 997 980 997 1000 970 960 970 988 983 947 904 935 972 1000 863 992 996 932 967",
"output": "81 82"
},
{
"input": "100\n48 108 63 21 27 8 49 21 75 8 24 42 149 18 8 28 21 18 25 35 59 70 59 33 40 1 67 34 120 82 4 115 72 87 3 15 15 63 37 12 40 27 83 14 38 20 14 58 93 10 31 3 39 6 197 77 54 16 31 146 9 49 14 8 77 82 5 11 80 116 8 61 50 24 7 103 29 11 3 3 1 12 46 24 21 131 39 29 36 2 107 40 16 99 31 41 29 48 17 17",
"output": "36 37"
}
] | 1,584,547,777
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 20
| 280
| 0
|
n=int(input())
l=list(map(int,input().split()))
x,y=0,0
m=10**10
for i in range(n-1):
s=abs(l[i+1]-l[i])
if(s<m):
m=s
x=i+2
y=i+1
w=abs(l[n-1]-l[0])
if(w<m):
print(1,n)
else:
print(x,y)
|
Title: Reconnaissance 2
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
*n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit.
Input Specification:
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction.
Output Specification:
Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle.
Demo Input:
['5\n10 12 13 15 10\n', '4\n10 20 30 40\n']
Demo Output:
['5 1\n', '1 2\n']
Note:
none
|
```python
n=int(input())
l=list(map(int,input().split()))
x,y=0,0
m=10**10
for i in range(n-1):
s=abs(l[i+1]-l[i])
if(s<m):
m=s
x=i+2
y=i+1
w=abs(l[n-1]-l[0])
if(w<m):
print(1,n)
else:
print(x,y)
```
| 3.93
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,612,599,506
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 81
| 124
| 0
|
n = int(input().strip(" "))
forces = []
count = [0 for i in range(3)]
for i in range(n):
f = list(map(int,input().strip(" ").split(" ")))
count = [f[i] + count[i] for i in range(3)]
if count == [0,0,0]:
print("YES")
else:
print("NO")
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
n = int(input().strip(" "))
forces = []
count = [0 for i in range(3)]
for i in range(n):
f = list(map(int,input().strip(" ").split(" ")))
count = [f[i] + count[i] for i in range(3)]
if count == [0,0,0]:
print("YES")
else:
print("NO")
```
| 3.969
|
932
|
B
|
Recursive Queries
|
PROGRAMMING
| 1,300
|
[
"binary search",
"data structures",
"dfs and similar"
] | null | null |
Let us define two functions *f* and *g* on positive integer numbers.
You need to process *Q* queries. In each query, you will be given three integers *l*, *r* and *k*. You need to print the number of integers *x* between *l* and *r* inclusive, such that *g*(*x*)<==<=*k*.
|
The first line of the input contains an integer *Q* (1<=≤<=*Q*<=≤<=2<=×<=105) representing the number of queries.
*Q* lines follow, each of which contains 3 integers *l*, *r* and *k* (1<=≤<=*l*<=≤<=*r*<=≤<=106,<=1<=≤<=*k*<=≤<=9).
|
For each query, print a single line containing the answer for that query.
|
[
"4\n22 73 9\n45 64 6\n47 55 7\n2 62 4\n",
"4\n82 94 6\n56 67 4\n28 59 9\n39 74 4\n"
] |
[
"1\n4\n0\n8\n",
"3\n1\n1\n5\n"
] |
In the first example:
- *g*(33) = 9 as *g*(33) = *g*(3 × 3) = *g*(9) = 9 - *g*(47) = *g*(48) = *g*(60) = *g*(61) = 6 - There are no such integers between 47 and 55. - *g*(4) = *g*(14) = *g*(22) = *g*(27) = *g*(39) = *g*(40) = *g*(41) = *g*(58) = 4
| 1,000
|
[
{
"input": "4\n22 73 9\n45 64 6\n47 55 7\n2 62 4",
"output": "1\n4\n0\n8"
},
{
"input": "4\n82 94 6\n56 67 4\n28 59 9\n39 74 4",
"output": "3\n1\n1\n5"
}
] | 1,518,708,019
| 2,719
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
PRETESTS
| 4
| 2,000
| 5,632,000
|
a=int(input())
ans=[]
def f(x):
t=1
for i in range(len(x)):
if int(x[i])!=0:
t*=int(x[i])
return t
def g(x):
if int(x)<=9:
return int(x)
else:
return g(str(f(x)))
for i in range(a):
posl=input().split()
otvet=0
for i in range(int(posl[0]),int(posl[1])+1):
if g(str(i))==int(posl[2]):
otvet+=1
ans.append(otvet)
for i in ans:
print(i)
|
Title: Recursive Queries
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let us define two functions *f* and *g* on positive integer numbers.
You need to process *Q* queries. In each query, you will be given three integers *l*, *r* and *k*. You need to print the number of integers *x* between *l* and *r* inclusive, such that *g*(*x*)<==<=*k*.
Input Specification:
The first line of the input contains an integer *Q* (1<=≤<=*Q*<=≤<=2<=×<=105) representing the number of queries.
*Q* lines follow, each of which contains 3 integers *l*, *r* and *k* (1<=≤<=*l*<=≤<=*r*<=≤<=106,<=1<=≤<=*k*<=≤<=9).
Output Specification:
For each query, print a single line containing the answer for that query.
Demo Input:
['4\n22 73 9\n45 64 6\n47 55 7\n2 62 4\n', '4\n82 94 6\n56 67 4\n28 59 9\n39 74 4\n']
Demo Output:
['1\n4\n0\n8\n', '3\n1\n1\n5\n']
Note:
In the first example:
- *g*(33) = 9 as *g*(33) = *g*(3 × 3) = *g*(9) = 9 - *g*(47) = *g*(48) = *g*(60) = *g*(61) = 6 - There are no such integers between 47 and 55. - *g*(4) = *g*(14) = *g*(22) = *g*(27) = *g*(39) = *g*(40) = *g*(41) = *g*(58) = 4
|
```python
a=int(input())
ans=[]
def f(x):
t=1
for i in range(len(x)):
if int(x[i])!=0:
t*=int(x[i])
return t
def g(x):
if int(x)<=9:
return int(x)
else:
return g(str(f(x)))
for i in range(a):
posl=input().split()
otvet=0
for i in range(int(posl[0]),int(posl[1])+1):
if g(str(i))==int(posl[2]):
otvet+=1
ans.append(otvet)
for i in ans:
print(i)
```
| 0
|
|
437
|
A
|
The Child and Homework
|
PROGRAMMING
| 1,300
|
[
"implementation"
] | null | null |
Once upon a time a child got a test consisting of multiple-choice questions as homework. A multiple-choice question consists of four choices: A, B, C and D. Each choice has a description, and the child should find out the only one that is correct.
Fortunately the child knows how to solve such complicated test. The child will follow the algorithm:
- If there is some choice whose description at least twice shorter than all other descriptions, or at least twice longer than all other descriptions, then the child thinks the choice is great. - If there is exactly one great choice then the child chooses it. Otherwise the child chooses C (the child think it is the luckiest choice).
You are given a multiple-choice questions, can you predict child's choose?
|
The first line starts with "A." (without quotes), then followed the description of choice A. The next three lines contains the descriptions of the other choices in the same format. They are given in order: B, C, D. Please note, that the description goes after prefix "X.", so the prefix mustn't be counted in description's length.
Each description is non-empty and consists of at most 100 characters. Each character can be either uppercase English letter or lowercase English letter, or "_".
|
Print a single line with the child's choice: "A", "B", "C" or "D" (without quotes).
|
[
"A.VFleaKing_is_the_author_of_this_problem\nB.Picks_is_the_author_of_this_problem\nC.Picking_is_the_author_of_this_problem\nD.Ftiasch_is_cute\n",
"A.ab\nB.abcde\nC.ab\nD.abc\n",
"A.c\nB.cc\nC.c\nD.c\n"
] |
[
"D\n",
"C\n",
"B\n"
] |
In the first sample, the first choice has length 39, the second one has length 35, the third one has length 37, and the last one has length 15. The choice D (length 15) is twice shorter than all other choices', so it is great choice. There is no other great choices so the child will choose D.
In the second sample, no choice is great, so the child will choose the luckiest choice C.
In the third sample, the choice B (length 2) is twice longer than all other choices', so it is great choice. There is no other great choices so the child will choose B.
| 500
|
[
{
"input": "A.VFleaKing_is_the_author_of_this_problem\nB.Picks_is_the_author_of_this_problem\nC.Picking_is_the_author_of_this_problem\nD.Ftiasch_is_cute",
"output": "D"
},
{
"input": "A.ab\nB.abcde\nC.ab\nD.abc",
"output": "C"
},
{
"input": "A.c\nB.cc\nC.c\nD.c",
"output": "B"
},
{
"input": "A.He_nan_de_yang_guang_zhao_yao_zhe_wo_men_mei_guo_ren_lian_shang_dou_xiao_kai_yan_wahaaaaaaaaaaaaaaaa\nB.Li_bai_li_bai_fei_liu_zhi_xia_san_qian_chi_yi_si_yin_he_luo_jiu_tian_li_bai_li_bai_li_bai_li_bai_shi\nC.Peng_yu_xiang_shi_zai_tai_shen_le_jian_zhi_jiu_shi_ye_jie_du_liu_a_si_mi_da_zhen_shi_tai_shen_le_a_a\nD.Wo_huo_le_si_shi_er_nian_zhen_de_shi_cong_lai_ye_mei_you_jian_guo_zhe_me_biao_zhun_de_yi_bai_ge_zi_a",
"output": "C"
},
{
"input": "A.a___FXIcs_gB____dxFFzst_p_P_Xp_vS__cS_C_ei_\nB.fmnmkS_SeZYx_tSys_d__Exbojv_a_YPEL_BPj__I_aYH\nC._nrPx_j\nD.o_A_UwmNbC_sZ_AXk_Y___i_SN_U_UxrBN_qo_____",
"output": "C"
},
{
"input": "A.G_R__iT_ow_Y__Sm_al__u_____l_ltK\nB.CWRe__h__cbCF\nC._QJ_dVHCL_g_WBsMO__LC____hMNE_DoO__xea_ec\nD.___Zh_",
"output": "D"
},
{
"input": "A.a___FXIcs_gB____dxFFzst_p_P_Xp_vS__cS_C_ei_\nB.fmnmkS_SeZYx_tSys_d__Exbojv_a_YPEL_BPj__I_aYH\nC._nrPx_j\nD.o_A_UwmNbC_sZ_AXk_Y___i_SN_U_UxrBN_qo_____",
"output": "C"
},
{
"input": "A.G_R__iT_ow_Y__Sm_al__u_____l_ltK\nB.CWRe__h__cbCF\nC._QJ_dVHCL_g_WBsMO__LC____hMNE_DoO__xea_ec\nD.___Zh_",
"output": "D"
},
{
"input": "A.ejQ_E_E_G_e_SDjZ__lh_f_K__Z_i_B_U__S__S_EMD_ZEU_Sq\nB.o_JpInEdsrAY_T__D_S\nC.E_Vp_s\nD.a_AU_h",
"output": "A"
},
{
"input": "A.PN_m_P_qgOAMwDyxtbH__Yc__bPOh_wYH___n_Fv_qlZp_\nB._gLeDU__rr_vjrm__O_jl_R__DG___u_XqJjW_\nC.___sHLQzdTzT_tZ_Gs\nD.sZNcVa__M_To_bz_clFi_mH_",
"output": "C"
},
{
"input": "A.bR___cCYJg_Wbt____cxfXfC____c_O_\nB.guM\nC.__bzsH_Of__RjG__u_w_i__PXQL_U_Ow_U_n\nD._nHIuZsu_uU_stRC_k___vD_ZOD_u_z_c_Zf__p_iF_uD_Hdg",
"output": "B"
},
{
"input": "A.x_\nB.__RSiDT_\nC.Ci\nD.KLY_Hc_YN_xXg_DynydumheKTw_PFHo_vqXwm_DY_dA___OS_kG___",
"output": "D"
},
{
"input": "A.yYGJ_C__NYq_\nB.ozMUZ_cKKk_zVUPR_b_g_ygv_HoM__yAxvh__iE\nC.sgHJ___MYP__AWejchRvjSD_o\nD.gkfF_GiOqW_psMT_eS",
"output": "C"
},
{
"input": "A._LYm_nvl_E__RCFZ_IdO\nB.k__qIPO_ivvZyIG__L_\nC.D_SabLm_R___j_HS_t__\nD._adj_R_ngix____GSe_aw__SbOOl_",
"output": "C"
},
{
"input": "A.h_WiYTD_C_h___z_Gn_Th_uNh__g___jm\nB.__HeQaudCJcYfVi__Eg_vryuQrDkb_g__oy_BwX_Mu_\nC._MChdMhQA_UKrf_LGZk_ALTo_mnry_GNNza_X_D_u____ueJb__Y_h__CNUNDfmZATck_ad_XTbG\nD.NV___OoL__GfP_CqhD__RB_____v_T_xi",
"output": "C"
},
{
"input": "A.____JGWsfiU\nB.S_LMq__MpE_oFBs_P\nC.U_Rph_VHpUr____X_jWXbk__ElJTu_Z_wlBpKLTD\nD.p_ysvPNmbrF__",
"output": "C"
},
{
"input": "A.ejQ_E_E_G_e_SDjZ__lh_f_K__Z_i_B_U__S__S_EMD_ZEU_Sq\nB.o_JpInEdsrAY_T__D_S\nC.E_Vp_s\nD.a_AU_h",
"output": "A"
},
{
"input": "A.PN_m_P_qgOAMwDyxtbH__Yc__bPOh_wYH___n_Fv_qlZp_\nB._gLeDU__rr_vjrm__O_jl_R__DG___u_XqJjW_\nC.___sHLQzdTzT_tZ_Gs\nD.sZNcVa__M_To_bz_clFi_mH_",
"output": "C"
},
{
"input": "A.bR___cCYJg_Wbt____cxfXfC____c_O_\nB.guM\nC.__bzsH_Of__RjG__u_w_i__PXQL_U_Ow_U_n\nD._nHIuZsu_uU_stRC_k___vD_ZOD_u_z_c_Zf__p_iF_uD_Hdg",
"output": "B"
},
{
"input": "A.x_\nB.__RSiDT_\nC.Ci\nD.KLY_Hc_YN_xXg_DynydumheKTw_PFHo_vqXwm_DY_dA___OS_kG___",
"output": "D"
},
{
"input": "A.yYGJ_C__NYq_\nB.ozMUZ_cKKk_zVUPR_b_g_ygv_HoM__yAxvh__iE\nC.sgHJ___MYP__AWejchRvjSD_o\nD.gkfF_GiOqW_psMT_eS",
"output": "C"
},
{
"input": "A._LYm_nvl_E__RCFZ_IdO\nB.k__qIPO_ivvZyIG__L_\nC.D_SabLm_R___j_HS_t__\nD._adj_R_ngix____GSe_aw__SbOOl_",
"output": "C"
},
{
"input": "A.h_WiYTD_C_h___z_Gn_Th_uNh__g___jm\nB.__HeQaudCJcYfVi__Eg_vryuQrDkb_g__oy_BwX_Mu_\nC._MChdMhQA_UKrf_LGZk_ALTo_mnry_GNNza_X_D_u____ueJb__Y_h__CNUNDfmZATck_ad_XTbG\nD.NV___OoL__GfP_CqhD__RB_____v_T_xi",
"output": "C"
},
{
"input": "A.____JGWsfiU\nB.S_LMq__MpE_oFBs_P\nC.U_Rph_VHpUr____X_jWXbk__ElJTu_Z_wlBpKLTD\nD.p_ysvPNmbrF__",
"output": "C"
},
{
"input": "A.aaaaaa\nB.aaa\nC.aaa\nD.aaa",
"output": "A"
},
{
"input": "A.aaa\nB.aaaaaa\nC.aaaaaa\nD.aaaaaa",
"output": "A"
},
{
"input": "A.a\nB.b\nC.c\nD.d",
"output": "C"
},
{
"input": "A._\nB.__\nC.____\nD.________",
"output": "C"
},
{
"input": "A.____\nB.________\nC.________\nD._______",
"output": "C"
},
{
"input": "A.h\nB.asdf\nC.asqw\nD.qwertasdfg",
"output": "C"
},
{
"input": "A.aa\nB.aaaaa\nC.aaaaaa\nD.aaaaaaaaaaaaa",
"output": "C"
},
{
"input": "A.ccc\nB.ccccccc\nC.ccc\nD.c",
"output": "C"
},
{
"input": "A.c\nB.ccc\nC.cccccccccccccccccc\nD.cccccc",
"output": "C"
},
{
"input": "A.aa\nB.bb\nC.cc\nD.ddd",
"output": "C"
},
{
"input": "A.QW\nB.WERT\nC.QWER\nD.QWERTYUI",
"output": "C"
}
] | 1,540,822,974
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 109
| 0
|
a = list(input())
a.pop(0)
a.pop(0)
b = list(input())
b.pop(0)
b.pop(0)
c = list(input())
c.pop(0)
c.pop(0)
d = list(input())
d.pop(0)
d.pop(0)
list1 = [b,c,d]
list2 = [a,c,d]
list3 = [a,b,c]
list4 = [a,b,d]
temp = 1
count = 0
for i in range(len(list1)):
if len(a) >= len(list1[i])*2 or len(a)<=len(list1[i])/2:
continue
else:
count+=1
temp = 0
break
if temp == 1:
print('A')
temp = 1
for i in range(len(list2)):
if len(b) >= len(list2[i])*2 or len(b)<=len(list2[i])/2:
continue
else:
count+=1
temp = 0
break
if temp == 1:
print('B')
temp = 1
for i in range(len(list3)):
if len(d) >= len(list3[i])*2 or len(d)<=len(list3[i])/2:
continue
else:
count+=1
temp = 0
break
if temp == 1:
print('D')
temp = 1
for i in range(len(list4)):
if len(c) >= len(list4[i])*2 or len(c)<=len(list4[i])/2:
continue
else:
count+=1
temp = 0
break
if temp == 1:
print('C')
if count == 4:
print('C')
|
Title: The Child and Homework
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Once upon a time a child got a test consisting of multiple-choice questions as homework. A multiple-choice question consists of four choices: A, B, C and D. Each choice has a description, and the child should find out the only one that is correct.
Fortunately the child knows how to solve such complicated test. The child will follow the algorithm:
- If there is some choice whose description at least twice shorter than all other descriptions, or at least twice longer than all other descriptions, then the child thinks the choice is great. - If there is exactly one great choice then the child chooses it. Otherwise the child chooses C (the child think it is the luckiest choice).
You are given a multiple-choice questions, can you predict child's choose?
Input Specification:
The first line starts with "A." (without quotes), then followed the description of choice A. The next three lines contains the descriptions of the other choices in the same format. They are given in order: B, C, D. Please note, that the description goes after prefix "X.", so the prefix mustn't be counted in description's length.
Each description is non-empty and consists of at most 100 characters. Each character can be either uppercase English letter or lowercase English letter, or "_".
Output Specification:
Print a single line with the child's choice: "A", "B", "C" or "D" (without quotes).
Demo Input:
['A.VFleaKing_is_the_author_of_this_problem\nB.Picks_is_the_author_of_this_problem\nC.Picking_is_the_author_of_this_problem\nD.Ftiasch_is_cute\n', 'A.ab\nB.abcde\nC.ab\nD.abc\n', 'A.c\nB.cc\nC.c\nD.c\n']
Demo Output:
['D\n', 'C\n', 'B\n']
Note:
In the first sample, the first choice has length 39, the second one has length 35, the third one has length 37, and the last one has length 15. The choice D (length 15) is twice shorter than all other choices', so it is great choice. There is no other great choices so the child will choose D.
In the second sample, no choice is great, so the child will choose the luckiest choice C.
In the third sample, the choice B (length 2) is twice longer than all other choices', so it is great choice. There is no other great choices so the child will choose B.
|
```python
a = list(input())
a.pop(0)
a.pop(0)
b = list(input())
b.pop(0)
b.pop(0)
c = list(input())
c.pop(0)
c.pop(0)
d = list(input())
d.pop(0)
d.pop(0)
list1 = [b,c,d]
list2 = [a,c,d]
list3 = [a,b,c]
list4 = [a,b,d]
temp = 1
count = 0
for i in range(len(list1)):
if len(a) >= len(list1[i])*2 or len(a)<=len(list1[i])/2:
continue
else:
count+=1
temp = 0
break
if temp == 1:
print('A')
temp = 1
for i in range(len(list2)):
if len(b) >= len(list2[i])*2 or len(b)<=len(list2[i])/2:
continue
else:
count+=1
temp = 0
break
if temp == 1:
print('B')
temp = 1
for i in range(len(list3)):
if len(d) >= len(list3[i])*2 or len(d)<=len(list3[i])/2:
continue
else:
count+=1
temp = 0
break
if temp == 1:
print('D')
temp = 1
for i in range(len(list4)):
if len(c) >= len(list4[i])*2 or len(c)<=len(list4[i])/2:
continue
else:
count+=1
temp = 0
break
if temp == 1:
print('C')
if count == 4:
print('C')
```
| 0
|
|
230
|
A
|
Dragons
|
PROGRAMMING
| 1,000
|
[
"greedy",
"sortings"
] | null | null |
Kirito is stuck on a level of the MMORPG he is playing now. To move on in the game, he's got to defeat all *n* dragons that live on this level. Kirito and the dragons have strength, which is represented by an integer. In the duel between two opponents the duel's outcome is determined by their strength. Initially, Kirito's strength equals *s*.
If Kirito starts duelling with the *i*-th (1<=≤<=*i*<=≤<=*n*) dragon and Kirito's strength is not greater than the dragon's strength *x**i*, then Kirito loses the duel and dies. But if Kirito's strength is greater than the dragon's strength, then he defeats the dragon and gets a bonus strength increase by *y**i*.
Kirito can fight the dragons in any order. Determine whether he can move on to the next level of the game, that is, defeat all dragons without a single loss.
|
The first line contains two space-separated integers *s* and *n* (1<=≤<=*s*<=≤<=104, 1<=≤<=*n*<=≤<=103). Then *n* lines follow: the *i*-th line contains space-separated integers *x**i* and *y**i* (1<=≤<=*x**i*<=≤<=104, 0<=≤<=*y**i*<=≤<=104) — the *i*-th dragon's strength and the bonus for defeating it.
|
On a single line print "YES" (without the quotes), if Kirito can move on to the next level and print "NO" (without the quotes), if he can't.
|
[
"2 2\n1 99\n100 0\n",
"10 1\n100 100\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample Kirito's strength initially equals 2. As the first dragon's strength is less than 2, Kirito can fight it and defeat it. After that he gets the bonus and his strength increases to 2 + 99 = 101. Now he can defeat the second dragon and move on to the next level.
In the second sample Kirito's strength is too small to defeat the only dragon and win.
| 500
|
[
{
"input": "2 2\n1 99\n100 0",
"output": "YES"
},
{
"input": "10 1\n100 100",
"output": "NO"
},
{
"input": "123 2\n78 10\n130 0",
"output": "YES"
},
{
"input": "999 2\n1010 10\n67 89",
"output": "YES"
},
{
"input": "2 5\n5 1\n2 1\n3 1\n1 1\n4 1",
"output": "YES"
},
{
"input": "2 2\n3 5\n1 2",
"output": "YES"
},
{
"input": "1 2\n1 0\n1 0",
"output": "NO"
},
{
"input": "5 10\n20 1\n4 3\n5 1\n100 1\n4 2\n101 1\n10 0\n10 2\n17 3\n12 84",
"output": "YES"
},
{
"input": "2 2\n1 98\n100 0",
"output": "NO"
},
{
"input": "2 2\n1 2\n3 5",
"output": "YES"
},
{
"input": "5 3\n13 20\n3 10\n15 5",
"output": "YES"
},
{
"input": "2 5\n1 1\n2 1\n3 1\n4 1\n5 1",
"output": "YES"
},
{
"input": "3 3\n1 1\n1 2\n4 0",
"output": "YES"
},
{
"input": "10 4\n20 1\n3 5\n2 4\n1 3",
"output": "YES"
},
{
"input": "10 1\n1 1",
"output": "YES"
},
{
"input": "4 1\n100 1000",
"output": "NO"
},
{
"input": "5 1\n6 7",
"output": "NO"
},
{
"input": "10 1\n10 10",
"output": "NO"
},
{
"input": "6 2\n496 0\n28 8128",
"output": "NO"
},
{
"input": "4 2\n2 1\n10 3",
"output": "NO"
},
{
"input": "11 2\n22 0\n33 0",
"output": "NO"
},
{
"input": "1 2\n100 1\n100 1",
"output": "NO"
},
{
"input": "10 3\n12 0\n13 0\n14 0",
"output": "NO"
},
{
"input": "50 3\n39 0\n38 0\n37 0",
"output": "YES"
},
{
"input": "14 3\n1 5\n1 6\n1 7",
"output": "YES"
},
{
"input": "1 3\n1 10\n1 11\n1 9",
"output": "NO"
},
{
"input": "10 10\n2 10\n3 10\n4 10\n2 20\n3 20\n3 20\n100 50\n100 30\n150 30\n200 10",
"output": "NO"
},
{
"input": "9983 34\n6626 5976\n4448 3568\n2794 2309\n3741 8806\n4754 129\n2780 9275\n5785 9243\n3915 6159\n2609 4331\n238 6756\n6987 3887\n3384 5711\n4349 5563\n1135 4483\n9151 1584\n1500 766\n1608 4440\n7768 5005\n7205 2360\n9088 2933\n3923 7814\n7538 9372\n7504 165\n5277 1636\n2061 4384\n7668 1422\n9582 2121\n5483 7967\n487 2944\n7432 5794\n8208 8970\n5747 3800\n4322 3920\n8261 9319",
"output": "YES"
},
{
"input": "1 10\n8 8\n54 3\n1 8\n26 3\n16 1\n29 9\n38 10\n57 8\n48 6\n17 9",
"output": "NO"
},
{
"input": "5 10\n7 0\n7 0\n10 0\n10 0\n7 2\n4 2\n9 0\n6 1\n7 0\n7 0",
"output": "NO"
},
{
"input": "2 3\n1 1\n1 10\n17 2",
"output": "NO"
},
{
"input": "100 5\n99 100\n199 1\n199 1\n199 1\n202 1",
"output": "YES"
},
{
"input": "1 1\n10000 1",
"output": "NO"
}
] | 1,697,523,311
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 62
| 0
|
s,n=map(int,input().split())
f=0
for i in range(n):
x,y=map(int,input().split())
if s>=x:
s+=y
else:
print("NO")
break
f=1
if f==0:
print("YES")
|
Title: Dragons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kirito is stuck on a level of the MMORPG he is playing now. To move on in the game, he's got to defeat all *n* dragons that live on this level. Kirito and the dragons have strength, which is represented by an integer. In the duel between two opponents the duel's outcome is determined by their strength. Initially, Kirito's strength equals *s*.
If Kirito starts duelling with the *i*-th (1<=≤<=*i*<=≤<=*n*) dragon and Kirito's strength is not greater than the dragon's strength *x**i*, then Kirito loses the duel and dies. But if Kirito's strength is greater than the dragon's strength, then he defeats the dragon and gets a bonus strength increase by *y**i*.
Kirito can fight the dragons in any order. Determine whether he can move on to the next level of the game, that is, defeat all dragons without a single loss.
Input Specification:
The first line contains two space-separated integers *s* and *n* (1<=≤<=*s*<=≤<=104, 1<=≤<=*n*<=≤<=103). Then *n* lines follow: the *i*-th line contains space-separated integers *x**i* and *y**i* (1<=≤<=*x**i*<=≤<=104, 0<=≤<=*y**i*<=≤<=104) — the *i*-th dragon's strength and the bonus for defeating it.
Output Specification:
On a single line print "YES" (without the quotes), if Kirito can move on to the next level and print "NO" (without the quotes), if he can't.
Demo Input:
['2 2\n1 99\n100 0\n', '10 1\n100 100\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample Kirito's strength initially equals 2. As the first dragon's strength is less than 2, Kirito can fight it and defeat it. After that he gets the bonus and his strength increases to 2 + 99 = 101. Now he can defeat the second dragon and move on to the next level.
In the second sample Kirito's strength is too small to defeat the only dragon and win.
|
```python
s,n=map(int,input().split())
f=0
for i in range(n):
x,y=map(int,input().split())
if s>=x:
s+=y
else:
print("NO")
break
f=1
if f==0:
print("YES")
```
| 0
|
|
39
|
B
|
Company Income Growth
|
PROGRAMMING
| 1,300
|
[
"greedy"
] |
B. Company Income Growth
|
2
|
64
|
Petya works as a PR manager for a successful Berland company BerSoft. He needs to prepare a presentation on the company income growth since 2001 (the year of its founding) till now. Petya knows that in 2001 the company income amounted to *a*1 billion bourles, in 2002 — to *a*2 billion, ..., and in the current (2000<=+<=*n*)-th year — *a**n* billion bourles. On the base of the information Petya decided to show in his presentation the linear progress history which is in his opinion perfect. According to a graph Petya has already made, in the first year BerSoft company income must amount to 1 billion bourles, in the second year — 2 billion bourles etc., each following year the income increases by 1 billion bourles. Unfortunately, the real numbers are different from the perfect ones. Among the numbers *a**i* can even occur negative ones that are a sign of the company’s losses in some years. That is why Petya wants to ignore some data, in other words, cross some numbers *a**i* from the sequence and leave only some subsequence that has perfect growth.
Thus Petya has to choose a sequence of years *y*1, *y*2, ..., *y**k*,so that in the year *y*1 the company income amounted to 1 billion bourles, in the year *y*2 — 2 billion bourles etc., in accordance with the perfect growth dynamics. Help him to choose the longest such sequence.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). The next line contains *n* integers *a**i* (<=-<=100<=≤<=*a**i*<=≤<=100). The number *a**i* determines the income of BerSoft company in the (2000<=+<=*i*)-th year. The numbers in the line are separated by spaces.
|
Output *k* — the maximum possible length of a perfect sequence. In the next line output the sequence of years *y*1, *y*2, ..., *y**k*. Separate the numbers by spaces. If the answer is not unique, output any. If no solution exist, output one number 0.
|
[
"10\n-2 1 1 3 2 3 4 -10 -2 5\n",
"3\n-1 -2 -3\n"
] |
[
"5\n2002 2005 2006 2007 2010\n",
"0\n"
] |
none
| 0
|
[
{
"input": "10\n-2 1 1 3 2 3 4 -10 -2 5",
"output": "5\n2002 2005 2006 2007 2010 "
},
{
"input": "3\n-1 -2 -3",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "2\n-1 1",
"output": "1\n2002 "
},
{
"input": "2\n-1 1",
"output": "1\n2002 "
},
{
"input": "2\n-2 0",
"output": "0"
},
{
"input": "2\n3 -3",
"output": "0"
},
{
"input": "3\n1 1 1",
"output": "1\n2001 "
},
{
"input": "3\n-2 -2 1",
"output": "1\n2003 "
},
{
"input": "4\n-4 2 3 -1",
"output": "0"
},
{
"input": "5\n-3 -3 -4 2 -2",
"output": "0"
},
{
"input": "100\n-1 -9 0 -2 -7 -3 -1 -1 6 -5 -3 5 10 -5 7 7 4 9 -6 1 0 3 0 1 -9 -9 6 -8 3 7 -9 -4 -5 -6 8 2 2 7 2 2 0 -6 5 3 9 7 -7 -7 -2 6 -3 -4 10 3 3 -4 2 -9 9 9 -6 -1 -7 -3 -6 10 10 -1 -8 -3 8 1 10 9 -9 10 4 -10 -6 9 7 8 5 -3 2 2 2 -7 -6 0 -4 -1 4 -2 -4 -1 2 -8 10 9",
"output": "5\n2020 2036 2044 2077 2083 "
},
{
"input": "100\n5 -1 6 0 2 10 -6 6 -10 0 10 6 -10 3 8 4 2 6 3 -9 1 -1 -8 6 -6 -10 0 -3 -1 -6 -7 -9 -5 -5 5 -10 -3 4 -6 8 -4 2 2 8 2 -7 -4 -4 -9 4 -9 6 -4 -10 -8 -6 2 6 -4 3 3 4 -1 -9 8 9 -6 5 3 9 -4 0 -9 -10 3 -10 2 5 7 0 9 4 5 -3 5 -5 9 -4 6 -7 4 -1 -10 -1 -2 2 -1 4 -10 6",
"output": "6\n2021 2042 2060 2062 2068 2089 "
},
{
"input": "100\n10 9 -10 0 -9 1 10 -6 -3 8 0 5 -7 -9 9 -1 1 4 9 0 4 -7 3 10 -3 -10 -6 4 -3 0 -7 8 -6 -1 5 0 -6 1 5 -7 10 10 -2 -10 -4 -1 -1 2 5 1 6 -7 3 -1 1 10 4 2 4 -3 -10 9 4 5 1 -10 -1 -9 -8 -2 4 -4 -10 -9 -5 -9 -1 -3 -3 -8 -8 -3 6 -3 6 10 -4 -1 -3 8 -9 0 -2 2 1 6 -4 -7 -9 3",
"output": "6\n2006 2048 2053 2057 2064 2083 "
},
{
"input": "100\n-8 -3 -4 2 1 -9 5 4 4 -8 -8 6 -7 -1 9 -6 -1 1 -5 9 6 10 -8 -5 -2 10 7 10 -5 8 -7 5 -4 0 3 9 -9 -5 -4 -2 4 -1 -4 -5 -9 6 2 7 0 -2 2 3 -9 6 -10 6 5 -4 -9 -9 1 -7 -9 -3 -5 -8 4 0 4 10 -8 -6 -8 -9 5 -8 -6 -9 10 5 -6 -7 6 -5 8 3 1 3 7 3 -1 0 5 4 4 7 -7 5 -8 -2",
"output": "7\n2005 2047 2052 2067 2075 2083 2089 "
},
{
"input": "100\n-15 8 -20 -2 -16 3 -19 -15 16 19 -1 -17 -14 9 7 2 20 -16 8 20 10 3 17 -3 2 5 9 15 3 3 -17 12 7 17 -19 -15 -5 16 -10 -4 10 -15 -16 9 -15 15 -16 7 -15 12 -17 7 4 -8 9 -2 -19 14 12 -1 17 -6 19 14 19 -9 -12 3 14 -10 5 7 19 11 5 10 18 2 -6 -12 7 5 -9 20 10 2 -20 6 -10 -16 -6 -5 -15 -2 15 -12 0 -18 2 -5",
"output": "0"
},
{
"input": "100\n11 18 14 -19 -12 -5 -14 -3 13 14 -20 11 -6 12 -2 19 -16 -2 -4 -4 -18 -2 -15 5 -7 -18 11 5 -8 16 17 1 6 8 -20 13 17 -15 -20 7 16 -3 -17 -1 1 -18 2 9 4 2 -18 13 16 -14 -18 -14 16 19 13 4 -14 3 5 -7 5 -17 -14 13 20 16 -13 7 12 15 0 4 16 -16 -6 -15 18 -19 2 8 -4 -8 14 -4 20 -15 -20 14 7 -10 -17 -20 13 -1 -11 -4",
"output": "4\n2032 2047 2062 2076 "
},
{
"input": "100\n3 99 47 -26 96 90 21 -74 -19 -17 80 -43 -24 -82 -39 -40 44 84 87 72 -78 -94 -82 -87 96 71 -29 -90 66 49 -87 19 -31 97 55 -29 -98 16 -23 68 84 -54 74 -71 -60 -32 -72 95 -55 -17 -49 -73 63 39 -31 -91 40 -29 -60 -33 -33 49 93 -56 -81 -18 38 45 -29 63 -37 27 75 13 -100 52 -51 75 -38 -49 28 39 -7 -37 -86 100 -8 28 -89 -57 -17 -52 -98 -92 56 -49 -24 92 28 31",
"output": "0"
},
{
"input": "100\n-36 -88 -23 -71 33 53 21 49 97 -50 -91 24 -83 -100 -77 88 -56 -31 -27 7 -74 -69 -75 -59 78 -66 53 21 -41 72 -31 -93 26 98 58 78 -95 -64 -2 34 74 14 23 -25 -51 -94 -46 100 -44 79 46 -8 79 25 -55 16 35 67 29 58 49 75 -53 80 63 -50 -59 -5 -71 -72 -57 75 -71 6 -5 -44 34 -2 -10 -58 -98 67 -42 22 95 46 -58 88 62 82 85 -74 -94 -5 -64 12 -8 44 -57 87",
"output": "0"
},
{
"input": "100\n-76 -73 -93 85 -30 66 -29 -79 13 -82 -12 90 8 -68 86 15 -5 55 -91 92 80 5 83 19 59 -1 -17 83 52 44 25 -3 83 -51 62 -66 -91 58 20 51 15 -70 -77 22 -92 -4 -70 55 -33 -27 -59 6 94 60 -79 -28 -20 -38 -83 100 -20 100 51 -35 -44 -82 44 -5 88 -6 -26 -79 -16 -2 -61 12 -81 -80 68 -68 -23 96 -77 80 -75 -57 93 97 12 20 -65 -46 -90 81 16 -77 -43 -3 8 -58",
"output": "0"
},
{
"input": "100\n-64 -18 -21 46 28 -100 21 -98 49 -44 -38 52 -85 62 42 -85 19 -27 88 -45 28 -86 -20 15 34 61 17 88 95 21 -40 -2 -12 90 -61 30 7 -13 -74 43 -57 43 -30 51 -19 -51 -22 -2 -76 85 1 -53 -31 -77 96 -61 61 88 -62 88 -6 -59 -70 18 -65 90 91 -27 -86 37 8 -92 -82 -78 -57 -81 17 -53 3 29 -88 -92 -28 49 -2 -41 32 -89 -38 49 22 37 -17 -1 -78 -80 -12 36 -95 30",
"output": "1\n2051 "
},
{
"input": "1\n1",
"output": "1\n2001 "
},
{
"input": "2\n1 2",
"output": "2\n2001 2002 "
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "100\n2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 2046 2047 2048 2049 2050 2051 2052 2053 2054 2055 2056 2057 2058 2059 2060 2061 2062 2063 2064 2065 2066 2067 2068 2069 2070 2071 2072 2073 2074 2075 2076 2077 2078 2079 2080 2081 2082 2083 2084 2085 2086 2087 2088 2089 2090 2091 2092 2093 2094 2095 2096 2097 2098 2099 2100 "
},
{
"input": "100\n-29 -92 -94 81 -100 1 -29 2 3 97 -37 4 5 -52 6 7 -81 86 8 9 10 98 36 -99 11 -18 12 -46 13 14 15 16 17 18 19 20 21 23 53 22 23 24 6 17 45 25 99 26 -53 -51 48 -11 71 27 -56 28 29 -36 30 31 61 -53 -64 32 33 89 -90 34 35 54 36 -89 13 -89 5 37 38 39 -57 26 55 80 40 63 41 42 43 44 92 45 46 47 -10 -10 -32 48 49 50 -10 -99",
"output": "50\n2006 2008 2009 2012 2013 2015 2016 2019 2020 2021 2025 2027 2029 2030 2031 2032 2033 2034 2035 2036 2037 2040 2041 2042 2046 2048 2054 2056 2057 2059 2060 2064 2065 2068 2069 2071 2076 2077 2078 2083 2085 2086 2087 2088 2090 2091 2092 2096 2097 2098 "
},
{
"input": "100\n1 2 84 -97 3 -59 30 -55 4 -6 80 5 6 7 -8 8 3 -96 88 9 10 -20 -95 11 12 67 5 4 -15 -62 -74 13 14 15 16 17 18 19 20 21 22 -15 23 -35 -17 24 25 -99 26 27 69 2 -92 -96 -77 28 29 -95 -75 30 -36 31 17 -88 10 52 32 33 34 -94 35 -38 -16 36 37 38 31 -58 39 -81 83 46 40 41 42 43 -44 44 4 49 -60 17 64 45 46 47 48 49 -38 50",
"output": "50\n2001 2002 2005 2009 2012 2013 2014 2016 2020 2021 2024 2025 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2043 2046 2047 2049 2050 2056 2057 2060 2062 2067 2068 2069 2071 2074 2075 2076 2079 2083 2084 2085 2086 2088 2094 2095 2096 2097 2098 2100 "
},
{
"input": "100\n1 2 80 30 95 51 -3 -12 3 -11 4 -90 5 6 7 8 -18 52 77 -82 9 10 11 -51 -16 70 12 13 14 15 16 17 58 18 36 19 -86 20 21 40 -53 94 22 23 27 67 24 -90 -38 17 -71 40 25 72 -82 26 27 -4 28 29 30 31 32 67 33 34 90 42 -52 35 36 37 -6 38 39 -11 30 40 41 42 -42 21 -96 43 -50 44 -73 16 45 90 46 47 48 2 -37 -88 49 -27 -43 50",
"output": "50\n2001 2002 2009 2011 2013 2014 2015 2016 2021 2022 2023 2027 2028 2029 2030 2031 2032 2034 2036 2038 2039 2043 2044 2047 2053 2056 2057 2059 2060 2061 2062 2063 2065 2066 2070 2071 2072 2074 2075 2078 2079 2080 2084 2086 2089 2091 2092 2093 2097 2100 "
},
{
"input": "100\n1 2 3 -72 6 4 5 6 7 8 9 10 11 -57 12 13 14 -37 74 15 16 17 3 18 19 20 21 22 -6 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 -24 39 40 41 42 43 44 45 -52 46 -65 47 -82 48 49 50 47 -28 51 52 53 54 55 -30 56 57 58 59 12 60 61 62 63 -14 64 65 66 67 -77 68 69 70 71 72 73 74 -4 -6 -75 75 -26 76 49 77 -86",
"output": "77\n2001 2002 2003 2006 2007 2008 2009 2010 2011 2012 2013 2015 2016 2017 2020 2021 2022 2024 2025 2026 2027 2028 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 2047 2048 2049 2050 2051 2052 2053 2055 2057 2059 2060 2061 2064 2065 2066 2067 2068 2070 2071 2072 2073 2075 2076 2077 2078 2080 2081 2082 2083 2085 2086 2087 2088 2089 2090 2091 2095 2097 2099 "
},
{
"input": "100\n10 5 -69 1 -79 -57 -80 87 -38 -54 -91 33 29 81 20 -58 -97 70 2 -13 71 57 -15 98 -18 100 34 -25 -39 75 100 -88 3 95 48 -92 -20 -13 5 4 -19 -99 4 -46 -35 12 -43 -30 -37 -51 77 90 -47 -87 3 -84 -62 -51 69 -38 74 -63 -5 5 6 7 -65 90 -33 -23 8 19 -69 -98 24 28 100 9 -90 -34 -69 72 -15 8 27 -80 6 33 62 -57 -4 10 40 81 -78 58 43 83 57 21",
"output": "10\n2004 2019 2033 2040 2064 2065 2066 2071 2078 2092 "
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "10\n2 3 1 3 3 2 1 2 1 2",
"output": "2\n2003 2006 "
},
{
"input": "15\n4 1 4 6 3 2 1 1 3 2 4 4 1 4 1",
"output": "4\n2002 2006 2009 2011 "
},
{
"input": "15\n3 3 3 2 2 2 1 1 1 2 2 2 4 4 4",
"output": "2\n2007 2010 "
},
{
"input": "15\n6 5 2 3 4 1 3 2 4 5 1 2 6 4 4",
"output": "2\n2006 2008 "
}
] | 1,522,705,144
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 218
| 7,065,600
|
n = int(input())
l = list(map(int, input().split()))
k = 1
r = []
for i in range(n):
if l[i] == k:
k += 1
r.append(i + 2001)
print(len(r))
for item in r:
print(item, end = ' ')
|
Title: Company Income Growth
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Petya works as a PR manager for a successful Berland company BerSoft. He needs to prepare a presentation on the company income growth since 2001 (the year of its founding) till now. Petya knows that in 2001 the company income amounted to *a*1 billion bourles, in 2002 — to *a*2 billion, ..., and in the current (2000<=+<=*n*)-th year — *a**n* billion bourles. On the base of the information Petya decided to show in his presentation the linear progress history which is in his opinion perfect. According to a graph Petya has already made, in the first year BerSoft company income must amount to 1 billion bourles, in the second year — 2 billion bourles etc., each following year the income increases by 1 billion bourles. Unfortunately, the real numbers are different from the perfect ones. Among the numbers *a**i* can even occur negative ones that are a sign of the company’s losses in some years. That is why Petya wants to ignore some data, in other words, cross some numbers *a**i* from the sequence and leave only some subsequence that has perfect growth.
Thus Petya has to choose a sequence of years *y*1, *y*2, ..., *y**k*,so that in the year *y*1 the company income amounted to 1 billion bourles, in the year *y*2 — 2 billion bourles etc., in accordance with the perfect growth dynamics. Help him to choose the longest such sequence.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). The next line contains *n* integers *a**i* (<=-<=100<=≤<=*a**i*<=≤<=100). The number *a**i* determines the income of BerSoft company in the (2000<=+<=*i*)-th year. The numbers in the line are separated by spaces.
Output Specification:
Output *k* — the maximum possible length of a perfect sequence. In the next line output the sequence of years *y*1, *y*2, ..., *y**k*. Separate the numbers by spaces. If the answer is not unique, output any. If no solution exist, output one number 0.
Demo Input:
['10\n-2 1 1 3 2 3 4 -10 -2 5\n', '3\n-1 -2 -3\n']
Demo Output:
['5\n2002 2005 2006 2007 2010\n', '0\n']
Note:
none
|
```python
n = int(input())
l = list(map(int, input().split()))
k = 1
r = []
for i in range(n):
if l[i] == k:
k += 1
r.append(i + 2001)
print(len(r))
for item in r:
print(item, end = ' ')
```
| 3.892857
|
734
|
A
|
Anton and Danik
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Anton likes to play chess, and so does his friend Danik.
Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie.
Now Anton wonders, who won more games, he or Danik? Help him determine this.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played.
The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game.
|
If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output.
If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output.
If Anton and Danik won the same number of games, print "Friendship" (without quotes).
|
[
"6\nADAAAA\n",
"7\nDDDAADA\n",
"6\nDADADA\n"
] |
[
"Anton\n",
"Danik\n",
"Friendship\n"
] |
In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton".
In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik".
In the third sample, both Anton and Danik won 3 games and the answer is "Friendship".
| 500
|
[
{
"input": "6\nADAAAA",
"output": "Anton"
},
{
"input": "7\nDDDAADA",
"output": "Danik"
},
{
"input": "6\nDADADA",
"output": "Friendship"
},
{
"input": "10\nDDDDADDADD",
"output": "Danik"
},
{
"input": "40\nAAAAAAAAADDAAAAAAAAAAADADDAAAAAAAAAAADAA",
"output": "Anton"
},
{
"input": "200\nDDDDDDDADDDDDDAADADAADAAADAADADAAADDDADDDDDDADDDAADDDAADADDDDDADDDAAAADAAADDDDDAAADAADDDAAAADDADADDDAADDAADAAADAADAAAADDAADDADAAAADADDDAAAAAADDAADAADAADADDDAAADAAAADADDADAAAAAADADADDDADDDAADDADDDAAAAD",
"output": "Friendship"
},
{
"input": "1\nA",
"output": "Anton"
},
{
"input": "1\nD",
"output": "Danik"
},
{
"input": "2\nDA",
"output": "Friendship"
},
{
"input": "4\nDADA",
"output": "Friendship"
},
{
"input": "4\nDAAD",
"output": "Friendship"
},
{
"input": "3\nADD",
"output": "Danik"
},
{
"input": "3\nDAD",
"output": "Danik"
},
{
"input": "2\nDA",
"output": "Friendship"
},
{
"input": "379\nAADAAAAAADDAAAAAADAADADADDAAAAADADDAADAAAADDDADAAAAAAADAADAAAAAAADAAAAAAAAADAAAAAAADAAAAAAAAAAADDDADAAAAAAAADAADADAAAADAAAAAAAAAAAAAAAAADAAAADDDAADAAAAAAADAAADAAADAADDDADDAAADAAAAAADDDADDDAAADAAAADAAAAAAAAADAAADAAAAAAAAADAAAAAAAAAAAAAAAAAADADAAAAAAAAAAADAAAAADAAAADAAAAAAAAAAAAADADAADAAAAAAAADAADAAAAAAAADAAAAAAAADDDAAAAAADAAADAAAAAADAADAAAAAADAAAADADAADAAAAAADAAAADAADDAADAADAAA",
"output": "Anton"
}
] | 1,695,563,049
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 46
| 102,400
|
n = int(input()) # Input: The number of games played
s = input() # Input: The outcome of each game (string)
# Count the occurrences of 'A' (Anton's wins) and 'D' (Danik's wins)
anton_wins = s.count('A')
danik_wins = s.count('D')
# Compare the counts to determine the winner
if anton_wins > danik_wins:
print("Anton")
elif danik_wins > anton_wins:
print("Danik")
else:
print("Friendship")
|
Title: Anton and Danik
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anton likes to play chess, and so does his friend Danik.
Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie.
Now Anton wonders, who won more games, he or Danik? Help him determine this.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played.
The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game.
Output Specification:
If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output.
If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output.
If Anton and Danik won the same number of games, print "Friendship" (without quotes).
Demo Input:
['6\nADAAAA\n', '7\nDDDAADA\n', '6\nDADADA\n']
Demo Output:
['Anton\n', 'Danik\n', 'Friendship\n']
Note:
In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton".
In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik".
In the third sample, both Anton and Danik won 3 games and the answer is "Friendship".
|
```python
n = int(input()) # Input: The number of games played
s = input() # Input: The outcome of each game (string)
# Count the occurrences of 'A' (Anton's wins) and 'D' (Danik's wins)
anton_wins = s.count('A')
danik_wins = s.count('D')
# Compare the counts to determine the winner
if anton_wins > danik_wins:
print("Anton")
elif danik_wins > anton_wins:
print("Danik")
else:
print("Friendship")
```
| 3
|
|
755
|
B
|
PolandBall and Game
|
PROGRAMMING
| 1,100
|
[
"binary search",
"data structures",
"games",
"greedy",
"sortings",
"strings"
] | null | null |
PolandBall is playing a game with EnemyBall. The rules are simple. Players have to say words in turns. You cannot say a word which was already said. PolandBall starts. The Ball which can't say a new word loses.
You're given two lists of words familiar to PolandBall and EnemyBall. Can you determine who wins the game, if both play optimally?
|
The first input line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=103) — number of words PolandBall and EnemyBall know, respectively.
Then *n* strings follow, one per line — words familiar to PolandBall.
Then *m* strings follow, one per line — words familiar to EnemyBall.
Note that one Ball cannot know a word more than once (strings are unique), but some words can be known by both players.
Each word is non-empty and consists of no more than 500 lowercase English alphabet letters.
|
In a single line of print the answer — "YES" if PolandBall wins and "NO" otherwise. Both Balls play optimally.
|
[
"5 1\npolandball\nis\na\ncool\ncharacter\nnope\n",
"2 2\nkremowka\nwadowicka\nkremowka\nwiedenska\n",
"1 2\na\na\nb\n"
] |
[
"YES",
"YES",
"NO"
] |
In the first example PolandBall knows much more words and wins effortlessly.
In the second example if PolandBall says kremowka first, then EnemyBall cannot use that word anymore. EnemyBall can only say wiedenska. PolandBall says wadowicka and wins.
| 1,000
|
[
{
"input": "5 1\npolandball\nis\na\ncool\ncharacter\nnope",
"output": "YES"
},
{
"input": "2 2\nkremowka\nwadowicka\nkremowka\nwiedenska",
"output": "YES"
},
{
"input": "1 2\na\na\nb",
"output": "NO"
},
{
"input": "2 2\na\nb\nb\nc",
"output": "YES"
},
{
"input": "2 1\nc\na\na",
"output": "YES"
},
{
"input": "3 3\nab\nbc\ncd\ncd\ndf\nfg",
"output": "YES"
},
{
"input": "3 3\nc\na\nb\na\nd\ng",
"output": "YES"
},
{
"input": "1 1\naa\naa",
"output": "YES"
},
{
"input": "2 1\na\nb\na",
"output": "YES"
},
{
"input": "6 5\na\nb\nc\nd\ne\nf\nf\ne\nd\nz\ny",
"output": "YES"
},
{
"input": "3 2\na\nb\nc\nd\ne",
"output": "YES"
}
] | 1,680,711,450
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 31
| 0
|
first_player_count, second_player_count = list((map(int, input().split())))
first_player_words = []
second_player_words = []
for count in range(first_player_count):
first_player_words.append(input())
for count in range(second_player_count):
second_player_words.append(input())
unique_second_player_words = [word for word in second_player_words if word not in first_player_words]
if len(first_player_words) > len(unique_second_player_words) and len(set(first_player_words + second_player_words)) % 2 == 0:
print('YES')
else:
print('NO')
|
Title: PolandBall and Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
PolandBall is playing a game with EnemyBall. The rules are simple. Players have to say words in turns. You cannot say a word which was already said. PolandBall starts. The Ball which can't say a new word loses.
You're given two lists of words familiar to PolandBall and EnemyBall. Can you determine who wins the game, if both play optimally?
Input Specification:
The first input line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=103) — number of words PolandBall and EnemyBall know, respectively.
Then *n* strings follow, one per line — words familiar to PolandBall.
Then *m* strings follow, one per line — words familiar to EnemyBall.
Note that one Ball cannot know a word more than once (strings are unique), but some words can be known by both players.
Each word is non-empty and consists of no more than 500 lowercase English alphabet letters.
Output Specification:
In a single line of print the answer — "YES" if PolandBall wins and "NO" otherwise. Both Balls play optimally.
Demo Input:
['5 1\npolandball\nis\na\ncool\ncharacter\nnope\n', '2 2\nkremowka\nwadowicka\nkremowka\nwiedenska\n', '1 2\na\na\nb\n']
Demo Output:
['YES', 'YES', 'NO']
Note:
In the first example PolandBall knows much more words and wins effortlessly.
In the second example if PolandBall says kremowka first, then EnemyBall cannot use that word anymore. EnemyBall can only say wiedenska. PolandBall says wadowicka and wins.
|
```python
first_player_count, second_player_count = list((map(int, input().split())))
first_player_words = []
second_player_words = []
for count in range(first_player_count):
first_player_words.append(input())
for count in range(second_player_count):
second_player_words.append(input())
unique_second_player_words = [word for word in second_player_words if word not in first_player_words]
if len(first_player_words) > len(unique_second_player_words) and len(set(first_player_words + second_player_words)) % 2 == 0:
print('YES')
else:
print('NO')
```
| 0
|
|
651
|
A
|
Joysticks
|
PROGRAMMING
| 1,100
|
[
"dp",
"greedy",
"implementation",
"math"
] | null | null |
Friends are going to play console. They have two joysticks and only one charger for them. Initially first joystick is charged at *a*1 percent and second one is charged at *a*2 percent. You can connect charger to a joystick only at the beginning of each minute. In one minute joystick either discharges by 2 percent (if not connected to a charger) or charges by 1 percent (if connected to a charger).
Game continues while both joysticks have a positive charge. Hence, if at the beginning of minute some joystick is charged by 1 percent, it has to be connected to a charger, otherwise the game stops. If some joystick completely discharges (its charge turns to 0), the game also stops.
Determine the maximum number of minutes that game can last. It is prohibited to pause the game, i. e. at each moment both joysticks should be enabled. It is allowed for joystick to be charged by more than 100 percent.
|
The first line of the input contains two positive integers *a*1 and *a*2 (1<=≤<=*a*1,<=*a*2<=≤<=100), the initial charge level of first and second joystick respectively.
|
Output the only integer, the maximum number of minutes that the game can last. Game continues until some joystick is discharged.
|
[
"3 5\n",
"4 4\n"
] |
[
"6\n",
"5\n"
] |
In the first sample game lasts for 6 minute by using the following algorithm:
- at the beginning of the first minute connect first joystick to the charger, by the end of this minute first joystick is at 4%, second is at 3%; - continue the game without changing charger, by the end of the second minute the first joystick is at 5%, second is at 1%; - at the beginning of the third minute connect second joystick to the charger, after this minute the first joystick is at 3%, the second one is at 2%; - continue the game without changing charger, by the end of the fourth minute first joystick is at 1%, second one is at 3%; - at the beginning of the fifth minute connect first joystick to the charger, after this minute the first joystick is at 2%, the second one is at 1%; - at the beginning of the sixth minute connect second joystick to the charger, after this minute the first joystick is at 0%, the second one is at 2%.
After that the first joystick is completely discharged and the game is stopped.
| 500
|
[
{
"input": "3 5",
"output": "6"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "100 100",
"output": "197"
},
{
"input": "1 100",
"output": "98"
},
{
"input": "100 1",
"output": "98"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "8 8",
"output": "13"
},
{
"input": "7 2",
"output": "7"
},
{
"input": "24 15",
"output": "36"
},
{
"input": "19 30",
"output": "47"
},
{
"input": "15 31",
"output": "44"
},
{
"input": "14 15",
"output": "27"
},
{
"input": "58 33",
"output": "89"
},
{
"input": "15 25",
"output": "38"
},
{
"input": "59 45",
"output": "102"
},
{
"input": "3 73",
"output": "74"
},
{
"input": "48 1",
"output": "47"
},
{
"input": "100 25",
"output": "122"
},
{
"input": "40 49",
"output": "86"
},
{
"input": "85 73",
"output": "155"
},
{
"input": "29 1",
"output": "28"
},
{
"input": "74 25",
"output": "97"
},
{
"input": "24 57",
"output": "78"
},
{
"input": "23 12",
"output": "33"
},
{
"input": "2 99",
"output": "99"
},
{
"input": "98 2",
"output": "97"
},
{
"input": "2 97",
"output": "97"
},
{
"input": "30 54",
"output": "81"
},
{
"input": "32 53",
"output": "82"
},
{
"input": "32 54",
"output": "84"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "2 1",
"output": "1"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "1 3",
"output": "2"
},
{
"input": "3 1",
"output": "2"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "3 2",
"output": "3"
}
] | 1,590,701,664
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 6
| 156
| 3,481,600
|
f,s = map(int, input().split())
mem = [[0 for i in range(500)]for i in range(500)]
def check(a,b):
if(mem[a][b]):
return mem[a][b]
if(a <=0 or b<= 0):
return 0
else:
mem[a][b] = 1 + max(check(a-2, b+1), check(a+1, b-2))
return mem[a][b]
print(check(f, s))
|
Title: Joysticks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Friends are going to play console. They have two joysticks and only one charger for them. Initially first joystick is charged at *a*1 percent and second one is charged at *a*2 percent. You can connect charger to a joystick only at the beginning of each minute. In one minute joystick either discharges by 2 percent (if not connected to a charger) or charges by 1 percent (if connected to a charger).
Game continues while both joysticks have a positive charge. Hence, if at the beginning of minute some joystick is charged by 1 percent, it has to be connected to a charger, otherwise the game stops. If some joystick completely discharges (its charge turns to 0), the game also stops.
Determine the maximum number of minutes that game can last. It is prohibited to pause the game, i. e. at each moment both joysticks should be enabled. It is allowed for joystick to be charged by more than 100 percent.
Input Specification:
The first line of the input contains two positive integers *a*1 and *a*2 (1<=≤<=*a*1,<=*a*2<=≤<=100), the initial charge level of first and second joystick respectively.
Output Specification:
Output the only integer, the maximum number of minutes that the game can last. Game continues until some joystick is discharged.
Demo Input:
['3 5\n', '4 4\n']
Demo Output:
['6\n', '5\n']
Note:
In the first sample game lasts for 6 minute by using the following algorithm:
- at the beginning of the first minute connect first joystick to the charger, by the end of this minute first joystick is at 4%, second is at 3%; - continue the game without changing charger, by the end of the second minute the first joystick is at 5%, second is at 1%; - at the beginning of the third minute connect second joystick to the charger, after this minute the first joystick is at 3%, the second one is at 2%; - continue the game without changing charger, by the end of the fourth minute first joystick is at 1%, second one is at 3%; - at the beginning of the fifth minute connect first joystick to the charger, after this minute the first joystick is at 2%, the second one is at 1%; - at the beginning of the sixth minute connect second joystick to the charger, after this minute the first joystick is at 0%, the second one is at 2%.
After that the first joystick is completely discharged and the game is stopped.
|
```python
f,s = map(int, input().split())
mem = [[0 for i in range(500)]for i in range(500)]
def check(a,b):
if(mem[a][b]):
return mem[a][b]
if(a <=0 or b<= 0):
return 0
else:
mem[a][b] = 1 + max(check(a-2, b+1), check(a+1, b-2))
return mem[a][b]
print(check(f, s))
```
| 0
|
|
1,004
|
A
|
Sonya and Hotels
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Sonya decided that having her own hotel business is the best way of earning money because she can profit and rest wherever she wants.
The country where Sonya lives is an endless line. There is a city in each integer coordinate on this line. She has $n$ hotels, where the $i$-th hotel is located in the city with coordinate $x_i$. Sonya is a smart girl, so she does not open two or more hotels in the same city.
Sonya understands that her business needs to be expanded by opening new hotels, so she decides to build one more. She wants to make the minimum distance from this hotel to all others to be equal to $d$. The girl understands that there are many possible locations to construct such a hotel. Thus she wants to know the number of possible coordinates of the cities where she can build a new hotel.
Because Sonya is lounging in a jacuzzi in one of her hotels, she is asking you to find the number of cities where she can build a new hotel so that the minimum distance from the original $n$ hotels to the new one is equal to $d$.
|
The first line contains two integers $n$ and $d$ ($1\leq n\leq 100$, $1\leq d\leq 10^9$) — the number of Sonya's hotels and the needed minimum distance from a new hotel to all others.
The second line contains $n$ different integers in strictly increasing order $x_1, x_2, \ldots, x_n$ ($-10^9\leq x_i\leq 10^9$) — coordinates of Sonya's hotels.
|
Print the number of cities where Sonya can build a new hotel so that the minimum distance from this hotel to all others is equal to $d$.
|
[
"4 3\n-3 2 9 16\n",
"5 2\n4 8 11 18 19\n"
] |
[
"6\n",
"5\n"
] |
In the first example, there are $6$ possible cities where Sonya can build a hotel. These cities have coordinates $-6$, $5$, $6$, $12$, $13$, and $19$.
In the second example, there are $5$ possible cities where Sonya can build a hotel. These cities have coordinates $2$, $6$, $13$, $16$, and $21$.
| 500
|
[
{
"input": "4 3\n-3 2 9 16",
"output": "6"
},
{
"input": "5 2\n4 8 11 18 19",
"output": "5"
},
{
"input": "10 10\n-67 -59 -49 -38 -8 20 41 59 74 83",
"output": "8"
},
{
"input": "10 10\n0 20 48 58 81 95 111 137 147 159",
"output": "9"
},
{
"input": "100 1\n0 1 2 3 4 5 7 8 10 11 12 13 14 15 16 17 19 21 22 23 24 25 26 27 28 30 32 33 36 39 40 41 42 46 48 53 54 55 59 60 61 63 65 68 70 71 74 75 76 79 80 81 82 84 88 89 90 91 93 94 96 97 98 100 101 102 105 106 107 108 109 110 111 113 114 115 116 117 118 120 121 122 125 126 128 131 132 133 134 135 137 138 139 140 143 144 146 147 148 149",
"output": "47"
},
{
"input": "1 1000000000\n-1000000000",
"output": "2"
},
{
"input": "2 1000000000\n-1000000000 1000000000",
"output": "3"
},
{
"input": "100 2\n1 3 5 6 8 9 12 13 14 17 18 21 22 23 24 25 26 27 29 30 34 35 36 39 41 44 46 48 52 53 55 56 57 59 61 63 64 66 68 69 70 71 72 73 75 76 77 79 80 81 82 87 88 91 92 93 94 95 96 97 99 100 102 103 104 106 109 110 111 112 113 114 115 117 118 119 120 122 124 125 127 128 129 130 131 132 133 134 136 137 139 140 141 142 143 145 146 148 149 150",
"output": "6"
},
{
"input": "100 3\n0 1 3 6 7 8 9 10 13 14 16 17 18 20 21 22 24 26 27 30 33 34 35 36 37 39 42 43 44 45 46 48 53 54 55 56 57 58 61 63 64 65 67 69 70 72 73 76 77 78 79 81 82 83 85 86 87 88 90 92 93 95 96 97 98 99 100 101 104 105 108 109 110 113 114 115 116 118 120 121 123 124 125 128 130 131 132 133 134 135 136 137 139 140 141 142 146 147 148 150",
"output": "2"
},
{
"input": "1 1000000000\n1000000000",
"output": "2"
},
{
"input": "10 2\n-93 -62 -53 -42 -38 11 57 58 87 94",
"output": "17"
},
{
"input": "2 500000000\n-1000000000 1000000000",
"output": "4"
},
{
"input": "100 10\n-489 -476 -445 -432 -430 -421 -420 -418 -412 -411 -404 -383 -356 -300 -295 -293 -287 -276 -265 -263 -258 -251 -249 -246 -220 -219 -205 -186 -166 -157 -143 -137 -136 -130 -103 -86 -80 -69 -67 -55 -43 -41 -40 -26 -19 -9 16 29 41 42 54 76 84 97 98 99 101 115 134 151 157 167 169 185 197 204 208 226 227 232 234 249 259 266 281 282 293 298 300 306 308 313 319 328 331 340 341 344 356 362 366 380 390 399 409 411 419 444 455 498",
"output": "23"
},
{
"input": "1 1000000000\n999999999",
"output": "2"
},
{
"input": "1 1\n-5",
"output": "2"
},
{
"input": "2 1\n-1000000000 1000000000",
"output": "4"
},
{
"input": "1 2\n1",
"output": "2"
},
{
"input": "4 5\n0 20 40 60",
"output": "8"
},
{
"input": "1 1\n-10",
"output": "2"
},
{
"input": "1 1\n-1000000000",
"output": "2"
},
{
"input": "1 1000000000\n0",
"output": "2"
},
{
"input": "1 2\n-10",
"output": "2"
},
{
"input": "1 1\n2",
"output": "2"
},
{
"input": "1 5\n-100",
"output": "2"
},
{
"input": "2 1000000000\n999999999 1000000000",
"output": "2"
},
{
"input": "2 2\n0 5",
"output": "4"
},
{
"input": "1 2\n-5",
"output": "2"
},
{
"input": "1 1\n1",
"output": "2"
},
{
"input": "1 5\n-20",
"output": "2"
},
{
"input": "2 100000000\n-1000000000 1000000000",
"output": "4"
},
{
"input": "1 1000000000\n147483641",
"output": "2"
},
{
"input": "3 3\n1 8 9",
"output": "4"
},
{
"input": "2 1\n1 1000000000",
"output": "4"
},
{
"input": "1 2\n-4",
"output": "2"
},
{
"input": "2 1\n-1000000000 -1",
"output": "4"
}
] | 1,674,412,853
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 45
| 62
| 0
|
x, y = map(int, input().split())
a = list(map(int, input().split()))
ans = 2
for i in range(x-1):
if a[i] + y <= a[i+1] - y:
ans += 1
if a[i+1] - y > a[i] + y:
ans += 1
print(ans)
|
Title: Sonya and Hotels
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sonya decided that having her own hotel business is the best way of earning money because she can profit and rest wherever she wants.
The country where Sonya lives is an endless line. There is a city in each integer coordinate on this line. She has $n$ hotels, where the $i$-th hotel is located in the city with coordinate $x_i$. Sonya is a smart girl, so she does not open two or more hotels in the same city.
Sonya understands that her business needs to be expanded by opening new hotels, so she decides to build one more. She wants to make the minimum distance from this hotel to all others to be equal to $d$. The girl understands that there are many possible locations to construct such a hotel. Thus she wants to know the number of possible coordinates of the cities where she can build a new hotel.
Because Sonya is lounging in a jacuzzi in one of her hotels, she is asking you to find the number of cities where she can build a new hotel so that the minimum distance from the original $n$ hotels to the new one is equal to $d$.
Input Specification:
The first line contains two integers $n$ and $d$ ($1\leq n\leq 100$, $1\leq d\leq 10^9$) — the number of Sonya's hotels and the needed minimum distance from a new hotel to all others.
The second line contains $n$ different integers in strictly increasing order $x_1, x_2, \ldots, x_n$ ($-10^9\leq x_i\leq 10^9$) — coordinates of Sonya's hotels.
Output Specification:
Print the number of cities where Sonya can build a new hotel so that the minimum distance from this hotel to all others is equal to $d$.
Demo Input:
['4 3\n-3 2 9 16\n', '5 2\n4 8 11 18 19\n']
Demo Output:
['6\n', '5\n']
Note:
In the first example, there are $6$ possible cities where Sonya can build a hotel. These cities have coordinates $-6$, $5$, $6$, $12$, $13$, and $19$.
In the second example, there are $5$ possible cities where Sonya can build a hotel. These cities have coordinates $2$, $6$, $13$, $16$, and $21$.
|
```python
x, y = map(int, input().split())
a = list(map(int, input().split()))
ans = 2
for i in range(x-1):
if a[i] + y <= a[i+1] - y:
ans += 1
if a[i+1] - y > a[i] + y:
ans += 1
print(ans)
```
| 3
|
|
2
|
A
|
Winner
|
PROGRAMMING
| 1,500
|
[
"hashing",
"implementation"
] |
A. Winner
|
1
|
64
|
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
|
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
|
Print the name of the winner.
|
[
"3\nmike 3\nandrew 5\nmike 2\n",
"3\nandrew 3\nandrew 2\nmike 5\n"
] |
[
"andrew\n",
"andrew\n"
] |
none
| 0
|
[
{
"input": "3\nmike 3\nandrew 5\nmike 2",
"output": "andrew"
},
{
"input": "3\nandrew 3\nandrew 2\nmike 5",
"output": "andrew"
},
{
"input": "5\nkaxqybeultn -352\nmgochgrmeyieyskhuourfg -910\nkaxqybeultn 691\nmgochgrmeyieyskhuourfg -76\nkaxqybeultn -303",
"output": "kaxqybeultn"
},
{
"input": "7\nksjuuerbnlklcfdjeyq 312\ndthjlkrvvbyahttifpdewvyslsh -983\nksjuuerbnlklcfdjeyq 268\ndthjlkrvvbyahttifpdewvyslsh 788\nksjuuerbnlklcfdjeyq -79\nksjuuerbnlklcfdjeyq -593\nksjuuerbnlklcfdjeyq 734",
"output": "ksjuuerbnlklcfdjeyq"
},
{
"input": "12\natrtthfpcvishmqbakprquvnejr 185\natrtthfpcvishmqbakprquvnejr -699\natrtthfpcvishmqbakprquvnejr -911\natrtthfpcvishmqbakprquvnejr -220\nfcgslzkicjrpbqaifgweyzreajjfdo 132\nfcgslzkicjrpbqaifgweyzreajjfdo -242\nm 177\nm -549\natrtthfpcvishmqbakprquvnejr -242\nm 38\natrtthfpcvishmqbakprquvnejr -761\nfcgslzkicjrpbqaifgweyzreajjfdo 879",
"output": "fcgslzkicjrpbqaifgweyzreajjfdo"
},
{
"input": "15\naawtvezfntstrcpgbzjbf 681\nzhahpvqiptvksnbjkdvmknb -74\naawtvezfntstrcpgbzjbf 661\njpdwmyke 474\naawtvezfntstrcpgbzjbf -547\naawtvezfntstrcpgbzjbf 600\nzhahpvqiptvksnbjkdvmknb -11\njpdwmyke 711\nbjmj 652\naawtvezfntstrcpgbzjbf -1000\naawtvezfntstrcpgbzjbf -171\nbjmj -302\naawtvezfntstrcpgbzjbf 961\nzhahpvqiptvksnbjkdvmknb 848\nbjmj -735",
"output": "aawtvezfntstrcpgbzjbf"
},
{
"input": "17\nqdplghhx -649\nivhgbxiv 424\nivhgbxiv -72\nivhgbxiv 479\nugowfouebkelargxylsxn 83\nugowfouebkelargxylsxn -840\nivhgbxiv 382\nqdplghhx -904\nivhgbxiv -710\nugowfouebkelargxylsxn -838\nqdplghhx -974\nqdplghhx 571\nivhgbxiv -145\nugowfouebkelargxylsxn -788\nivhgbxiv 209\nivhgbxiv 420\nqdplghhx -158",
"output": "ivhgbxiv"
}
] | 1,635,753,323
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 124
| 4,505,600
|
n = int(input())
dic = {}
for i in range(n):
name,s = [x for x in input().split(" ")]
if name in dic:
dic[name][0] += int(s)
else:
dic[name] = [0,0]
dic[name][0] = int(s)
dic[name][1] = i
ans = ""
maxi = -1000
minind = 1001
for k,v in dic.items():
if v[0] >= maxi and v[1] < minind:
maxi = v[0]
minind = v[1]
ans = k
print(ans)
|
Title: Winner
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
Input Specification:
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
Output Specification:
Print the name of the winner.
Demo Input:
['3\nmike 3\nandrew 5\nmike 2\n', '3\nandrew 3\nandrew 2\nmike 5\n']
Demo Output:
['andrew\n', 'andrew\n']
Note:
none
|
```python
n = int(input())
dic = {}
for i in range(n):
name,s = [x for x in input().split(" ")]
if name in dic:
dic[name][0] += int(s)
else:
dic[name] = [0,0]
dic[name][0] = int(s)
dic[name][1] = i
ans = ""
maxi = -1000
minind = 1001
for k,v in dic.items():
if v[0] >= maxi and v[1] < minind:
maxi = v[0]
minind = v[1]
ans = k
print(ans)
```
| 0
|
277
|
A
|
Learning Languages
|
PROGRAMMING
| 1,400
|
[
"dfs and similar",
"dsu"
] | null | null |
The "BerCorp" company has got *n* employees. These employees can use *m* approved official languages for the formal correspondence. The languages are numbered with integers from 1 to *m*. For each employee we have the list of languages, which he knows. This list could be empty, i. e. an employee may know no official languages. But the employees are willing to learn any number of official languages, as long as the company pays their lessons. A study course in one language for one employee costs 1 berdollar.
Find the minimum sum of money the company needs to spend so as any employee could correspond to any other one (their correspondence can be indirect, i. e. other employees can help out translating).
|
The first line contains two integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of employees and the number of languages.
Then *n* lines follow — each employee's language list. At the beginning of the *i*-th line is integer *k**i* (0<=≤<=*k**i*<=≤<=*m*) — the number of languages the *i*-th employee knows. Next, the *i*-th line contains *k**i* integers — *a**ij* (1<=≤<=*a**ij*<=≤<=*m*) — the identifiers of languages the *i*-th employee knows. It is guaranteed that all the identifiers in one list are distinct. Note that an employee may know zero languages.
The numbers in the lines are separated by single spaces.
|
Print a single integer — the minimum amount of money to pay so that in the end every employee could write a letter to every other one (other employees can help out translating).
|
[
"5 5\n1 2\n2 2 3\n2 3 4\n2 4 5\n1 5\n",
"8 7\n0\n3 1 2 3\n1 1\n2 5 4\n2 6 7\n1 3\n2 7 4\n1 1\n",
"2 2\n1 2\n0\n"
] |
[
"0\n",
"2\n",
"1\n"
] |
In the second sample the employee 1 can learn language 2, and employee 8 can learn language 4.
In the third sample employee 2 must learn language 2.
| 500
|
[
{
"input": "5 5\n1 2\n2 2 3\n2 3 4\n2 4 5\n1 5",
"output": "0"
},
{
"input": "8 7\n0\n3 1 2 3\n1 1\n2 5 4\n2 6 7\n1 3\n2 7 4\n1 1",
"output": "2"
},
{
"input": "2 2\n1 2\n0",
"output": "1"
},
{
"input": "2 2\n0\n0",
"output": "2"
},
{
"input": "5 5\n1 3\n0\n0\n2 4 1\n0",
"output": "4"
},
{
"input": "6 2\n0\n0\n2 1 2\n1 1\n1 1\n0",
"output": "3"
},
{
"input": "7 3\n3 1 3 2\n3 2 1 3\n2 2 3\n1 1\n2 2 3\n3 3 2 1\n3 2 3 1",
"output": "0"
},
{
"input": "8 4\n0\n0\n4 2 3 1 4\n4 2 1 4 3\n3 4 3 1\n1 2\n2 4 1\n2 4 2",
"output": "2"
},
{
"input": "10 10\n5 7 5 2 8 1\n7 10 6 9 5 8 2 4\n2 2 7\n5 8 6 9 10 1\n2 9 5\n3 6 5 2\n6 5 8 7 9 10 4\n0\n1 1\n2 8 6",
"output": "1"
},
{
"input": "11 42\n4 20 26 9 24\n14 34 7 28 32 12 15 26 4 10 38 21 20 8 11\n4 21 8 36 6\n11 32 1 39 11 21 10 25 17 26 15 4\n2 8 12\n2 21 31\n8 17 10 3 39 32 30 5 15\n20 24 20 38 17 4 7 21 19 32 28 31 22 30 37 10 5 33 2 13 9\n7 38 34 42 27 20 11 6\n3 40 3 39\n14 39 40 4 30 33 8 36 28 14 23 16 7 25 9",
"output": "0"
},
{
"input": "100 100\n1 33\n0\n2 35 4\n2 40 78\n1 69\n0\n1 2\n0\n0\n2 81 34\n1 45\n0\n1 87\n1 50\n1 97\n0\n2 100 59\n0\n0\n0\n1 45\n0\n0\n0\n1 6\n1 54\n0\n0\n0\n4 79 96 52 84\n1 86\n0\n0\n0\n0\n0\n0\n0\n0\n3 90 2 80\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 2\n0\n1 64\n0\n1 78\n1 82\n0\n0\n0\n0\n0\n1 6\n0\n0\n2 47 57\n1 95\n0\n2 91 79\n0\n1 27\n0\n1 74\n0\n0\n1 14\n0\n0\n2 90 19\n0\n1 10\n0\n0\n0\n0\n0\n1 57\n0\n2 28 50\n0\n0\n0\n1 47\n0\n0\n1 14\n0\n1 84\n1 1\n0\n0",
"output": "87"
},
{
"input": "2 2\n2 1 2\n2 1 2",
"output": "0"
},
{
"input": "2 2\n2 1 2\n1 1",
"output": "0"
},
{
"input": "2 2\n1 2\n1 1",
"output": "1"
},
{
"input": "3 100\n0\n0\n0",
"output": "3"
},
{
"input": "100 100\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "100"
},
{
"input": "3 3\n0\n0\n0",
"output": "3"
}
] | 1,601,026,201
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 218
| 409,600
|
from collections import defaultdict
def DFS(graph,x,visited):
stack = [x]
while len(stack):
temp = stack.pop()
visited[temp] = 1
for j in graph[temp]:
if visited[j] == 0:
stack.append(j)
n,m = map(int,input().split())
d = defaultdict(set)
graph = defaultdict(list)
for j in range(n):
l = list(map(int,input().split()))
l = list(l[1:])
for k in l:
d[j+1].add(k)
for j in range(1,n+1):
for k in range(j+1,n+1):
l = d[j].intersection(d[k])
if len(l):
graph[j].append(k)
graph[k].append(j)
visited = [0 for i in range(n+1)]
c = 0
for j in range(1,n+1):
if visited[j] == 0:
DFS(graph,j,visited)
c = c + 1
print(c-1)
|
Title: Learning Languages
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The "BerCorp" company has got *n* employees. These employees can use *m* approved official languages for the formal correspondence. The languages are numbered with integers from 1 to *m*. For each employee we have the list of languages, which he knows. This list could be empty, i. e. an employee may know no official languages. But the employees are willing to learn any number of official languages, as long as the company pays their lessons. A study course in one language for one employee costs 1 berdollar.
Find the minimum sum of money the company needs to spend so as any employee could correspond to any other one (their correspondence can be indirect, i. e. other employees can help out translating).
Input Specification:
The first line contains two integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of employees and the number of languages.
Then *n* lines follow — each employee's language list. At the beginning of the *i*-th line is integer *k**i* (0<=≤<=*k**i*<=≤<=*m*) — the number of languages the *i*-th employee knows. Next, the *i*-th line contains *k**i* integers — *a**ij* (1<=≤<=*a**ij*<=≤<=*m*) — the identifiers of languages the *i*-th employee knows. It is guaranteed that all the identifiers in one list are distinct. Note that an employee may know zero languages.
The numbers in the lines are separated by single spaces.
Output Specification:
Print a single integer — the minimum amount of money to pay so that in the end every employee could write a letter to every other one (other employees can help out translating).
Demo Input:
['5 5\n1 2\n2 2 3\n2 3 4\n2 4 5\n1 5\n', '8 7\n0\n3 1 2 3\n1 1\n2 5 4\n2 6 7\n1 3\n2 7 4\n1 1\n', '2 2\n1 2\n0\n']
Demo Output:
['0\n', '2\n', '1\n']
Note:
In the second sample the employee 1 can learn language 2, and employee 8 can learn language 4.
In the third sample employee 2 must learn language 2.
|
```python
from collections import defaultdict
def DFS(graph,x,visited):
stack = [x]
while len(stack):
temp = stack.pop()
visited[temp] = 1
for j in graph[temp]:
if visited[j] == 0:
stack.append(j)
n,m = map(int,input().split())
d = defaultdict(set)
graph = defaultdict(list)
for j in range(n):
l = list(map(int,input().split()))
l = list(l[1:])
for k in l:
d[j+1].add(k)
for j in range(1,n+1):
for k in range(j+1,n+1):
l = d[j].intersection(d[k])
if len(l):
graph[j].append(k)
graph[k].append(j)
visited = [0 for i in range(n+1)]
c = 0
for j in range(1,n+1):
if visited[j] == 0:
DFS(graph,j,visited)
c = c + 1
print(c-1)
```
| 0
|
|
166
|
C
|
Median
|
PROGRAMMING
| 1,500
|
[
"greedy",
"math",
"sortings"
] | null | null |
A median in an array with the length of *n* is an element which occupies position number after we sort the elements in the non-decreasing order (the array elements are numbered starting with 1). A median of an array (2,<=6,<=1,<=2,<=3) is the number 2, and a median of array (0,<=96,<=17,<=23) — the number 17.
We define an expression as the integer part of dividing number *a* by number *b*.
One day Vasya showed Petya an array consisting of *n* integers and suggested finding the array's median. Petya didn't even look at the array and said that it equals *x*. Petya is a very honest boy, so he decided to add several numbers to the given array so that the median of the resulting array would be equal to *x*.
Petya can add any integers from 1 to 105 to the array, including the same numbers. Of course, he can add nothing to the array. If a number is added multiple times, then we should consider it the number of times it occurs. It is not allowed to delete of change initial numbers of the array.
While Petya is busy distracting Vasya, your task is to find the minimum number of elements he will need.
|
The first input line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=500, 1<=≤<=*x*<=≤<=105) — the initial array's length and the required median's value. The second line contains *n* space-separated numbers — the initial array. The elements of the array are integers from 1 to 105. The array elements are not necessarily different.
|
Print the only integer — the minimum number of elements Petya needs to add to the array so that its median equals *x*.
|
[
"3 10\n10 20 30\n",
"3 4\n1 2 3\n"
] |
[
"1\n",
"4\n"
] |
In the first sample we can add number 9 to array (10, 20, 30). The resulting array (9, 10, 20, 30) will have a median in position <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7dd92241318a531b780c7783dfa446a3e413115e.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 10.
In the second sample you should add numbers 4, 5, 5, 5. The resulting array has median equal to 4.
| 1,000
|
[
{
"input": "3 10\n10 20 30",
"output": "1"
},
{
"input": "3 4\n1 2 3",
"output": "4"
},
{
"input": "2 2\n3 2",
"output": "0"
},
{
"input": "5 1\n1 1 2 1 2",
"output": "0"
},
{
"input": "5 4\n5 5 4 3 5",
"output": "1"
},
{
"input": "10 2\n2 2 1 3 2 1 2 1 1 3",
"output": "0"
},
{
"input": "10 55749\n46380 58202 54935 26290 18295 83040 6933 89652 75187 93963",
"output": "1"
},
{
"input": "10 809\n949 31 175 118 640 588 809 398 792 743",
"output": "7"
},
{
"input": "50 1\n1 2 1 2 1 1 1 2 2 2 2 2 1 1 2 2 2 2 1 2 2 2 1 2 1 1 2 1 1 1 2 2 2 2 2 2 2 2 1 2 2 1 1 1 2 2 1 2 2 2",
"output": "12"
},
{
"input": "100 6\n7 5 2 8 4 9 4 8 6 1 7 8 7 8 1 5 4 10 9 10 7 5 6 2 1 6 9 10 6 5 10 9 9 5 1 4 4 5 4 4 1 1 6 7 4 9 3 5 6 5 6 3 7 6 9 4 4 8 7 10 6 10 4 6 6 5 1 9 6 7 10 1 9 4 5 3 7 7 4 4 7 4 7 3 3 7 2 5 5 3 8 9 6 9 4 5 5 9 1 7",
"output": "0"
},
{
"input": "100 813\n285 143 378 188 972 950 222 557 170 755 470 164 800 553 146 820 842 62 496 980 746 944 677 828 465 577 791 277 303 515 561 653 925 692 871 424 626 795 813 343 418 280 123 364 496 447 435 404 645 141 169 315 830 289 450 675 81 212 509 661 7 217 468 877 172 141 475 409 178 71 936 843 761 889 417 282 530 612 328 572 310 632 498 271 19 753 3 787 31 266 251 897 450 206 731 678 64 417 664 224",
"output": "69"
},
{
"input": "100 37\n20 20 3 35 36 14 30 9 33 36 32 46 43 22 43 50 34 6 13 25 1 34 10 6 21 30 19 17 1 23 9 23 38 21 7 43 49 28 33 42 4 19 39 23 12 42 31 13 26 23 1 26 24 48 10 6 12 48 40 18 10 26 9 5 22 45 46 23 46 34 34 45 3 7 16 39 14 29 48 1 12 37 4 20 29 26 35 38 20 47 39 29 12 35 4 32 26 1 50 33",
"output": "53"
},
{
"input": "100 20\n40 44 41 81 59 96 91 49 57 41 44 42 65 31 74 70 54 47 51 7 71 7 75 79 13 20 2 78 66 34 81 84 18 37 85 42 5 40 17 15 66 10 95 93 20 43 63 83 60 61 9 33 68 81 97 25 39 37 22 90 63 45 33 89 1 68 37 66 89 86 6 29 40 33 44 11 83 21 11 32 92 41 45 79 29 86 89 87 14 1 32 22 25 90 56 6 1 49 15 89",
"output": "58"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 2\n1",
"output": "2"
},
{
"input": "1 1\n2",
"output": "1"
},
{
"input": "4 1\n2 3 4 5",
"output": "4"
},
{
"input": "9 228\n1 1 1 1 1 1 228 228 228",
"output": "4"
}
] | 1,603,335,470
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 1
| 2,000
| 102,400
|
n,m=[int(x) for x in input().split()]
arr=[int(x) for x in input().split()]
arr.sort()
median=arr[(n+1)//2-1]
ans=0
while median!=m:
arr.append(m)
ans+=1
arr.sort()
median=arr[(n+1)//2-1]
print(ans)
|
Title: Median
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A median in an array with the length of *n* is an element which occupies position number after we sort the elements in the non-decreasing order (the array elements are numbered starting with 1). A median of an array (2,<=6,<=1,<=2,<=3) is the number 2, and a median of array (0,<=96,<=17,<=23) — the number 17.
We define an expression as the integer part of dividing number *a* by number *b*.
One day Vasya showed Petya an array consisting of *n* integers and suggested finding the array's median. Petya didn't even look at the array and said that it equals *x*. Petya is a very honest boy, so he decided to add several numbers to the given array so that the median of the resulting array would be equal to *x*.
Petya can add any integers from 1 to 105 to the array, including the same numbers. Of course, he can add nothing to the array. If a number is added multiple times, then we should consider it the number of times it occurs. It is not allowed to delete of change initial numbers of the array.
While Petya is busy distracting Vasya, your task is to find the minimum number of elements he will need.
Input Specification:
The first input line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=500, 1<=≤<=*x*<=≤<=105) — the initial array's length and the required median's value. The second line contains *n* space-separated numbers — the initial array. The elements of the array are integers from 1 to 105. The array elements are not necessarily different.
Output Specification:
Print the only integer — the minimum number of elements Petya needs to add to the array so that its median equals *x*.
Demo Input:
['3 10\n10 20 30\n', '3 4\n1 2 3\n']
Demo Output:
['1\n', '4\n']
Note:
In the first sample we can add number 9 to array (10, 20, 30). The resulting array (9, 10, 20, 30) will have a median in position <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7dd92241318a531b780c7783dfa446a3e413115e.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 10.
In the second sample you should add numbers 4, 5, 5, 5. The resulting array has median equal to 4.
|
```python
n,m=[int(x) for x in input().split()]
arr=[int(x) for x in input().split()]
arr.sort()
median=arr[(n+1)//2-1]
ans=0
while median!=m:
arr.append(m)
ans+=1
arr.sort()
median=arr[(n+1)//2-1]
print(ans)
```
| 0
|
|
362
|
E
|
Petya and Pipes
|
PROGRAMMING
| 2,300
|
[
"flows",
"graphs",
"shortest paths"
] | null | null |
A little boy Petya dreams of growing up and becoming the Head Berland Plumber. He is thinking of the problems he will have to solve in the future. Unfortunately, Petya is too inexperienced, so you are about to solve one of such problems for Petya, the one he's the most interested in.
The Berland capital has *n* water tanks numbered from 1 to *n*. These tanks are connected by unidirectional pipes in some manner. Any pair of water tanks is connected by at most one pipe in each direction. Each pipe has a strictly positive integer width. Width determines the number of liters of water per a unit of time this pipe can transport. The water goes to the city from the main water tank (its number is 1). The water must go through some pipe path and get to the sewer tank with cleaning system (its number is *n*).
Petya wants to increase the width of some subset of pipes by at most *k* units in total so that the width of each pipe remains integer. Help him determine the maximum amount of water that can be transmitted per a unit of time from the main tank to the sewer tank after such operation is completed.
|
The first line contains two space-separated integers *n* and *k* (2<=≤<=*n*<=≤<=50, 0<=≤<=*k*<=≤<=1000). Then follow *n* lines, each line contains *n* integers separated by single spaces. The *i*<=+<=1-th row and *j*-th column contain number *c**ij* — the width of the pipe that goes from tank *i* to tank *j* (0<=≤<=*c**ij*<=≤<=106,<=*c**ii*<==<=0). If *c**ij*<==<=0, then there is no pipe from tank *i* to tank *j*.
|
Print a single integer — the maximum amount of water that can be transmitted from the main tank to the sewer tank per a unit of time.
|
[
"5 7\n0 1 0 2 0\n0 0 4 10 0\n0 0 0 0 5\n0 0 0 0 10\n0 0 0 0 0\n",
"5 10\n0 1 0 0 0\n0 0 2 0 0\n0 0 0 3 0\n0 0 0 0 4\n100 0 0 0 0\n"
] |
[
"10\n",
"5\n"
] |
In the first test Petya can increase width of the pipe that goes from the 1st to the 2nd water tank by 7 units.
In the second test Petya can increase width of the pipe that goes from the 1st to the 2nd water tank by 4 units, from the 2nd to the 3rd water tank by 3 units, from the 3rd to the 4th water tank by 2 units and from the 4th to 5th water tank by 1 unit.
| 3,000
|
[] | 1,692,088,899
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 31
| 0
|
print("_RANDOM_GUESS_1692088899.2331738")# 1692088899.2331903
|
Title: Petya and Pipes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A little boy Petya dreams of growing up and becoming the Head Berland Plumber. He is thinking of the problems he will have to solve in the future. Unfortunately, Petya is too inexperienced, so you are about to solve one of such problems for Petya, the one he's the most interested in.
The Berland capital has *n* water tanks numbered from 1 to *n*. These tanks are connected by unidirectional pipes in some manner. Any pair of water tanks is connected by at most one pipe in each direction. Each pipe has a strictly positive integer width. Width determines the number of liters of water per a unit of time this pipe can transport. The water goes to the city from the main water tank (its number is 1). The water must go through some pipe path and get to the sewer tank with cleaning system (its number is *n*).
Petya wants to increase the width of some subset of pipes by at most *k* units in total so that the width of each pipe remains integer. Help him determine the maximum amount of water that can be transmitted per a unit of time from the main tank to the sewer tank after such operation is completed.
Input Specification:
The first line contains two space-separated integers *n* and *k* (2<=≤<=*n*<=≤<=50, 0<=≤<=*k*<=≤<=1000). Then follow *n* lines, each line contains *n* integers separated by single spaces. The *i*<=+<=1-th row and *j*-th column contain number *c**ij* — the width of the pipe that goes from tank *i* to tank *j* (0<=≤<=*c**ij*<=≤<=106,<=*c**ii*<==<=0). If *c**ij*<==<=0, then there is no pipe from tank *i* to tank *j*.
Output Specification:
Print a single integer — the maximum amount of water that can be transmitted from the main tank to the sewer tank per a unit of time.
Demo Input:
['5 7\n0 1 0 2 0\n0 0 4 10 0\n0 0 0 0 5\n0 0 0 0 10\n0 0 0 0 0\n', '5 10\n0 1 0 0 0\n0 0 2 0 0\n0 0 0 3 0\n0 0 0 0 4\n100 0 0 0 0\n']
Demo Output:
['10\n', '5\n']
Note:
In the first test Petya can increase width of the pipe that goes from the 1st to the 2nd water tank by 7 units.
In the second test Petya can increase width of the pipe that goes from the 1st to the 2nd water tank by 4 units, from the 2nd to the 3rd water tank by 3 units, from the 3rd to the 4th water tank by 2 units and from the 4th to 5th water tank by 1 unit.
|
```python
print("_RANDOM_GUESS_1692088899.2331738")# 1692088899.2331903
```
| 0
|
|
813
|
C
|
The Tag Game
|
PROGRAMMING
| 1,700
|
[
"dfs and similar",
"graphs"
] | null | null |
Alice got tired of playing the tag game by the usual rules so she offered Bob a little modification to it. Now the game should be played on an undirected rooted tree of *n* vertices. Vertex 1 is the root of the tree.
Alice starts at vertex 1 and Bob starts at vertex *x* (*x*<=≠<=1). The moves are made in turns, Bob goes first. In one move one can either stay at the current vertex or travel to the neighbouring one.
The game ends when Alice goes to the same vertex where Bob is standing. Alice wants to minimize the total number of moves and Bob wants to maximize it.
You should write a program which will determine how many moves will the game last.
|
The first line contains two integer numbers *n* and *x* (2<=≤<=*n*<=≤<=2·105, 2<=≤<=*x*<=≤<=*n*).
Each of the next *n*<=-<=1 lines contains two integer numbers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=*n*) — edges of the tree. It is guaranteed that the edges form a valid tree.
|
Print the total number of moves Alice and Bob will make.
|
[
"4 3\n1 2\n2 3\n2 4\n",
"5 2\n1 2\n2 3\n3 4\n2 5\n"
] |
[
"4\n",
"6\n"
] |
In the first example the tree looks like this:
The red vertex is Alice's starting position, the blue one is Bob's. Bob will make the game run the longest by standing at the vertex 3 during all the game. So here are the moves:
B: stay at vertex 3
A: go to vertex 2
B: stay at vertex 3
A: go to vertex 3
In the second example the tree looks like this:
The moves in the optimal strategy are:
B: go to vertex 3
A: go to vertex 2
B: go to vertex 4
A: go to vertex 3
B: stay at vertex 4
A: go to vertex 4
| 0
|
[
{
"input": "4 3\n1 2\n2 3\n2 4",
"output": "4"
},
{
"input": "5 2\n1 2\n2 3\n3 4\n2 5",
"output": "6"
},
{
"input": "2 2\n2 1",
"output": "2"
},
{
"input": "3 3\n2 1\n3 1",
"output": "2"
},
{
"input": "3 3\n1 2\n3 2",
"output": "4"
},
{
"input": "10 4\n5 4\n8 3\n4 6\n5 3\n7 9\n1 3\n5 10\n2 9\n9 8",
"output": "8"
},
{
"input": "10 7\n8 7\n2 8\n2 3\n10 6\n4 6\n4 1\n10 5\n7 5\n9 8",
"output": "16"
},
{
"input": "8 3\n2 1\n3 1\n4 3\n5 1\n6 1\n7 1\n8 6",
"output": "4"
},
{
"input": "34 33\n2 1\n3 2\n4 3\n5 2\n6 3\n7 2\n8 5\n9 7\n10 8\n11 7\n12 7\n13 8\n14 2\n15 10\n16 1\n17 9\n18 14\n19 1\n20 2\n21 8\n22 21\n23 9\n24 6\n25 2\n26 20\n27 5\n28 20\n29 2\n30 10\n31 14\n32 12\n33 15\n34 8",
"output": "12"
}
] | 1,647,269,322
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 30
| 102,400
|
import sys
input = sys.stdin.readline
from collections import deque
def solve(n, x, edges):
# BFS, O(N) time and O(N) space
q = deque([(1, 0)])
vis = {1}
dis = 1
while q:
node, dis = q.popleft()
for nei in edges[node]:
if nei in vis:
continue
if nei == x:
dis += 1
break
vis.add(nei)
q.append((nei, dis+1))
lengthX = dis
q = deque([(x, 0)])
depth = 0
while q:
node, dis = q.popleft()
depth = max(depth, dis)
for nei in edges[node]:
if nei in vis:
continue
vis.add(nei)
q.append((nei, dis+1))
print((lengthX + depth)*2)
n, x = map(int, input().split())
edges = [[] for _ in range(n+1)]
for _ in range(n-1):
u, v = map(int, input().split())
edges[u].append(v)
edges[v].append(u)
solve(n, x, edges)
|
Title: The Tag Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alice got tired of playing the tag game by the usual rules so she offered Bob a little modification to it. Now the game should be played on an undirected rooted tree of *n* vertices. Vertex 1 is the root of the tree.
Alice starts at vertex 1 and Bob starts at vertex *x* (*x*<=≠<=1). The moves are made in turns, Bob goes first. In one move one can either stay at the current vertex or travel to the neighbouring one.
The game ends when Alice goes to the same vertex where Bob is standing. Alice wants to minimize the total number of moves and Bob wants to maximize it.
You should write a program which will determine how many moves will the game last.
Input Specification:
The first line contains two integer numbers *n* and *x* (2<=≤<=*n*<=≤<=2·105, 2<=≤<=*x*<=≤<=*n*).
Each of the next *n*<=-<=1 lines contains two integer numbers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=*n*) — edges of the tree. It is guaranteed that the edges form a valid tree.
Output Specification:
Print the total number of moves Alice and Bob will make.
Demo Input:
['4 3\n1 2\n2 3\n2 4\n', '5 2\n1 2\n2 3\n3 4\n2 5\n']
Demo Output:
['4\n', '6\n']
Note:
In the first example the tree looks like this:
The red vertex is Alice's starting position, the blue one is Bob's. Bob will make the game run the longest by standing at the vertex 3 during all the game. So here are the moves:
B: stay at vertex 3
A: go to vertex 2
B: stay at vertex 3
A: go to vertex 3
In the second example the tree looks like this:
The moves in the optimal strategy are:
B: go to vertex 3
A: go to vertex 2
B: go to vertex 4
A: go to vertex 3
B: stay at vertex 4
A: go to vertex 4
|
```python
import sys
input = sys.stdin.readline
from collections import deque
def solve(n, x, edges):
# BFS, O(N) time and O(N) space
q = deque([(1, 0)])
vis = {1}
dis = 1
while q:
node, dis = q.popleft()
for nei in edges[node]:
if nei in vis:
continue
if nei == x:
dis += 1
break
vis.add(nei)
q.append((nei, dis+1))
lengthX = dis
q = deque([(x, 0)])
depth = 0
while q:
node, dis = q.popleft()
depth = max(depth, dis)
for nei in edges[node]:
if nei in vis:
continue
vis.add(nei)
q.append((nei, dis+1))
print((lengthX + depth)*2)
n, x = map(int, input().split())
edges = [[] for _ in range(n+1)]
for _ in range(n-1):
u, v = map(int, input().split())
edges[u].append(v)
edges[v].append(u)
solve(n, x, edges)
```
| 0
|
|
677
|
A
|
Vanya and Fence
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
|
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
|
Print a single integer — the minimum possible valid width of the road.
|
[
"3 7\n4 5 14\n",
"6 1\n1 1 1 1 1 1\n",
"6 5\n7 6 8 9 10 5\n"
] |
[
"4\n",
"6\n",
"11\n"
] |
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
| 500
|
[
{
"input": "3 7\n4 5 14",
"output": "4"
},
{
"input": "6 1\n1 1 1 1 1 1",
"output": "6"
},
{
"input": "6 5\n7 6 8 9 10 5",
"output": "11"
},
{
"input": "10 420\n214 614 297 675 82 740 174 23 255 15",
"output": "13"
},
{
"input": "10 561\n657 23 1096 487 785 66 481 554 1000 821",
"output": "15"
},
{
"input": "100 342\n478 143 359 336 162 333 385 515 117 496 310 538 469 539 258 676 466 677 1 296 150 560 26 213 627 221 255 126 617 174 279 178 24 435 70 145 619 46 669 566 300 67 576 251 58 176 441 564 569 194 24 669 73 262 457 259 619 78 400 579 222 626 269 47 80 315 160 194 455 186 315 424 197 246 683 220 68 682 83 233 290 664 273 598 362 305 674 614 321 575 362 120 14 534 62 436 294 351 485 396",
"output": "144"
},
{
"input": "100 290\n244 49 276 77 449 261 468 458 201 424 9 131 300 88 432 394 104 77 13 289 435 259 111 453 168 394 156 412 351 576 178 530 81 271 228 564 125 328 42 372 205 61 180 471 33 360 567 331 222 318 241 117 529 169 188 484 202 202 299 268 246 343 44 364 333 494 59 236 84 485 50 8 428 8 571 227 205 310 210 9 324 472 368 490 114 84 296 305 411 351 569 393 283 120 510 171 232 151 134 366",
"output": "145"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 1\n2",
"output": "2"
},
{
"input": "46 71\n30 26 56 138 123 77 60 122 73 45 79 10 130 3 14 1 38 46 128 50 82 16 32 68 28 98 62 106 2 49 131 11 114 39 139 70 40 50 45 137 33 30 35 136 135 19",
"output": "63"
},
{
"input": "20 723\n212 602 293 591 754 91 1135 640 80 495 845 928 1399 498 926 1431 1226 869 814 1386",
"output": "31"
},
{
"input": "48 864\n843 1020 751 1694 18 1429 1395 1174 272 1158 1628 1233 1710 441 765 561 778 748 1501 1200 563 1263 1398 1687 1518 1640 1591 839 500 466 1603 1587 1201 1209 432 868 1159 639 649 628 9 91 1036 147 896 1557 941 518",
"output": "75"
},
{
"input": "26 708\n549 241 821 734 945 1161 566 1268 216 30 1142 730 529 1014 255 168 796 1148 89 113 1328 286 743 871 1259 1397",
"output": "41"
},
{
"input": "75 940\n1620 1745 1599 441 64 1466 1496 1239 1716 1475 778 106 1136 1212 1261 444 781 257 1071 747 626 232 609 1544 682 1326 469 1361 1460 1450 1207 1319 922 625 1737 1057 1698 592 692 80 1016 541 1254 201 682 1007 847 206 1066 809 259 109 240 1611 219 1455 1326 1377 1827 786 42 1002 1382 1592 543 1866 1198 334 1524 1760 340 1566 955 257 1118",
"output": "116"
}
] | 1,693,885,806
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 15
| 0
|
n, j = map(int, input().split())
h = list(map(int, input().split()))
w = 0
for i in h:
if i > h:
w += 2
else:
w += 1
print(w)
|
Title: Vanya and Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
Input Specification:
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
Output Specification:
Print a single integer — the minimum possible valid width of the road.
Demo Input:
['3 7\n4 5 14\n', '6 1\n1 1 1 1 1 1\n', '6 5\n7 6 8 9 10 5\n']
Demo Output:
['4\n', '6\n', '11\n']
Note:
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
|
```python
n, j = map(int, input().split())
h = list(map(int, input().split()))
w = 0
for i in h:
if i > h:
w += 2
else:
w += 1
print(w)
```
| -1
|
|
41
|
A
|
Translation
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Translation
|
2
|
256
|
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
|
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
|
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
|
[
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,653,943,444
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 30
| 0
|
l = input()
m = input()
n = ""
for i in l[::-1]:
c += i
if c == m:
print("YES")
else:
print("NO")
|
Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
l = input()
m = input()
n = ""
for i in l[::-1]:
c += i
if c == m:
print("YES")
else:
print("NO")
```
| -1
|
553
|
A
|
Kyoya and Colored Balls
|
PROGRAMMING
| 1,500
|
[
"combinatorics",
"dp",
"math"
] | null | null |
Kyoya Ootori has a bag with *n* colored balls that are colored with *k* different colors. The colors are labeled from 1 to *k*. Balls of the same color are indistinguishable. He draws balls from the bag one by one until the bag is empty. He noticed that he drew the last ball of color *i* before drawing the last ball of color *i*<=+<=1 for all *i* from 1 to *k*<=-<=1. Now he wonders how many different ways this can happen.
|
The first line of input will have one integer *k* (1<=≤<=*k*<=≤<=1000) the number of colors.
Then, *k* lines will follow. The *i*-th line will contain *c**i*, the number of balls of the *i*-th color (1<=≤<=*c**i*<=≤<=1000).
The total number of balls doesn't exceed 1000.
|
A single integer, the number of ways that Kyoya can draw the balls from the bag as described in the statement, modulo 1<=000<=000<=007.
|
[
"3\n2\n2\n1\n",
"4\n1\n2\n3\n4\n"
] |
[
"3\n",
"1680\n"
] |
In the first sample, we have 2 balls of color 1, 2 balls of color 2, and 1 ball of color 3. The three ways for Kyoya are:
| 250
|
[
{
"input": "3\n2\n2\n1",
"output": "3"
},
{
"input": "4\n1\n2\n3\n4",
"output": "1680"
},
{
"input": "10\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100",
"output": "12520708"
},
{
"input": "5\n10\n10\n10\n10\n10",
"output": "425711769"
},
{
"input": "11\n291\n381\n126\n39\n19\n20\n3\n1\n20\n45\n2",
"output": "902382672"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "13\n67\n75\n76\n80\n69\n86\n75\n86\n81\n84\n73\n72\n76",
"output": "232242896"
},
{
"input": "25\n35\n43\n38\n33\n47\n44\n40\n36\n41\n42\n33\n30\n49\n42\n62\n39\n40\n35\n43\n31\n42\n46\n42\n34\n33",
"output": "362689152"
},
{
"input": "47\n20\n21\n16\n18\n24\n20\n25\n13\n20\n22\n26\n24\n17\n18\n21\n22\n21\n23\n17\n15\n24\n19\n18\n21\n20\n19\n26\n25\n20\n17\n17\n17\n26\n32\n20\n21\n25\n28\n24\n21\n21\n17\n28\n20\n20\n31\n19",
"output": "295545118"
},
{
"input": "3\n343\n317\n337",
"output": "691446102"
},
{
"input": "1\n5",
"output": "1"
}
] | 1,604,579,859
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 27
| 389
| 614,400
|
def fact(x):
r = 1
for i in range(1, x + 1): r *= i
return r
mod = int(1e9 + 7)
n = int(input())
arr = [0] * n
for i in range(n): arr[i] = int(input())
r = 1; s = 0
for i in range(1, n):
s += arr[i - 1]
r *= fact(s + arr[i] - 1) // fact(s) // fact(arr[i] - 1)
r %= mod
print(r)
|
Title: Kyoya and Colored Balls
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kyoya Ootori has a bag with *n* colored balls that are colored with *k* different colors. The colors are labeled from 1 to *k*. Balls of the same color are indistinguishable. He draws balls from the bag one by one until the bag is empty. He noticed that he drew the last ball of color *i* before drawing the last ball of color *i*<=+<=1 for all *i* from 1 to *k*<=-<=1. Now he wonders how many different ways this can happen.
Input Specification:
The first line of input will have one integer *k* (1<=≤<=*k*<=≤<=1000) the number of colors.
Then, *k* lines will follow. The *i*-th line will contain *c**i*, the number of balls of the *i*-th color (1<=≤<=*c**i*<=≤<=1000).
The total number of balls doesn't exceed 1000.
Output Specification:
A single integer, the number of ways that Kyoya can draw the balls from the bag as described in the statement, modulo 1<=000<=000<=007.
Demo Input:
['3\n2\n2\n1\n', '4\n1\n2\n3\n4\n']
Demo Output:
['3\n', '1680\n']
Note:
In the first sample, we have 2 balls of color 1, 2 balls of color 2, and 1 ball of color 3. The three ways for Kyoya are:
|
```python
def fact(x):
r = 1
for i in range(1, x + 1): r *= i
return r
mod = int(1e9 + 7)
n = int(input())
arr = [0] * n
for i in range(n): arr[i] = int(input())
r = 1; s = 0
for i in range(1, n):
s += arr[i - 1]
r *= fact(s + arr[i] - 1) // fact(s) // fact(arr[i] - 1)
r %= mod
print(r)
```
| 3
|
|
583
|
A
|
Asphalting Roads
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
City X consists of *n* vertical and *n* horizontal infinite roads, forming *n*<=×<=*n* intersections. Roads (both vertical and horizontal) are numbered from 1 to *n*, and the intersections are indicated by the numbers of the roads that form them.
Sand roads have long been recognized out of date, so the decision was made to asphalt them. To do this, a team of workers was hired and a schedule of work was made, according to which the intersections should be asphalted.
Road repairs are planned for *n*2 days. On the *i*-th day of the team arrives at the *i*-th intersection in the list and if none of the two roads that form the intersection were already asphalted they asphalt both roads. Otherwise, the team leaves the intersection, without doing anything with the roads.
According to the schedule of road works tell in which days at least one road will be asphalted.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of vertical and horizontal roads in the city.
Next *n*2 lines contain the order of intersections in the schedule. The *i*-th of them contains two numbers *h**i*,<=*v**i* (1<=≤<=*h**i*,<=*v**i*<=≤<=*n*), separated by a space, and meaning that the intersection that goes *i*-th in the timetable is at the intersection of the *h**i*-th horizontal and *v**i*-th vertical roads. It is guaranteed that all the intersections in the timetable are distinct.
|
In the single line print the numbers of the days when road works will be in progress in ascending order. The days are numbered starting from 1.
|
[
"2\n1 1\n1 2\n2 1\n2 2\n",
"1\n1 1\n"
] |
[
"1 4 \n",
"1 \n"
] |
In the sample the brigade acts like that:
1. On the first day the brigade comes to the intersection of the 1-st horizontal and the 1-st vertical road. As none of them has been asphalted, the workers asphalt the 1-st vertical and the 1-st horizontal road; 1. On the second day the brigade of the workers comes to the intersection of the 1-st horizontal and the 2-nd vertical road. The 2-nd vertical road hasn't been asphalted, but as the 1-st horizontal road has been asphalted on the first day, the workers leave and do not asphalt anything; 1. On the third day the brigade of the workers come to the intersection of the 2-nd horizontal and the 1-st vertical road. The 2-nd horizontal road hasn't been asphalted but as the 1-st vertical road has been asphalted on the first day, the workers leave and do not asphalt anything; 1. On the fourth day the brigade come to the intersection formed by the intersection of the 2-nd horizontal and 2-nd vertical road. As none of them has been asphalted, the workers asphalt the 2-nd vertical and the 2-nd horizontal road.
| 500
|
[
{
"input": "2\n1 1\n1 2\n2 1\n2 2",
"output": "1 4 "
},
{
"input": "1\n1 1",
"output": "1 "
},
{
"input": "2\n1 1\n2 2\n1 2\n2 1",
"output": "1 2 "
},
{
"input": "2\n1 2\n2 2\n2 1\n1 1",
"output": "1 3 "
},
{
"input": "3\n2 2\n1 2\n3 2\n3 3\n1 1\n2 3\n1 3\n3 1\n2 1",
"output": "1 4 5 "
},
{
"input": "3\n1 3\n3 1\n2 1\n1 1\n1 2\n2 2\n3 2\n3 3\n2 3",
"output": "1 2 6 "
},
{
"input": "4\n1 3\n2 3\n2 4\n4 4\n3 1\n1 1\n3 4\n2 1\n1 4\n4 3\n4 1\n3 2\n1 2\n4 2\n2 2\n3 3",
"output": "1 3 5 14 "
},
{
"input": "4\n3 3\n4 2\n2 3\n3 4\n4 4\n1 2\n3 2\n2 2\n1 4\n3 1\n4 1\n2 1\n1 3\n1 1\n4 3\n2 4",
"output": "1 2 9 12 "
},
{
"input": "9\n4 5\n2 3\n8 3\n5 6\n9 3\n4 4\n5 4\n4 7\n1 7\n8 4\n1 4\n1 5\n5 7\n7 8\n7 1\n9 9\n8 7\n7 5\n3 7\n6 6\n7 3\n5 2\n3 6\n7 4\n9 6\n5 8\n9 7\n6 3\n7 9\n1 2\n1 1\n6 2\n5 3\n7 2\n1 6\n4 1\n6 1\n8 9\n2 2\n3 9\n2 9\n7 7\n2 8\n9 4\n2 5\n8 6\n3 4\n2 1\n2 7\n6 5\n9 1\n3 3\n3 8\n5 5\n4 3\n3 1\n1 9\n6 4\n3 2\n6 8\n2 6\n5 9\n8 5\n8 8\n9 5\n6 9\n9 2\n3 5\n4 9\n4 8\n2 4\n5 1\n4 6\n7 6\n9 8\n1 3\n4 2\n8 1\n8 2\n6 7\n1 8",
"output": "1 2 4 9 10 14 16 32 56 "
},
{
"input": "8\n1 1\n1 2\n1 3\n1 4\n1 5\n8 6\n1 7\n1 8\n2 1\n8 5\n2 3\n2 4\n2 5\n2 6\n4 3\n2 2\n3 1\n3 2\n3 3\n3 4\n3 5\n3 6\n5 6\n3 8\n4 1\n4 2\n2 7\n4 4\n8 8\n4 6\n4 7\n4 8\n5 1\n5 2\n5 3\n6 5\n5 5\n3 7\n5 7\n5 8\n6 1\n6 2\n6 3\n6 4\n5 4\n6 6\n6 7\n6 8\n7 1\n7 2\n7 3\n7 4\n7 5\n7 6\n7 7\n7 8\n8 1\n8 2\n8 3\n8 4\n2 8\n1 6\n8 7\n4 5",
"output": "1 6 11 18 28 36 39 56 "
},
{
"input": "9\n9 9\n5 5\n8 8\n3 3\n2 2\n6 6\n4 4\n1 1\n7 7\n8 4\n1 4\n1 5\n5 7\n7 8\n7 1\n1 7\n8 7\n7 5\n3 7\n5 6\n7 3\n5 2\n3 6\n7 4\n9 6\n5 8\n9 7\n6 3\n7 9\n1 2\n4 5\n6 2\n5 3\n7 2\n1 6\n4 1\n6 1\n8 9\n2 3\n3 9\n2 9\n5 4\n2 8\n9 4\n2 5\n8 6\n3 4\n2 1\n2 7\n6 5\n9 1\n8 3\n3 8\n9 3\n4 3\n3 1\n1 9\n6 4\n3 2\n6 8\n2 6\n5 9\n8 5\n4 7\n9 5\n6 9\n9 2\n3 5\n4 9\n4 8\n2 4\n5 1\n4 6\n7 6\n9 8\n1 3\n4 2\n8 1\n8 2\n6 7\n1 8",
"output": "1 2 3 4 5 6 7 8 9 "
}
] | 1,680,493,086
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 39
| 46
| 0
|
n = int(input())
h = [0] * n
v = [0] * n
g = []
for i in range(n * n):
a, b = map(int, input().split())
if h[a - 1] == 0 and v[b - 1] == 0:
h[a - 1] = 1
v[b - 1] = 1
g.append(i+1)
print(*g)
|
Title: Asphalting Roads
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
City X consists of *n* vertical and *n* horizontal infinite roads, forming *n*<=×<=*n* intersections. Roads (both vertical and horizontal) are numbered from 1 to *n*, and the intersections are indicated by the numbers of the roads that form them.
Sand roads have long been recognized out of date, so the decision was made to asphalt them. To do this, a team of workers was hired and a schedule of work was made, according to which the intersections should be asphalted.
Road repairs are planned for *n*2 days. On the *i*-th day of the team arrives at the *i*-th intersection in the list and if none of the two roads that form the intersection were already asphalted they asphalt both roads. Otherwise, the team leaves the intersection, without doing anything with the roads.
According to the schedule of road works tell in which days at least one road will be asphalted.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of vertical and horizontal roads in the city.
Next *n*2 lines contain the order of intersections in the schedule. The *i*-th of them contains two numbers *h**i*,<=*v**i* (1<=≤<=*h**i*,<=*v**i*<=≤<=*n*), separated by a space, and meaning that the intersection that goes *i*-th in the timetable is at the intersection of the *h**i*-th horizontal and *v**i*-th vertical roads. It is guaranteed that all the intersections in the timetable are distinct.
Output Specification:
In the single line print the numbers of the days when road works will be in progress in ascending order. The days are numbered starting from 1.
Demo Input:
['2\n1 1\n1 2\n2 1\n2 2\n', '1\n1 1\n']
Demo Output:
['1 4 \n', '1 \n']
Note:
In the sample the brigade acts like that:
1. On the first day the brigade comes to the intersection of the 1-st horizontal and the 1-st vertical road. As none of them has been asphalted, the workers asphalt the 1-st vertical and the 1-st horizontal road; 1. On the second day the brigade of the workers comes to the intersection of the 1-st horizontal and the 2-nd vertical road. The 2-nd vertical road hasn't been asphalted, but as the 1-st horizontal road has been asphalted on the first day, the workers leave and do not asphalt anything; 1. On the third day the brigade of the workers come to the intersection of the 2-nd horizontal and the 1-st vertical road. The 2-nd horizontal road hasn't been asphalted but as the 1-st vertical road has been asphalted on the first day, the workers leave and do not asphalt anything; 1. On the fourth day the brigade come to the intersection formed by the intersection of the 2-nd horizontal and 2-nd vertical road. As none of them has been asphalted, the workers asphalt the 2-nd vertical and the 2-nd horizontal road.
|
```python
n = int(input())
h = [0] * n
v = [0] * n
g = []
for i in range(n * n):
a, b = map(int, input().split())
if h[a - 1] == 0 and v[b - 1] == 0:
h[a - 1] = 1
v[b - 1] = 1
g.append(i+1)
print(*g)
```
| 3
|
|
982
|
A
|
Row
|
PROGRAMMING
| 1,200
|
[
"brute force",
"constructive algorithms"
] | null | null |
You're given a row with $n$ chairs. We call a seating of people "maximal" if the two following conditions hold:
1. There are no neighbors adjacent to anyone seated. 1. It's impossible to seat one more person without violating the first rule.
The seating is given as a string consisting of zeros and ones ($0$ means that the corresponding seat is empty, $1$ — occupied). The goal is to determine whether this seating is "maximal".
Note that the first and last seats are not adjacent (if $n \ne 2$).
|
The first line contains a single integer $n$ ($1 \leq n \leq 1000$) — the number of chairs.
The next line contains a string of $n$ characters, each of them is either zero or one, describing the seating.
|
Output "Yes" (without quotation marks) if the seating is "maximal". Otherwise print "No".
You are allowed to print letters in whatever case you'd like (uppercase or lowercase).
|
[
"3\n101\n",
"4\n1011\n",
"5\n10001\n"
] |
[
"Yes\n",
"No\n",
"No\n"
] |
In sample case one the given seating is maximal.
In sample case two the person at chair three has a neighbour to the right.
In sample case three it is possible to seat yet another person into chair three.
| 500
|
[
{
"input": "3\n101",
"output": "Yes"
},
{
"input": "4\n1011",
"output": "No"
},
{
"input": "5\n10001",
"output": "No"
},
{
"input": "1\n0",
"output": "No"
},
{
"input": "1\n1",
"output": "Yes"
},
{
"input": "100\n0101001010101001010010010101001010100101001001001010010101010010101001001010101001001001010100101010",
"output": "Yes"
},
{
"input": "4\n0100",
"output": "No"
},
{
"input": "42\n011000100101001001101011011010100010011010",
"output": "No"
},
{
"input": "3\n001",
"output": "No"
},
{
"input": "64\n1001001010010010100101010010010100100101001001001001010100101001",
"output": "Yes"
},
{
"input": "3\n111",
"output": "No"
},
{
"input": "4\n0000",
"output": "No"
},
{
"input": "4\n0001",
"output": "No"
},
{
"input": "4\n0010",
"output": "No"
},
{
"input": "4\n0011",
"output": "No"
},
{
"input": "4\n0101",
"output": "Yes"
},
{
"input": "4\n0110",
"output": "No"
},
{
"input": "4\n0111",
"output": "No"
},
{
"input": "4\n1000",
"output": "No"
},
{
"input": "4\n1001",
"output": "Yes"
},
{
"input": "4\n1010",
"output": "Yes"
},
{
"input": "4\n1100",
"output": "No"
},
{
"input": "4\n1101",
"output": "No"
},
{
"input": "4\n1110",
"output": "No"
},
{
"input": "4\n1111",
"output": "No"
},
{
"input": "2\n00",
"output": "No"
},
{
"input": "2\n01",
"output": "Yes"
},
{
"input": "2\n10",
"output": "Yes"
},
{
"input": "2\n11",
"output": "No"
},
{
"input": "3\n000",
"output": "No"
},
{
"input": "3\n010",
"output": "Yes"
},
{
"input": "3\n011",
"output": "No"
},
{
"input": "3\n100",
"output": "No"
},
{
"input": "3\n110",
"output": "No"
},
{
"input": "100\n0111001010101110001100000010011000100101110010001100111110101110001110101010111000010010011000000110",
"output": "No"
},
{
"input": "357\n100101010010010010010100101001001010101010100100100100101001010101001010010100101001010100101001010010100100101001010101010101001001010100101010010100101001010100100100101010010010010100101010010010101001010010010101001001010010010101010100100101010010100100101001010100101001010100101001010010010010100101001010100100100100100100100101010101010010010100101",
"output": "Yes"
},
{
"input": "459\n000111000101010000100001001010111110011011010001100101111010111011101110111101111101100101100011011001100110001001111001101000111001011100110100011111011111000010000110010011100110011011111110011100001101001111000100111011001000001011111100110100001001001100101011100001110110100101011011110100100111101011000101110000100110100100010000000100001001111111000011101010010011001111010111001100000100111001010111011010000011000011100101101011101000011011000110011",
"output": "No"
},
{
"input": "3\n001",
"output": "No"
},
{
"input": "4\n0010",
"output": "No"
},
{
"input": "3\n111",
"output": "No"
},
{
"input": "4\n0110",
"output": "No"
},
{
"input": "2\n11",
"output": "No"
},
{
"input": "2\n10",
"output": "Yes"
},
{
"input": "2\n01",
"output": "Yes"
},
{
"input": "4\n1101",
"output": "No"
},
{
"input": "2\n00",
"output": "No"
},
{
"input": "4\n1111",
"output": "No"
},
{
"input": "15\n000010101010000",
"output": "No"
},
{
"input": "8\n10010100",
"output": "No"
},
{
"input": "5\n00100",
"output": "No"
},
{
"input": "6\n100100",
"output": "No"
},
{
"input": "7\n1000001",
"output": "No"
},
{
"input": "98\n10101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010",
"output": "Yes"
}
] | 1,625,293,672
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
n=int(input())
s=input()
for i in range(n):
for j in range(i+1,n):
if s[i]==s[j]:
print("no")
else:
print("yes")
|
Title: Row
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You're given a row with $n$ chairs. We call a seating of people "maximal" if the two following conditions hold:
1. There are no neighbors adjacent to anyone seated. 1. It's impossible to seat one more person without violating the first rule.
The seating is given as a string consisting of zeros and ones ($0$ means that the corresponding seat is empty, $1$ — occupied). The goal is to determine whether this seating is "maximal".
Note that the first and last seats are not adjacent (if $n \ne 2$).
Input Specification:
The first line contains a single integer $n$ ($1 \leq n \leq 1000$) — the number of chairs.
The next line contains a string of $n$ characters, each of them is either zero or one, describing the seating.
Output Specification:
Output "Yes" (without quotation marks) if the seating is "maximal". Otherwise print "No".
You are allowed to print letters in whatever case you'd like (uppercase or lowercase).
Demo Input:
['3\n101\n', '4\n1011\n', '5\n10001\n']
Demo Output:
['Yes\n', 'No\n', 'No\n']
Note:
In sample case one the given seating is maximal.
In sample case two the person at chair three has a neighbour to the right.
In sample case three it is possible to seat yet another person into chair three.
|
```python
n=int(input())
s=input()
for i in range(n):
for j in range(i+1,n):
if s[i]==s[j]:
print("no")
else:
print("yes")
```
| 0
|
|
591
|
A
|
Wizards' Duel
|
PROGRAMMING
| 900
|
[
"implementation",
"math"
] | null | null |
Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second.
The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse.
Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight.
|
The first line of the input contains a single integer *l* (1<=≤<=*l*<=≤<=1<=000) — the length of the corridor where the fight takes place.
The second line contains integer *p*, the third line contains integer *q* (1<=≤<=*p*,<=*q*<=≤<=500) — the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively.
|
Print a single real number — the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4.
Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if .
|
[
"100\n50\n50\n",
"199\n60\n40\n"
] |
[
"50\n",
"119.4\n"
] |
In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor.
| 500
|
[
{
"input": "100\n50\n50",
"output": "50"
},
{
"input": "199\n60\n40",
"output": "119.4"
},
{
"input": "1\n1\n1",
"output": "0.5"
},
{
"input": "1\n1\n500",
"output": "0.001996007984"
},
{
"input": "1\n500\n1",
"output": "0.998003992"
},
{
"input": "1\n500\n500",
"output": "0.5"
},
{
"input": "1000\n1\n1",
"output": "500"
},
{
"input": "1000\n1\n500",
"output": "1.996007984"
},
{
"input": "1000\n500\n1",
"output": "998.003992"
},
{
"input": "1000\n500\n500",
"output": "500"
},
{
"input": "101\n11\n22",
"output": "33.66666667"
},
{
"input": "987\n1\n3",
"output": "246.75"
},
{
"input": "258\n25\n431",
"output": "14.14473684"
},
{
"input": "979\n39\n60",
"output": "385.6666667"
},
{
"input": "538\n479\n416",
"output": "287.9351955"
},
{
"input": "583\n112\n248",
"output": "181.3777778"
},
{
"input": "978\n467\n371",
"output": "545.0190931"
},
{
"input": "980\n322\n193",
"output": "612.7378641"
},
{
"input": "871\n401\n17",
"output": "835.576555"
},
{
"input": "349\n478\n378",
"output": "194.885514"
},
{
"input": "425\n458\n118",
"output": "337.9340278"
},
{
"input": "919\n323\n458",
"output": "380.0729834"
},
{
"input": "188\n59\n126",
"output": "59.95675676"
},
{
"input": "644\n428\n484",
"output": "302.2280702"
},
{
"input": "253\n80\n276",
"output": "56.85393258"
},
{
"input": "745\n152\n417",
"output": "199.0158172"
},
{
"input": "600\n221\n279",
"output": "265.2"
},
{
"input": "690\n499\n430",
"output": "370.6243272"
},
{
"input": "105\n68\n403",
"output": "15.15923567"
},
{
"input": "762\n462\n371",
"output": "422.6218487"
},
{
"input": "903\n460\n362",
"output": "505.3284672"
},
{
"input": "886\n235\n95",
"output": "630.9393939"
},
{
"input": "655\n203\n18",
"output": "601.6515837"
},
{
"input": "718\n29\n375",
"output": "51.53960396"
},
{
"input": "296\n467\n377",
"output": "163.7819905"
},
{
"input": "539\n61\n56",
"output": "281.017094"
},
{
"input": "133\n53\n124",
"output": "39.82485876"
},
{
"input": "998\n224\n65",
"output": "773.5363322"
},
{
"input": "961\n173\n47",
"output": "755.6954545"
},
{
"input": "285\n468\n62",
"output": "251.6603774"
},
{
"input": "496\n326\n429",
"output": "214.1668874"
},
{
"input": "627\n150\n285",
"output": "216.2068966"
},
{
"input": "961\n443\n50",
"output": "863.535497"
},
{
"input": "623\n422\n217",
"output": "411.4334898"
},
{
"input": "678\n295\n29",
"output": "617.3148148"
}
] | 1,446,735,805
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 62
| 0
|
l = int(input())
p = int(input())
q = int(input())
t = l/(p+q)
ans = p*t
print(ans)
|
Title: Wizards' Duel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second.
The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse.
Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight.
Input Specification:
The first line of the input contains a single integer *l* (1<=≤<=*l*<=≤<=1<=000) — the length of the corridor where the fight takes place.
The second line contains integer *p*, the third line contains integer *q* (1<=≤<=*p*,<=*q*<=≤<=500) — the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively.
Output Specification:
Print a single real number — the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4.
Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if .
Demo Input:
['100\n50\n50\n', '199\n60\n40\n']
Demo Output:
['50\n', '119.4\n']
Note:
In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor.
|
```python
l = int(input())
p = int(input())
q = int(input())
t = l/(p+q)
ans = p*t
print(ans)
```
| 3
|
|
432
|
A
|
Choosing Teams
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
|
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
|
Print a single number — the answer to the problem.
|
[
"5 2\n0 4 5 1 0\n",
"6 4\n0 1 2 3 4 5\n",
"6 5\n0 0 0 0 0 0\n"
] |
[
"1\n",
"0\n",
"2\n"
] |
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
| 500
|
[
{
"input": "5 2\n0 4 5 1 0",
"output": "1"
},
{
"input": "6 4\n0 1 2 3 4 5",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "3 4\n0 1 0",
"output": "1"
},
{
"input": "3 4\n0 2 0",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "12 2\n0 1 2 3 4 0 1 2 3 4 0 1",
"output": "3"
},
{
"input": "15 2\n0 1 2 3 4 0 1 2 3 4 0 1 2 3 4",
"output": "4"
},
{
"input": "13 1\n5 0 5 0 1 5 0 4 1 1 1 4 1",
"output": "3"
},
{
"input": "20 1\n5 0 4 2 2 3 2 1 2 4 1 3 5 5 5 4 4 1 3 0",
"output": "5"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "6 3\n4 4 4 4 4 4",
"output": "0"
},
{
"input": "1 4\n1",
"output": "0"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "2 3\n0 0",
"output": "0"
}
] | 1,655,322,865
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 31
| 0
|
n, k = map(int, input().split())
a = list(map(int, input().split()))
ans = 0
for i in a:
if n - i >= k:
ans += 1
print(ans//3)
|
Title: Choosing Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
Input Specification:
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['5 2\n0 4 5 1 0\n', '6 4\n0 1 2 3 4 5\n', '6 5\n0 0 0 0 0 0\n']
Demo Output:
['1\n', '0\n', '2\n']
Note:
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
|
```python
n, k = map(int, input().split())
a = list(map(int, input().split()))
ans = 0
for i in a:
if n - i >= k:
ans += 1
print(ans//3)
```
| 0
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,592,507,579
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 4
| 140
| 0
|
s=input()
t='hello'
n=len(s)
j=0
for i in range(n-1):
if(s[i]==t[j]):
j+=1
else:
continue
if(j==len(t)):
print('YES')
break
if(j!=len(t)):
print('NO')
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
s=input()
t='hello'
n=len(s)
j=0
for i in range(n-1):
if(s[i]==t[j]):
j+=1
else:
continue
if(j==len(t)):
print('YES')
break
if(j!=len(t)):
print('NO')
```
| 0
|
493
|
A
|
Vasya and Football
|
PROGRAMMING
| 1,300
|
[
"implementation"
] | null | null |
Vasya has started watching football games. He has learned that for some fouls the players receive yellow cards, and for some fouls they receive red cards. A player who receives the second yellow card automatically receives a red card.
Vasya is watching a recorded football match now and makes notes of all the fouls that he would give a card for. Help Vasya determine all the moments in time when players would be given red cards if Vasya were the judge. For each player, Vasya wants to know only the first moment of time when he would receive a red card from Vasya.
|
The first line contains the name of the team playing at home. The second line contains the name of the team playing away. Both lines are not empty. The lengths of both lines do not exceed 20. Each line contains only of large English letters. The names of the teams are distinct.
Next follows number *n* (1<=≤<=*n*<=≤<=90) — the number of fouls.
Each of the following *n* lines contains information about a foul in the following form:
- first goes number *t* (1<=≤<=*t*<=≤<=90) — the minute when the foul occurs; - then goes letter "h" or letter "a" — if the letter is "h", then the card was given to a home team player, otherwise the card was given to an away team player; - then goes the player's number *m* (1<=≤<=*m*<=≤<=99); - then goes letter "y" or letter "r" — if the letter is "y", that means that the yellow card was given, otherwise the red card was given.
The players from different teams can have the same number. The players within one team have distinct numbers. The fouls go chronologically, no two fouls happened at the same minute.
|
For each event when a player received his first red card in a chronological order print a string containing the following information:
- The name of the team to which the player belongs; - the player's number in his team; - the minute when he received the card.
If no player received a card, then you do not need to print anything.
It is possible case that the program will not print anything to the output (if there were no red cards).
|
[
"MC\nCSKA\n9\n28 a 3 y\n62 h 25 y\n66 h 42 y\n70 h 25 y\n77 a 4 y\n79 a 25 y\n82 h 42 r\n89 h 16 y\n90 a 13 r\n"
] |
[
"MC 25 70\nMC 42 82\nCSKA 13 90\n"
] |
none
| 500
|
[
{
"input": "MC\nCSKA\n9\n28 a 3 y\n62 h 25 y\n66 h 42 y\n70 h 25 y\n77 a 4 y\n79 a 25 y\n82 h 42 r\n89 h 16 y\n90 a 13 r",
"output": "MC 25 70\nMC 42 82\nCSKA 13 90"
},
{
"input": "REAL\nBARCA\n3\n27 h 7 y\n44 a 10 y\n87 h 3 r",
"output": "REAL 3 87"
},
{
"input": "MASFF\nSAFBDSRG\n5\n1 h 1 y\n15 h 1 r\n27 a 1 y\n58 a 1 y\n69 h 10 y",
"output": "MASFF 1 15\nSAFBDSRG 1 58"
},
{
"input": "ARMENIA\nBULGARIA\n12\n33 h 17 y\n42 h 21 y\n56 a 17 y\n58 a 6 y\n61 a 7 y\n68 a 10 y\n72 h 13 y\n73 h 21 y\n74 a 8 r\n75 a 4 y\n77 a 10 y\n90 a 23 y",
"output": "ARMENIA 21 73\nBULGARIA 8 74\nBULGARIA 10 77"
},
{
"input": "PORTUGAL\nNETHERLANDS\n16\n2 a 18 y\n7 a 3 y\n20 h 18 y\n31 h 6 y\n45 h 6 y\n50 h 8 y\n59 a 5 y\n60 h 7 y\n63 a 3 y\n72 a 20 y\n73 h 20 y\n74 a 10 y\n75 h 1 y\n76 h 14 y\n78 h 20 y\n90 a 5 y",
"output": "PORTUGAL 6 45\nNETHERLANDS 3 63\nPORTUGAL 20 78\nNETHERLANDS 5 90"
},
{
"input": "TANC\nXNCOR\n2\n15 h 27 r\n28 h 27 r",
"output": "TANC 27 15"
},
{
"input": "ASGDFJH\nAHGRSDXGER\n3\n23 h 15 r\n68 h 15 y\n79 h 15 y",
"output": "ASGDFJH 15 23"
},
{
"input": "ASFSHDSG\nADGYRTJNG\n5\n1 h 1 y\n2 h 1 y\n3 h 1 y\n4 h 1 r\n5 h 1 y",
"output": "ASFSHDSG 1 2"
},
{
"input": "A\nB\n42\n5 a 84 y\n8 h 28 r\n10 a 9 r\n11 h 93 y\n13 a 11 r\n15 h 3 r\n20 a 88 r\n23 a 41 y\n25 a 14 y\n27 a 38 r\n28 a 33 y\n29 h 66 r\n31 a 16 r\n32 a 80 y\n34 a 54 r\n35 a 50 y\n36 a 9 y\n39 a 22 y\n42 h 81 y\n43 a 10 y\n44 a 27 r\n47 h 39 y\n48 a 80 y\n50 h 5 y\n52 a 67 y\n54 h 63 y\n56 h 7 y\n57 h 44 y\n58 h 41 y\n61 h 32 y\n64 h 91 y\n67 a 56 y\n69 h 83 y\n71 h 59 y\n72 a 76 y\n75 h 41 y\n76 a 49 r\n77 a 4 r\n78 a 69 y\n79 a 96 r\n80 h 81 y\n86 h 85 r",
"output": "A 28 8\nB 9 10\nB 11 13\nA 3 15\nB 88 20\nB 38 27\nA 66 29\nB 16 31\nB 54 34\nB 27 44\nB 80 48\nA 41 75\nB 49 76\nB 4 77\nB 96 79\nA 81 80\nA 85 86"
},
{
"input": "ARM\nAZE\n45\n2 a 13 r\n3 a 73 r\n4 a 10 y\n5 h 42 y\n8 h 56 y\n10 h 15 y\n11 a 29 r\n13 a 79 y\n14 a 77 r\n18 h 7 y\n20 a 69 r\n22 h 19 y\n25 h 88 r\n26 a 78 y\n27 a 91 r\n28 h 10 r\n30 h 13 r\n31 a 26 r\n33 a 43 r\n34 a 91 y\n40 h 57 y\n44 h 18 y\n46 a 25 r\n48 a 29 y\n51 h 71 y\n57 a 16 r\n58 h 37 r\n59 h 92 y\n60 h 11 y\n61 a 88 y\n64 a 28 r\n65 h 71 r\n68 h 39 y\n70 h 8 r\n71 a 10 y\n72 a 32 y\n73 h 95 r\n74 a 33 y\n75 h 48 r\n78 a 44 y\n79 a 22 r\n80 h 50 r\n84 a 50 y\n88 a 90 y\n89 h 42 r",
"output": "AZE 13 2\nAZE 73 3\nAZE 29 11\nAZE 77 14\nAZE 69 20\nARM 88 25\nAZE 91 27\nARM 10 28\nARM 13 30\nAZE 26 31\nAZE 43 33\nAZE 25 46\nAZE 16 57\nARM 37 58\nAZE 28 64\nARM 71 65\nARM 8 70\nAZE 10 71\nARM 95 73\nARM 48 75\nAZE 22 79\nARM 50 80\nARM 42 89"
},
{
"input": "KASFLS\nASJBGGDLJFDDFHHTHJH\n42\n2 a 68 y\n4 h 64 r\n5 a 24 y\n6 h 20 r\n8 a 16 r\n9 a 96 y\n10 h 36 r\n12 a 44 y\n13 h 69 r\n16 a 62 r\n18 a 99 r\n20 h 12 r\n21 a 68 y\n25 h 40 y\n26 h 54 r\n28 h 91 r\n29 a 36 r\n33 a 91 y\n36 h 93 r\n37 h 60 r\n38 a 82 r\n41 a 85 y\n42 a 62 r\n46 a 22 r\n48 a 88 r\n49 a 8 r\n51 h 45 y\n54 a 84 y\n57 a 8 y\n59 h 24 y\n61 h 22 r\n64 h 11 r\n69 a 89 y\n72 h 44 r\n75 h 57 r\n76 h 80 y\n77 h 54 r\n79 a 1 y\n81 a 31 r\n82 h 8 y\n83 a 28 r\n86 h 56 y",
"output": "KASFLS 64 4\nKASFLS 20 6\nASJBGGDLJFDDFHHTHJH 16 8\nKASFLS 36 10\nKASFLS 69 13\nASJBGGDLJFDDFHHTHJH 62 16\nASJBGGDLJFDDFHHTHJH 99 18\nKASFLS 12 20\nASJBGGDLJFDDFHHTHJH 68 21\nKASFLS 54 26\nKASFLS 91 28\nASJBGGDLJFDDFHHTHJH 36 29\nKASFLS 93 36\nKASFLS 60 37\nASJBGGDLJFDDFHHTHJH 82 38\nASJBGGDLJFDDFHHTHJH 22 46\nASJBGGDLJFDDFHHTHJH 88 48\nASJBGGDLJFDDFHHTHJH 8 49\nKASFLS 22 61\nKASFLS 11 64\nKASFLS 44 72\nKASFLS 57 75\nASJBGGDLJFDDFHHTHJH 31 81\nASJBGGDLJFDDFHHTHJH 28 83"
},
{
"input": "AB\nBC\n3\n1 h 1 y\n2 h 1 y\n3 h 1 r",
"output": "AB 1 2"
}
] | 1,696,842,995
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 5
| 61
| 0
|
# Wadea #
h = input()
a = input()
arr = []
player = []
out = []
for i in range(int(input())):
minute,ha,num,card = input().split()
arr.append([ha,num])
if card == "r":
if ha == "h":
out.append([h,num,minute])
elif ha == "a":
out.append([a,num,minute])
player.append([ha,num])
else:
if arr.count([ha,num]) == 2 and [ha,num] not in player:
player.append([ha,num])
if ha == "h":
out.append([h,num,minute])
elif ha == "a":
out.append([a,num,minute])
for i in out:
print(*i)
|
Title: Vasya and Football
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has started watching football games. He has learned that for some fouls the players receive yellow cards, and for some fouls they receive red cards. A player who receives the second yellow card automatically receives a red card.
Vasya is watching a recorded football match now and makes notes of all the fouls that he would give a card for. Help Vasya determine all the moments in time when players would be given red cards if Vasya were the judge. For each player, Vasya wants to know only the first moment of time when he would receive a red card from Vasya.
Input Specification:
The first line contains the name of the team playing at home. The second line contains the name of the team playing away. Both lines are not empty. The lengths of both lines do not exceed 20. Each line contains only of large English letters. The names of the teams are distinct.
Next follows number *n* (1<=≤<=*n*<=≤<=90) — the number of fouls.
Each of the following *n* lines contains information about a foul in the following form:
- first goes number *t* (1<=≤<=*t*<=≤<=90) — the minute when the foul occurs; - then goes letter "h" or letter "a" — if the letter is "h", then the card was given to a home team player, otherwise the card was given to an away team player; - then goes the player's number *m* (1<=≤<=*m*<=≤<=99); - then goes letter "y" or letter "r" — if the letter is "y", that means that the yellow card was given, otherwise the red card was given.
The players from different teams can have the same number. The players within one team have distinct numbers. The fouls go chronologically, no two fouls happened at the same minute.
Output Specification:
For each event when a player received his first red card in a chronological order print a string containing the following information:
- The name of the team to which the player belongs; - the player's number in his team; - the minute when he received the card.
If no player received a card, then you do not need to print anything.
It is possible case that the program will not print anything to the output (if there were no red cards).
Demo Input:
['MC\nCSKA\n9\n28 a 3 y\n62 h 25 y\n66 h 42 y\n70 h 25 y\n77 a 4 y\n79 a 25 y\n82 h 42 r\n89 h 16 y\n90 a 13 r\n']
Demo Output:
['MC 25 70\nMC 42 82\nCSKA 13 90\n']
Note:
none
|
```python
# Wadea #
h = input()
a = input()
arr = []
player = []
out = []
for i in range(int(input())):
minute,ha,num,card = input().split()
arr.append([ha,num])
if card == "r":
if ha == "h":
out.append([h,num,minute])
elif ha == "a":
out.append([a,num,minute])
player.append([ha,num])
else:
if arr.count([ha,num]) == 2 and [ha,num] not in player:
player.append([ha,num])
if ha == "h":
out.append([h,num,minute])
elif ha == "a":
out.append([a,num,minute])
for i in out:
print(*i)
```
| 0
|
|
863
|
B
|
Kayaking
|
PROGRAMMING
| 1,500
|
[
"brute force",
"greedy",
"sortings"
] | null | null |
Vadim is really keen on travelling. Recently he heard about kayaking activity near his town and became very excited about it, so he joined a party of kayakers.
Now the party is ready to start its journey, but firstly they have to choose kayaks. There are 2·*n* people in the group (including Vadim), and they have exactly *n*<=-<=1 tandem kayaks (each of which, obviously, can carry two people) and 2 single kayaks. *i*-th person's weight is *w**i*, and weight is an important matter in kayaking — if the difference between the weights of two people that sit in the same tandem kayak is too large, then it can crash. And, of course, people want to distribute their seats in kayaks in order to minimize the chances that kayaks will crash.
Formally, the instability of a single kayak is always 0, and the instability of a tandem kayak is the absolute difference between weights of the people that are in this kayak. Instability of the whole journey is the total instability of all kayaks.
Help the party to determine minimum possible total instability!
|
The first line contains one number *n* (2<=≤<=*n*<=≤<=50).
The second line contains 2·*n* integer numbers *w*1, *w*2, ..., *w*2*n*, where *w**i* is weight of person *i* (1<=≤<=*w**i*<=≤<=1000).
|
Print minimum possible total instability.
|
[
"2\n1 2 3 4\n",
"4\n1 3 4 6 3 4 100 200\n"
] |
[
"1\n",
"5\n"
] |
none
| 0
|
[
{
"input": "2\n1 2 3 4",
"output": "1"
},
{
"input": "4\n1 3 4 6 3 4 100 200",
"output": "5"
},
{
"input": "3\n305 139 205 406 530 206",
"output": "102"
},
{
"input": "3\n610 750 778 6 361 407",
"output": "74"
},
{
"input": "5\n97 166 126 164 154 98 221 7 51 47",
"output": "35"
},
{
"input": "50\n1 1 2 2 1 3 2 2 1 1 1 1 2 3 3 1 2 1 3 3 2 1 2 3 1 1 2 1 3 1 3 1 3 3 3 1 1 1 3 3 2 2 2 2 3 2 2 2 2 3 1 3 3 3 3 1 3 3 1 3 3 3 3 2 3 1 3 3 1 1 1 3 1 2 2 2 1 1 1 3 1 2 3 2 1 3 3 2 2 1 3 1 3 1 2 2 1 2 3 2",
"output": "0"
},
{
"input": "50\n5 5 5 5 4 2 2 3 2 2 4 1 5 5 1 2 4 2 4 2 5 2 2 2 2 3 2 4 2 5 5 4 3 1 2 3 3 5 4 2 2 5 2 4 5 5 4 4 1 5 5 3 2 2 5 1 3 3 2 4 4 5 1 2 3 4 4 1 3 3 3 5 1 2 4 4 4 4 2 5 2 5 3 2 4 5 5 2 1 1 2 4 5 3 2 1 2 4 4 4",
"output": "1"
},
{
"input": "50\n499 780 837 984 481 526 944 482 862 136 265 605 5 631 974 967 574 293 969 467 573 845 102 224 17 873 648 120 694 996 244 313 404 129 899 583 541 314 525 496 443 857 297 78 575 2 430 137 387 319 382 651 594 411 845 746 18 232 6 289 889 81 174 175 805 1000 799 950 475 713 951 685 729 925 262 447 139 217 788 514 658 572 784 185 112 636 10 251 621 218 210 89 597 553 430 532 264 11 160 476",
"output": "368"
},
{
"input": "50\n873 838 288 87 889 364 720 410 565 651 577 356 740 99 549 592 994 385 777 435 486 118 887 440 749 533 356 790 413 681 267 496 475 317 88 660 374 186 61 437 729 860 880 538 277 301 667 180 60 393 955 540 896 241 362 146 74 680 734 767 851 337 751 860 542 735 444 793 340 259 495 903 743 961 964 966 87 275 22 776 368 701 835 732 810 735 267 988 352 647 924 183 1 924 217 944 322 252 758 597",
"output": "393"
},
{
"input": "50\n297 787 34 268 439 629 600 398 425 833 721 908 830 636 64 509 420 647 499 675 427 599 396 119 798 742 577 355 22 847 389 574 766 453 196 772 808 261 106 844 726 975 173 992 874 89 775 616 678 52 69 591 181 573 258 381 665 301 589 379 362 146 790 842 765 100 229 916 938 97 340 793 758 177 736 396 247 562 571 92 923 861 165 748 345 703 431 930 101 761 862 595 505 393 126 846 431 103 596 21",
"output": "387"
},
{
"input": "50\n721 631 587 746 692 406 583 90 388 16 161 948 921 70 387 426 39 398 517 724 879 377 906 502 359 950 798 408 846 718 911 845 57 886 9 668 537 632 344 762 19 193 658 447 870 173 98 156 592 519 183 539 274 393 962 615 551 626 148 183 769 763 829 120 796 761 14 744 537 231 696 284 581 688 611 826 703 145 224 600 965 613 791 275 984 375 402 281 851 580 992 8 816 454 35 532 347 250 242 637",
"output": "376"
},
{
"input": "50\n849 475 37 120 754 183 758 374 543 198 896 691 11 607 198 343 761 660 239 669 628 259 223 182 216 158 20 565 454 884 137 923 156 22 310 77 267 707 582 169 120 308 439 309 59 152 206 696 210 177 296 887 559 22 154 553 142 247 491 692 473 572 461 206 532 319 503 164 328 365 541 366 300 392 486 257 863 432 877 404 520 69 418 99 519 239 374 927 601 103 226 316 423 219 240 26 455 101 184 61",
"output": "351"
},
{
"input": "3\n1 2 10 11 100 100",
"output": "1"
},
{
"input": "17\n814 744 145 886 751 1000 272 914 270 529 467 164 410 369 123 424 991 12 702 582 561 858 746 950 598 393 606 498 648 686 455 873 728 858",
"output": "318"
},
{
"input": "45\n476 103 187 696 463 457 588 632 763 77 391 721 95 124 378 812 980 193 694 898 859 572 721 274 605 264 929 615 257 918 42 493 1 3 697 349 990 800 82 535 382 816 943 735 11 272 562 323 653 370 766 332 666 130 704 604 645 717 267 255 37 470 925 941 376 611 332 758 504 40 477 263 708 434 38 596 650 990 714 662 572 467 949 799 648 581 545 828 508 636",
"output": "355"
},
{
"input": "2\n55 5 25 51",
"output": "4"
},
{
"input": "25\n89 50 640 463 858 301 522 241 923 378 892 822 550 17 42 66 706 779 657 840 273 222 444 459 94 925 437 159 182 727 92 851 742 215 653 891 782 533 29 128 133 883 317 475 165 994 802 434 744 973",
"output": "348"
},
{
"input": "4\n35 48 71 44 78 79 57 48",
"output": "10"
},
{
"input": "3\n58 89 73 15 5 47",
"output": "21"
},
{
"input": "2\n1 20 99 100",
"output": "1"
}
] | 1,610,152,184
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 20
| 109
| 1,331,200
|
n = int(input())
arr = input().split()
for i in range(2*n):
arr[i] = int(arr[i])
arr.sort()
b = [0] * (n*2)
ctr = 0
best = 1000000
for i in range(2*n):
for j in range(i+1, 2*n):
for k in range(2*n):
b[k] = arr[k]
b[i] = -1
b[j] = -1
b.sort()
ctr = 0
for k in range(2, 2*n-1, 2):
ctr += b[k+1] - b[k]
best = min(best, ctr)
print(best)
|
Title: Kayaking
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vadim is really keen on travelling. Recently he heard about kayaking activity near his town and became very excited about it, so he joined a party of kayakers.
Now the party is ready to start its journey, but firstly they have to choose kayaks. There are 2·*n* people in the group (including Vadim), and they have exactly *n*<=-<=1 tandem kayaks (each of which, obviously, can carry two people) and 2 single kayaks. *i*-th person's weight is *w**i*, and weight is an important matter in kayaking — if the difference between the weights of two people that sit in the same tandem kayak is too large, then it can crash. And, of course, people want to distribute their seats in kayaks in order to minimize the chances that kayaks will crash.
Formally, the instability of a single kayak is always 0, and the instability of a tandem kayak is the absolute difference between weights of the people that are in this kayak. Instability of the whole journey is the total instability of all kayaks.
Help the party to determine minimum possible total instability!
Input Specification:
The first line contains one number *n* (2<=≤<=*n*<=≤<=50).
The second line contains 2·*n* integer numbers *w*1, *w*2, ..., *w*2*n*, where *w**i* is weight of person *i* (1<=≤<=*w**i*<=≤<=1000).
Output Specification:
Print minimum possible total instability.
Demo Input:
['2\n1 2 3 4\n', '4\n1 3 4 6 3 4 100 200\n']
Demo Output:
['1\n', '5\n']
Note:
none
|
```python
n = int(input())
arr = input().split()
for i in range(2*n):
arr[i] = int(arr[i])
arr.sort()
b = [0] * (n*2)
ctr = 0
best = 1000000
for i in range(2*n):
for j in range(i+1, 2*n):
for k in range(2*n):
b[k] = arr[k]
b[i] = -1
b[j] = -1
b.sort()
ctr = 0
for k in range(2, 2*n-1, 2):
ctr += b[k+1] - b[k]
best = min(best, ctr)
print(best)
```
| 3
|
|
777
|
A
|
Shell Game
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms",
"implementation",
"math"
] | null | null |
Bomboslav likes to look out of the window in his room and watch lads outside playing famous shell game. The game is played by two persons: operator and player. Operator takes three similar opaque shells and places a ball beneath one of them. Then he shuffles the shells by swapping some pairs and the player has to guess the current position of the ball.
Bomboslav noticed that guys are not very inventive, so the operator always swaps the left shell with the middle one during odd moves (first, third, fifth, etc.) and always swaps the middle shell with the right one during even moves (second, fourth, etc.).
Let's number shells from 0 to 2 from left to right. Thus the left shell is assigned number 0, the middle shell is 1 and the right shell is 2. Bomboslav has missed the moment when the ball was placed beneath the shell, but he knows that exactly *n* movements were made by the operator and the ball was under shell *x* at the end. Now he wonders, what was the initial position of the ball?
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=2·109) — the number of movements made by the operator.
The second line contains a single integer *x* (0<=≤<=*x*<=≤<=2) — the index of the shell where the ball was found after *n* movements.
|
Print one integer from 0 to 2 — the index of the shell where the ball was initially placed.
|
[
"4\n2\n",
"1\n1\n"
] |
[
"1\n",
"0\n"
] |
In the first sample, the ball was initially placed beneath the middle shell and the operator completed four movements.
1. During the first move operator swapped the left shell and the middle shell. The ball is now under the left shell. 1. During the second move operator swapped the middle shell and the right one. The ball is still under the left shell. 1. During the third move operator swapped the left shell and the middle shell again. The ball is again in the middle. 1. Finally, the operators swapped the middle shell and the right shell. The ball is now beneath the right shell.
| 500
|
[
{
"input": "4\n2",
"output": "1"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "2\n2",
"output": "0"
},
{
"input": "3\n1",
"output": "1"
},
{
"input": "3\n2",
"output": "0"
},
{
"input": "3\n0",
"output": "2"
},
{
"input": "2000000000\n0",
"output": "1"
},
{
"input": "2\n0",
"output": "1"
},
{
"input": "2\n1",
"output": "2"
},
{
"input": "4\n0",
"output": "2"
},
{
"input": "4\n1",
"output": "0"
},
{
"input": "5\n0",
"output": "0"
},
{
"input": "5\n1",
"output": "2"
},
{
"input": "5\n2",
"output": "1"
},
{
"input": "6\n0",
"output": "0"
},
{
"input": "6\n1",
"output": "1"
},
{
"input": "6\n2",
"output": "2"
},
{
"input": "7\n0",
"output": "1"
},
{
"input": "7\n1",
"output": "0"
},
{
"input": "7\n2",
"output": "2"
},
{
"input": "100000\n0",
"output": "2"
},
{
"input": "100000\n1",
"output": "0"
},
{
"input": "100000\n2",
"output": "1"
},
{
"input": "99999\n1",
"output": "1"
},
{
"input": "99998\n1",
"output": "2"
},
{
"input": "99997\n1",
"output": "0"
},
{
"input": "99996\n1",
"output": "1"
},
{
"input": "99995\n1",
"output": "2"
},
{
"input": "1999999995\n0",
"output": "2"
},
{
"input": "1999999995\n1",
"output": "1"
},
{
"input": "1999999995\n2",
"output": "0"
},
{
"input": "1999999996\n0",
"output": "2"
},
{
"input": "1999999996\n1",
"output": "0"
},
{
"input": "1999999996\n2",
"output": "1"
},
{
"input": "1999999997\n0",
"output": "0"
},
{
"input": "1999999997\n1",
"output": "2"
},
{
"input": "1999999997\n2",
"output": "1"
},
{
"input": "1999999998\n0",
"output": "0"
},
{
"input": "1999999998\n1",
"output": "1"
},
{
"input": "1999999998\n2",
"output": "2"
},
{
"input": "1999999999\n0",
"output": "1"
},
{
"input": "1999999999\n1",
"output": "0"
},
{
"input": "1999999999\n2",
"output": "2"
},
{
"input": "2000000000\n1",
"output": "2"
},
{
"input": "2000000000\n2",
"output": "0"
},
{
"input": "1234567890\n0",
"output": "0"
},
{
"input": "1234567890\n1",
"output": "1"
},
{
"input": "1234567890\n2",
"output": "2"
},
{
"input": "123456789\n0",
"output": "2"
},
{
"input": "123456789\n1",
"output": "1"
},
{
"input": "123456789\n2",
"output": "0"
},
{
"input": "123456790\n0",
"output": "2"
},
{
"input": "12\n2",
"output": "2"
},
{
"input": "32\n1",
"output": "2"
},
{
"input": "20\n2",
"output": "0"
},
{
"input": "10\n1",
"output": "0"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "76994383\n1",
"output": "0"
},
{
"input": "25\n2",
"output": "2"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "12\n0",
"output": "0"
},
{
"input": "150\n2",
"output": "2"
},
{
"input": "15\n0",
"output": "2"
},
{
"input": "21\n2",
"output": "0"
},
{
"input": "18\n2",
"output": "2"
},
{
"input": "8\n2",
"output": "0"
},
{
"input": "10\n0",
"output": "2"
},
{
"input": "16\n0",
"output": "2"
}
] | 1,532,463,502
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 68
| 124
| 0
|
n = int(input())
ball = int(input())
n = n % 6
while n > 0:
if n % 2 == 1:
if ball == 0:
ball = 1
elif ball == 1:
ball = 0
elif n % 2 == 0:
if ball == 1:
ball = 2
elif ball == 2:
ball = 1
n -= 1
print(ball)
|
Title: Shell Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bomboslav likes to look out of the window in his room and watch lads outside playing famous shell game. The game is played by two persons: operator and player. Operator takes three similar opaque shells and places a ball beneath one of them. Then he shuffles the shells by swapping some pairs and the player has to guess the current position of the ball.
Bomboslav noticed that guys are not very inventive, so the operator always swaps the left shell with the middle one during odd moves (first, third, fifth, etc.) and always swaps the middle shell with the right one during even moves (second, fourth, etc.).
Let's number shells from 0 to 2 from left to right. Thus the left shell is assigned number 0, the middle shell is 1 and the right shell is 2. Bomboslav has missed the moment when the ball was placed beneath the shell, but he knows that exactly *n* movements were made by the operator and the ball was under shell *x* at the end. Now he wonders, what was the initial position of the ball?
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=2·109) — the number of movements made by the operator.
The second line contains a single integer *x* (0<=≤<=*x*<=≤<=2) — the index of the shell where the ball was found after *n* movements.
Output Specification:
Print one integer from 0 to 2 — the index of the shell where the ball was initially placed.
Demo Input:
['4\n2\n', '1\n1\n']
Demo Output:
['1\n', '0\n']
Note:
In the first sample, the ball was initially placed beneath the middle shell and the operator completed four movements.
1. During the first move operator swapped the left shell and the middle shell. The ball is now under the left shell. 1. During the second move operator swapped the middle shell and the right one. The ball is still under the left shell. 1. During the third move operator swapped the left shell and the middle shell again. The ball is again in the middle. 1. Finally, the operators swapped the middle shell and the right shell. The ball is now beneath the right shell.
|
```python
n = int(input())
ball = int(input())
n = n % 6
while n > 0:
if n % 2 == 1:
if ball == 0:
ball = 1
elif ball == 1:
ball = 0
elif n % 2 == 0:
if ball == 1:
ball = 2
elif ball == 2:
ball = 1
n -= 1
print(ball)
```
| 3
|
|
714
|
B
|
Filya and Homework
|
PROGRAMMING
| 1,200
|
[
"implementation",
"sortings"
] | null | null |
Today, hedgehog Filya went to school for the very first time! Teacher gave him a homework which Filya was unable to complete without your help.
Filya is given an array of non-negative integers *a*1,<=*a*2,<=...,<=*a**n*. First, he pick an integer *x* and then he adds *x* to some elements of the array (no more than once), subtract *x* from some other elements (also, no more than once) and do no change other elements. He wants all elements of the array to be equal.
Now he wonders if it's possible to pick such integer *x* and change some elements of the array using this *x* in order to make all elements equal.
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of integers in the Filya's array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — elements of the array.
|
If it's impossible to make all elements of the array equal using the process given in the problem statement, then print "NO" (without quotes) in the only line of the output. Otherwise print "YES" (without quotes).
|
[
"5\n1 3 3 2 1\n",
"5\n1 2 3 4 5\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample Filya should select *x* = 1, then add it to the first and the last elements of the array and subtract from the second and the third elements.
| 1,000
|
[
{
"input": "5\n1 3 3 2 1",
"output": "YES"
},
{
"input": "5\n1 2 3 4 5",
"output": "NO"
},
{
"input": "2\n1 2",
"output": "YES"
},
{
"input": "3\n1 2 3",
"output": "YES"
},
{
"input": "3\n1 1 1",
"output": "YES"
},
{
"input": "2\n1 1000000000",
"output": "YES"
},
{
"input": "4\n1 2 3 4",
"output": "NO"
},
{
"input": "10\n1 1 1 1 1 2 2 2 2 2",
"output": "YES"
},
{
"input": "2\n4 2",
"output": "YES"
},
{
"input": "4\n1 1 4 7",
"output": "YES"
},
{
"input": "3\n99999999 1 50000000",
"output": "YES"
},
{
"input": "1\n0",
"output": "YES"
},
{
"input": "5\n0 0 0 0 0",
"output": "YES"
},
{
"input": "4\n4 2 2 1",
"output": "NO"
},
{
"input": "3\n1 4 2",
"output": "NO"
},
{
"input": "3\n1 4 100",
"output": "NO"
},
{
"input": "3\n2 5 11",
"output": "NO"
},
{
"input": "3\n1 4 6",
"output": "NO"
},
{
"input": "3\n1 2 4",
"output": "NO"
},
{
"input": "3\n1 2 7",
"output": "NO"
},
{
"input": "5\n1 1 1 4 5",
"output": "NO"
},
{
"input": "2\n100000001 100000003",
"output": "YES"
},
{
"input": "3\n7 4 5",
"output": "NO"
},
{
"input": "3\n2 3 5",
"output": "NO"
},
{
"input": "3\n1 2 5",
"output": "NO"
},
{
"input": "2\n2 3",
"output": "YES"
},
{
"input": "3\n2 100 29",
"output": "NO"
},
{
"input": "3\n0 1 5",
"output": "NO"
},
{
"input": "3\n1 3 6",
"output": "NO"
},
{
"input": "3\n2 1 3",
"output": "YES"
},
{
"input": "3\n1 5 100",
"output": "NO"
},
{
"input": "3\n1 4 8",
"output": "NO"
},
{
"input": "3\n1 7 10",
"output": "NO"
},
{
"input": "3\n5 4 1",
"output": "NO"
},
{
"input": "3\n1 6 10",
"output": "NO"
},
{
"input": "4\n1 3 4 5",
"output": "NO"
},
{
"input": "3\n1 5 4",
"output": "NO"
},
{
"input": "5\n1 2 3 3 5",
"output": "NO"
},
{
"input": "3\n2 3 1",
"output": "YES"
},
{
"input": "3\n2 3 8",
"output": "NO"
},
{
"input": "3\n0 3 5",
"output": "NO"
},
{
"input": "3\n1 5 10",
"output": "NO"
},
{
"input": "3\n1 7 2",
"output": "NO"
},
{
"input": "3\n1 3 9",
"output": "NO"
},
{
"input": "3\n1 1 2",
"output": "YES"
},
{
"input": "7\n1 1 1 1 1 2 4",
"output": "NO"
},
{
"input": "5\n1 4 4 4 6",
"output": "NO"
},
{
"input": "5\n1 2 2 4 4",
"output": "NO"
},
{
"input": "3\n1 9 10",
"output": "NO"
},
{
"input": "8\n1 1 1 1 1 1 2 3",
"output": "YES"
},
{
"input": "3\n1 2 100",
"output": "NO"
},
{
"input": "3\n1 3 4",
"output": "NO"
},
{
"input": "3\n1 15 14",
"output": "NO"
},
{
"input": "3\n1 3 8",
"output": "NO"
},
{
"input": "3\n1 2 10",
"output": "NO"
},
{
"input": "4\n2 2 4 5",
"output": "NO"
},
{
"input": "3\n1 3 5",
"output": "YES"
},
{
"input": "5\n3 6 7 8 9",
"output": "NO"
},
{
"input": "3\n7 6 8",
"output": "YES"
},
{
"input": "3\n3 2 1",
"output": "YES"
},
{
"input": "5\n1 2 2 2 3",
"output": "YES"
},
{
"input": "3\n4 6 7",
"output": "NO"
},
{
"input": "3\n2 0 4",
"output": "YES"
},
{
"input": "4\n10 20 21 30",
"output": "NO"
},
{
"input": "4\n0 2 3 4",
"output": "NO"
},
{
"input": "3\n3 6 12",
"output": "NO"
},
{
"input": "5\n0 0 1 3 5",
"output": "NO"
},
{
"input": "3\n3 5 8",
"output": "NO"
},
{
"input": "3\n1 4 4",
"output": "YES"
},
{
"input": "4\n2 4 5 6",
"output": "NO"
}
] | 1,631,770,826
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 79
| 93
| 16,179,200
|
n = int(input())
l = sorted(set(map(int, input().split())))
s = len(l)
print(['NO', 'YES'][s<3 or (s==3 and l[0]+l[2]==l[1]*2)])
|
Title: Filya and Homework
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today, hedgehog Filya went to school for the very first time! Teacher gave him a homework which Filya was unable to complete without your help.
Filya is given an array of non-negative integers *a*1,<=*a*2,<=...,<=*a**n*. First, he pick an integer *x* and then he adds *x* to some elements of the array (no more than once), subtract *x* from some other elements (also, no more than once) and do no change other elements. He wants all elements of the array to be equal.
Now he wonders if it's possible to pick such integer *x* and change some elements of the array using this *x* in order to make all elements equal.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of integers in the Filya's array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — elements of the array.
Output Specification:
If it's impossible to make all elements of the array equal using the process given in the problem statement, then print "NO" (without quotes) in the only line of the output. Otherwise print "YES" (without quotes).
Demo Input:
['5\n1 3 3 2 1\n', '5\n1 2 3 4 5\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample Filya should select *x* = 1, then add it to the first and the last elements of the array and subtract from the second and the third elements.
|
```python
n = int(input())
l = sorted(set(map(int, input().split())))
s = len(l)
print(['NO', 'YES'][s<3 or (s==3 and l[0]+l[2]==l[1]*2)])
```
| 3
|
|
732
|
A
|
Buy a Shovel
|
PROGRAMMING
| 800
|
[
"brute force",
"constructive algorithms",
"implementation",
"math"
] | null | null |
Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop.
In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9).
What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel.
|
The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins".
Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels.
|
Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change.
|
[
"117 3\n",
"237 7\n",
"15 2\n"
] |
[
"9\n",
"1\n",
"2\n"
] |
In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change.
In the second example it is enough for Polycarp to buy one shovel.
In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
| 500
|
[
{
"input": "117 3",
"output": "9"
},
{
"input": "237 7",
"output": "1"
},
{
"input": "15 2",
"output": "2"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 9",
"output": "9"
},
{
"input": "1000 3",
"output": "1"
},
{
"input": "1000 1",
"output": "1"
},
{
"input": "1000 9",
"output": "1"
},
{
"input": "1 2",
"output": "2"
},
{
"input": "999 9",
"output": "1"
},
{
"input": "999 8",
"output": "2"
},
{
"input": "105 6",
"output": "2"
},
{
"input": "403 9",
"output": "3"
},
{
"input": "546 4",
"output": "4"
},
{
"input": "228 9",
"output": "5"
},
{
"input": "57 2",
"output": "6"
},
{
"input": "437 9",
"output": "7"
},
{
"input": "997 6",
"output": "8"
},
{
"input": "109 1",
"output": "9"
},
{
"input": "998 9",
"output": "5"
},
{
"input": "4 2",
"output": "3"
},
{
"input": "9 3",
"output": "7"
},
{
"input": "8 2",
"output": "4"
},
{
"input": "1 3",
"output": "3"
},
{
"input": "1 4",
"output": "4"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "1 7",
"output": "7"
},
{
"input": "1 8",
"output": "8"
},
{
"input": "100 3",
"output": "1"
},
{
"input": "1000 2",
"output": "1"
},
{
"input": "1000 4",
"output": "1"
},
{
"input": "1000 5",
"output": "1"
},
{
"input": "1000 6",
"output": "1"
},
{
"input": "1000 7",
"output": "1"
},
{
"input": "1000 8",
"output": "1"
},
{
"input": "23 4",
"output": "8"
},
{
"input": "33 1",
"output": "7"
},
{
"input": "33 2",
"output": "4"
},
{
"input": "666 5",
"output": "5"
},
{
"input": "2 3",
"output": "5"
},
{
"input": "5 5",
"output": "1"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "12 4",
"output": "2"
},
{
"input": "15 5",
"output": "1"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "25 5",
"output": "1"
},
{
"input": "2 9",
"output": "5"
},
{
"input": "6 7",
"output": "5"
},
{
"input": "8 9",
"output": "5"
},
{
"input": "2 7",
"output": "5"
},
{
"input": "4 7",
"output": "5"
},
{
"input": "2 1",
"output": "5"
},
{
"input": "261 1",
"output": "1"
}
] | 1,689,709,990
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 14
| 46
| 0
|
def num(k,r):
if k == r:
return 1
elif k%10 == 5:
return 2
elif k%10 == 0:
return 1
else:
for i in range(1,10):
d = k * i
rem = d%10
if rem == r:
return i
if __name__ == '__main__':
k,r = map(int, input().split())
res = num(k,r)
print(res)
|
Title: Buy a Shovel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop.
In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9).
What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel.
Input Specification:
The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins".
Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels.
Output Specification:
Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change.
Demo Input:
['117 3\n', '237 7\n', '15 2\n']
Demo Output:
['9\n', '1\n', '2\n']
Note:
In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change.
In the second example it is enough for Polycarp to buy one shovel.
In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
|
```python
def num(k,r):
if k == r:
return 1
elif k%10 == 5:
return 2
elif k%10 == 0:
return 1
else:
for i in range(1,10):
d = k * i
rem = d%10
if rem == r:
return i
if __name__ == '__main__':
k,r = map(int, input().split())
res = num(k,r)
print(res)
```
| 0
|
|
447
|
A
|
DZY Loves Hash
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
DZY has a hash table with *p* buckets, numbered from 0 to *p*<=-<=1. He wants to insert *n* numbers, in the order they are given, into the hash table. For the *i*-th number *x**i*, DZY will put it into the bucket numbered *h*(*x**i*), where *h*(*x*) is the hash function. In this problem we will assume, that *h*(*x*)<==<=*x* *mod* *p*. Operation *a* *mod* *b* denotes taking a remainder after division *a* by *b*.
However, each bucket can contain no more than one element. If DZY wants to insert an number into a bucket which is already filled, we say a "conflict" happens. Suppose the first conflict happens right after the *i*-th insertion, you should output *i*. If no conflict happens, just output -1.
|
The first line contains two integers, *p* and *n* (2<=≤<=*p*,<=*n*<=≤<=300). Then *n* lines follow. The *i*-th of them contains an integer *x**i* (0<=≤<=*x**i*<=≤<=109).
|
Output a single integer — the answer to the problem.
|
[
"10 5\n0\n21\n53\n41\n53\n",
"5 5\n0\n1\n2\n3\n4\n"
] |
[
"4\n",
"-1\n"
] |
none
| 500
|
[
{
"input": "10 5\n0\n21\n53\n41\n53",
"output": "4"
},
{
"input": "5 5\n0\n1\n2\n3\n4",
"output": "-1"
},
{
"input": "10 6\n811966798\n734823552\n790326404\n929189974\n414343256\n560346537",
"output": "4"
},
{
"input": "2 2\n788371161\n801743052",
"output": "-1"
},
{
"input": "10 6\n812796223\n122860157\n199259103\n597650585\n447742024\n521549402",
"output": "3"
},
{
"input": "300 2\n822454942\n119374431",
"output": "-1"
},
{
"input": "300 2\n823284367\n507345500",
"output": "-1"
},
{
"input": "2 5\n791579811\n35613889\n997079893\n878677665\n693717467",
"output": "2"
},
{
"input": "20 5\n793926268\n28931770\n842870287\n974950617\n859404206",
"output": "-1"
},
{
"input": "100 15\n805069249\n778178198\n633897389\n844316223\n146759898\n870527016\n82668754\n42060733\n943602929\n979451110\n746979598\n47406033\n607284062\n850870259\n229415316",
"output": "5"
},
{
"input": "100 15\n806204335\n189490323\n718805086\n716787474\n262315718\n822030596\n894644222\n724054623\n141384399\n579354205\n192622443\n672556242\n97417563\n243354557\n208957882",
"output": "8"
},
{
"input": "100 15\n807033760\n577461392\n275221433\n532633429\n295714486\n783298996\n255799943\n99107143\n729119412\n59302896\n37640015\n313610861\n630550567\n534283052\n681062462",
"output": "8"
},
{
"input": "100 15\n808103310\n136224397\n360129131\n405104681\n263786657\n734802577\n67808179\n928584682\n926900882\n511722343\n483348395\n938695534\n120684068\n74152694\n808088675",
"output": "9"
},
{
"input": "2 2\n2\n2",
"output": "2"
},
{
"input": "300 2\n0\n300",
"output": "2"
},
{
"input": "2 2\n0\n0",
"output": "2"
}
] | 1,584,379,271
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 2
| 139
| 0
|
p=[];a=[]
m,n=map(int,input().split())
for i in range(n):
x=int(input())
if x in p:
a.append(i)
p.append(x)
print(a[0] if len(a)!=0 else '-1')
|
Title: DZY Loves Hash
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY has a hash table with *p* buckets, numbered from 0 to *p*<=-<=1. He wants to insert *n* numbers, in the order they are given, into the hash table. For the *i*-th number *x**i*, DZY will put it into the bucket numbered *h*(*x**i*), where *h*(*x*) is the hash function. In this problem we will assume, that *h*(*x*)<==<=*x* *mod* *p*. Operation *a* *mod* *b* denotes taking a remainder after division *a* by *b*.
However, each bucket can contain no more than one element. If DZY wants to insert an number into a bucket which is already filled, we say a "conflict" happens. Suppose the first conflict happens right after the *i*-th insertion, you should output *i*. If no conflict happens, just output -1.
Input Specification:
The first line contains two integers, *p* and *n* (2<=≤<=*p*,<=*n*<=≤<=300). Then *n* lines follow. The *i*-th of them contains an integer *x**i* (0<=≤<=*x**i*<=≤<=109).
Output Specification:
Output a single integer — the answer to the problem.
Demo Input:
['10 5\n0\n21\n53\n41\n53\n', '5 5\n0\n1\n2\n3\n4\n']
Demo Output:
['4\n', '-1\n']
Note:
none
|
```python
p=[];a=[]
m,n=map(int,input().split())
for i in range(n):
x=int(input())
if x in p:
a.append(i)
p.append(x)
print(a[0] if len(a)!=0 else '-1')
```
| 0
|
|
976
|
E
|
Well played!
|
PROGRAMMING
| 2,100
|
[
"greedy",
"sortings"
] | null | null |
Recently Max has got himself into popular CCG "BrainStone". As "BrainStone" is a pretty intellectual game, Max has to solve numerous hard problems during the gameplay. Here is one of them:
Max owns *n* creatures, *i*-th of them can be described with two numbers — its health *hp**i* and its damage *dmg**i*. Max also has two types of spells in stock:
1. Doubles health of the creature (*hp**i* := *hp**i*·2); 1. Assigns value of health of the creature to its damage (*dmg**i* := *hp**i*).
Spell of first type can be used no more than *a* times in total, of the second type — no more than *b* times in total. Spell can be used on a certain creature multiple times. Spells can be used in arbitrary order. It isn't necessary to use all the spells.
Max is really busy preparing for his final exams, so he asks you to determine what is the maximal total damage of all creatures he can achieve if he uses spells in most optimal way.
|
The first line contains three integers *n*, *a*, *b* (1<=≤<=*n*<=≤<=2·105, 0<=≤<=*a*<=≤<=20, 0<=≤<=*b*<=≤<=2·105) — the number of creatures, spells of the first type and spells of the second type, respectively.
The *i*-th of the next *n* lines contain two number *hp**i* and *dmg**i* (1<=≤<=*hp**i*,<=*dmg**i*<=≤<=109) — description of the *i*-th creature.
|
Print single integer — maximum total damage creatures can deal.
|
[
"2 1 1\n10 15\n6 1\n",
"3 0 3\n10 8\n7 11\n5 2\n"
] |
[
"27\n",
"26\n"
] |
In the first example Max should use the spell of the first type on the second creature, then the spell of the second type on the same creature. Then total damage will be equal to 15 + 6·2 = 27.
In the second example Max should use the spell of the second type on the first creature, then the spell of the second type on the third creature. Total damage will be equal to 10 + 11 + 5 = 26.
| 0
|
[
{
"input": "2 1 1\n10 15\n6 1",
"output": "27"
},
{
"input": "3 0 3\n10 8\n7 11\n5 2",
"output": "26"
},
{
"input": "1 0 0\n2 1",
"output": "1"
},
{
"input": "1 0 200000\n1 2",
"output": "2"
},
{
"input": "7 5 7\n29 25\n84 28\n34 34\n14 76\n85 9\n40 57\n99 88",
"output": "3533"
},
{
"input": "7 6 7\n11 75\n61 90\n22 14\n100 36\n29 48\n69 52\n16 3",
"output": "6720"
},
{
"input": "7 8 7\n88 29\n30 44\n14 1\n83 95\n73 88\n10 42\n29 26",
"output": "22840"
},
{
"input": "12 7 7\n78 189\n614 271\n981 510\n37 762\n803 106\n78 369\n787 54\n768 159\n238 111\n107 54\n207 72\n485 593",
"output": "130952"
},
{
"input": "12 20 4\n852 935\n583 820\n969 197\n219 918\n547 842\n615 163\n704 377\n326 482\n183 833\n884 994\n886 581\n909 450",
"output": "1016078777"
},
{
"input": "2 13 2\n208637 682633\n393097 724045",
"output": "3220933257"
},
{
"input": "1 0 200000\n42 1",
"output": "42"
},
{
"input": "1 6 200000\n42 1",
"output": "2688"
},
{
"input": "1 0 200000\n1 42",
"output": "42"
},
{
"input": "1 6 200000\n1 42",
"output": "64"
},
{
"input": "3 1 1\n10 9\n8 6\n7 5",
"output": "31"
},
{
"input": "1 1 0\n10 1",
"output": "1"
},
{
"input": "1 1 0\n3 4",
"output": "4"
},
{
"input": "3 20 0\n1 5\n5 1\n5 1",
"output": "7"
},
{
"input": "2 5 1\n10 1\n20 20",
"output": "641"
},
{
"input": "3 20 0\n3 2\n4 3\n5 4",
"output": "9"
},
{
"input": "2 1 0\n10 15\n6 1",
"output": "16"
},
{
"input": "5 10 0\n20 1\n22 1\n30 1\n30 5\n40 6",
"output": "14"
},
{
"input": "1 20 0\n1 5",
"output": "5"
},
{
"input": "2 3 14\n28 5\n32 47",
"output": "284"
},
{
"input": "3 1 2\n20 10\n5 1\n25 25",
"output": "71"
},
{
"input": "2 3 3\n28 5\n32 47",
"output": "284"
},
{
"input": "2 2 1\n10 15\n6 1",
"output": "41"
},
{
"input": "2 1 2\n20 1\n22 23",
"output": "64"
},
{
"input": "10 7 2\n8 6\n5 5\n3 7\n7 7\n3 8\n6 1\n10 9\n4 6\n9 5\n7 9",
"output": "1339"
},
{
"input": "3 8 1\n6 6\n7 9\n2 5",
"output": "1803"
},
{
"input": "10 4 4\n5 5\n8 1\n10 10\n3 1\n7 10\n1 7\n8 7\n5 9\n3 3\n1 1",
"output": "214"
},
{
"input": "4 8 3\n1 6\n10 10\n4 8\n9 4",
"output": "2583"
},
{
"input": "8 18 1\n8 6\n6 8\n1 7\n7 2\n5 1\n10 5\n8 3\n9 3",
"output": "2621470"
},
{
"input": "2 11 1\n1 4\n1 5",
"output": "2053"
},
{
"input": "2 19 2\n9 3\n7 2",
"output": "4718599"
},
{
"input": "5 13 0\n4 4\n8 10\n1 8\n3 9\n4 6",
"output": "37"
},
{
"input": "5 8 0\n10 7\n6 6\n6 5\n7 9\n10 7",
"output": "34"
},
{
"input": "5 20 2\n1 10\n7 8\n10 1\n6 5\n2 1",
"output": "10485785"
},
{
"input": "2 1 0\n5 6\n8 8",
"output": "14"
},
{
"input": "7 3 5\n2 6\n5 9\n5 5\n4 10\n5 7\n7 8\n3 10",
"output": "103"
},
{
"input": "10 9 0\n620118469 704168608\n528098892 341451371\n15150469 449838744\n960504540 722185004\n271837337 344050133\n940943201 419522619\n85569623 788965215\n161962866 563795701\n943389281 445744350\n610994199 473866838",
"output": "5253588583"
},
{
"input": "10 11 1\n7 3\n9 4\n1 5\n10 3\n6 1\n10 7\n8 5\n7 6\n1 4\n9 9",
"output": "20524"
},
{
"input": "2 1 200000\n44 42\n1000 1001",
"output": "2044"
},
{
"input": "5 12 2\n5 9\n8 9\n4 1\n2 5\n1 8",
"output": "32794"
},
{
"input": "4 8 1\n9 9\n7 6\n2 4\n6 10",
"output": "2324"
},
{
"input": "2 1 1\n292725479 742903381\n239450691 307356865",
"output": "1221804763"
}
] | 1,540,221,604
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 9
| 1,000
| 25,600,000
|
def main():
n, a, b = map(int, input().split())
arr = []
for i in range(n):
arr.append(list(map(int,input().split())))
arr.sort(key=lambda x:-x[0]+x[1])
total = 0
for i in range(len(arr)):
if i < b:
total += max(arr[i][0], arr[i][1])
else:
total += arr[i][1]
if b == 0:
print(total)
return
s = total
for i in range(len(arr)):
ctotal = s
if i < b:
ctotal -= max(arr[i][0], arr[i][1])
ctotal += arr[i][0] * 2 ** a
else:
ctotal -= arr[i][0]
ctotal += arr[i][0] * 2 ** a
ctotal -= max(arr[b-1][0], arr[b-1][1])
ctotal += arr[b-1][1]
total = max(total, ctotal)
print(total)
main()
|
Title: Well played!
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently Max has got himself into popular CCG "BrainStone". As "BrainStone" is a pretty intellectual game, Max has to solve numerous hard problems during the gameplay. Here is one of them:
Max owns *n* creatures, *i*-th of them can be described with two numbers — its health *hp**i* and its damage *dmg**i*. Max also has two types of spells in stock:
1. Doubles health of the creature (*hp**i* := *hp**i*·2); 1. Assigns value of health of the creature to its damage (*dmg**i* := *hp**i*).
Spell of first type can be used no more than *a* times in total, of the second type — no more than *b* times in total. Spell can be used on a certain creature multiple times. Spells can be used in arbitrary order. It isn't necessary to use all the spells.
Max is really busy preparing for his final exams, so he asks you to determine what is the maximal total damage of all creatures he can achieve if he uses spells in most optimal way.
Input Specification:
The first line contains three integers *n*, *a*, *b* (1<=≤<=*n*<=≤<=2·105, 0<=≤<=*a*<=≤<=20, 0<=≤<=*b*<=≤<=2·105) — the number of creatures, spells of the first type and spells of the second type, respectively.
The *i*-th of the next *n* lines contain two number *hp**i* and *dmg**i* (1<=≤<=*hp**i*,<=*dmg**i*<=≤<=109) — description of the *i*-th creature.
Output Specification:
Print single integer — maximum total damage creatures can deal.
Demo Input:
['2 1 1\n10 15\n6 1\n', '3 0 3\n10 8\n7 11\n5 2\n']
Demo Output:
['27\n', '26\n']
Note:
In the first example Max should use the spell of the first type on the second creature, then the spell of the second type on the same creature. Then total damage will be equal to 15 + 6·2 = 27.
In the second example Max should use the spell of the second type on the first creature, then the spell of the second type on the third creature. Total damage will be equal to 10 + 11 + 5 = 26.
|
```python
def main():
n, a, b = map(int, input().split())
arr = []
for i in range(n):
arr.append(list(map(int,input().split())))
arr.sort(key=lambda x:-x[0]+x[1])
total = 0
for i in range(len(arr)):
if i < b:
total += max(arr[i][0], arr[i][1])
else:
total += arr[i][1]
if b == 0:
print(total)
return
s = total
for i in range(len(arr)):
ctotal = s
if i < b:
ctotal -= max(arr[i][0], arr[i][1])
ctotal += arr[i][0] * 2 ** a
else:
ctotal -= arr[i][0]
ctotal += arr[i][0] * 2 ** a
ctotal -= max(arr[b-1][0], arr[b-1][1])
ctotal += arr[b-1][1]
total = max(total, ctotal)
print(total)
main()
```
| 0
|
|
475
|
B
|
Strongly Connected City
|
PROGRAMMING
| 1,400
|
[
"brute force",
"dfs and similar",
"graphs",
"implementation"
] | null | null |
Imagine a city with *n* horizontal streets crossing *m* vertical streets, forming an (*n*<=-<=1)<=×<=(*m*<=-<=1) grid. In order to increase the traffic flow, mayor of the city has decided to make each street one way. This means in each horizontal street, the traffic moves only from west to east or only from east to west. Also, traffic moves only from north to south or only from south to north in each vertical street. It is possible to enter a horizontal street from a vertical street, or vice versa, at their intersection.
The mayor has received some street direction patterns. Your task is to check whether it is possible to reach any junction from any other junction in the proposed street direction pattern.
|
The first line of input contains two integers *n* and *m*, (2<=≤<=*n*,<=*m*<=≤<=20), denoting the number of horizontal streets and the number of vertical streets.
The second line contains a string of length *n*, made of characters '<' and '>', denoting direction of each horizontal street. If the *i*-th character is equal to '<', the street is directed from east to west otherwise, the street is directed from west to east. Streets are listed in order from north to south.
The third line contains a string of length *m*, made of characters '^' and 'v', denoting direction of each vertical street. If the *i*-th character is equal to '^', the street is directed from south to north, otherwise the street is directed from north to south. Streets are listed in order from west to east.
|
If the given pattern meets the mayor's criteria, print a single line containing "YES", otherwise print a single line containing "NO".
|
[
"3 3\n><>\nv^v\n",
"4 6\n<><>\nv^v^v^\n"
] |
[
"NO\n",
"YES\n"
] |
The figure above shows street directions in the second sample test case.
| 1,000
|
[
{
"input": "3 3\n><>\nv^v",
"output": "NO"
},
{
"input": "4 6\n<><>\nv^v^v^",
"output": "YES"
},
{
"input": "2 2\n<>\nv^",
"output": "YES"
},
{
"input": "2 2\n>>\n^v",
"output": "NO"
},
{
"input": "3 3\n>><\n^^v",
"output": "YES"
},
{
"input": "3 4\n>><\n^v^v",
"output": "YES"
},
{
"input": "3 8\n>><\nv^^^^^^^",
"output": "NO"
},
{
"input": "7 2\n<><<<<>\n^^",
"output": "NO"
},
{
"input": "4 5\n><<<\n^^^^v",
"output": "YES"
},
{
"input": "2 20\n><\n^v^^v^^v^^^v^vv^vv^^",
"output": "NO"
},
{
"input": "2 20\n<>\nv^vv^v^^vvv^^^v^vvv^",
"output": "YES"
},
{
"input": "20 2\n<><<><<>><<<>><><<<<\n^^",
"output": "NO"
},
{
"input": "20 2\n><>><>><>><<<><<><><\n^v",
"output": "YES"
},
{
"input": "11 12\n><<<><><<>>\nvv^^^^vvvvv^",
"output": "NO"
},
{
"input": "4 18\n<<>>\nv^v^v^^vvvv^v^^vv^",
"output": "YES"
},
{
"input": "16 11\n<<<<>><><<<<<><<\nvv^v^vvvv^v",
"output": "NO"
},
{
"input": "14 7\n><<<<>>>>>>><<\nvv^^^vv",
"output": "NO"
},
{
"input": "5 14\n<<><>\nv^vv^^vv^v^^^v",
"output": "NO"
},
{
"input": "8 18\n>>>><>>>\nv^vv^v^^^^^vvv^^vv",
"output": "NO"
},
{
"input": "18 18\n<<><>><<>><>><><<<\n^^v^v^vvvv^v^vv^vv",
"output": "NO"
},
{
"input": "4 18\n<<<>\n^^^^^vv^vv^^vv^v^v",
"output": "NO"
},
{
"input": "19 18\n><><>>><<<<<>>><<<>\n^^v^^v^^v^vv^v^vvv",
"output": "NO"
},
{
"input": "14 20\n<<<><><<>><><<\nvvvvvvv^v^vvvv^^^vv^",
"output": "NO"
},
{
"input": "18 18\n><>>><<<>><><>>>><\nvv^^^^v^v^^^^v^v^^",
"output": "NO"
},
{
"input": "8 18\n<><<<>>>\n^^^^^^v^^^vv^^vvvv",
"output": "NO"
},
{
"input": "11 12\n><><><<><><\n^^v^^^^^^^^v",
"output": "YES"
},
{
"input": "4 18\n<<>>\nv^v^v^^vvvv^v^^vv^",
"output": "YES"
},
{
"input": "16 11\n>><<><<<<>>><><<\n^^^^vvvv^vv",
"output": "YES"
},
{
"input": "14 7\n<><><<<>>>><>>\nvv^^v^^",
"output": "YES"
},
{
"input": "5 14\n>>>><\n^v^v^^^vv^vv^v",
"output": "YES"
},
{
"input": "8 18\n<<<><>>>\nv^^vvv^^v^v^vvvv^^",
"output": "YES"
},
{
"input": "18 18\n><><<><><>>><>>>><\n^^vvv^v^^^v^vv^^^v",
"output": "YES"
},
{
"input": "4 18\n<<>>\nv^v^v^^vvvv^v^^vv^",
"output": "YES"
},
{
"input": "19 18\n>>>><><<>>><<<><<<<\n^v^^^^vv^^v^^^^v^v",
"output": "YES"
},
{
"input": "14 20\n<>><<<><<>>>>>\nvv^^v^^^^v^^vv^^vvv^",
"output": "YES"
},
{
"input": "18 18\n><><<><><>>><>>>><\n^^vvv^v^^^v^vv^^^v",
"output": "YES"
},
{
"input": "8 18\n<<<><>>>\nv^^vvv^^v^v^vvvv^^",
"output": "YES"
},
{
"input": "20 19\n<><>>>>><<<<<><<>>>>\nv^vv^^vvvvvv^vvvv^v",
"output": "NO"
},
{
"input": "20 19\n<<<><<<>><<<>><><><>\nv^v^vvv^vvv^^^vvv^^",
"output": "YES"
},
{
"input": "19 20\n<><<<><><><<<<<<<<>\n^v^^^^v^^vvvv^^^^vvv",
"output": "NO"
},
{
"input": "19 20\n>>>>>>>><>>><><<<><\n^v^v^^^vvv^^^v^^vvvv",
"output": "YES"
},
{
"input": "20 20\n<<<>>>><>><<>><<>>>>\n^vvv^^^^vv^^^^^v^^vv",
"output": "NO"
},
{
"input": "20 20\n>>><><<><<<<<<<><<><\nvv^vv^vv^^^^^vv^^^^^",
"output": "NO"
},
{
"input": "20 20\n><<><<<<<<<>>><>>><<\n^^^^^^^^vvvv^vv^vvvv",
"output": "YES"
},
{
"input": "20 20\n<>>>>>>>><>>><>><<<>\nvv^^vv^^^^v^vv^v^^^^",
"output": "YES"
},
{
"input": "20 20\n><>><<>><>>>>>>>><<>\n^^v^vv^^^vvv^v^^^vv^",
"output": "NO"
},
{
"input": "20 20\n<<<<><<>><><<<>><<><\nv^^^^vvv^^^vvvv^v^vv",
"output": "NO"
},
{
"input": "20 20\n><<<><<><>>><><<<<<<\nvv^^vvv^^v^^v^vv^vvv",
"output": "NO"
},
{
"input": "20 20\n<<>>><>>>><<<<>>><<>\nv^vv^^^^^vvv^^v^^v^v",
"output": "NO"
},
{
"input": "20 20\n><<><<><<<<<<>><><>>\nv^^^v^vv^^v^^vvvv^vv",
"output": "NO"
},
{
"input": "20 20\n<<<<<<<<><>><><>><<<\n^vvv^^^v^^^vvv^^^^^v",
"output": "NO"
},
{
"input": "20 20\n>>><<<<<>>><><><<><<\n^^^vvv^^^v^^v^^v^vvv",
"output": "YES"
},
{
"input": "20 20\n<><<<><><>><><><<<<>\n^^^vvvv^vv^v^^^^v^vv",
"output": "NO"
},
{
"input": "20 20\n>>>>>>>>>><>>><>><>>\n^vvv^^^vv^^^^^^vvv^v",
"output": "NO"
},
{
"input": "20 20\n<><>><><<<<<>><<>>><\nv^^^v^v^v^vvvv^^^vv^",
"output": "NO"
},
{
"input": "20 20\n><<<><<<><<<><>>>><<\nvvvv^^^^^vv^v^^vv^v^",
"output": "NO"
},
{
"input": "20 20\n<<><<<<<<>>>>><<<>>>\nvvvvvv^v^vvv^^^^^^^^",
"output": "YES"
},
{
"input": "20 20\n><<><<>>>>><><>><>>>\nv^^^^vvv^^^^^v^v^vv^",
"output": "NO"
},
{
"input": "20 20\n<<>>><>><<>>>><<<><<\n^^vvv^^vvvv^vv^^v^v^",
"output": "NO"
},
{
"input": "20 20\n><<>><>>>><<><>><><<\n^v^^^^^^vvvv^v^v^v^^",
"output": "NO"
},
{
"input": "20 20\n<<><<<<><><<>>><>>>>\n^^vvvvv^v^^^^^^^vvv^",
"output": "NO"
},
{
"input": "20 20\n>><<<<<<><>>>><>>><>\n^^^v^v^vv^^vv^vvv^^^",
"output": "NO"
},
{
"input": "20 20\n>>>>>>>>>>>>>>>>>>>>\nvvvvvvvvvvvvvvvvvvvv",
"output": "NO"
},
{
"input": "2 2\n><\nv^",
"output": "NO"
},
{
"input": "2 2\n<>\n^v",
"output": "NO"
},
{
"input": "3 3\n>><\nvvv",
"output": "NO"
},
{
"input": "2 3\n<>\nv^^",
"output": "YES"
},
{
"input": "4 4\n>>><\nvvv^",
"output": "NO"
},
{
"input": "20 20\n<><><><><><><><><><>\nvvvvvvvvvvvvvvvvvvvv",
"output": "NO"
},
{
"input": "4 4\n<>>>\nv^^^",
"output": "YES"
},
{
"input": "20 20\n<><><><><><><><><><>\nv^v^v^v^v^v^v^v^v^v^",
"output": "YES"
},
{
"input": "2 3\n<>\n^v^",
"output": "NO"
},
{
"input": "4 3\n<><>\n^vv",
"output": "NO"
},
{
"input": "3 3\n<<>\nvv^",
"output": "YES"
},
{
"input": "2 3\n><\nvv^",
"output": "NO"
},
{
"input": "7 6\n>>><>><\n^vv^vv",
"output": "YES"
},
{
"input": "2 2\n<<\nv^",
"output": "NO"
},
{
"input": "3 3\n>><\n^^^",
"output": "NO"
},
{
"input": "3 3\n<><\nv^v",
"output": "NO"
},
{
"input": "20 20\n><><><><><><><><><><\n^v^v^v^v^v^v^v^v^v^v",
"output": "YES"
},
{
"input": "4 4\n<>>>\nvvv^",
"output": "YES"
}
] | 1,690,198,046
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 46
| 0
|
n, m = map(int, input().split())
hor = input()
vert = input()
if (vert[0]!=vert[n-1]) and (hor[0]!=hor[n-1]):
print("YES")
else:
print("NO")
|
Title: Strongly Connected City
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Imagine a city with *n* horizontal streets crossing *m* vertical streets, forming an (*n*<=-<=1)<=×<=(*m*<=-<=1) grid. In order to increase the traffic flow, mayor of the city has decided to make each street one way. This means in each horizontal street, the traffic moves only from west to east or only from east to west. Also, traffic moves only from north to south or only from south to north in each vertical street. It is possible to enter a horizontal street from a vertical street, or vice versa, at their intersection.
The mayor has received some street direction patterns. Your task is to check whether it is possible to reach any junction from any other junction in the proposed street direction pattern.
Input Specification:
The first line of input contains two integers *n* and *m*, (2<=≤<=*n*,<=*m*<=≤<=20), denoting the number of horizontal streets and the number of vertical streets.
The second line contains a string of length *n*, made of characters '<' and '>', denoting direction of each horizontal street. If the *i*-th character is equal to '<', the street is directed from east to west otherwise, the street is directed from west to east. Streets are listed in order from north to south.
The third line contains a string of length *m*, made of characters '^' and 'v', denoting direction of each vertical street. If the *i*-th character is equal to '^', the street is directed from south to north, otherwise the street is directed from north to south. Streets are listed in order from west to east.
Output Specification:
If the given pattern meets the mayor's criteria, print a single line containing "YES", otherwise print a single line containing "NO".
Demo Input:
['3 3\n><>\nv^v\n', '4 6\n<><>\nv^v^v^\n']
Demo Output:
['NO\n', 'YES\n']
Note:
The figure above shows street directions in the second sample test case.
|
```python
n, m = map(int, input().split())
hor = input()
vert = input()
if (vert[0]!=vert[n-1]) and (hor[0]!=hor[n-1]):
print("YES")
else:
print("NO")
```
| 0
|
|
689
|
B
|
Mike and Shortcuts
|
PROGRAMMING
| 1,600
|
[
"dfs and similar",
"graphs",
"greedy",
"shortest paths"
] | null | null |
Recently, Mike was very busy with studying for exams and contests. Now he is going to chill a bit by doing some sight seeing in the city.
City consists of *n* intersections numbered from 1 to *n*. Mike starts walking from his house located at the intersection number 1 and goes along some sequence of intersections. Walking from intersection number *i* to intersection *j* requires |*i*<=-<=*j*| units of energy. The total energy spent by Mike to visit a sequence of intersections *p*1<==<=1,<=*p*2,<=...,<=*p**k* is equal to units of energy.
Of course, walking would be boring if there were no shortcuts. A shortcut is a special path that allows Mike walking from one intersection to another requiring only 1 unit of energy. There are exactly *n* shortcuts in Mike's city, the *i**th* of them allows walking from intersection *i* to intersection *a**i* (*i*<=≤<=*a**i*<=≤<=*a**i*<=+<=1) (but not in the opposite direction), thus there is exactly one shortcut starting at each intersection. Formally, if Mike chooses a sequence *p*1<==<=1,<=*p*2,<=...,<=*p**k* then for each 1<=≤<=*i*<=<<=*k* satisfying *p**i*<=+<=1<==<=*a**p**i* and *a**p**i*<=≠<=*p**i* Mike will spend only 1 unit of energy instead of |*p**i*<=-<=*p**i*<=+<=1| walking from the intersection *p**i* to intersection *p**i*<=+<=1. For example, if Mike chooses a sequence *p*1<==<=1,<=*p*2<==<=*a**p*1,<=*p*3<==<=*a**p*2,<=...,<=*p**k*<==<=*a**p**k*<=-<=1, he spends exactly *k*<=-<=1 units of total energy walking around them.
Before going on his adventure, Mike asks you to find the minimum amount of energy required to reach each of the intersections from his home. Formally, for each 1<=≤<=*i*<=≤<=*n* Mike is interested in finding minimum possible total energy of some sequence *p*1<==<=1,<=*p*2,<=...,<=*p**k*<==<=*i*.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Mike's city intersection.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (*i*<=≤<=*a**i*<=≤<=*n* , , describing shortcuts of Mike's city, allowing to walk from intersection *i* to intersection *a**i* using only 1 unit of energy. Please note that the shortcuts don't allow walking in opposite directions (from *a**i* to *i*).
|
In the only line print *n* integers *m*1,<=*m*2,<=...,<=*m**n*, where *m**i* denotes the least amount of total energy required to walk from intersection 1 to intersection *i*.
|
[
"3\n2 2 3\n",
"5\n1 2 3 4 5\n",
"7\n4 4 4 4 7 7 7\n"
] |
[
"0 1 2 \n",
"0 1 2 3 4 \n",
"0 1 2 1 2 3 3 \n"
] |
In the first sample case desired sequences are:
1: 1; *m*<sub class="lower-index">1</sub> = 0;
2: 1, 2; *m*<sub class="lower-index">2</sub> = 1;
3: 1, 3; *m*<sub class="lower-index">3</sub> = |3 - 1| = 2.
In the second sample case the sequence for any intersection 1 < *i* is always 1, *i* and *m*<sub class="lower-index">*i*</sub> = |1 - *i*|.
In the third sample case — consider the following intersection sequences:
1: 1; *m*<sub class="lower-index">1</sub> = 0;
2: 1, 2; *m*<sub class="lower-index">2</sub> = |2 - 1| = 1;
3: 1, 4, 3; *m*<sub class="lower-index">3</sub> = 1 + |4 - 3| = 2;
4: 1, 4; *m*<sub class="lower-index">4</sub> = 1;
5: 1, 4, 5; *m*<sub class="lower-index">5</sub> = 1 + |4 - 5| = 2;
6: 1, 4, 6; *m*<sub class="lower-index">6</sub> = 1 + |4 - 6| = 3;
7: 1, 4, 5, 7; *m*<sub class="lower-index">7</sub> = 1 + |4 - 5| + 1 = 3.
| 1,000
|
[
{
"input": "3\n2 2 3",
"output": "0 1 2 "
},
{
"input": "5\n1 2 3 4 5",
"output": "0 1 2 3 4 "
},
{
"input": "7\n4 4 4 4 7 7 7",
"output": "0 1 2 1 2 3 3 "
},
{
"input": "98\n17 17 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 90 90 90 90 90 90 90 90 90 90 90 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 95 95 95 95 95 97 98 98",
"output": "0 1 2 3 4 5 6 7 8 8 7 6 5 4 3 2 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 4 4 5 6 5 6 7 8 "
},
{
"input": "91\n4 6 23 23 23 23 23 28 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 39 47 47 47 54 54 54 54 54 54 54 58 58 58 58 58 58 69 69 69 69 69 69 69 69 69 69 69 69 70 70 70 70 70 70 70 70 70 70 71 72 72 72 73 75 77 77 77 82 82 84 84 84 84 84 85 86 87 89 89 90 91",
"output": "0 1 2 1 2 2 3 4 5 6 7 8 9 10 10 9 8 7 6 5 4 3 2 3 4 5 6 5 6 7 8 9 9 8 7 6 5 4 3 4 5 6 7 8 9 10 9 10 9 8 7 6 5 4 5 6 7 6 7 8 9 10 11 10 9 8 7 6 5 6 6 7 8 9 10 11 11 12 13 14 14 13 14 14 15 16 17 18 19 20 21 "
},
{
"input": "82\n1 5 11 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 39 39 39 39 39 45 45 45 45 45 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 69 71 71 71 71 71 71 71 73 73 75 75 76 77 79 81 81 81 82",
"output": "0 1 2 3 2 3 4 5 5 4 3 4 5 6 7 8 9 10 11 12 13 12 11 10 9 8 7 6 5 4 3 4 5 6 7 8 9 10 9 9 8 7 6 5 4 5 6 7 8 9 10 11 12 13 14 15 16 16 15 14 13 12 11 10 9 8 7 6 5 6 6 7 8 9 10 11 12 13 14 15 15 16 "
},
{
"input": "4\n2 3 3 4",
"output": "0 1 2 3 "
}
] | 1,467,824,411
| 1,511
|
Python 3
|
COMPILATION_ERROR
|
PRETESTS
| 0
| 0
| 0
|
#include <bits/stdc++.h>
using namespace std;
typedef long long ll;
typedef unsigned long long ull;
typedef unsigned int ui;
typedef long double ld;
typedef pair<int, int> ii;
typedef pair<ii, ii> iii;
ll MOD = 1e9 + 7;
const ld E = 1e-10;
#define null NULL
#define ms(x) memset(x, 0, sizeof(x))
#ifndef LOCAL
#define endl "\n"
#endif
#define sync ios_base::sync_with_stdio(0); cin.tie(0); cout.tie(0);
#define _read(x) freopen(x, "r", stdin)
#define _write(x) freopen(x, "w", stdout)
#define files(x) _read(x ".in"); _write(x ".out")
#define filesdatsol(x) _read(x ".DAT"); _write(x ".SOL")
#define output _write("output.txt")
#define input _read("input.txt")
#define mod % MOD
#define y1 hello_world
unsigned char ccc;
bool _minus = false;
template<typename T>
inline T sqr(T t) {
return (t * t);
}
inline void read(ll &n) {
n = 0;
_minus = false;
while (true) {
ccc = getchar();
if (ccc == ' ' || ccc == '\n')
break;
if (ccc == '-') {
_minus = true;
continue;
}
n = n * 10 + ccc - '0';
}
if (_minus)
n *= -1;
}
inline void read(int &n) {
n = 0;
_minus = false;
while (true) {
ccc = getchar();
if (ccc == ' ' || ccc == '\n')
break;
if (ccc == '-') {
_minus = true;
continue;
}
n = n * 10 + ccc - '0';
}
if (_minus)
n *= -1;
}
char wwww[12];
int kkkk;
inline void write(ll y) {
long long x = y;
kkkk = 0;
if (!x)
++kkkk, wwww[kkkk] = '0';
else
while (x) {
++kkkk;
wwww[kkkk] = char(x % 10 + '0');
x /= 10;
}
for (int i = kkkk; i >= 1; --i)
putchar(wwww[i]);
putchar(' ');
}
#ifdef LOCAL
//#define DEBUG
#endif
#ifdef DEBUG
#define dbg if(1)
#else
#define dbg if(0)
#endif
int main() {
sync;
srand(time(NULL));
cout.precision(5);
cout << fixed;
#ifdef LOCAL
input;
#else
#endif
int n;
read(n);
int ar[n + 1];
for(int i = 1; i <= n; i++)
read(ar[i]);
vector<int> dp(n + 1, INT_MAX);
dp[0] = 0;
dp[1] = 0;
for(int i = 1; i <= n; i++){
dp[i] = min(dp[i], dp[i - 1] + 1);
if(ar[i] > i){
dp[ar[i]] = min(dp[ar[i]], dp[i] + 1);
}
write(dp[i]);
}
putchar('\n');
}
|
Title: Mike and Shortcuts
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, Mike was very busy with studying for exams and contests. Now he is going to chill a bit by doing some sight seeing in the city.
City consists of *n* intersections numbered from 1 to *n*. Mike starts walking from his house located at the intersection number 1 and goes along some sequence of intersections. Walking from intersection number *i* to intersection *j* requires |*i*<=-<=*j*| units of energy. The total energy spent by Mike to visit a sequence of intersections *p*1<==<=1,<=*p*2,<=...,<=*p**k* is equal to units of energy.
Of course, walking would be boring if there were no shortcuts. A shortcut is a special path that allows Mike walking from one intersection to another requiring only 1 unit of energy. There are exactly *n* shortcuts in Mike's city, the *i**th* of them allows walking from intersection *i* to intersection *a**i* (*i*<=≤<=*a**i*<=≤<=*a**i*<=+<=1) (but not in the opposite direction), thus there is exactly one shortcut starting at each intersection. Formally, if Mike chooses a sequence *p*1<==<=1,<=*p*2,<=...,<=*p**k* then for each 1<=≤<=*i*<=<<=*k* satisfying *p**i*<=+<=1<==<=*a**p**i* and *a**p**i*<=≠<=*p**i* Mike will spend only 1 unit of energy instead of |*p**i*<=-<=*p**i*<=+<=1| walking from the intersection *p**i* to intersection *p**i*<=+<=1. For example, if Mike chooses a sequence *p*1<==<=1,<=*p*2<==<=*a**p*1,<=*p*3<==<=*a**p*2,<=...,<=*p**k*<==<=*a**p**k*<=-<=1, he spends exactly *k*<=-<=1 units of total energy walking around them.
Before going on his adventure, Mike asks you to find the minimum amount of energy required to reach each of the intersections from his home. Formally, for each 1<=≤<=*i*<=≤<=*n* Mike is interested in finding minimum possible total energy of some sequence *p*1<==<=1,<=*p*2,<=...,<=*p**k*<==<=*i*.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Mike's city intersection.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (*i*<=≤<=*a**i*<=≤<=*n* , , describing shortcuts of Mike's city, allowing to walk from intersection *i* to intersection *a**i* using only 1 unit of energy. Please note that the shortcuts don't allow walking in opposite directions (from *a**i* to *i*).
Output Specification:
In the only line print *n* integers *m*1,<=*m*2,<=...,<=*m**n*, where *m**i* denotes the least amount of total energy required to walk from intersection 1 to intersection *i*.
Demo Input:
['3\n2 2 3\n', '5\n1 2 3 4 5\n', '7\n4 4 4 4 7 7 7\n']
Demo Output:
['0 1 2 \n', '0 1 2 3 4 \n', '0 1 2 1 2 3 3 \n']
Note:
In the first sample case desired sequences are:
1: 1; *m*<sub class="lower-index">1</sub> = 0;
2: 1, 2; *m*<sub class="lower-index">2</sub> = 1;
3: 1, 3; *m*<sub class="lower-index">3</sub> = |3 - 1| = 2.
In the second sample case the sequence for any intersection 1 < *i* is always 1, *i* and *m*<sub class="lower-index">*i*</sub> = |1 - *i*|.
In the third sample case — consider the following intersection sequences:
1: 1; *m*<sub class="lower-index">1</sub> = 0;
2: 1, 2; *m*<sub class="lower-index">2</sub> = |2 - 1| = 1;
3: 1, 4, 3; *m*<sub class="lower-index">3</sub> = 1 + |4 - 3| = 2;
4: 1, 4; *m*<sub class="lower-index">4</sub> = 1;
5: 1, 4, 5; *m*<sub class="lower-index">5</sub> = 1 + |4 - 5| = 2;
6: 1, 4, 6; *m*<sub class="lower-index">6</sub> = 1 + |4 - 6| = 3;
7: 1, 4, 5, 7; *m*<sub class="lower-index">7</sub> = 1 + |4 - 5| + 1 = 3.
|
```python
#include <bits/stdc++.h>
using namespace std;
typedef long long ll;
typedef unsigned long long ull;
typedef unsigned int ui;
typedef long double ld;
typedef pair<int, int> ii;
typedef pair<ii, ii> iii;
ll MOD = 1e9 + 7;
const ld E = 1e-10;
#define null NULL
#define ms(x) memset(x, 0, sizeof(x))
#ifndef LOCAL
#define endl "\n"
#endif
#define sync ios_base::sync_with_stdio(0); cin.tie(0); cout.tie(0);
#define _read(x) freopen(x, "r", stdin)
#define _write(x) freopen(x, "w", stdout)
#define files(x) _read(x ".in"); _write(x ".out")
#define filesdatsol(x) _read(x ".DAT"); _write(x ".SOL")
#define output _write("output.txt")
#define input _read("input.txt")
#define mod % MOD
#define y1 hello_world
unsigned char ccc;
bool _minus = false;
template<typename T>
inline T sqr(T t) {
return (t * t);
}
inline void read(ll &n) {
n = 0;
_minus = false;
while (true) {
ccc = getchar();
if (ccc == ' ' || ccc == '\n')
break;
if (ccc == '-') {
_minus = true;
continue;
}
n = n * 10 + ccc - '0';
}
if (_minus)
n *= -1;
}
inline void read(int &n) {
n = 0;
_minus = false;
while (true) {
ccc = getchar();
if (ccc == ' ' || ccc == '\n')
break;
if (ccc == '-') {
_minus = true;
continue;
}
n = n * 10 + ccc - '0';
}
if (_minus)
n *= -1;
}
char wwww[12];
int kkkk;
inline void write(ll y) {
long long x = y;
kkkk = 0;
if (!x)
++kkkk, wwww[kkkk] = '0';
else
while (x) {
++kkkk;
wwww[kkkk] = char(x % 10 + '0');
x /= 10;
}
for (int i = kkkk; i >= 1; --i)
putchar(wwww[i]);
putchar(' ');
}
#ifdef LOCAL
//#define DEBUG
#endif
#ifdef DEBUG
#define dbg if(1)
#else
#define dbg if(0)
#endif
int main() {
sync;
srand(time(NULL));
cout.precision(5);
cout << fixed;
#ifdef LOCAL
input;
#else
#endif
int n;
read(n);
int ar[n + 1];
for(int i = 1; i <= n; i++)
read(ar[i]);
vector<int> dp(n + 1, INT_MAX);
dp[0] = 0;
dp[1] = 0;
for(int i = 1; i <= n; i++){
dp[i] = min(dp[i], dp[i - 1] + 1);
if(ar[i] > i){
dp[ar[i]] = min(dp[ar[i]], dp[i] + 1);
}
write(dp[i]);
}
putchar('\n');
}
```
| -1
|
|
447
|
B
|
DZY Loves Strings
|
PROGRAMMING
| 1,000
|
[
"greedy",
"implementation"
] | null | null |
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
|
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
|
Print a single integer — the largest possible value of the resulting string DZY could get.
|
[
"abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n"
] |
[
"41\n"
] |
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
| 1,000
|
[
{
"input": "abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "41"
},
{
"input": "mmzhr\n3\n443 497 867 471 195 670 453 413 579 466 553 881 847 642 269 996 666 702 487 209 257 741 974 133 519 453",
"output": "29978"
},
{
"input": "ajeeseerqnpaujubmajpibxrccazaawetywxmifzehojf\n23\n359 813 772 413 733 654 33 87 890 433 395 311 801 852 376 148 914 420 636 695 583 733 664 394 407 314",
"output": "1762894"
},
{
"input": "uahngxejpomhbsebcxvelfsojbaouynnlsogjyvktpwwtcyddkcdqcqs\n34\n530 709 150 660 947 830 487 142 208 276 885 542 138 214 76 184 273 753 30 195 722 236 82 691 572 585",
"output": "2960349"
},
{
"input": "xnzeqmouqyzvblcidmhbkqmtusszuczadpooslqxegldanwopilmdwzbczvrwgnwaireykwpugvpnpafbxlyggkgawghysufuegvmzvpgcqyjkoadcreaguzepbendwnowsuekxxivkziibxvxfoilofxcgnxvfefyezfhevfvtetsuhwtyxdlkccdkvqjl\n282\n170 117 627 886 751 147 414 187 150 960 410 70 576 681 641 729 798 877 611 108 772 643 683 166 305 933",
"output": "99140444"
},
{
"input": "pplkqmluhfympkjfjnfdkwrkpumgdmbkfbbldpepicbbmdgafttpopzdxsevlqbtywzkoxyviglbbxsohycbdqksrhlumsldiwzjmednbkcjishkiekfrchzuztkcxnvuykhuenqojrmzaxlaoxnljnvqgnabtmcftisaazzgbmubmpsorygyusmeonrhrgphnfhlaxrvyhuxsnnezjxmdoklpquzpvjbxgbywppmegzxknhfzyygrmejleesoqfwheulmqhonqaukyuejtwxskjldplripyihbfpookxkuehiwqthbfafyrgmykuxglpplozycgydyecqkgfjljfqvigqhuxssqqtfanwszduwbsoytnrtgc\n464\n838 95 473 955 690 84 436 19 179 437 674 626 377 365 781 4 733 776 462 203 119 256 381 668 855 686",
"output": "301124161"
},
{
"input": "qkautnuilwlhjsldfcuwhiqtgtoihifszlyvfaygrnivzgvwthkrzzdtfjcirrjjlrmjtbjlzmjeqmuffsjorjyggzefwgvmblvotvzffnwjhqxorpowzdcnfksdibezdtfjjxfozaghieksbmowrbeehuxlesmvqjsphlvauxiijm\n98\n121 622 0 691 616 959 838 161 581 862 876 830 267 812 598 106 337 73 588 323 999 17 522 399 657 495",
"output": "30125295"
},
{
"input": "tghyxqfmhz\n8\n191 893 426 203 780 326 148 259 182 140 847 636 778 97 167 773 219 891 758 993 695 603 223 779 368 165",
"output": "136422"
},
{
"input": "nyawbfjxnxjiyhwkydaruozobpphgjqdpfdqzezcsoyvurnapu\n30\n65 682 543 533 990 148 815 821 315 916 632 771 332 513 472 864 12 73 548 687 660 572 507 192 226 348",
"output": "2578628"
},
{
"input": "pylrnkrbcjgoytvdnhmlvnkknijkdgdhworlvtwuonrkhrilkewcnofodaumgvnsisxooswgrgtvdeauyxhkipfoxrrtysuepjcf\n60\n894 206 704 179 272 337 413 828 119 182 330 46 440 102 250 191 242 539 678 783 843 431 612 567 33 338",
"output": "9168707"
},
{
"input": "vhjnkrxbyhjhnjrxvwxmhxwoxttbtqosfxtcuvhfjlkyfspeypthsdkkwnqdpxdlnxsgtzvkrgqosgfjrwetqbxgoarkjhrjbspzgblsapifltkfxbfdbxqwoohlgyzijmiwnpmveybyzvasoctxsmgjehpyysmqblwnmkappbecklqjfmxhlyceordroflnposohfplrvijxbwvqdtvzhobtrumiujnyrfbwthvciinuveoizkccelxtaveiiagryqnyvsgfnipnavrtmdqlcnldepocbpzmqnarkdvykds\n276\n364 244 798 82 582 9 309 950 286 547 892 371 569 159 705 975 740 845 655 179 130 993 255 552 882 657",
"output": "144901921"
},
{
"input": "gsaddmezrnttfalbwlqbnedumvikplfosw\n12\n290 850 872 361 483 895 152 118 974 619 701 154 899 285 328 712 669 984 407 340 851 775 324 892 554 860",
"output": "809931"
},
{
"input": "a\n0\n5 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "5"
},
{
"input": "lol\n3\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "21"
}
] | 1,405,270,623
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 24
| 140
| 5,120,000
|
import sys
import string
from decimal import *
from itertools import *
from math import *
def solve():
s = input()
k = int(input())
w = list(map(int,input().split()))
mm = max(w)
ans = 0
for i in range(len(s)+k):
if (i < len(s)):
ans = ans + w[ord(s[i])-ord('a')]*(i+1)
else:
ans = ans + mm*(i+1)
print(ans)
solve();
|
Title: DZY Loves Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
Input Specification:
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
Output Specification:
Print a single integer — the largest possible value of the resulting string DZY could get.
Demo Input:
['abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n']
Demo Output:
['41\n']
Note:
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
|
```python
import sys
import string
from decimal import *
from itertools import *
from math import *
def solve():
s = input()
k = int(input())
w = list(map(int,input().split()))
mm = max(w)
ans = 0
for i in range(len(s)+k):
if (i < len(s)):
ans = ans + w[ord(s[i])-ord('a')]*(i+1)
else:
ans = ans + mm*(i+1)
print(ans)
solve();
```
| 3
|
|
883
|
G
|
Orientation of Edges
|
PROGRAMMING
| 1,900
|
[
"dfs and similar",
"graphs"
] | null | null |
Vasya has a graph containing both directed (oriented) and undirected (non-oriented) edges. There can be multiple edges between a pair of vertices.
Vasya has picked a vertex *s* from the graph. Now Vasya wants to create two separate plans:
1. to orient each undirected edge in one of two possible directions to maximize number of vertices reachable from vertex *s*; 1. to orient each undirected edge in one of two possible directions to minimize number of vertices reachable from vertex *s*.
In each of two plans each undirected edge must become directed. For an edge chosen directions can differ in two plans.
Help Vasya find the plans.
|
The first line contains three integers *n*, *m* and *s* (2<=≤<=*n*<=≤<=3·105, 1<=≤<=*m*<=≤<=3·105, 1<=≤<=*s*<=≤<=*n*) — number of vertices and edges in the graph, and the vertex Vasya has picked.
The following *m* lines contain information about the graph edges. Each line contains three integers *t**i*, *u**i* and *v**i* (1<=≤<=*t**i*<=≤<=2, 1<=≤<=*u**i*,<=*v**i*<=≤<=*n*, *u**i*<=≠<=*v**i*) — edge type and vertices connected by the edge. If *t**i*<==<=1 then the edge is directed and goes from the vertex *u**i* to the vertex *v**i*. If *t**i*<==<=2 then the edge is undirected and it connects the vertices *u**i* and *v**i*.
It is guaranteed that there is at least one undirected edge in the graph.
|
The first two lines should describe the plan which maximizes the number of reachable vertices. The lines three and four should describe the plan which minimizes the number of reachable vertices.
A description of each plan should start with a line containing the number of reachable vertices. The second line of a plan should consist of *f* symbols '+' and '-', where *f* is the number of undirected edges in the initial graph. Print '+' as the *j*-th symbol of the string if the *j*-th undirected edge (*u*,<=*v*) from the input should be oriented from *u* to *v*. Print '-' to signify the opposite direction (from *v* to *u*). Consider undirected edges to be numbered in the same order they are given in the input.
If there are multiple solutions, print any of them.
|
[
"2 2 1\n1 1 2\n2 2 1\n",
"6 6 3\n2 2 6\n1 4 5\n2 3 4\n1 4 1\n1 3 1\n2 2 3\n"
] |
[
"2\n-\n2\n+\n",
"6\n++-\n2\n+-+\n"
] |
none
| 0
|
[
{
"input": "2 2 1\n1 1 2\n2 2 1",
"output": "2\n-\n2\n+"
},
{
"input": "6 6 3\n2 2 6\n1 4 5\n2 3 4\n1 4 1\n1 3 1\n2 2 3",
"output": "6\n++-\n2\n+-+"
},
{
"input": "5 5 5\n2 5 3\n1 2 3\n1 4 5\n2 5 2\n1 2 1",
"output": "4\n++\n1\n--"
},
{
"input": "13 18 9\n2 3 10\n1 12 10\n1 11 4\n2 2 8\n1 5 1\n1 7 12\n1 5 13\n1 9 7\n1 10 11\n2 3 12\n1 9 2\n1 3 9\n1 8 12\n2 11 3\n1 3 1\n1 8 4\n2 9 11\n1 12 13",
"output": "11\n++-++\n8\n+-+-+"
},
{
"input": "5 10 2\n2 2 4\n1 1 2\n2 2 3\n1 3 1\n1 4 1\n1 5 1\n1 3 4\n2 5 4\n1 5 2\n2 5 3",
"output": "5\n++--\n1\n--++"
},
{
"input": "5 5 1\n2 5 3\n2 2 5\n1 2 1\n2 4 2\n1 1 5",
"output": "5\n+--\n2\n-++"
},
{
"input": "5 10 3\n2 5 1\n2 1 3\n2 3 5\n2 1 4\n2 5 4\n2 2 5\n2 3 2\n2 2 1\n2 4 3\n2 4 2",
"output": "5\n--+---+---\n1\n++-+++-+++"
},
{
"input": "10 10 9\n2 1 6\n2 7 8\n1 4 1\n2 5 10\n1 5 2\n1 6 7\n1 5 1\n2 9 8\n2 5 3\n2 3 8",
"output": "9\n+-++--\n1\n+++-++"
},
{
"input": "10 20 5\n2 3 8\n2 10 2\n1 8 2\n1 7 3\n1 1 8\n1 8 5\n1 2 7\n1 3 9\n1 6 1\n2 10 8\n1 4 5\n1 6 8\n2 3 4\n1 6 5\n1 2 4\n1 2 3\n1 5 9\n2 4 9\n1 4 7\n1 6 2",
"output": "8\n+----\n2\n+++++"
},
{
"input": "10 10 6\n2 1 4\n1 7 8\n1 6 4\n1 7 2\n1 6 2\n1 1 3\n1 9 7\n1 3 10\n1 9 6\n1 9 1",
"output": "6\n-\n3\n+"
},
{
"input": "10 20 10\n2 7 3\n1 7 9\n1 3 6\n2 8 3\n2 9 2\n1 5 3\n2 9 8\n2 9 1\n1 5 9\n1 10 2\n1 6 7\n2 3 2\n2 8 1\n1 6 1\n2 4 6\n2 10 9\n2 5 7\n2 10 1\n1 2 7\n2 3 4",
"output": "10\n---+----+-++\n4\n-++--+++++-+"
},
{
"input": "14 19 14\n2 5 7\n1 4 1\n2 9 8\n1 7 3\n2 14 2\n2 2 8\n2 6 7\n2 14 7\n1 7 8\n2 10 8\n2 11 10\n1 11 7\n2 3 13\n1 5 4\n1 14 8\n2 3 1\n2 6 1\n2 6 10\n2 8 1",
"output": "13\n--+--+--+---+\n2\n++-++-++++++-"
},
{
"input": "300000 1 5345\n2 5345 23423",
"output": "2\n+\n1\n-"
},
{
"input": "2 5 1\n1 1 2\n1 1 2\n1 1 2\n2 1 2\n1 1 2",
"output": "2\n+\n2\n+"
},
{
"input": "2 5 2\n1 1 2\n1 1 2\n1 1 2\n2 1 2\n1 1 2",
"output": "2\n-\n1\n+"
},
{
"input": "2 5 2\n2 1 2\n2 1 2\n2 1 2\n2 1 2\n2 1 2",
"output": "2\n-----\n1\n+++++"
},
{
"input": "2 5 2\n1 1 2\n1 1 2\n1 2 1\n2 1 2\n1 2 1",
"output": "2\n-\n2\n+"
},
{
"input": "2 5 1\n1 1 2\n1 1 2\n1 2 1\n2 1 2\n1 2 1",
"output": "2\n+\n2\n+"
},
{
"input": "2 2 1\n2 1 2\n2 2 1",
"output": "2\n+-\n1\n-+"
},
{
"input": "2 5 1\n2 1 2\n2 1 2\n2 1 2\n2 1 2\n2 1 2",
"output": "2\n+++++\n1\n-----"
}
] | 1,609,965,477
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 12
| 530
| 20,480,000
|
from collections import defaultdict
def dfs(u):
vis[u]=1
for j in adj[u]:
if d[j,u]==1:
d1[j,u]="+"
elif d[u,j]==1:
d1[u,j]="-"
if d3[u,j]:
if not vis[j]:
dfs(j)
def dfs2(u):
vis[u] = 1
for j in adj[u]:
if not vis[j]:
if d[j, u] == 1:
d2[j, u] = "-"
elif d[u, j] == 1:
d2[u, j] = "+"
dfs2(j)
n,m,s=map(int,input().split())
edges=[]
adj=[[] for i in range(n+1)]
d=defaultdict(lambda:0)
d3=defaultdict(lambda:0)
d1=defaultdict(lambda:"+")
d2=defaultdict(lambda:"+")
for j in range(m):
b=list(map(int,input().split()))
if b[0]==1:
adj[b[1]].append(b[2])
d3[b[1],b[2]]=1
else:
adj[b[1]].append(b[2])
adj[b[2]].append(b[1])
d[b[1],b[2]]=1
edges.append([b[1],b[2]])
vis=[0]*(n+1)
dfs(s)
m1=vis.count(1)
vis=[0]*(n+1)
dfs2(s)
m2=vis.count(1)
res1=[]
res2=[]
for j in edges:
res1.append(d1[j[0],j[1]])
res2.append(d2[j[0],j[1]])
print(m2)
print("".join(res2))
print(m1)
print("".join(res1))
|
Title: Orientation of Edges
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has a graph containing both directed (oriented) and undirected (non-oriented) edges. There can be multiple edges between a pair of vertices.
Vasya has picked a vertex *s* from the graph. Now Vasya wants to create two separate plans:
1. to orient each undirected edge in one of two possible directions to maximize number of vertices reachable from vertex *s*; 1. to orient each undirected edge in one of two possible directions to minimize number of vertices reachable from vertex *s*.
In each of two plans each undirected edge must become directed. For an edge chosen directions can differ in two plans.
Help Vasya find the plans.
Input Specification:
The first line contains three integers *n*, *m* and *s* (2<=≤<=*n*<=≤<=3·105, 1<=≤<=*m*<=≤<=3·105, 1<=≤<=*s*<=≤<=*n*) — number of vertices and edges in the graph, and the vertex Vasya has picked.
The following *m* lines contain information about the graph edges. Each line contains three integers *t**i*, *u**i* and *v**i* (1<=≤<=*t**i*<=≤<=2, 1<=≤<=*u**i*,<=*v**i*<=≤<=*n*, *u**i*<=≠<=*v**i*) — edge type and vertices connected by the edge. If *t**i*<==<=1 then the edge is directed and goes from the vertex *u**i* to the vertex *v**i*. If *t**i*<==<=2 then the edge is undirected and it connects the vertices *u**i* and *v**i*.
It is guaranteed that there is at least one undirected edge in the graph.
Output Specification:
The first two lines should describe the plan which maximizes the number of reachable vertices. The lines three and four should describe the plan which minimizes the number of reachable vertices.
A description of each plan should start with a line containing the number of reachable vertices. The second line of a plan should consist of *f* symbols '+' and '-', where *f* is the number of undirected edges in the initial graph. Print '+' as the *j*-th symbol of the string if the *j*-th undirected edge (*u*,<=*v*) from the input should be oriented from *u* to *v*. Print '-' to signify the opposite direction (from *v* to *u*). Consider undirected edges to be numbered in the same order they are given in the input.
If there are multiple solutions, print any of them.
Demo Input:
['2 2 1\n1 1 2\n2 2 1\n', '6 6 3\n2 2 6\n1 4 5\n2 3 4\n1 4 1\n1 3 1\n2 2 3\n']
Demo Output:
['2\n-\n2\n+\n', '6\n++-\n2\n+-+\n']
Note:
none
|
```python
from collections import defaultdict
def dfs(u):
vis[u]=1
for j in adj[u]:
if d[j,u]==1:
d1[j,u]="+"
elif d[u,j]==1:
d1[u,j]="-"
if d3[u,j]:
if not vis[j]:
dfs(j)
def dfs2(u):
vis[u] = 1
for j in adj[u]:
if not vis[j]:
if d[j, u] == 1:
d2[j, u] = "-"
elif d[u, j] == 1:
d2[u, j] = "+"
dfs2(j)
n,m,s=map(int,input().split())
edges=[]
adj=[[] for i in range(n+1)]
d=defaultdict(lambda:0)
d3=defaultdict(lambda:0)
d1=defaultdict(lambda:"+")
d2=defaultdict(lambda:"+")
for j in range(m):
b=list(map(int,input().split()))
if b[0]==1:
adj[b[1]].append(b[2])
d3[b[1],b[2]]=1
else:
adj[b[1]].append(b[2])
adj[b[2]].append(b[1])
d[b[1],b[2]]=1
edges.append([b[1],b[2]])
vis=[0]*(n+1)
dfs(s)
m1=vis.count(1)
vis=[0]*(n+1)
dfs2(s)
m2=vis.count(1)
res1=[]
res2=[]
for j in edges:
res1.append(d1[j[0],j[1]])
res2.append(d2[j[0],j[1]])
print(m2)
print("".join(res2))
print(m1)
print("".join(res1))
```
| -1
|
|
407
|
A
|
Triangle
|
PROGRAMMING
| 1,600
|
[
"brute force",
"geometry",
"implementation",
"math"
] | null | null |
There is a right triangle with legs of length *a* and *b*. Your task is to determine whether it is possible to locate the triangle on the plane in such a way that none of its sides is parallel to the coordinate axes. All the vertices must have integer coordinates. If there exists such a location, you have to output the appropriate coordinates of vertices.
|
The first line contains two integers *a*,<=*b* (1<=≤<=*a*,<=*b*<=≤<=1000), separated by a single space.
|
In the first line print either "YES" or "NO" (without the quotes) depending on whether the required location exists. If it does, print in the next three lines three pairs of integers — the coordinates of the triangle vertices, one pair per line. The coordinates must be integers, not exceeding 109 in their absolute value.
|
[
"1 1\n",
"5 5\n",
"5 10\n"
] |
[
"NO\n",
"YES\n2 1\n5 5\n-2 4\n",
"YES\n-10 4\n-2 -2\n1 2\n"
] |
none
| 500
|
[
{
"input": "1 1",
"output": "NO"
},
{
"input": "5 5",
"output": "YES\n2 1\n5 5\n-2 4"
},
{
"input": "5 10",
"output": "YES\n-10 4\n-2 -2\n1 2"
},
{
"input": "2 2",
"output": "NO"
},
{
"input": "5 6",
"output": "NO"
},
{
"input": "5 11",
"output": "NO"
},
{
"input": "10 15",
"output": "YES\n0 0\n6 8\n-12 9"
},
{
"input": "935 938",
"output": "NO"
},
{
"input": "999 1000",
"output": "NO"
},
{
"input": "1000 1000",
"output": "YES\n0 0\n280 960\n-960 280"
},
{
"input": "15 20",
"output": "YES\n0 0\n12 9\n-12 16"
},
{
"input": "20 15",
"output": "YES\n0 0\n12 16\n-12 9"
},
{
"input": "629 865",
"output": "NO"
},
{
"input": "45 872",
"output": "NO"
},
{
"input": "757 582",
"output": "NO"
},
{
"input": "173 588",
"output": "NO"
},
{
"input": "533 298",
"output": "NO"
},
{
"input": "949 360",
"output": "NO"
},
{
"input": "661 175",
"output": "NO"
},
{
"input": "728 299",
"output": "YES\n0 0\n280 672\n-276 115"
},
{
"input": "575 85",
"output": "YES\n0 0\n345 460\n-68 51"
},
{
"input": "385 505",
"output": "YES\n0 0\n231 308\n-404 303"
},
{
"input": "755 865",
"output": "YES\n0 0\n453 604\n-692 519"
},
{
"input": "395 55",
"output": "YES\n0 0\n237 316\n-44 33"
},
{
"input": "600 175",
"output": "YES\n0 0\n168 576\n-168 49"
},
{
"input": "280 210",
"output": "YES\n0 0\n168 224\n-168 126"
},
{
"input": "180 135",
"output": "YES\n0 0\n108 144\n-108 81"
},
{
"input": "140 105",
"output": "YES\n0 0\n84 112\n-84 63"
},
{
"input": "440 330",
"output": "YES\n0 0\n264 352\n-264 198"
},
{
"input": "130 312",
"output": "YES\n0 0\n120 50\n-120 288"
},
{
"input": "65 156",
"output": "YES\n0 0\n60 25\n-60 144"
},
{
"input": "105 140",
"output": "YES\n0 0\n84 63\n-84 112"
},
{
"input": "408 765",
"output": "YES\n0 0\n360 192\n-360 675"
},
{
"input": "195 468",
"output": "YES\n0 0\n180 75\n-180 432"
},
{
"input": "305 949",
"output": "NO"
},
{
"input": "80 60",
"output": "YES\n0 0\n48 64\n-48 36"
},
{
"input": "15 15",
"output": "YES\n0 0\n9 12\n-12 9"
},
{
"input": "120 90",
"output": "YES\n0 0\n72 96\n-72 54"
},
{
"input": "60 80",
"output": "YES\n0 0\n48 36\n-48 64"
},
{
"input": "5 25",
"output": "YES\n0 0\n3 4\n-20 15"
},
{
"input": "5 1000",
"output": "YES\n0 0\n3 4\n-800 600"
},
{
"input": "25 35",
"output": "YES\n0 0\n15 20\n-28 21"
},
{
"input": "25 5",
"output": "YES\n0 0\n15 20\n-4 3"
},
{
"input": "30 40",
"output": "YES\n0 0\n24 18\n-24 32"
},
{
"input": "65 156",
"output": "YES\n0 0\n60 25\n-60 144"
},
{
"input": "455 470",
"output": "YES\n0 0\n273 364\n-376 282"
},
{
"input": "90 120",
"output": "YES\n0 0\n72 54\n-72 96"
},
{
"input": "5 205",
"output": "YES\n0 0\n3 4\n-164 123"
},
{
"input": "111 111",
"output": "YES\n0 0\n36 105\n-105 36"
},
{
"input": "17 17",
"output": "YES\n0 0\n8 15\n-15 8"
},
{
"input": "1000 5",
"output": "YES\n0 0\n600 800\n-4 3"
}
] | 1,557,365,076
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 93
| 0
|
a, b = map(int, input().split())
s = [i*i for i in range(1, int(max(a, b)**0.5+1))]
for i in s:
if a-i in s:
for j in s:
if b-j in s: print('YES'); exit()
print('NO'); exit()
print('NO')
|
Title: Triangle
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a right triangle with legs of length *a* and *b*. Your task is to determine whether it is possible to locate the triangle on the plane in such a way that none of its sides is parallel to the coordinate axes. All the vertices must have integer coordinates. If there exists such a location, you have to output the appropriate coordinates of vertices.
Input Specification:
The first line contains two integers *a*,<=*b* (1<=≤<=*a*,<=*b*<=≤<=1000), separated by a single space.
Output Specification:
In the first line print either "YES" or "NO" (without the quotes) depending on whether the required location exists. If it does, print in the next three lines three pairs of integers — the coordinates of the triangle vertices, one pair per line. The coordinates must be integers, not exceeding 109 in their absolute value.
Demo Input:
['1 1\n', '5 5\n', '5 10\n']
Demo Output:
['NO\n', 'YES\n2 1\n5 5\n-2 4\n', 'YES\n-10 4\n-2 -2\n1 2\n']
Note:
none
|
```python
a, b = map(int, input().split())
s = [i*i for i in range(1, int(max(a, b)**0.5+1))]
for i in s:
if a-i in s:
for j in s:
if b-j in s: print('YES'); exit()
print('NO'); exit()
print('NO')
```
| 0
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,650,192,875
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
n, m =input().split()
e = (int(n)*int(m))/2
print(int(e))
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
n, m =input().split()
e = (int(n)*int(m))/2
print(int(e))
```
| -1
|
723
|
A
|
The New Year: Meeting Friends
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"sortings"
] | null | null |
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
|
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
|
Print one integer — the minimum total distance the friends need to travel in order to meet together.
|
[
"7 1 4\n",
"30 20 10\n"
] |
[
"6\n",
"20\n"
] |
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
| 500
|
[
{
"input": "7 1 4",
"output": "6"
},
{
"input": "30 20 10",
"output": "20"
},
{
"input": "1 4 100",
"output": "99"
},
{
"input": "100 1 91",
"output": "99"
},
{
"input": "1 45 100",
"output": "99"
},
{
"input": "1 2 3",
"output": "2"
},
{
"input": "71 85 88",
"output": "17"
},
{
"input": "30 38 99",
"output": "69"
},
{
"input": "23 82 95",
"output": "72"
},
{
"input": "22 41 47",
"output": "25"
},
{
"input": "9 94 77",
"output": "85"
},
{
"input": "1 53 51",
"output": "52"
},
{
"input": "25 97 93",
"output": "72"
},
{
"input": "42 53 51",
"output": "11"
},
{
"input": "81 96 94",
"output": "15"
},
{
"input": "21 5 93",
"output": "88"
},
{
"input": "50 13 75",
"output": "62"
},
{
"input": "41 28 98",
"output": "70"
},
{
"input": "69 46 82",
"output": "36"
},
{
"input": "87 28 89",
"output": "61"
},
{
"input": "44 45 40",
"output": "5"
},
{
"input": "86 97 68",
"output": "29"
},
{
"input": "43 92 30",
"output": "62"
},
{
"input": "16 70 1",
"output": "69"
},
{
"input": "40 46 19",
"output": "27"
},
{
"input": "71 38 56",
"output": "33"
},
{
"input": "82 21 80",
"output": "61"
},
{
"input": "75 8 35",
"output": "67"
},
{
"input": "75 24 28",
"output": "51"
},
{
"input": "78 23 56",
"output": "55"
},
{
"input": "85 31 10",
"output": "75"
},
{
"input": "76 50 9",
"output": "67"
},
{
"input": "95 37 34",
"output": "61"
},
{
"input": "84 61 35",
"output": "49"
},
{
"input": "87 85 37",
"output": "50"
},
{
"input": "1 3 2",
"output": "2"
},
{
"input": "4 2 6",
"output": "4"
},
{
"input": "6 9 3",
"output": "6"
},
{
"input": "12 4 8",
"output": "8"
},
{
"input": "15 10 5",
"output": "10"
},
{
"input": "1 50 17",
"output": "49"
},
{
"input": "10 5 15",
"output": "10"
},
{
"input": "8 1 9",
"output": "8"
},
{
"input": "3 5 4",
"output": "2"
},
{
"input": "2 1 3",
"output": "2"
},
{
"input": "1 8 2",
"output": "7"
},
{
"input": "1 100 2",
"output": "99"
},
{
"input": "1 4 6",
"output": "5"
}
] | 1,688,419,907
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 46
| 0
|
x1,x2,x3 = map(int, input().split())
z1 = abs(x2-x1)+abs(x3-x2)
z2 = abs(x1-x2)+abs(x1-x3)
z3 = abs(x3-x1)+abs(x3-x2)
print(min(z1,z2,z3))
|
Title: The New Year: Meeting Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
Input Specification:
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
Output Specification:
Print one integer — the minimum total distance the friends need to travel in order to meet together.
Demo Input:
['7 1 4\n', '30 20 10\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
|
```python
x1,x2,x3 = map(int, input().split())
z1 = abs(x2-x1)+abs(x3-x2)
z2 = abs(x1-x2)+abs(x1-x3)
z3 = abs(x3-x1)+abs(x3-x2)
print(min(z1,z2,z3))
```
| 3
|
|
867
|
A
|
Between the Offices
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
|
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
|
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower).
|
[
"4\nFSSF\n",
"2\nSF\n",
"10\nFFFFFFFFFF\n",
"10\nSSFFSFFSFF\n"
] |
[
"NO\n",
"YES\n",
"NO\n",
"YES\n"
] |
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
| 500
|
[
{
"input": "4\nFSSF",
"output": "NO"
},
{
"input": "2\nSF",
"output": "YES"
},
{
"input": "10\nFFFFFFFFFF",
"output": "NO"
},
{
"input": "10\nSSFFSFFSFF",
"output": "YES"
},
{
"input": "20\nSFSFFFFSSFFFFSSSSFSS",
"output": "NO"
},
{
"input": "20\nSSFFFFFSFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "20\nSSFSFSFSFSFSFSFSSFSF",
"output": "YES"
},
{
"input": "20\nSSSSFSFSSFSFSSSSSSFS",
"output": "NO"
},
{
"input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF",
"output": "NO"
},
{
"input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF",
"output": "YES"
},
{
"input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS",
"output": "NO"
},
{
"input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS",
"output": "NO"
},
{
"input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS",
"output": "NO"
},
{
"input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS",
"output": "NO"
},
{
"input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF",
"output": "YES"
},
{
"input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF",
"output": "YES"
},
{
"input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF",
"output": "YES"
},
{
"input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF",
"output": "YES"
},
{
"input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF",
"output": "YES"
},
{
"input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF",
"output": "YES"
},
{
"input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "2\nSS",
"output": "NO"
}
] | 1,579,113,971
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 108
| 0
|
#867A
n = int(input())
a = list(input())
cur = a[0]
count = 0
total = 0
for i in range(1,n):
if cur == 'S' and a[i] == 'F':
count+=1
if cur == a[i]:
total += 1
cur = a[i]
if count > (total-count):
print('YES')
else:
print('NO')
|
Title: Between the Offices
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
Input Specification:
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Output Specification:
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower).
Demo Input:
['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n', 'YES\n']
Note:
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
|
```python
#867A
n = int(input())
a = list(input())
cur = a[0]
count = 0
total = 0
for i in range(1,n):
if cur == 'S' and a[i] == 'F':
count+=1
if cur == a[i]:
total += 1
cur = a[i]
if count > (total-count):
print('YES')
else:
print('NO')
```
| 0
|
|
954
|
A
|
Diagonal Walking
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Mikhail walks on a 2D plane. He can go either up or right. You are given a sequence of Mikhail's moves. He thinks that this sequence is too long and he wants to make it as short as possible.
In the given sequence moving up is described by character U and moving right is described by character R. Mikhail can replace any pair of consecutive moves RU or UR with a diagonal move (described as character D). After that, he can go on and do some other replacements, until there is no pair of consecutive moves RU or UR left.
Your problem is to print the minimum possible length of the sequence of moves after the replacements.
|
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=100) — the length of the sequence. The second line contains the sequence consisting of *n* characters U and R.
|
Print the minimum possible length of the sequence of moves after all replacements are done.
|
[
"5\nRUURU\n",
"17\nUUURRRRRUUURURUUU\n"
] |
[
"3\n",
"13\n"
] |
In the first test the shortened sequence of moves may be DUD (its length is 3).
In the second test the shortened sequence of moves can be UUDRRRDUDDUUU (its length is 13).
| 0
|
[
{
"input": "5\nRUURU",
"output": "3"
},
{
"input": "17\nUUURRRRRUUURURUUU",
"output": "13"
},
{
"input": "100\nUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU",
"output": "100"
},
{
"input": "100\nRRURRUUUURURRRURRRRURRRRRRURRUURRRUUURUURURRURUURUURRUURUURRURURUUUUURUUUUUURRUUURRRURRURRRUURRUUUUR",
"output": "67"
},
{
"input": "100\nUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUURUUUUUUUUUUUUUUUUUUUUU",
"output": "99"
},
{
"input": "3\nRUR",
"output": "2"
},
{
"input": "1\nR",
"output": "1"
},
{
"input": "5\nRURUU",
"output": "3"
},
{
"input": "1\nU",
"output": "1"
},
{
"input": "2\nUR",
"output": "1"
},
{
"input": "23\nUUUUUUUUUUUUUUUUUUUUUUU",
"output": "23"
}
] | 1,675,860,378
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
n = int(input())
s = input()
# Count the number of 'U's and 'R's in the input string
u_count = s.count('U')
r_count = s.count('R')
# The minimum length of the sequence after replacements is the minimum of the number of 'U's and 'R's
print(min(u_count, r_count) * 2 + 1)
|
Title: Diagonal Walking
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mikhail walks on a 2D plane. He can go either up or right. You are given a sequence of Mikhail's moves. He thinks that this sequence is too long and he wants to make it as short as possible.
In the given sequence moving up is described by character U and moving right is described by character R. Mikhail can replace any pair of consecutive moves RU or UR with a diagonal move (described as character D). After that, he can go on and do some other replacements, until there is no pair of consecutive moves RU or UR left.
Your problem is to print the minimum possible length of the sequence of moves after the replacements.
Input Specification:
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=100) — the length of the sequence. The second line contains the sequence consisting of *n* characters U and R.
Output Specification:
Print the minimum possible length of the sequence of moves after all replacements are done.
Demo Input:
['5\nRUURU\n', '17\nUUURRRRRUUURURUUU\n']
Demo Output:
['3\n', '13\n']
Note:
In the first test the shortened sequence of moves may be DUD (its length is 3).
In the second test the shortened sequence of moves can be UUDRRRDUDDUUU (its length is 13).
|
```python
n = int(input())
s = input()
# Count the number of 'U's and 'R's in the input string
u_count = s.count('U')
r_count = s.count('R')
# The minimum length of the sequence after replacements is the minimum of the number of 'U's and 'R's
print(min(u_count, r_count) * 2 + 1)
```
| 0
|
|
965
|
A
|
Paper Airplanes
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes.
A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy?
|
The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively.
|
Print a single integer — the minimum number of packs they should buy.
|
[
"5 3 2 3\n",
"5 3 100 1\n"
] |
[
"4\n",
"5\n"
] |
In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs.
In the second sample they have to buy a pack for each person as they can't share sheets.
| 500
|
[
{
"input": "5 3 2 3",
"output": "4"
},
{
"input": "5 3 100 1",
"output": "5"
},
{
"input": "10000 10000 1 1",
"output": "100000000"
},
{
"input": "1 1 10000 10000",
"output": "1"
},
{
"input": "300 300 21 23",
"output": "196"
},
{
"input": "300 2 37 51",
"output": "6"
},
{
"input": "2 400 23 57",
"output": "1"
},
{
"input": "1 1 1 1",
"output": "1"
},
{
"input": "10000 10000 3 2",
"output": "16670000"
},
{
"input": "1 2 1 2",
"output": "1"
},
{
"input": "1 1 2 2",
"output": "1"
},
{
"input": "1 1 10 10",
"output": "1"
},
{
"input": "5324 5439 32 13",
"output": "69622"
},
{
"input": "9000 1 2432 1",
"output": "9000"
},
{
"input": "230 1234 9124 23",
"output": "10"
},
{
"input": "11 1 1 1",
"output": "11"
},
{
"input": "6246 8489 1227 9",
"output": "4858"
},
{
"input": "9 20 5 7",
"output": "6"
}
] | 1,524,693,411
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 77
| 7,065,600
|
n,k=[int(x) for x in input().split()]
m=[]
for i in range(n):
m.append(list(input()))
for i in range(n):
for j in range(n):
if m[i][j]=='.':
m[i][j]=1
else:
m[i][j]=-1
for i in range(n):
for j in range(n):
if m[i][j]>=1:
#down
flag=0
if n-i>=k:
for w in range(i,i+k):
if m[w][j]==-1:
flag=1
break
if flag==0:
for w in range(i,i+k):
m[w][j]+=1
flag=0
#right
if n-j>=k:
for w in range(j,j+k):
if m[i][w]==-1:
flag=1
break
if flag==0:
for w in range(j,j+k):
m[i][w]+=1
ans=-1
for i in range(n):
for j in range(n):
if m[i][j]>ans:
ans=m[i][j]
r=i+1
c=j+1
if ans==-1:
print(1,1)
exit()
print(r,c)
|
Title: Paper Airplanes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes.
A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy?
Input Specification:
The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively.
Output Specification:
Print a single integer — the minimum number of packs they should buy.
Demo Input:
['5 3 2 3\n', '5 3 100 1\n']
Demo Output:
['4\n', '5\n']
Note:
In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs.
In the second sample they have to buy a pack for each person as they can't share sheets.
|
```python
n,k=[int(x) for x in input().split()]
m=[]
for i in range(n):
m.append(list(input()))
for i in range(n):
for j in range(n):
if m[i][j]=='.':
m[i][j]=1
else:
m[i][j]=-1
for i in range(n):
for j in range(n):
if m[i][j]>=1:
#down
flag=0
if n-i>=k:
for w in range(i,i+k):
if m[w][j]==-1:
flag=1
break
if flag==0:
for w in range(i,i+k):
m[w][j]+=1
flag=0
#right
if n-j>=k:
for w in range(j,j+k):
if m[i][w]==-1:
flag=1
break
if flag==0:
for w in range(j,j+k):
m[i][w]+=1
ans=-1
for i in range(n):
for j in range(n):
if m[i][j]>ans:
ans=m[i][j]
r=i+1
c=j+1
if ans==-1:
print(1,1)
exit()
print(r,c)
```
| -1
|
|
389
|
A
|
Fox and Number Game
|
PROGRAMMING
| 1,000
|
[
"greedy",
"math"
] | null | null |
Fox Ciel is playing a game with numbers now.
Ciel has *n* positive integers: *x*1, *x*2, ..., *x**n*. She can do the following operation as many times as needed: select two different indexes *i* and *j* such that *x**i* > *x**j* hold, and then apply assignment *x**i* = *x**i* - *x**j*. The goal is to make the sum of all numbers as small as possible.
Please help Ciel to find this minimal sum.
|
The first line contains an integer *n* (2<=≤<=*n*<=≤<=100). Then the second line contains *n* integers: *x*1, *x*2, ..., *x**n* (1<=≤<=*x**i*<=≤<=100).
|
Output a single integer — the required minimal sum.
|
[
"2\n1 2\n",
"3\n2 4 6\n",
"2\n12 18\n",
"5\n45 12 27 30 18\n"
] |
[
"2\n",
"6\n",
"12\n",
"15\n"
] |
In the first example the optimal way is to do the assignment: *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
In the second example the optimal sequence of operations is: *x*<sub class="lower-index">3</sub> = *x*<sub class="lower-index">3</sub> - *x*<sub class="lower-index">2</sub>, *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
| 500
|
[
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n2 4 6",
"output": "6"
},
{
"input": "2\n12 18",
"output": "12"
},
{
"input": "5\n45 12 27 30 18",
"output": "15"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "2\n100 100",
"output": "200"
},
{
"input": "2\n87 58",
"output": "58"
},
{
"input": "39\n52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52",
"output": "2028"
},
{
"input": "59\n96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96",
"output": "5664"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "10000"
},
{
"input": "100\n70 70 77 42 98 84 56 91 35 21 7 70 77 77 56 63 14 84 56 14 77 77 63 70 14 7 28 91 63 49 21 84 98 56 77 98 98 84 98 14 7 56 49 28 91 98 7 56 14 91 14 98 49 28 98 14 98 98 14 70 35 28 63 28 49 63 63 56 91 98 35 42 42 35 63 35 42 14 63 21 77 56 42 77 35 91 56 21 28 84 56 70 70 91 98 70 84 63 21 98",
"output": "700"
},
{
"input": "39\n63 21 21 42 21 63 21 84 42 21 84 63 42 63 84 84 84 42 42 84 21 63 42 63 42 42 63 42 42 63 84 42 21 84 21 63 42 21 42",
"output": "819"
},
{
"input": "59\n70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70",
"output": "4130"
},
{
"input": "87\n44 88 88 88 88 66 88 22 22 88 88 44 88 22 22 22 88 88 88 88 66 22 88 88 88 88 66 66 44 88 44 44 66 22 88 88 22 44 66 44 88 66 66 22 22 22 22 88 22 22 44 66 88 22 22 88 66 66 88 22 66 88 66 88 66 44 88 44 22 44 44 22 44 88 44 44 44 44 22 88 88 88 66 66 88 44 22",
"output": "1914"
},
{
"input": "15\n63 63 63 63 63 63 63 63 63 63 63 63 63 63 63",
"output": "945"
},
{
"input": "39\n63 77 21 14 14 35 21 21 70 42 21 70 28 77 28 77 7 42 63 7 98 49 98 84 35 70 70 91 14 42 98 7 42 7 98 42 56 35 91",
"output": "273"
},
{
"input": "18\n18 18 18 36 36 36 54 72 54 36 72 54 36 36 36 36 18 36",
"output": "324"
},
{
"input": "46\n71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71",
"output": "3266"
},
{
"input": "70\n66 11 66 11 44 11 44 99 55 22 88 11 11 22 55 44 22 77 44 77 77 22 44 55 88 11 99 99 88 22 77 77 66 11 11 66 99 55 55 44 66 44 77 44 44 55 33 55 44 88 77 77 22 66 33 44 11 22 55 44 22 66 77 33 33 44 44 44 22 33",
"output": "770"
},
{
"input": "10\n60 12 96 48 60 24 60 36 60 60",
"output": "120"
},
{
"input": "20\n51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51",
"output": "1020"
},
{
"input": "50\n58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58",
"output": "2900"
},
{
"input": "98\n70 60 100 30 70 20 30 50 50 30 90 40 30 40 60 80 60 60 80 50 10 80 20 10 20 10 50 70 30 80 30 50 60 90 90 100 60 30 90 20 30 60 90 80 60 60 10 90 10 50 40 40 80 90 100 40 70 40 30 50 60 50 60 30 40 20 90 60 20 20 20 70 60 70 50 100 90 50 20 40 80 60 10 60 50 40 40 10 50 10 40 10 80 100 100 90 10 90",
"output": "980"
},
{
"input": "100\n82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82",
"output": "8200"
},
{
"input": "100\n11 87 77 93 3 54 21 93 9 71 37 23 69 85 74 3 48 99 51 31 56 19 21 96 39 6 4 4 29 69 100 42 1 22 81 53 48 49 81 61 10 7 40 61 7 71 51 59 79 44 50 35 95 80 83 8 98 40 18 94 84 49 52 74 66 69 39 37 100 44 38 62 2 80 46 31 35 53 5 60 21 49 63 55 20 53 80 53 66 34 23 92 77 50 86 63 65 24 12 70",
"output": "100"
},
{
"input": "2\n100 1",
"output": "2"
},
{
"input": "2\n18 30",
"output": "12"
},
{
"input": "2\n3 5",
"output": "2"
},
{
"input": "2\n1 10",
"output": "2"
},
{
"input": "2\n8 5",
"output": "2"
},
{
"input": "5\n2 3 5 8 18",
"output": "5"
},
{
"input": "5\n2 4 1 6 8",
"output": "5"
},
{
"input": "3\n12 10 5",
"output": "3"
},
{
"input": "3\n6 10 15",
"output": "3"
}
] | 1,414,225,048
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 30
| 62
| 0
|
import sys
import math
n = int(sys.stdin.readline())
x = [int(x) for x in (sys.stdin.readline()).split()]
vmax = 0
vmin = 100
for k in x:
if(k > vmax):
vmax = k
if(k < vmin):
vmin = k
res = 0
while(vmin != 0):
res = vmin
t = vmax % vmin
vmax = vmin
vmin = t
print(res * n)
|
Title: Fox and Number Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fox Ciel is playing a game with numbers now.
Ciel has *n* positive integers: *x*1, *x*2, ..., *x**n*. She can do the following operation as many times as needed: select two different indexes *i* and *j* such that *x**i* > *x**j* hold, and then apply assignment *x**i* = *x**i* - *x**j*. The goal is to make the sum of all numbers as small as possible.
Please help Ciel to find this minimal sum.
Input Specification:
The first line contains an integer *n* (2<=≤<=*n*<=≤<=100). Then the second line contains *n* integers: *x*1, *x*2, ..., *x**n* (1<=≤<=*x**i*<=≤<=100).
Output Specification:
Output a single integer — the required minimal sum.
Demo Input:
['2\n1 2\n', '3\n2 4 6\n', '2\n12 18\n', '5\n45 12 27 30 18\n']
Demo Output:
['2\n', '6\n', '12\n', '15\n']
Note:
In the first example the optimal way is to do the assignment: *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
In the second example the optimal sequence of operations is: *x*<sub class="lower-index">3</sub> = *x*<sub class="lower-index">3</sub> - *x*<sub class="lower-index">2</sub>, *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
|
```python
import sys
import math
n = int(sys.stdin.readline())
x = [int(x) for x in (sys.stdin.readline()).split()]
vmax = 0
vmin = 100
for k in x:
if(k > vmax):
vmax = k
if(k < vmin):
vmin = k
res = 0
while(vmin != 0):
res = vmin
t = vmax % vmin
vmax = vmin
vmin = t
print(res * n)
```
| 0
|
|
527
|
A
|
Playing with Paper
|
PROGRAMMING
| 1,100
|
[
"implementation",
"math"
] | null | null |
One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=×<= *b* mm sheet of paper (*a*<=><=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part.
After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=×<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop.
Can you determine how many ships Vasya will make during the lesson?
|
The first line of the input contains two integers *a*, *b* (1<=≤<=*b*<=<<=*a*<=≤<=1012) — the sizes of the original sheet of paper.
|
Print a single integer — the number of ships that Vasya will make.
|
[
"2 1\n",
"10 7\n",
"1000000000000 1\n"
] |
[
"2\n",
"6\n",
"1000000000000\n"
] |
Pictures to the first and second sample test.
| 500
|
[
{
"input": "2 1",
"output": "2"
},
{
"input": "10 7",
"output": "6"
},
{
"input": "1000000000000 1",
"output": "1000000000000"
},
{
"input": "3 1",
"output": "3"
},
{
"input": "4 1",
"output": "4"
},
{
"input": "3 2",
"output": "3"
},
{
"input": "4 2",
"output": "2"
},
{
"input": "1000 700",
"output": "6"
},
{
"input": "959986566087 524054155168",
"output": "90"
},
{
"input": "4 3",
"output": "4"
},
{
"input": "7 6",
"output": "7"
},
{
"input": "1000 999",
"output": "1000"
},
{
"input": "1000 998",
"output": "500"
},
{
"input": "1000 997",
"output": "336"
},
{
"input": "42 1",
"output": "42"
},
{
"input": "1000 1",
"output": "1000"
},
{
"input": "8 5",
"output": "5"
},
{
"input": "13 8",
"output": "6"
},
{
"input": "987 610",
"output": "15"
},
{
"input": "442 42",
"output": "22"
},
{
"input": "754 466",
"output": "13"
},
{
"input": "1000000000000 999999999999",
"output": "1000000000000"
},
{
"input": "1000000000000 999999999998",
"output": "500000000000"
},
{
"input": "941 14",
"output": "74"
},
{
"input": "998 2",
"output": "499"
},
{
"input": "1000 42",
"output": "32"
},
{
"input": "1000 17",
"output": "66"
},
{
"input": "5 1",
"output": "5"
},
{
"input": "5 2",
"output": "4"
},
{
"input": "5 3",
"output": "4"
},
{
"input": "5 4",
"output": "5"
},
{
"input": "293 210",
"output": "17"
},
{
"input": "787878787878 424242424242",
"output": "8"
},
{
"input": "956722026041 591286729879",
"output": "58"
},
{
"input": "956722026041 365435296162",
"output": "58"
},
{
"input": "628625247282 464807889701",
"output": "102"
},
{
"input": "695928431619 424778620208",
"output": "167"
},
{
"input": "1000000000000 42",
"output": "23809523821"
},
{
"input": "987654345678 23",
"output": "42941493300"
},
{
"input": "10000000001 2",
"output": "5000000002"
},
{
"input": "1000000000000 2",
"output": "500000000000"
},
{
"input": "1000000000000 3",
"output": "333333333336"
},
{
"input": "100000000000 3",
"output": "33333333336"
},
{
"input": "100000000000 23",
"output": "4347826109"
},
{
"input": "999999999997 7",
"output": "142857142861"
},
{
"input": "8589934592 4294967296",
"output": "2"
}
] | 1,645,950,212
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 46
| 62
| 0
|
# m, n = map(lambda v: int(v), input().split())
# n = int(input())
# mem=dict()
# mem.setdefault(1, 1)
# mem.setdefault(2, 1)
# def fib(a):
# if not mem.get(a): mem.setdefault(a, fib(a-1) + fib(a-2))
# return mem[a]
a,b = map(lambda v: int(v), input().split())
i=1
while a!=b and a*b>0:
if a>b:
i += a // b
a-=a//b*b
else:
i += b // a
b-=b//a*a
print(i-1)
|
Title: Playing with Paper
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=×<= *b* mm sheet of paper (*a*<=><=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part.
After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=×<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop.
Can you determine how many ships Vasya will make during the lesson?
Input Specification:
The first line of the input contains two integers *a*, *b* (1<=≤<=*b*<=<<=*a*<=≤<=1012) — the sizes of the original sheet of paper.
Output Specification:
Print a single integer — the number of ships that Vasya will make.
Demo Input:
['2 1\n', '10 7\n', '1000000000000 1\n']
Demo Output:
['2\n', '6\n', '1000000000000\n']
Note:
Pictures to the first and second sample test.
|
```python
# m, n = map(lambda v: int(v), input().split())
# n = int(input())
# mem=dict()
# mem.setdefault(1, 1)
# mem.setdefault(2, 1)
# def fib(a):
# if not mem.get(a): mem.setdefault(a, fib(a-1) + fib(a-2))
# return mem[a]
a,b = map(lambda v: int(v), input().split())
i=1
while a!=b and a*b>0:
if a>b:
i += a // b
a-=a//b*b
else:
i += b // a
b-=b//a*a
print(i-1)
```
| 3
|
|
466
|
A
|
Cheap Travel
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
Ann has recently started commuting by subway. We know that a one ride subway ticket costs *a* rubles. Besides, Ann found out that she can buy a special ticket for *m* rides (she can buy it several times). It costs *b* rubles. Ann did the math; she will need to use subway *n* times. Help Ann, tell her what is the minimum sum of money she will have to spend to make *n* rides?
|
The single line contains four space-separated integers *n*, *m*, *a*, *b* (1<=≤<=*n*,<=*m*,<=*a*,<=*b*<=≤<=1000) — the number of rides Ann has planned, the number of rides covered by the *m* ride ticket, the price of a one ride ticket and the price of an *m* ride ticket.
|
Print a single integer — the minimum sum in rubles that Ann will need to spend.
|
[
"6 2 1 2\n",
"5 2 2 3\n"
] |
[
"6\n",
"8\n"
] |
In the first sample one of the optimal solutions is: each time buy a one ride ticket. There are other optimal solutions. For example, buy three *m* ride tickets.
| 500
|
[
{
"input": "6 2 1 2",
"output": "6"
},
{
"input": "5 2 2 3",
"output": "8"
},
{
"input": "10 3 5 1",
"output": "4"
},
{
"input": "1000 1 1000 1000",
"output": "1000000"
},
{
"input": "1000 3 1000 1000",
"output": "334000"
},
{
"input": "1 1 1 1",
"output": "1"
},
{
"input": "10 2 1 1",
"output": "5"
},
{
"input": "1 1000 1 2",
"output": "1"
},
{
"input": "1 1000 3 2",
"output": "2"
},
{
"input": "10 3 1 2",
"output": "7"
},
{
"input": "995 1 2 1",
"output": "995"
},
{
"input": "556 2 16 15",
"output": "4170"
},
{
"input": "477 2 16 14",
"output": "3346"
},
{
"input": "101 110 1 100",
"output": "100"
},
{
"input": "9 3 3 10",
"output": "27"
},
{
"input": "100 8 10 1",
"output": "13"
},
{
"input": "6 4 1 3",
"output": "5"
},
{
"input": "8 5 2 8",
"output": "14"
},
{
"input": "1000 2 1 1000",
"output": "1000"
}
] | 1,693,636,896
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 19
| 46
| 0
|
n,m,a,b = map(int,input().split())
if (m*a >b):
rem = n%m * a
if rem>b:
print(n // m * b + b)
else:
print(n // m * b + rem)
else:
print(n*a)
|
Title: Cheap Travel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ann has recently started commuting by subway. We know that a one ride subway ticket costs *a* rubles. Besides, Ann found out that she can buy a special ticket for *m* rides (she can buy it several times). It costs *b* rubles. Ann did the math; she will need to use subway *n* times. Help Ann, tell her what is the minimum sum of money she will have to spend to make *n* rides?
Input Specification:
The single line contains four space-separated integers *n*, *m*, *a*, *b* (1<=≤<=*n*,<=*m*,<=*a*,<=*b*<=≤<=1000) — the number of rides Ann has planned, the number of rides covered by the *m* ride ticket, the price of a one ride ticket and the price of an *m* ride ticket.
Output Specification:
Print a single integer — the minimum sum in rubles that Ann will need to spend.
Demo Input:
['6 2 1 2\n', '5 2 2 3\n']
Demo Output:
['6\n', '8\n']
Note:
In the first sample one of the optimal solutions is: each time buy a one ride ticket. There are other optimal solutions. For example, buy three *m* ride tickets.
|
```python
n,m,a,b = map(int,input().split())
if (m*a >b):
rem = n%m * a
if rem>b:
print(n // m * b + b)
else:
print(n // m * b + rem)
else:
print(n*a)
```
| 3
|
|
808
|
B
|
Average Sleep Time
|
PROGRAMMING
| 1,300
|
[
"data structures",
"implementation",
"math"
] | null | null |
It's been almost a week since Polycarp couldn't get rid of insomnia. And as you may already know, one week in Berland lasts *k* days!
When Polycarp went to a doctor with his problem, the doctor asked him about his sleeping schedule (more specifically, the average amount of hours of sleep per week). Luckily, Polycarp kept records of sleep times for the last *n* days. So now he has a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* is the sleep time on the *i*-th day.
The number of records is so large that Polycarp is unable to calculate the average value by himself. Thus he is asking you to help him with the calculations. To get the average Polycarp is going to consider *k* consecutive days as a week. So there will be *n*<=-<=*k*<=+<=1 weeks to take into consideration. For example, if *k*<==<=2, *n*<==<=3 and *a*<==<=[3,<=4,<=7], then the result is .
You should write a program which will calculate average sleep times of Polycarp over all weeks.
|
The first line contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=2·105).
The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105).
|
Output average sleeping time over all weeks.
The answer is considered to be correct if its absolute or relative error does not exceed 10<=-<=6. In particular, it is enough to output real number with at least 6 digits after the decimal point.
|
[
"3 2\n3 4 7\n",
"1 1\n10\n",
"8 2\n1 2 4 100000 123 456 789 1\n"
] |
[
"9.0000000000\n",
"10.0000000000\n",
"28964.2857142857\n"
] |
In the third example there are *n* - *k* + 1 = 7 weeks, so the answer is sums of all weeks divided by 7.
| 0
|
[
{
"input": "3 2\n3 4 7",
"output": "9.0000000000"
},
{
"input": "1 1\n10",
"output": "10.0000000000"
},
{
"input": "8 2\n1 2 4 100000 123 456 789 1",
"output": "28964.2857142857"
},
{
"input": "1 1\n1",
"output": "1.0000000000"
},
{
"input": "1 1\n100000",
"output": "100000.0000000000"
},
{
"input": "3 1\n1 2 3",
"output": "2.0000000000"
},
{
"input": "10 4\n11 3 5 20 12 7 9 2 2 20",
"output": "36.2857142857"
},
{
"input": "10 5\n15 9 3 2 17 10 9 18 4 19",
"output": "50.3333333333"
},
{
"input": "10 6\n19 3 20 16 14 10 1 13 7 3",
"output": "65.8000000000"
},
{
"input": "10 7\n8 16 2 13 15 9 5 13 9 2",
"output": "68.2500000000"
},
{
"input": "10 4\n127 1459 718 1183 880 1044 1857 1340 725 1496",
"output": "4574.4285714286"
},
{
"input": "10 5\n1384 1129 1780 1960 1567 1928 12 1523 1165 344",
"output": "6931.3333333333"
}
] | 1,517,220,467
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 14
| 62
| 5,632,000
|
n,k=(int(x) for x in input().split())
s=[int(x) for x in input().split()]
a=0
for i in range(k):
a+=s[i]
a/=k
x=a
if n==k:
print(a)
else:
for i in range(n-k):
x=(x*k+s[i+k]-s[i])/k
a+=x
a/=(n-k+1)
print(a*k)
|
Title: Average Sleep Time
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It's been almost a week since Polycarp couldn't get rid of insomnia. And as you may already know, one week in Berland lasts *k* days!
When Polycarp went to a doctor with his problem, the doctor asked him about his sleeping schedule (more specifically, the average amount of hours of sleep per week). Luckily, Polycarp kept records of sleep times for the last *n* days. So now he has a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* is the sleep time on the *i*-th day.
The number of records is so large that Polycarp is unable to calculate the average value by himself. Thus he is asking you to help him with the calculations. To get the average Polycarp is going to consider *k* consecutive days as a week. So there will be *n*<=-<=*k*<=+<=1 weeks to take into consideration. For example, if *k*<==<=2, *n*<==<=3 and *a*<==<=[3,<=4,<=7], then the result is .
You should write a program which will calculate average sleep times of Polycarp over all weeks.
Input Specification:
The first line contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=2·105).
The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105).
Output Specification:
Output average sleeping time over all weeks.
The answer is considered to be correct if its absolute or relative error does not exceed 10<=-<=6. In particular, it is enough to output real number with at least 6 digits after the decimal point.
Demo Input:
['3 2\n3 4 7\n', '1 1\n10\n', '8 2\n1 2 4 100000 123 456 789 1\n']
Demo Output:
['9.0000000000\n', '10.0000000000\n', '28964.2857142857\n']
Note:
In the third example there are *n* - *k* + 1 = 7 weeks, so the answer is sums of all weeks divided by 7.
|
```python
n,k=(int(x) for x in input().split())
s=[int(x) for x in input().split()]
a=0
for i in range(k):
a+=s[i]
a/=k
x=a
if n==k:
print(a)
else:
for i in range(n-k):
x=(x*k+s[i+k]-s[i])/k
a+=x
a/=(n-k+1)
print(a*k)
```
| 0
|
|
814
|
A
|
An abandoned sentiment from past
|
PROGRAMMING
| 900
|
[
"constructive algorithms",
"greedy",
"implementation",
"sortings"
] | null | null |
A few years ago, Hitagi encountered a giant crab, who stole the whole of her body weight. Ever since, she tried to avoid contact with others, for fear that this secret might be noticed.
To get rid of the oddity and recover her weight, a special integer sequence is needed. Hitagi's sequence has been broken for a long time, but now Kaiki provides an opportunity.
Hitagi's sequence *a* has a length of *n*. Lost elements in it are denoted by zeros. Kaiki provides another sequence *b*, whose length *k* equals the number of lost elements in *a* (i.e. the number of zeros). Hitagi is to replace each zero in *a* with an element from *b* so that each element in *b* should be used exactly once. Hitagi knows, however, that, apart from 0, no integer occurs in *a* and *b* more than once in total.
If the resulting sequence is not an increasing sequence, then it has the power to recover Hitagi from the oddity. You are to determine whether this is possible, or Kaiki's sequence is just another fake. In other words, you should detect whether it is possible to replace each zero in *a* with an integer from *b* so that each integer from *b* is used exactly once, and the resulting sequence is not increasing.
|
The first line of input contains two space-separated positive integers *n* (2<=≤<=*n*<=≤<=100) and *k* (1<=≤<=*k*<=≤<=*n*) — the lengths of sequence *a* and *b* respectively.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=200) — Hitagi's broken sequence with exactly *k* zero elements.
The third line contains *k* space-separated integers *b*1,<=*b*2,<=...,<=*b**k* (1<=≤<=*b**i*<=≤<=200) — the elements to fill into Hitagi's sequence.
Input guarantees that apart from 0, no integer occurs in *a* and *b* more than once in total.
|
Output "Yes" if it's possible to replace zeros in *a* with elements in *b* and make the resulting sequence not increasing, and "No" otherwise.
|
[
"4 2\n11 0 0 14\n5 4\n",
"6 1\n2 3 0 8 9 10\n5\n",
"4 1\n8 94 0 4\n89\n",
"7 7\n0 0 0 0 0 0 0\n1 2 3 4 5 6 7\n"
] |
[
"Yes\n",
"No\n",
"Yes\n",
"Yes\n"
] |
In the first sample:
- Sequence *a* is 11, 0, 0, 14. - Two of the elements are lost, and the candidates in *b* are 5 and 4. - There are two possible resulting sequences: 11, 5, 4, 14 and 11, 4, 5, 14, both of which fulfill the requirements. Thus the answer is "Yes".
In the second sample, the only possible resulting sequence is 2, 3, 5, 8, 9, 10, which is an increasing sequence and therefore invalid.
| 500
|
[
{
"input": "4 2\n11 0 0 14\n5 4",
"output": "Yes"
},
{
"input": "6 1\n2 3 0 8 9 10\n5",
"output": "No"
},
{
"input": "4 1\n8 94 0 4\n89",
"output": "Yes"
},
{
"input": "7 7\n0 0 0 0 0 0 0\n1 2 3 4 5 6 7",
"output": "Yes"
},
{
"input": "40 1\n23 26 27 28 31 35 38 40 43 50 52 53 56 57 59 61 65 73 75 76 79 0 82 84 85 86 88 93 99 101 103 104 105 106 110 111 112 117 119 120\n80",
"output": "No"
},
{
"input": "100 1\n99 95 22 110 47 20 37 34 23 0 16 69 64 49 111 42 112 96 13 40 18 77 44 46 74 55 15 54 56 75 78 100 82 101 31 83 53 80 52 63 30 57 104 36 67 65 103 51 48 26 68 59 35 92 85 38 107 98 73 90 62 43 32 89 19 106 17 88 41 72 113 86 66 102 81 27 29 50 71 79 109 91 70 39 61 76 93 84 108 97 24 25 45 105 94 60 33 87 14 21\n58",
"output": "Yes"
},
{
"input": "4 1\n2 1 0 4\n3",
"output": "Yes"
},
{
"input": "2 1\n199 0\n200",
"output": "No"
},
{
"input": "3 2\n115 0 0\n145 191",
"output": "Yes"
},
{
"input": "5 1\n196 197 198 0 200\n199",
"output": "No"
},
{
"input": "5 1\n92 0 97 99 100\n93",
"output": "No"
},
{
"input": "3 1\n3 87 0\n81",
"output": "Yes"
},
{
"input": "3 1\n0 92 192\n118",
"output": "Yes"
},
{
"input": "10 1\n1 3 0 7 35 46 66 72 83 90\n22",
"output": "Yes"
},
{
"input": "100 1\n14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 0 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113\n67",
"output": "No"
},
{
"input": "100 5\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 0 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 0 53 54 0 56 57 58 59 60 61 62 63 0 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 0 99 100\n98 64 55 52 29",
"output": "Yes"
},
{
"input": "100 5\n175 30 124 0 12 111 6 0 119 108 0 38 127 3 151 114 95 54 4 128 91 11 168 120 80 107 18 21 149 169 0 141 195 20 78 157 33 118 17 69 105 130 197 57 74 110 138 84 71 172 132 93 191 44 152 156 24 101 146 26 2 36 143 122 104 42 103 97 39 116 115 0 155 87 53 85 7 43 65 196 136 154 16 79 45 129 67 150 35 73 55 76 37 147 112 82 162 58 40 75\n121 199 62 193 27",
"output": "Yes"
},
{
"input": "100 1\n1 2 3 4 5 6 7 8 9 0 10 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n11",
"output": "Yes"
},
{
"input": "100 1\n0 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n1",
"output": "No"
},
{
"input": "100 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 0\n100",
"output": "No"
},
{
"input": "100 1\n9 79 7 98 10 50 28 99 43 74 89 20 32 66 23 45 87 78 81 41 86 71 75 85 5 39 14 53 42 48 40 52 3 51 11 34 35 76 77 61 47 19 55 91 62 56 8 72 88 4 33 0 97 92 31 83 18 49 54 21 17 16 63 44 84 22 2 96 70 36 68 60 80 82 13 73 26 94 27 58 1 30 100 38 12 15 93 90 57 59 67 6 64 46 25 29 37 95 69 24\n65",
"output": "Yes"
},
{
"input": "100 2\n0 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 0 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n48 1",
"output": "Yes"
},
{
"input": "100 1\n2 7 11 17 20 22 23 24 25 27 29 30 31 33 34 35 36 38 39 40 42 44 46 47 50 52 53 58 59 60 61 62 63 66 0 67 71 72 75 79 80 81 86 91 93 94 99 100 101 102 103 104 105 108 109 110 111 113 114 118 119 120 122 123 127 129 130 131 132 133 134 135 136 138 139 140 141 142 147 154 155 156 160 168 170 171 172 176 179 180 181 182 185 186 187 188 189 190 194 198\n69",
"output": "Yes"
},
{
"input": "100 1\n3 5 7 9 11 12 13 18 20 21 22 23 24 27 28 29 31 34 36 38 39 43 46 48 49 50 52 53 55 59 60 61 62 63 66 68 70 72 73 74 75 77 78 79 80 81 83 85 86 88 89 91 92 94 97 98 102 109 110 115 116 117 118 120 122 126 127 128 0 133 134 136 137 141 142 144 145 147 151 152 157 159 160 163 164 171 172 175 176 178 179 180 181 184 186 188 190 192 193 200\n129",
"output": "No"
},
{
"input": "5 2\n0 2 7 0 10\n1 8",
"output": "Yes"
},
{
"input": "3 1\n5 4 0\n1",
"output": "Yes"
},
{
"input": "3 1\n1 0 3\n4",
"output": "Yes"
},
{
"input": "2 1\n0 2\n1",
"output": "No"
},
{
"input": "2 1\n0 5\n7",
"output": "Yes"
},
{
"input": "5 1\n10 11 0 12 13\n1",
"output": "Yes"
},
{
"input": "5 1\n0 2 3 4 5\n6",
"output": "Yes"
},
{
"input": "6 2\n1 0 3 4 0 6\n2 5",
"output": "Yes"
},
{
"input": "7 2\n1 2 3 0 0 6 7\n4 5",
"output": "Yes"
},
{
"input": "4 1\n1 2 3 0\n4",
"output": "No"
},
{
"input": "2 2\n0 0\n1 2",
"output": "Yes"
},
{
"input": "3 2\n1 0 0\n2 3",
"output": "Yes"
},
{
"input": "4 2\n1 0 4 0\n5 2",
"output": "Yes"
},
{
"input": "2 1\n0 1\n2",
"output": "Yes"
},
{
"input": "5 2\n1 0 4 0 6\n2 5",
"output": "Yes"
},
{
"input": "5 1\n2 3 0 4 5\n1",
"output": "Yes"
},
{
"input": "3 1\n0 2 3\n5",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 4 5 0\n6",
"output": "No"
},
{
"input": "5 1\n1 2 0 4 5\n6",
"output": "Yes"
},
{
"input": "3 1\n5 0 2\n7",
"output": "Yes"
},
{
"input": "4 1\n4 5 0 8\n3",
"output": "Yes"
},
{
"input": "5 1\n10 11 12 0 14\n13",
"output": "No"
},
{
"input": "4 1\n1 2 0 4\n5",
"output": "Yes"
},
{
"input": "3 1\n0 11 14\n12",
"output": "Yes"
},
{
"input": "4 1\n1 3 0 4\n2",
"output": "Yes"
},
{
"input": "2 1\n0 5\n1",
"output": "No"
},
{
"input": "5 1\n1 2 0 4 7\n5",
"output": "Yes"
},
{
"input": "3 1\n2 3 0\n1",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 0 5 4\n6",
"output": "Yes"
},
{
"input": "4 2\n11 0 0 14\n13 12",
"output": "Yes"
},
{
"input": "2 1\n1 0\n2",
"output": "No"
},
{
"input": "3 1\n1 2 0\n3",
"output": "No"
},
{
"input": "4 1\n1 0 3 2\n4",
"output": "Yes"
},
{
"input": "3 1\n0 1 2\n5",
"output": "Yes"
},
{
"input": "3 1\n0 1 2\n3",
"output": "Yes"
},
{
"input": "4 1\n0 2 3 4\n5",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 0 4 5\n6",
"output": "Yes"
},
{
"input": "3 1\n1 2 0\n5",
"output": "No"
},
{
"input": "4 2\n1 0 0 4\n3 2",
"output": "Yes"
},
{
"input": "5 1\n2 3 0 5 7\n6",
"output": "Yes"
},
{
"input": "3 1\n2 3 0\n4",
"output": "No"
},
{
"input": "3 1\n1 0 11\n5",
"output": "No"
},
{
"input": "4 1\n7 9 5 0\n8",
"output": "Yes"
},
{
"input": "6 2\n1 2 3 0 5 0\n6 4",
"output": "Yes"
},
{
"input": "3 2\n0 1 0\n3 2",
"output": "Yes"
},
{
"input": "4 1\n6 9 5 0\n8",
"output": "Yes"
},
{
"input": "2 1\n0 3\n6",
"output": "Yes"
},
{
"input": "5 2\n1 2 0 0 5\n4 3",
"output": "Yes"
},
{
"input": "4 2\n2 0 0 8\n3 4",
"output": "Yes"
},
{
"input": "2 1\n0 2\n3",
"output": "Yes"
},
{
"input": "3 1\n0 4 5\n6",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 4 0 5\n6",
"output": "Yes"
},
{
"input": "2 1\n2 0\n3",
"output": "No"
},
{
"input": "4 2\n11 0 0 200\n100 199",
"output": "Yes"
},
{
"input": "2 1\n5 0\n4",
"output": "Yes"
},
{
"input": "3 1\n1 0 5\n10",
"output": "Yes"
},
{
"input": "6 2\n1 2 0 0 5 6\n3 4",
"output": "Yes"
},
{
"input": "5 2\n1 0 3 0 5\n2 4",
"output": "Yes"
},
{
"input": "4 1\n1 4 0 8\n3",
"output": "Yes"
},
{
"input": "4 1\n5 9 4 0\n8",
"output": "Yes"
},
{
"input": "4 2\n1 0 0 7\n3 2",
"output": "Yes"
},
{
"input": "3 3\n0 0 0\n1 4 3",
"output": "Yes"
},
{
"input": "5 5\n0 0 0 0 0\n5 4 3 2 1",
"output": "Yes"
},
{
"input": "4 1\n3 9 4 0\n8",
"output": "Yes"
},
{
"input": "4 2\n1 0 0 4\n2 3",
"output": "Yes"
},
{
"input": "6 1\n2 4 0 8 9 10\n3",
"output": "Yes"
},
{
"input": "4 1\n0 3 5 6\n9",
"output": "Yes"
},
{
"input": "4 2\n1 2 0 0\n3 4",
"output": "Yes"
},
{
"input": "5 1\n2 3 4 5 0\n1",
"output": "Yes"
},
{
"input": "3 1\n2 0 4\n5",
"output": "Yes"
}
] | 1,497,257,178
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 96
| 77
| 0
|
def solve(n,k,a,b):
if k==1:
for i in range(n):
if a[i]==0:
a[i] = b[0]
for i in range(n):
j = i+1
while(j<n):
if a[i]>a[j]:
return "Yes"
j = j+1
return "No"
else:
return "Yes"
n,k = (int(x) for x in input().strip().split(" "))
a = [int(x) for x in input().strip().split(" ")]
b = [int(x) for x in input().strip().split(" ")]
print(solve(n,k,a,b))
|
Title: An abandoned sentiment from past
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A few years ago, Hitagi encountered a giant crab, who stole the whole of her body weight. Ever since, she tried to avoid contact with others, for fear that this secret might be noticed.
To get rid of the oddity and recover her weight, a special integer sequence is needed. Hitagi's sequence has been broken for a long time, but now Kaiki provides an opportunity.
Hitagi's sequence *a* has a length of *n*. Lost elements in it are denoted by zeros. Kaiki provides another sequence *b*, whose length *k* equals the number of lost elements in *a* (i.e. the number of zeros). Hitagi is to replace each zero in *a* with an element from *b* so that each element in *b* should be used exactly once. Hitagi knows, however, that, apart from 0, no integer occurs in *a* and *b* more than once in total.
If the resulting sequence is not an increasing sequence, then it has the power to recover Hitagi from the oddity. You are to determine whether this is possible, or Kaiki's sequence is just another fake. In other words, you should detect whether it is possible to replace each zero in *a* with an integer from *b* so that each integer from *b* is used exactly once, and the resulting sequence is not increasing.
Input Specification:
The first line of input contains two space-separated positive integers *n* (2<=≤<=*n*<=≤<=100) and *k* (1<=≤<=*k*<=≤<=*n*) — the lengths of sequence *a* and *b* respectively.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=200) — Hitagi's broken sequence with exactly *k* zero elements.
The third line contains *k* space-separated integers *b*1,<=*b*2,<=...,<=*b**k* (1<=≤<=*b**i*<=≤<=200) — the elements to fill into Hitagi's sequence.
Input guarantees that apart from 0, no integer occurs in *a* and *b* more than once in total.
Output Specification:
Output "Yes" if it's possible to replace zeros in *a* with elements in *b* and make the resulting sequence not increasing, and "No" otherwise.
Demo Input:
['4 2\n11 0 0 14\n5 4\n', '6 1\n2 3 0 8 9 10\n5\n', '4 1\n8 94 0 4\n89\n', '7 7\n0 0 0 0 0 0 0\n1 2 3 4 5 6 7\n']
Demo Output:
['Yes\n', 'No\n', 'Yes\n', 'Yes\n']
Note:
In the first sample:
- Sequence *a* is 11, 0, 0, 14. - Two of the elements are lost, and the candidates in *b* are 5 and 4. - There are two possible resulting sequences: 11, 5, 4, 14 and 11, 4, 5, 14, both of which fulfill the requirements. Thus the answer is "Yes".
In the second sample, the only possible resulting sequence is 2, 3, 5, 8, 9, 10, which is an increasing sequence and therefore invalid.
|
```python
def solve(n,k,a,b):
if k==1:
for i in range(n):
if a[i]==0:
a[i] = b[0]
for i in range(n):
j = i+1
while(j<n):
if a[i]>a[j]:
return "Yes"
j = j+1
return "No"
else:
return "Yes"
n,k = (int(x) for x in input().strip().split(" "))
a = [int(x) for x in input().strip().split(" ")]
b = [int(x) for x in input().strip().split(" ")]
print(solve(n,k,a,b))
```
| 3
|
|
339
|
B
|
Xenia and Ringroad
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Xenia lives in a city that has *n* houses built along the main ringroad. The ringroad houses are numbered 1 through *n* in the clockwise order. The ringroad traffic is one way and also is clockwise.
Xenia has recently moved into the ringroad house number 1. As a result, she's got *m* things to do. In order to complete the *i*-th task, she needs to be in the house number *a**i* and complete all tasks with numbers less than *i*. Initially, Xenia is in the house number 1, find the minimum time she needs to complete all her tasks if moving from a house to a neighboring one along the ringroad takes one unit of time.
|
The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=1<=≤<=*m*<=≤<=105). The second line contains *m* integers *a*1,<=*a*2,<=...,<=*a**m* (1<=≤<=*a**i*<=≤<=*n*). Note that Xenia can have multiple consecutive tasks in one house.
|
Print a single integer — the time Xenia needs to complete all tasks.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
[
"4 3\n3 2 3\n",
"4 3\n2 3 3\n"
] |
[
"6\n",
"2\n"
] |
In the first test example the sequence of Xenia's moves along the ringroad looks as follows: 1 → 2 → 3 → 4 → 1 → 2 → 3. This is optimal sequence. So, she needs 6 time units.
| 1,000
|
[
{
"input": "4 3\n3 2 3",
"output": "6"
},
{
"input": "4 3\n2 3 3",
"output": "2"
},
{
"input": "2 2\n1 1",
"output": "0"
},
{
"input": "2 2\n1 2",
"output": "1"
},
{
"input": "2 2\n1 2",
"output": "1"
},
{
"input": "100 100\n56 46 1 47 5 86 45 35 81 1 31 70 67 70 62 99 100 47 44 33 78 35 32 37 92 12 95 18 3 22 54 24 22 90 25 22 78 88 51 92 46 84 15 29 28 40 8 5 93 68 77 47 45 76 85 39 84 94 52 69 93 64 31 60 99 17 51 59 62 37 46 47 86 60 88 14 68 22 47 93 50 10 55 87 46 50 43 63 44 43 61 65 91 43 33 97 67 57 66 70",
"output": "4869"
},
{
"input": "78 58\n23 14 73 45 47 14 27 59 65 39 15 23 5 1 50 37 3 51 46 69 75 65 45 68 48 59 77 39 53 21 72 33 46 32 34 5 69 55 56 53 47 31 32 5 42 23 76 15 2 77 65 24 16 68 61 28 55 10",
"output": "2505"
},
{
"input": "14 54\n9 13 14 9 5 12 4 7 3 14 5 12 13 1 1 11 10 2 7 9 5 2 2 8 10 7 3 9 5 11 2 2 6 12 11 5 4 11 11 6 2 11 14 13 8 7 13 9 4 9 11 3 7 13",
"output": "362"
},
{
"input": "100 100\n48 73 63 16 49 88 36 17 66 6 87 13 94 52 58 70 71 52 7 70 25 42 24 36 57 9 79 26 75 39 13 14 38 26 33 66 88 28 75 98 53 48 67 54 63 25 69 87 88 32 72 17 36 35 29 67 74 89 70 47 20 90 78 13 94 57 32 73 29 74 45 78 85 64 81 56 12 65 19 67 34 86 55 71 41 33 76 13 100 47 44 76 86 78 37 15 26 98 83 98",
"output": "4997"
},
{
"input": "99 100\n88 65 10 91 18 35 58 49 42 2 22 57 74 31 53 24 27 93 45 4 71 2 69 39 21 90 97 89 45 73 20 45 82 98 35 90 37 76 68 26 21 65 95 63 24 74 50 59 3 93 65 6 30 37 62 71 18 88 40 12 56 40 89 56 38 71 90 41 97 43 44 23 19 22 10 80 3 24 32 85 26 65 70 60 76 85 66 68 74 11 64 88 12 63 16 15 79 57 93 58",
"output": "4809"
},
{
"input": "65 100\n53 14 5 10 32 60 31 52 52 56 38 6 8 17 52 23 59 3 18 28 15 2 46 26 8 2 40 6 58 30 28 46 49 23 47 24 9 53 3 47 55 12 36 49 12 24 54 55 58 7 50 42 15 4 58 49 34 40 19 4 59 19 31 17 35 65 36 50 45 5 33 11 29 52 55 40 48 11 32 41 31 7 46 55 32 41 56 51 39 13 5 59 58 34 38 50 55 10 43 30",
"output": "3149"
},
{
"input": "10 100\n7 6 2 10 7 2 3 8 10 4 6 1 4 5 7 10 1 2 3 5 4 10 8 2 3 3 6 8 3 9 4 1 9 10 1 2 5 1 8 8 5 9 2 8 1 2 3 2 1 10 10 7 1 3 2 2 7 1 6 6 6 9 2 3 1 7 2 2 9 7 3 3 2 10 7 4 7 3 3 3 2 4 4 2 2 8 4 1 10 10 5 10 6 10 6 10 3 10 8 9",
"output": "428"
},
{
"input": "2 100\n1 1 2 2 2 2 1 2 1 2 2 2 1 1 2 2 2 2 1 1 2 1 2 2 1 1 2 2 2 1 2 1 1 1 2 1 2 2 2 1 2 2 2 2 1 2 1 1 1 2 1 1 2 1 1 2 2 1 2 1 2 2 2 1 1 1 1 1 2 2 2 1 1 2 2 1 1 2 2 1 1 2 1 1 1 1 2 2 1 1 1 2 1 1 1 1 1 1 1 2",
"output": "47"
},
{
"input": "67 100\n49 5 25 48 37 55 5 33 14 30 59 28 57 46 45 32 47 22 40 28 58 34 27 29 4 52 63 44 31 65 42 61 11 17 32 17 18 1 12 33 38 11 59 46 43 55 23 30 23 2 42 21 45 51 30 19 35 15 10 30 13 21 32 34 33 3 5 59 23 63 6 9 20 43 64 3 42 41 40 4 14 20 40 33 25 44 1 2 50 46 13 10 3 20 22 64 28 42 58 30",
"output": "3245"
},
{
"input": "100 100\n81 62 26 90 7 87 60 35 75 81 54 94 53 71 64 80 58 83 53 70 40 96 87 50 37 63 5 77 83 75 53 28 22 98 52 45 72 70 62 21 1 99 37 93 16 98 68 27 96 37 21 83 92 23 62 96 85 31 85 66 38 77 45 16 90 86 6 21 75 42 18 60 2 17 51 61 94 68 97 79 17 59 66 14 87 78 70 40 63 78 58 22 87 7 90 17 20 97 9 31",
"output": "5530"
},
{
"input": "2 1\n1",
"output": "0"
},
{
"input": "2 10\n1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "2 10\n1 1 1 2 2 2 1 1 1 2",
"output": "3"
},
{
"input": "3 6\n1 2 3 3 2 1",
"output": "6"
}
] | 1,694,861,860
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 156
| 13,824,000
|
n, m = map(int, input().split())
tasks = list(map(int, input().split()))
current_house = 1
total_time = 0
for task in tasks:
if task >= current_house:
time_to_task = task - current_house
else:
time_to_task = n - current_house + task
total_time += time_to_task
current_house = task
print(total_time)
|
Title: Xenia and Ringroad
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia lives in a city that has *n* houses built along the main ringroad. The ringroad houses are numbered 1 through *n* in the clockwise order. The ringroad traffic is one way and also is clockwise.
Xenia has recently moved into the ringroad house number 1. As a result, she's got *m* things to do. In order to complete the *i*-th task, she needs to be in the house number *a**i* and complete all tasks with numbers less than *i*. Initially, Xenia is in the house number 1, find the minimum time she needs to complete all her tasks if moving from a house to a neighboring one along the ringroad takes one unit of time.
Input Specification:
The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=1<=≤<=*m*<=≤<=105). The second line contains *m* integers *a*1,<=*a*2,<=...,<=*a**m* (1<=≤<=*a**i*<=≤<=*n*). Note that Xenia can have multiple consecutive tasks in one house.
Output Specification:
Print a single integer — the time Xenia needs to complete all tasks.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['4 3\n3 2 3\n', '4 3\n2 3 3\n']
Demo Output:
['6\n', '2\n']
Note:
In the first test example the sequence of Xenia's moves along the ringroad looks as follows: 1 → 2 → 3 → 4 → 1 → 2 → 3. This is optimal sequence. So, she needs 6 time units.
|
```python
n, m = map(int, input().split())
tasks = list(map(int, input().split()))
current_house = 1
total_time = 0
for task in tasks:
if task >= current_house:
time_to_task = task - current_house
else:
time_to_task = n - current_house + task
total_time += time_to_task
current_house = task
print(total_time)
```
| 3
|
|
810
|
A
|
Straight <<A>>
|
PROGRAMMING
| 900
|
[
"implementation",
"math"
] | null | null |
Noora is a student of one famous high school. It's her final year in school — she is going to study in university next year. However, she has to get an «A» graduation certificate in order to apply to a prestigious one.
In school, where Noora is studying, teachers are putting down marks to the online class register, which are integers from 1 to *k*. The worst mark is 1, the best is *k*. Mark that is going to the certificate, is calculated as an average of all the marks, rounded to the closest integer. If several answers are possible, rounding up is produced. For example, 7.3 is rounded to 7, but 7.5 and 7.8784 — to 8.
For instance, if Noora has marks [8,<=9], then the mark to the certificate is 9, because the average is equal to 8.5 and rounded to 9, but if the marks are [8,<=8,<=9], Noora will have graduation certificate with 8.
To graduate with «A» certificate, Noora has to have mark *k*.
Noora got *n* marks in register this year. However, she is afraid that her marks are not enough to get final mark *k*. Noora decided to ask for help in the internet, where hacker Leha immediately responded to her request. He is ready to hack class register for Noora and to add Noora any number of additional marks from 1 to *k*. At the same time, Leha want his hack be unseen to everyone, so he decided to add as less as possible additional marks. Please help Leha to calculate the minimal number of marks he has to add, so that final Noora's mark will become equal to *k*.
|
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*k*<=≤<=100) denoting the number of marks, received by Noora and the value of highest possible mark.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*k*) denoting marks received by Noora before Leha's hack.
|
Print a single integer — minimal number of additional marks, that Leha has to add in order to change Noora's final mark to *k*.
|
[
"2 10\n8 9\n",
"3 5\n4 4 4\n"
] |
[
"4",
"3"
] |
Consider the first example testcase.
Maximal mark is 10, Noora received two marks — 8 and 9, so current final mark is 9. To fix it, Leha can add marks [10, 10, 10, 10] (4 marks in total) to the registry, achieving Noora having average mark equal to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1b961585522f76271546da990a6228e7c666277f.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Consequently, new final mark is 10. Less number of marks won't fix the situation.
In the second example Leha can add [5, 5, 5] to the registry, so that making average mark equal to 4.5, which is enough to have 5 in the certificate.
| 500
|
[
{
"input": "2 10\n8 9",
"output": "4"
},
{
"input": "3 5\n4 4 4",
"output": "3"
},
{
"input": "3 10\n10 8 9",
"output": "3"
},
{
"input": "2 23\n21 23",
"output": "2"
},
{
"input": "5 10\n5 10 10 9 10",
"output": "7"
},
{
"input": "12 50\n18 10 26 22 22 23 14 21 27 18 25 12",
"output": "712"
},
{
"input": "38 12\n2 7 10 8 5 3 5 6 3 6 5 1 9 7 7 8 3 4 4 4 5 2 3 6 6 1 6 7 4 4 8 7 4 5 3 6 6 6",
"output": "482"
},
{
"input": "63 86\n32 31 36 29 36 26 28 38 39 32 29 26 33 38 36 38 36 28 43 48 28 33 25 39 39 27 34 25 37 28 40 26 30 31 42 32 36 44 29 36 30 35 48 40 26 34 30 33 33 46 42 24 36 38 33 51 33 41 38 29 29 32 28",
"output": "6469"
},
{
"input": "100 38\n30 24 38 31 31 33 32 32 29 34 29 22 27 23 34 25 32 30 30 26 16 27 38 33 38 38 37 34 32 27 33 23 33 32 24 24 30 36 29 30 33 30 29 30 36 33 33 35 28 24 30 32 38 29 30 36 31 30 27 38 31 36 15 37 32 27 29 24 38 33 28 29 34 21 37 35 32 31 27 25 27 28 31 31 36 38 35 35 36 29 35 22 38 31 38 28 31 27 34 31",
"output": "1340"
},
{
"input": "33 69\n60 69 68 69 69 60 64 60 62 59 54 47 60 62 69 69 69 58 67 69 62 69 68 53 69 69 66 66 57 58 65 69 61",
"output": "329"
},
{
"input": "39 92\n19 17 16 19 15 30 21 25 14 17 19 19 23 16 14 15 17 19 29 15 11 25 19 14 18 20 10 16 11 15 18 20 20 17 18 16 12 17 16",
"output": "5753"
},
{
"input": "68 29\n29 29 29 29 29 28 29 29 29 27 29 29 29 29 29 29 29 23 29 29 26 29 29 29 29 29 29 29 29 29 29 29 29 29 29 29 26 29 29 29 29 29 29 29 29 29 29 29 29 22 29 29 29 29 29 29 29 29 29 29 29 29 29 28 29 29 29 29",
"output": "0"
},
{
"input": "75 30\n22 18 21 26 23 18 28 30 24 24 19 25 28 30 23 29 18 23 23 30 26 30 17 30 18 19 25 26 26 15 27 23 30 21 19 26 25 30 25 28 20 22 22 21 26 17 23 23 24 15 25 19 18 22 30 30 29 21 30 28 28 30 27 25 24 15 22 19 30 21 20 30 18 20 25",
"output": "851"
},
{
"input": "78 43\n2 7 6 5 5 6 4 5 3 4 6 8 4 5 5 4 3 1 2 4 4 6 5 6 4 4 6 4 8 4 6 5 6 1 4 5 6 3 2 5 2 5 3 4 8 8 3 3 4 4 6 6 5 4 5 5 7 9 3 9 6 4 7 3 6 9 6 5 1 7 2 5 6 3 6 2 5 4",
"output": "5884"
},
{
"input": "82 88\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1",
"output": "14170"
},
{
"input": "84 77\n28 26 36 38 37 44 48 34 40 22 42 35 40 37 30 31 33 35 36 55 47 36 33 47 40 38 27 38 36 33 35 31 47 33 30 38 38 47 49 24 38 37 28 43 39 36 34 33 29 38 36 43 48 38 36 34 33 34 35 31 26 33 39 37 37 37 35 52 47 30 24 46 38 26 43 46 41 50 33 40 36 41 37 30",
"output": "6650"
},
{
"input": "94 80\n21 19 15 16 27 16 20 18 19 19 15 15 20 19 19 21 20 19 13 17 15 9 17 15 23 15 12 18 12 13 15 12 14 13 14 17 20 20 14 21 15 6 10 23 24 8 18 18 13 23 17 22 17 19 19 18 17 24 8 16 18 20 24 19 10 19 15 10 13 14 19 15 16 19 20 15 14 21 16 16 14 14 22 19 12 11 14 13 19 32 16 16 13 20",
"output": "11786"
},
{
"input": "96 41\n13 32 27 34 28 34 30 26 21 24 29 20 25 34 25 16 27 15 22 22 34 22 25 19 23 17 17 22 26 24 23 20 21 27 19 33 13 24 22 18 30 30 27 14 26 24 20 20 22 11 19 31 19 29 18 28 30 22 17 15 28 32 17 24 17 24 24 19 26 23 22 29 18 22 23 29 19 32 26 23 22 22 24 23 27 30 24 25 21 21 33 19 35 27 34 28",
"output": "3182"
},
{
"input": "1 26\n26",
"output": "0"
},
{
"input": "99 39\n25 28 30 28 32 34 31 28 29 28 29 30 33 19 33 31 27 33 29 24 27 30 25 38 28 34 35 31 34 37 30 22 21 24 34 27 34 33 34 33 26 26 36 19 30 22 35 30 21 28 23 35 33 29 21 22 36 31 34 32 34 32 30 32 27 33 38 25 35 26 39 27 29 29 19 33 28 29 34 38 26 30 36 26 29 30 26 34 22 32 29 38 25 27 24 17 25 28 26",
"output": "1807"
},
{
"input": "100 12\n7 6 6 3 5 5 9 8 7 7 4 7 12 6 9 5 6 3 4 7 9 10 7 7 5 3 9 6 9 9 6 7 4 10 4 8 8 6 9 8 6 5 7 4 10 7 5 6 8 9 3 4 8 5 4 8 6 10 5 8 7 5 9 8 5 8 5 6 9 11 4 9 5 5 11 4 6 6 7 3 8 9 6 7 10 4 7 6 9 4 8 11 5 4 10 8 5 10 11 4",
"output": "946"
},
{
"input": "100 18\n1 2 2 2 2 2 1 1 1 2 3 1 3 1 1 4 2 4 1 2 1 2 1 3 2 1 2 1 1 1 2 1 2 2 1 1 4 3 1 1 2 1 3 3 2 1 2 2 1 1 1 1 3 1 1 2 2 1 1 1 5 1 2 1 3 2 2 1 4 2 2 1 1 1 1 1 1 1 1 2 2 1 2 1 1 1 2 1 2 2 2 1 1 3 1 1 2 1 1 2",
"output": "3164"
},
{
"input": "100 27\n16 20 21 10 16 17 18 25 19 18 20 12 11 21 21 23 20 26 20 21 27 16 25 18 25 21 27 12 20 27 18 17 27 13 21 26 12 22 15 21 25 21 18 27 24 15 16 18 23 21 24 27 19 17 24 14 21 16 24 26 13 14 25 18 27 26 22 16 27 27 17 25 17 12 22 10 19 27 19 20 23 22 25 23 17 25 14 20 22 10 22 27 21 20 15 26 24 27 12 16",
"output": "1262"
},
{
"input": "100 29\n20 18 23 24 14 14 16 23 22 17 18 22 21 21 19 19 14 11 18 19 16 22 25 20 14 13 21 24 18 16 18 29 17 25 12 10 18 28 11 16 17 14 15 20 17 20 18 22 10 16 16 20 18 19 29 18 25 27 17 19 24 15 24 25 16 23 19 16 16 20 19 15 12 21 20 13 21 15 15 23 16 23 17 13 17 21 13 18 17 18 18 20 16 12 19 15 27 14 11 18",
"output": "2024"
},
{
"input": "100 30\n16 10 20 11 14 27 15 17 22 26 24 17 15 18 19 22 22 15 21 22 14 21 22 22 21 22 15 17 17 22 18 19 26 18 22 20 22 25 18 18 17 23 18 18 20 13 19 30 17 24 22 19 29 20 20 21 17 18 26 25 22 19 15 18 18 20 19 19 18 18 24 16 19 17 12 21 20 16 23 21 16 17 26 23 25 28 22 20 9 21 17 24 15 19 17 21 29 13 18 15",
"output": "1984"
},
{
"input": "100 59\n56 58 53 59 59 48 59 54 46 59 59 58 48 59 55 59 59 50 59 56 59 59 59 59 59 59 59 57 59 53 45 53 50 59 50 55 58 54 59 56 54 59 59 59 59 48 56 59 59 57 59 59 48 43 55 57 39 59 46 55 55 52 58 57 51 59 59 59 59 53 59 43 51 54 46 59 57 43 50 59 47 58 59 59 59 55 46 56 55 59 56 47 56 56 46 51 47 48 59 55",
"output": "740"
},
{
"input": "100 81\n6 7 6 6 7 6 6 6 3 9 4 5 4 3 4 6 6 6 1 3 9 5 2 3 8 5 6 9 6 6 6 5 4 4 7 7 3 6 11 7 6 4 8 7 12 6 4 10 2 4 9 11 7 4 7 7 8 8 6 7 9 8 4 5 8 13 6 6 6 8 6 2 5 6 7 5 4 4 4 4 2 6 4 8 3 4 7 7 6 7 7 10 5 10 6 7 4 11 8 4",
"output": "14888"
},
{
"input": "100 100\n30 35 23 43 28 49 31 32 30 44 32 37 33 34 38 28 43 32 33 32 50 32 41 38 33 20 40 36 29 21 42 25 23 34 43 32 37 31 30 27 36 32 45 37 33 29 38 34 35 33 28 19 37 33 28 41 31 29 41 27 32 39 30 34 37 40 33 38 35 32 32 34 35 34 28 39 28 34 40 45 31 25 42 28 29 31 33 21 36 33 34 37 40 42 39 30 36 34 34 40",
"output": "13118"
},
{
"input": "100 100\n71 87 100 85 89 98 90 90 71 65 76 75 85 100 81 100 91 80 73 89 86 78 82 89 77 92 78 90 100 81 85 89 73 100 66 60 72 88 91 73 93 76 88 81 86 78 83 77 74 93 97 94 85 78 82 78 91 91 100 78 89 76 78 82 81 78 83 88 87 83 78 98 85 97 98 89 88 75 76 86 74 81 70 76 86 84 99 100 89 94 72 84 82 88 83 89 78 99 87 76",
"output": "3030"
},
{
"input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "19700"
},
{
"input": "100 100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "0"
},
{
"input": "100 100\n1 1 2 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "19696"
},
{
"input": "100 100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99",
"output": "0"
},
{
"input": "100 100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 98 100 100 100 100 98 100 100 100 100 100 100 99 98 100 100 93 100 100 98 100 100 100 100 93 100 96 100 100 100 94 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 95 88 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "0"
},
{
"input": "100 100\n95 100 100 100 100 100 100 100 100 100 100 100 100 100 87 100 100 100 94 100 100 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 100 100 100 100 100 90 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 97 100 100 100 96 100 98 100 100 100 100 100 96 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 97 100 100 100 100",
"output": "2"
},
{
"input": "100 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "100 2\n2 1 1 2 1 1 1 1 2 2 2 2 1 1 1 2 1 1 1 2 2 2 2 1 1 1 1 2 2 2 1 2 2 2 2 1 2 2 1 1 1 1 1 1 2 2 1 2 1 1 1 2 1 2 2 2 2 1 1 1 2 2 1 2 1 1 1 2 1 2 2 1 1 1 2 2 1 1 2 1 1 2 1 1 1 2 1 1 1 1 2 1 1 1 1 2 1 2 1 1",
"output": "16"
},
{
"input": "3 5\n5 5 5",
"output": "0"
},
{
"input": "7 7\n1 1 1 1 1 1 1",
"output": "77"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "19700"
},
{
"input": "4 10\n10 10 10 10",
"output": "0"
},
{
"input": "1 10\n10",
"output": "0"
},
{
"input": "10 1\n1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "3 10\n10 10 10",
"output": "0"
},
{
"input": "2 4\n3 4",
"output": "0"
},
{
"input": "1 2\n2",
"output": "0"
},
{
"input": "3 4\n4 4 4",
"output": "0"
},
{
"input": "3 2\n2 2 1",
"output": "0"
},
{
"input": "5 5\n5 5 5 5 5",
"output": "0"
},
{
"input": "3 3\n3 3 3",
"output": "0"
},
{
"input": "2 9\n8 9",
"output": "0"
},
{
"input": "3 10\n9 10 10",
"output": "0"
},
{
"input": "1 3\n3",
"output": "0"
},
{
"input": "2 2\n1 2",
"output": "0"
},
{
"input": "2 10\n10 10",
"output": "0"
},
{
"input": "23 14\n7 11 13 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14",
"output": "0"
},
{
"input": "2 10\n9 10",
"output": "0"
},
{
"input": "2 2\n2 2",
"output": "0"
},
{
"input": "10 5\n5 5 5 5 5 5 5 5 5 4",
"output": "0"
},
{
"input": "3 5\n4 5 5",
"output": "0"
},
{
"input": "5 4\n4 4 4 4 4",
"output": "0"
},
{
"input": "2 10\n10 9",
"output": "0"
},
{
"input": "4 5\n3 5 5 5",
"output": "0"
},
{
"input": "10 5\n5 5 5 5 5 5 5 5 5 5",
"output": "0"
},
{
"input": "3 10\n10 10 9",
"output": "0"
},
{
"input": "5 1\n1 1 1 1 1",
"output": "0"
},
{
"input": "2 1\n1 1",
"output": "0"
},
{
"input": "4 10\n9 10 10 10",
"output": "0"
},
{
"input": "5 2\n2 2 2 2 2",
"output": "0"
},
{
"input": "2 5\n4 5",
"output": "0"
},
{
"input": "5 10\n10 10 10 10 10",
"output": "0"
},
{
"input": "2 6\n6 6",
"output": "0"
},
{
"input": "2 9\n9 9",
"output": "0"
},
{
"input": "3 10\n10 9 10",
"output": "0"
},
{
"input": "4 40\n39 40 40 40",
"output": "0"
},
{
"input": "3 4\n3 4 4",
"output": "0"
},
{
"input": "9 9\n9 9 9 9 9 9 9 9 9",
"output": "0"
},
{
"input": "1 4\n4",
"output": "0"
},
{
"input": "4 7\n1 1 1 1",
"output": "44"
},
{
"input": "1 5\n5",
"output": "0"
},
{
"input": "3 1\n1 1 1",
"output": "0"
},
{
"input": "1 100\n100",
"output": "0"
},
{
"input": "2 7\n3 5",
"output": "10"
},
{
"input": "3 6\n6 6 6",
"output": "0"
},
{
"input": "4 2\n1 2 2 2",
"output": "0"
},
{
"input": "4 5\n4 5 5 5",
"output": "0"
},
{
"input": "5 5\n1 1 1 1 1",
"output": "35"
},
{
"input": "66 2\n1 2 2 2 2 1 1 2 1 2 2 2 2 2 2 1 2 1 2 1 2 1 2 1 2 1 1 1 1 2 2 1 2 2 1 1 2 1 2 2 1 1 1 2 1 2 1 2 1 2 1 2 2 2 2 1 2 2 1 2 1 1 1 2 2 1",
"output": "0"
},
{
"input": "2 2\n2 1",
"output": "0"
},
{
"input": "5 5\n5 5 5 4 5",
"output": "0"
},
{
"input": "3 7\n1 1 1",
"output": "33"
},
{
"input": "2 5\n5 5",
"output": "0"
},
{
"input": "1 7\n1",
"output": "11"
},
{
"input": "6 7\n1 1 1 1 1 1",
"output": "66"
},
{
"input": "99 97\n15 80 78 69 12 84 36 51 89 77 88 10 1 19 67 85 6 36 8 70 14 45 88 97 22 13 75 57 83 27 13 97 9 90 68 51 76 37 5 2 16 92 11 48 13 77 35 19 15 74 22 29 21 12 28 42 56 5 32 41 62 75 71 71 68 72 24 77 11 28 78 27 53 88 74 66 1 42 18 16 18 39 75 38 81 5 13 39 40 75 13 36 53 83 9 54 57 63 64",
"output": "10077"
},
{
"input": "8 7\n1 1 1 1 1 1 1 1",
"output": "88"
},
{
"input": "3 2\n2 2 2",
"output": "0"
},
{
"input": "6 5\n5 5 5 5 5 5",
"output": "0"
},
{
"input": "10 5\n5 5 5 5 5 5 5 4 1 1",
"output": "8"
},
{
"input": "1 5\n1",
"output": "7"
},
{
"input": "10 10\n10 10 10 10 10 10 10 10 10 10",
"output": "0"
},
{
"input": "2 3\n2 3",
"output": "0"
},
{
"input": "1 9\n9",
"output": "0"
},
{
"input": "74 2\n2 2 2 2 1 2 2 1 1 1 2 2 1 2 2 2 2 1 2 1 1 1 2 1 1 2 2 1 2 1 1 2 1 1 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 1 1 2 1 1 1 1 1 1 2 2 2 1 1 1 1 1 2 2 2 2 2 2 1 2",
"output": "0"
},
{
"input": "5 5\n5 5 5 5 4",
"output": "0"
}
] | 1,637,415,281
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 106
| 62
| 0
|
def round(n):
if n-int(n)>=0.5:
return n+1
else:
return n
n,k=[int(x) for x in input().split()]
a=[int(x) for x in input().split()]
if round(sum(a)/n)>=k:
print(0)
else:
print(2*k*n-2*sum(a)-n)
|
Title: Straight <<A>>
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Noora is a student of one famous high school. It's her final year in school — she is going to study in university next year. However, she has to get an «A» graduation certificate in order to apply to a prestigious one.
In school, where Noora is studying, teachers are putting down marks to the online class register, which are integers from 1 to *k*. The worst mark is 1, the best is *k*. Mark that is going to the certificate, is calculated as an average of all the marks, rounded to the closest integer. If several answers are possible, rounding up is produced. For example, 7.3 is rounded to 7, but 7.5 and 7.8784 — to 8.
For instance, if Noora has marks [8,<=9], then the mark to the certificate is 9, because the average is equal to 8.5 and rounded to 9, but if the marks are [8,<=8,<=9], Noora will have graduation certificate with 8.
To graduate with «A» certificate, Noora has to have mark *k*.
Noora got *n* marks in register this year. However, she is afraid that her marks are not enough to get final mark *k*. Noora decided to ask for help in the internet, where hacker Leha immediately responded to her request. He is ready to hack class register for Noora and to add Noora any number of additional marks from 1 to *k*. At the same time, Leha want his hack be unseen to everyone, so he decided to add as less as possible additional marks. Please help Leha to calculate the minimal number of marks he has to add, so that final Noora's mark will become equal to *k*.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*k*<=≤<=100) denoting the number of marks, received by Noora and the value of highest possible mark.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*k*) denoting marks received by Noora before Leha's hack.
Output Specification:
Print a single integer — minimal number of additional marks, that Leha has to add in order to change Noora's final mark to *k*.
Demo Input:
['2 10\n8 9\n', '3 5\n4 4 4\n']
Demo Output:
['4', '3']
Note:
Consider the first example testcase.
Maximal mark is 10, Noora received two marks — 8 and 9, so current final mark is 9. To fix it, Leha can add marks [10, 10, 10, 10] (4 marks in total) to the registry, achieving Noora having average mark equal to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1b961585522f76271546da990a6228e7c666277f.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Consequently, new final mark is 10. Less number of marks won't fix the situation.
In the second example Leha can add [5, 5, 5] to the registry, so that making average mark equal to 4.5, which is enough to have 5 in the certificate.
|
```python
def round(n):
if n-int(n)>=0.5:
return n+1
else:
return n
n,k=[int(x) for x in input().split()]
a=[int(x) for x in input().split()]
if round(sum(a)/n)>=k:
print(0)
else:
print(2*k*n-2*sum(a)-n)
```
| 3
|
|
306
|
A
|
Candies
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Polycarpus has got *n* candies and *m* friends (*n*<=≥<=*m*). He wants to make a New Year present with candies to each friend. Polycarpus is planning to present all candies and he wants to do this in the fairest (that is, most equal) manner. He wants to choose such *a**i*, where *a**i* is the number of candies in the *i*-th friend's present, that the maximum *a**i* differs from the least *a**i* as little as possible.
For example, if *n* is divisible by *m*, then he is going to present the same number of candies to all his friends, that is, the maximum *a**i* won't differ from the minimum one.
|
The single line of the input contains a pair of space-separated positive integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100;*n*<=≥<=*m*) — the number of candies and the number of Polycarpus's friends.
|
Print the required sequence *a*1,<=*a*2,<=...,<=*a**m*, where *a**i* is the number of candies in the *i*-th friend's present. All numbers *a**i* must be positive integers, total up to *n*, the maximum one should differ from the minimum one by the smallest possible value.
|
[
"12 3\n",
"15 4\n",
"18 7\n"
] |
[
"4 4 4 ",
"3 4 4 4 ",
"2 2 2 3 3 3 3 "
] |
Print *a*<sub class="lower-index">*i*</sub> in any order, separate the numbers by spaces.
| 500
|
[
{
"input": "12 4",
"output": "3 3 3 3 "
},
{
"input": "15 6",
"output": "2 2 2 3 3 3 "
},
{
"input": "18 8",
"output": "2 2 2 2 2 2 3 3 "
},
{
"input": "1 1",
"output": "1 "
},
{
"input": "2 1",
"output": "2 "
},
{
"input": "100 1",
"output": "100 "
},
{
"input": "100 100",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "100 10",
"output": "10 10 10 10 10 10 10 10 10 10 "
},
{
"input": "64 8",
"output": "8 8 8 8 8 8 8 8 "
},
{
"input": "81 27",
"output": "3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 "
},
{
"input": "100 99",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 "
},
{
"input": "100 51",
"output": "1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "100 49",
"output": "2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 "
},
{
"input": "100 13",
"output": "7 7 7 7 8 8 8 8 8 8 8 8 8 "
},
{
"input": "97 11",
"output": "8 8 9 9 9 9 9 9 9 9 9 "
},
{
"input": "19 3",
"output": "6 6 7 "
},
{
"input": "99 10",
"output": "9 10 10 10 10 10 10 10 10 10 "
},
{
"input": "88 5",
"output": "17 17 18 18 18 "
},
{
"input": "87 34",
"output": "2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 "
},
{
"input": "97 55",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
}
] | 1,625,580,004
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 154
| 0
|
a,b=input().split()
a,b=int(a),int(b)
c=a//b
rem=a%b
d=[c]*(b-rem)
d=d+[c+1]*rem
for i in d:
print(i,end=" ")
|
Title: Candies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus has got *n* candies and *m* friends (*n*<=≥<=*m*). He wants to make a New Year present with candies to each friend. Polycarpus is planning to present all candies and he wants to do this in the fairest (that is, most equal) manner. He wants to choose such *a**i*, where *a**i* is the number of candies in the *i*-th friend's present, that the maximum *a**i* differs from the least *a**i* as little as possible.
For example, if *n* is divisible by *m*, then he is going to present the same number of candies to all his friends, that is, the maximum *a**i* won't differ from the minimum one.
Input Specification:
The single line of the input contains a pair of space-separated positive integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100;*n*<=≥<=*m*) — the number of candies and the number of Polycarpus's friends.
Output Specification:
Print the required sequence *a*1,<=*a*2,<=...,<=*a**m*, where *a**i* is the number of candies in the *i*-th friend's present. All numbers *a**i* must be positive integers, total up to *n*, the maximum one should differ from the minimum one by the smallest possible value.
Demo Input:
['12 3\n', '15 4\n', '18 7\n']
Demo Output:
['4 4 4 ', '3 4 4 4 ', '2 2 2 3 3 3 3 ']
Note:
Print *a*<sub class="lower-index">*i*</sub> in any order, separate the numbers by spaces.
|
```python
a,b=input().split()
a,b=int(a),int(b)
c=a//b
rem=a%b
d=[c]*(b-rem)
d=d+[c+1]*rem
for i in d:
print(i,end=" ")
```
| 3
|
|
514
|
A
|
Chewbaсca and Number
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation"
] | null | null |
Luke Skywalker gave Chewbacca an integer number *x*. Chewbacca isn't good at numbers but he loves inverting digits in them. Inverting digit *t* means replacing it with digit 9<=-<=*t*.
Help Chewbacca to transform the initial number *x* to the minimum possible positive number by inverting some (possibly, zero) digits. The decimal representation of the final number shouldn't start with a zero.
|
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=1018) — the number that Luke Skywalker gave to Chewbacca.
|
Print the minimum possible positive number that Chewbacca can obtain after inverting some digits. The number shouldn't contain leading zeroes.
|
[
"27\n",
"4545\n"
] |
[
"22\n",
"4444\n"
] |
none
| 500
|
[
{
"input": "27",
"output": "22"
},
{
"input": "4545",
"output": "4444"
},
{
"input": "1",
"output": "1"
},
{
"input": "9",
"output": "9"
},
{
"input": "8772",
"output": "1222"
},
{
"input": "81",
"output": "11"
},
{
"input": "71723447",
"output": "21223442"
},
{
"input": "91730629",
"output": "91230320"
},
{
"input": "420062703497",
"output": "420032203402"
},
{
"input": "332711047202",
"output": "332211042202"
},
{
"input": "3395184971407775",
"output": "3304114021402224"
},
{
"input": "8464062628894325",
"output": "1434032321104324"
},
{
"input": "164324828731963982",
"output": "134324121231033012"
},
{
"input": "384979173822804784",
"output": "314020123122104214"
},
{
"input": "41312150450968417",
"output": "41312140440031412"
},
{
"input": "2156",
"output": "2143"
},
{
"input": "1932",
"output": "1032"
},
{
"input": "5902",
"output": "4002"
},
{
"input": "5728",
"output": "4221"
},
{
"input": "8537",
"output": "1432"
},
{
"input": "55403857",
"output": "44403142"
},
{
"input": "270739",
"output": "220230"
},
{
"input": "28746918",
"output": "21243011"
},
{
"input": "10279211",
"output": "10220211"
},
{
"input": "40289679",
"output": "40210320"
},
{
"input": "545203238506",
"output": "444203231403"
},
{
"input": "461117063340",
"output": "431112033340"
},
{
"input": "658492686568",
"output": "341402313431"
},
{
"input": "857373361868",
"output": "142323331131"
},
{
"input": "429325660016",
"output": "420324330013"
},
{
"input": "9894448650287940",
"output": "9104441340212040"
},
{
"input": "6354510839296263",
"output": "3344410130203233"
},
{
"input": "6873575462224593",
"output": "3123424432224403"
},
{
"input": "4237951492601449",
"output": "4232041402301440"
},
{
"input": "2680352384836991",
"output": "2310342314133001"
},
{
"input": "606187734191890310",
"output": "303112234101100310"
},
{
"input": "351499943576823355",
"output": "341400043423123344"
},
{
"input": "180593481782177068",
"output": "110403411212122031"
},
{
"input": "999999999999999999",
"output": "900000000000000000"
},
{
"input": "1000000000000000000",
"output": "1000000000000000000"
},
{
"input": "9999",
"output": "9000"
},
{
"input": "99",
"output": "90"
},
{
"input": "9991",
"output": "9001"
}
] | 1,683,179,496
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 46
| 0
|
x = list(input())
y = []
for i in range(len(x)):
if (int(x[i]) >= 5):
y.append(9-int(x[i]))
else:
y.append(int(x[i]))
stri = ""
for i in y:
stri = stri + str(i)
print(stri)
|
Title: Chewbaсca and Number
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Luke Skywalker gave Chewbacca an integer number *x*. Chewbacca isn't good at numbers but he loves inverting digits in them. Inverting digit *t* means replacing it with digit 9<=-<=*t*.
Help Chewbacca to transform the initial number *x* to the minimum possible positive number by inverting some (possibly, zero) digits. The decimal representation of the final number shouldn't start with a zero.
Input Specification:
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=1018) — the number that Luke Skywalker gave to Chewbacca.
Output Specification:
Print the minimum possible positive number that Chewbacca can obtain after inverting some digits. The number shouldn't contain leading zeroes.
Demo Input:
['27\n', '4545\n']
Demo Output:
['22\n', '4444\n']
Note:
none
|
```python
x = list(input())
y = []
for i in range(len(x)):
if (int(x[i]) >= 5):
y.append(9-int(x[i]))
else:
y.append(int(x[i]))
stri = ""
for i in y:
stri = stri + str(i)
print(stri)
```
| 0
|
|
6
|
A
|
Triangle
|
PROGRAMMING
| 900
|
[
"brute force",
"geometry"
] |
A. Triangle
|
2
|
64
|
Johnny has a younger sister Anne, who is very clever and smart. As she came home from the kindergarten, she told his brother about the task that her kindergartener asked her to solve. The task was just to construct a triangle out of four sticks of different colours. Naturally, one of the sticks is extra. It is not allowed to break the sticks or use their partial length. Anne has perfectly solved this task, now she is asking Johnny to do the same.
The boy answered that he would cope with it without any difficulty. However, after a while he found out that different tricky things can occur. It can happen that it is impossible to construct a triangle of a positive area, but it is possible to construct a degenerate triangle. It can be so, that it is impossible to construct a degenerate triangle even. As Johnny is very lazy, he does not want to consider such a big amount of cases, he asks you to help him.
|
The first line of the input contains four space-separated positive integer numbers not exceeding 100 — lengthes of the sticks.
|
Output TRIANGLE if it is possible to construct a non-degenerate triangle. Output SEGMENT if the first case cannot take place and it is possible to construct a degenerate triangle. Output IMPOSSIBLE if it is impossible to construct any triangle. Remember that you are to use three sticks. It is not allowed to break the sticks or use their partial length.
|
[
"4 2 1 3\n",
"7 2 2 4\n",
"3 5 9 1\n"
] |
[
"TRIANGLE\n",
"SEGMENT\n",
"IMPOSSIBLE\n"
] |
none
| 0
|
[
{
"input": "4 2 1 3",
"output": "TRIANGLE"
},
{
"input": "7 2 2 4",
"output": "SEGMENT"
},
{
"input": "3 5 9 1",
"output": "IMPOSSIBLE"
},
{
"input": "3 1 5 1",
"output": "IMPOSSIBLE"
},
{
"input": "10 10 10 10",
"output": "TRIANGLE"
},
{
"input": "11 5 6 11",
"output": "TRIANGLE"
},
{
"input": "1 1 1 1",
"output": "TRIANGLE"
},
{
"input": "10 20 30 40",
"output": "TRIANGLE"
},
{
"input": "45 25 5 15",
"output": "IMPOSSIBLE"
},
{
"input": "20 5 8 13",
"output": "TRIANGLE"
},
{
"input": "10 30 7 20",
"output": "SEGMENT"
},
{
"input": "3 2 3 2",
"output": "TRIANGLE"
},
{
"input": "70 10 100 30",
"output": "SEGMENT"
},
{
"input": "4 8 16 2",
"output": "IMPOSSIBLE"
},
{
"input": "3 3 3 10",
"output": "TRIANGLE"
},
{
"input": "1 5 5 5",
"output": "TRIANGLE"
},
{
"input": "13 25 12 1",
"output": "SEGMENT"
},
{
"input": "10 100 7 3",
"output": "SEGMENT"
},
{
"input": "50 1 50 100",
"output": "TRIANGLE"
},
{
"input": "50 1 100 49",
"output": "SEGMENT"
},
{
"input": "49 51 100 1",
"output": "SEGMENT"
},
{
"input": "5 11 2 25",
"output": "IMPOSSIBLE"
},
{
"input": "91 50 9 40",
"output": "IMPOSSIBLE"
},
{
"input": "27 53 7 97",
"output": "IMPOSSIBLE"
},
{
"input": "51 90 24 8",
"output": "IMPOSSIBLE"
},
{
"input": "3 5 1 1",
"output": "IMPOSSIBLE"
},
{
"input": "13 49 69 15",
"output": "IMPOSSIBLE"
},
{
"input": "16 99 9 35",
"output": "IMPOSSIBLE"
},
{
"input": "27 6 18 53",
"output": "IMPOSSIBLE"
},
{
"input": "57 88 17 8",
"output": "IMPOSSIBLE"
},
{
"input": "95 20 21 43",
"output": "IMPOSSIBLE"
},
{
"input": "6 19 32 61",
"output": "IMPOSSIBLE"
},
{
"input": "100 21 30 65",
"output": "IMPOSSIBLE"
},
{
"input": "85 16 61 9",
"output": "IMPOSSIBLE"
},
{
"input": "5 6 19 82",
"output": "IMPOSSIBLE"
},
{
"input": "1 5 1 3",
"output": "IMPOSSIBLE"
},
{
"input": "65 10 36 17",
"output": "IMPOSSIBLE"
},
{
"input": "81 64 9 7",
"output": "IMPOSSIBLE"
},
{
"input": "11 30 79 43",
"output": "IMPOSSIBLE"
},
{
"input": "1 1 5 3",
"output": "IMPOSSIBLE"
},
{
"input": "21 94 61 31",
"output": "IMPOSSIBLE"
},
{
"input": "49 24 9 74",
"output": "IMPOSSIBLE"
},
{
"input": "11 19 5 77",
"output": "IMPOSSIBLE"
},
{
"input": "52 10 19 71",
"output": "SEGMENT"
},
{
"input": "2 3 7 10",
"output": "SEGMENT"
},
{
"input": "1 2 6 3",
"output": "SEGMENT"
},
{
"input": "2 6 1 8",
"output": "SEGMENT"
},
{
"input": "1 2 4 1",
"output": "SEGMENT"
},
{
"input": "4 10 6 2",
"output": "SEGMENT"
},
{
"input": "2 10 7 3",
"output": "SEGMENT"
},
{
"input": "5 2 3 9",
"output": "SEGMENT"
},
{
"input": "6 1 4 10",
"output": "SEGMENT"
},
{
"input": "10 6 4 1",
"output": "SEGMENT"
},
{
"input": "3 2 9 1",
"output": "SEGMENT"
},
{
"input": "22 80 29 7",
"output": "SEGMENT"
},
{
"input": "2 6 3 9",
"output": "SEGMENT"
},
{
"input": "3 1 2 1",
"output": "SEGMENT"
},
{
"input": "3 4 7 1",
"output": "SEGMENT"
},
{
"input": "8 4 3 1",
"output": "SEGMENT"
},
{
"input": "2 8 3 5",
"output": "SEGMENT"
},
{
"input": "4 1 2 1",
"output": "SEGMENT"
},
{
"input": "8 1 3 2",
"output": "SEGMENT"
},
{
"input": "6 2 1 8",
"output": "SEGMENT"
},
{
"input": "3 3 3 6",
"output": "TRIANGLE"
},
{
"input": "3 6 3 3",
"output": "TRIANGLE"
},
{
"input": "4 10 4 4",
"output": "TRIANGLE"
},
{
"input": "1 1 2 1",
"output": "TRIANGLE"
},
{
"input": "3 3 3 6",
"output": "TRIANGLE"
},
{
"input": "5 4 5 5",
"output": "TRIANGLE"
},
{
"input": "8 7 8 8",
"output": "TRIANGLE"
},
{
"input": "3 3 3 1",
"output": "TRIANGLE"
},
{
"input": "1 1 6 6",
"output": "TRIANGLE"
},
{
"input": "1 9 1 9",
"output": "TRIANGLE"
},
{
"input": "7 2 2 7",
"output": "TRIANGLE"
},
{
"input": "7 2 3 2",
"output": "TRIANGLE"
},
{
"input": "4 4 10 10",
"output": "TRIANGLE"
},
{
"input": "7 7 10 7",
"output": "TRIANGLE"
},
{
"input": "4 4 4 5",
"output": "TRIANGLE"
},
{
"input": "1 10 9 2",
"output": "TRIANGLE"
},
{
"input": "1 8 2 7",
"output": "TRIANGLE"
},
{
"input": "4 3 2 8",
"output": "TRIANGLE"
},
{
"input": "5 9 5 3",
"output": "TRIANGLE"
},
{
"input": "4 10 3 5",
"output": "TRIANGLE"
}
] | 1,601,514,354
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 83
| 218
| 307,200
|
def determine(l,a,b):
if l < a+b:
return 'TRIANGLE'
elif l == a+b:
return 'SEGMENT'
else:
return 'IMPOSSIBLE'
if __name__ == '__main__':
lines = list(map(int, input().split()))
lines.sort(reverse=True)
result = set([determine(*lines[:-1]), determine(*lines[1:])])
if 'TRIANGLE' in result:
print('TRIANGLE')
elif 'SEGMENT' in result:
print('SEGMENT')
else:
print('IMPOSSIBLE')
|
Title: Triangle
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Johnny has a younger sister Anne, who is very clever and smart. As she came home from the kindergarten, she told his brother about the task that her kindergartener asked her to solve. The task was just to construct a triangle out of four sticks of different colours. Naturally, one of the sticks is extra. It is not allowed to break the sticks or use their partial length. Anne has perfectly solved this task, now she is asking Johnny to do the same.
The boy answered that he would cope with it without any difficulty. However, after a while he found out that different tricky things can occur. It can happen that it is impossible to construct a triangle of a positive area, but it is possible to construct a degenerate triangle. It can be so, that it is impossible to construct a degenerate triangle even. As Johnny is very lazy, he does not want to consider such a big amount of cases, he asks you to help him.
Input Specification:
The first line of the input contains four space-separated positive integer numbers not exceeding 100 — lengthes of the sticks.
Output Specification:
Output TRIANGLE if it is possible to construct a non-degenerate triangle. Output SEGMENT if the first case cannot take place and it is possible to construct a degenerate triangle. Output IMPOSSIBLE if it is impossible to construct any triangle. Remember that you are to use three sticks. It is not allowed to break the sticks or use their partial length.
Demo Input:
['4 2 1 3\n', '7 2 2 4\n', '3 5 9 1\n']
Demo Output:
['TRIANGLE\n', 'SEGMENT\n', 'IMPOSSIBLE\n']
Note:
none
|
```python
def determine(l,a,b):
if l < a+b:
return 'TRIANGLE'
elif l == a+b:
return 'SEGMENT'
else:
return 'IMPOSSIBLE'
if __name__ == '__main__':
lines = list(map(int, input().split()))
lines.sort(reverse=True)
result = set([determine(*lines[:-1]), determine(*lines[1:])])
if 'TRIANGLE' in result:
print('TRIANGLE')
elif 'SEGMENT' in result:
print('SEGMENT')
else:
print('IMPOSSIBLE')
```
| 3.943211
|
266
|
B
|
Queue at the School
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"graph matchings",
"implementation",
"shortest paths"
] | null | null |
During the break the schoolchildren, boys and girls, formed a queue of *n* people in the canteen. Initially the children stood in the order they entered the canteen. However, after a while the boys started feeling awkward for standing in front of the girls in the queue and they started letting the girls move forward each second.
Let's describe the process more precisely. Let's say that the positions in the queue are sequentially numbered by integers from 1 to *n*, at that the person in the position number 1 is served first. Then, if at time *x* a boy stands on the *i*-th position and a girl stands on the (*i*<=+<=1)-th position, then at time *x*<=+<=1 the *i*-th position will have a girl and the (*i*<=+<=1)-th position will have a boy. The time is given in seconds.
You've got the initial position of the children, at the initial moment of time. Determine the way the queue is going to look after *t* seconds.
|
The first line contains two integers *n* and *t* (1<=≤<=*n*,<=*t*<=≤<=50), which represent the number of children in the queue and the time after which the queue will transform into the arrangement you need to find.
The next line contains string *s*, which represents the schoolchildren's initial arrangement. If the *i*-th position in the queue contains a boy, then the *i*-th character of string *s* equals "B", otherwise the *i*-th character equals "G".
|
Print string *a*, which describes the arrangement after *t* seconds. If the *i*-th position has a boy after the needed time, then the *i*-th character *a* must equal "B", otherwise it must equal "G".
|
[
"5 1\nBGGBG\n",
"5 2\nBGGBG\n",
"4 1\nGGGB\n"
] |
[
"GBGGB\n",
"GGBGB\n",
"GGGB\n"
] |
none
| 500
|
[
{
"input": "5 1\nBGGBG",
"output": "GBGGB"
},
{
"input": "5 2\nBGGBG",
"output": "GGBGB"
},
{
"input": "4 1\nGGGB",
"output": "GGGB"
},
{
"input": "2 1\nBB",
"output": "BB"
},
{
"input": "2 1\nBG",
"output": "GB"
},
{
"input": "6 2\nBBGBBG",
"output": "GBBGBB"
},
{
"input": "8 3\nBBGBGBGB",
"output": "GGBGBBBB"
},
{
"input": "10 3\nBBGBBBBBBG",
"output": "GBBBBBGBBB"
},
{
"input": "22 7\nGBGGBGGGGGBBBGGBGBGBBB",
"output": "GGGGGGGGBGGBGGBBBBBBBB"
},
{
"input": "50 4\nGBBGBBBGGGGGBBGGBBBBGGGBBBGBBBGGBGGBGBBBGGBGGBGGBG",
"output": "GGBGBGBGBGBGGGBBGBGBGBGBBBGBGBGBGBGBGBGBGBGBGGBGBB"
},
{
"input": "50 8\nGGGGBGGBGGGBGBBBGGGGGGGGBBGBGBGBBGGBGGBGGGGGGGGBBG",
"output": "GGGGGGGGGGGGBGGBGBGBGBGBGGGGGGBGBGBGBGBGBGGBGGBGBB"
},
{
"input": "50 30\nBGGGGGGBGGBGBGGGGBGBBGBBBGGBBBGBGBGGGGGBGBBGBGBGGG",
"output": "GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGBBBBBBBBBBBBBBBBBBBB"
},
{
"input": "20 20\nBBGGBGGGGBBBGBBGGGBB",
"output": "GGGGGGGGGGBBBBBBBBBB"
},
{
"input": "27 6\nGBGBGBGGGGGGBGGBGGBBGBBBGBB",
"output": "GGGGGGGBGBGBGGGGGBGBBBBBBBB"
},
{
"input": "46 11\nBGGGGGBGBGGBGGGBBGBBGBBGGBBGBBGBGGGGGGGBGBGBGB",
"output": "GGGGGGGGGGGBGGGGGBBGBGBGBGBGBGBGBGBGBGBGBBBBBB"
},
{
"input": "50 6\nBGGBBBBGGBBBBBBGGBGBGBBBBGBBBBBBGBBBBBBBBBBBBBBBBB",
"output": "GGGGBBBBBGBGBGBGBBBGBBBBBBGBBBBBBBBBBBBBBBBBBBBBBB"
},
{
"input": "50 10\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB"
},
{
"input": "50 8\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG"
},
{
"input": "50 10\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBGB",
"output": "BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBGBBBBBBBBBBB"
},
{
"input": "50 13\nGGGBGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "GGGGGGGGGGGGGGGGBGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG"
},
{
"input": "1 1\nB",
"output": "B"
},
{
"input": "1 1\nG",
"output": "G"
},
{
"input": "1 50\nB",
"output": "B"
},
{
"input": "1 50\nG",
"output": "G"
},
{
"input": "50 50\nBBBBBBBBGGBBBBBBGBBBBBBBBBBBGBBBBBBBBBBBBBBGBBBBBB",
"output": "GGGGGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB"
},
{
"input": "50 50\nGGBBGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGBBGGGGGGBG",
"output": "GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGBBBBB"
},
{
"input": "6 3\nGGBBBG",
"output": "GGGBBB"
},
{
"input": "26 3\nGBBGBBBBBGGGBGBGGGBGBGGBBG",
"output": "GGBBBBGBGBGBGGGBGBGGGBGBBB"
},
{
"input": "46 3\nGGBBGGGGBBGBGBBBBBGGGBGGGBBGGGBBBGGBGGBBBGBGBB",
"output": "GGGGBGBGGGBBBBBGBGBGBGGGBGGBGBGBGBGBGBGBGBBBBB"
},
{
"input": "44 8\nBGBBBBBBBBBGGBBGBGBGGBBBBBGBBGBBBBBBBBBGBBGB",
"output": "GBBGBGBGBGBGBGBBBBGBBGBBBBBBBBBGBBGBBBBBBBBB"
},
{
"input": "20 20\nBBGGBGGGGBBBGBBGGGBB",
"output": "GGGGGGGGGGBBBBBBBBBB"
},
{
"input": "30 25\nBGGBBGBGGBGBGBBGBGGGGBGBGGBBBB",
"output": "GGGGGGGGGGGGGGGBBBBBBBBBBBBBBB"
},
{
"input": "17 42\nBBGBGBGGGGGGBBGGG",
"output": "GGGGGGGGGGGBBBBBB"
},
{
"input": "30 50\nBGGBBGGGGGGGGBBGGGBBGGBBBGBBGG",
"output": "GGGGGGGGGGGGGGGGGGBBBBBBBBBBBB"
},
{
"input": "31 33\nBBGGBBGGBGBBBBGGBGBBBGBGGBBGBBB",
"output": "GGGGGGGGGGGGBBBBBBBBBBBBBBBBBBB"
},
{
"input": "2 2\nBG",
"output": "GB"
},
{
"input": "8 8\nGGGBGGBB",
"output": "GGGGGBBB"
},
{
"input": "34 34\nBGGBBBBGGBBGBGGGGGGBBGGGGGBGGBGGGB",
"output": "GGGGGGGGGGGGGGGGGGGGGBBBBBBBBBBBBB"
},
{
"input": "34 20\nBBBBGBGGGBGGGBGBGGBBBBGGBBGGGBGBBG",
"output": "GGGGGGGGGGGGGGGGGBBBBBBBBBBBBBBBBB"
},
{
"input": "50 50\nBBGBBBBBBBBBBBBGBBBGBBBBBBBGBBBBBBGBBBGBBGBBGBBBGG",
"output": "GGGGGGGGGGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB"
},
{
"input": "10 10\nGGGGGGGGGG",
"output": "GGGGGGGGGG"
},
{
"input": "10 10\nBBBBBBBBBB",
"output": "BBBBBBBBBB"
},
{
"input": "10 10\nBGBGBGBGBG",
"output": "GGGGGBBBBB"
},
{
"input": "1 1\nB",
"output": "B"
}
] | 1,698,779,074
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 44
| 92
| 0
|
n, t = map(int, input().split())
s = input()
while t:
s = s.replace("BG", "GB")
t -= 1
print(s)
|
Title: Queue at the School
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
During the break the schoolchildren, boys and girls, formed a queue of *n* people in the canteen. Initially the children stood in the order they entered the canteen. However, after a while the boys started feeling awkward for standing in front of the girls in the queue and they started letting the girls move forward each second.
Let's describe the process more precisely. Let's say that the positions in the queue are sequentially numbered by integers from 1 to *n*, at that the person in the position number 1 is served first. Then, if at time *x* a boy stands on the *i*-th position and a girl stands on the (*i*<=+<=1)-th position, then at time *x*<=+<=1 the *i*-th position will have a girl and the (*i*<=+<=1)-th position will have a boy. The time is given in seconds.
You've got the initial position of the children, at the initial moment of time. Determine the way the queue is going to look after *t* seconds.
Input Specification:
The first line contains two integers *n* and *t* (1<=≤<=*n*,<=*t*<=≤<=50), which represent the number of children in the queue and the time after which the queue will transform into the arrangement you need to find.
The next line contains string *s*, which represents the schoolchildren's initial arrangement. If the *i*-th position in the queue contains a boy, then the *i*-th character of string *s* equals "B", otherwise the *i*-th character equals "G".
Output Specification:
Print string *a*, which describes the arrangement after *t* seconds. If the *i*-th position has a boy after the needed time, then the *i*-th character *a* must equal "B", otherwise it must equal "G".
Demo Input:
['5 1\nBGGBG\n', '5 2\nBGGBG\n', '4 1\nGGGB\n']
Demo Output:
['GBGGB\n', 'GGBGB\n', 'GGGB\n']
Note:
none
|
```python
n, t = map(int, input().split())
s = input()
while t:
s = s.replace("BG", "GB")
t -= 1
print(s)
```
| 3
|
|
61
|
A
|
Ultra-Fast Mathematician
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Ultra-Fast Mathematician
|
2
|
256
|
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
|
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
|
Write one line — the corresponding answer. Do not omit the leading 0s.
|
[
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] |
[
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] |
none
| 500
|
[
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,635,723,252
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 102
| 61
| 4,300,800
|
s = input()
l= input()
d=[]
b=int(len(s))
for i in range(0,b):
if s[i]==l[i]:
d.append("0")
else:
d.append("1")
print(''.join(d))
|
Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none
|
```python
s = input()
l= input()
d=[]
b=int(len(s))
for i in range(0,b):
if s[i]==l[i]:
d.append("0")
else:
d.append("1")
print(''.join(d))
```
| 3.976739
|
660
|
B
|
Seating On Bus
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Consider 2*n* rows of the seats in a bus. *n* rows of the seats on the left and *n* rows of the seats on the right. Each row can be filled by two people. So the total capacity of the bus is 4*n*.
Consider that *m* (*m*<=≤<=4*n*) people occupy the seats in the bus. The passengers entering the bus are numbered from 1 to *m* (in the order of their entering the bus). The pattern of the seat occupation is as below:
1-st row left window seat, 1-st row right window seat, 2-nd row left window seat, 2-nd row right window seat, ... , *n*-th row left window seat, *n*-th row right window seat.
After occupying all the window seats (for *m*<=><=2*n*) the non-window seats are occupied:
1-st row left non-window seat, 1-st row right non-window seat, ... , *n*-th row left non-window seat, *n*-th row right non-window seat.
All the passengers go to a single final destination. In the final destination, the passengers get off in the given order.
1-st row left non-window seat, 1-st row left window seat, 1-st row right non-window seat, 1-st row right window seat, ... , *n*-th row left non-window seat, *n*-th row left window seat, *n*-th row right non-window seat, *n*-th row right window seat.
You are given the values *n* and *m*. Output *m* numbers from 1 to *m*, the order in which the passengers will get off the bus.
|
The only line contains two integers, *n* and *m* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=4*n*) — the number of pairs of rows and the number of passengers.
|
Print *m* distinct integers from 1 to *m* — the order in which the passengers will get off the bus.
|
[
"2 7\n",
"9 36\n"
] |
[
"5 1 6 2 7 3 4\n",
"19 1 20 2 21 3 22 4 23 5 24 6 25 7 26 8 27 9 28 10 29 11 30 12 31 13 32 14 33 15 34 16 35 17 36 18\n"
] |
none
| 0
|
[
{
"input": "2 7",
"output": "5 1 6 2 7 3 4"
},
{
"input": "9 36",
"output": "19 1 20 2 21 3 22 4 23 5 24 6 25 7 26 8 27 9 28 10 29 11 30 12 31 13 32 14 33 15 34 16 35 17 36 18"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 4",
"output": "3 1 4 2"
},
{
"input": "10 1",
"output": "1"
},
{
"input": "10 10",
"output": "1 2 3 4 5 6 7 8 9 10"
},
{
"input": "10 40",
"output": "21 1 22 2 23 3 24 4 25 5 26 6 27 7 28 8 29 9 30 10 31 11 32 12 33 13 34 14 35 15 36 16 37 17 38 18 39 19 40 20"
},
{
"input": "10 39",
"output": "21 1 22 2 23 3 24 4 25 5 26 6 27 7 28 8 29 9 30 10 31 11 32 12 33 13 34 14 35 15 36 16 37 17 38 18 39 19 20"
},
{
"input": "77 1",
"output": "1"
},
{
"input": "77 13",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13"
},
{
"input": "77 53",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53"
},
{
"input": "77 280",
"output": "155 1 156 2 157 3 158 4 159 5 160 6 161 7 162 8 163 9 164 10 165 11 166 12 167 13 168 14 169 15 170 16 171 17 172 18 173 19 174 20 175 21 176 22 177 23 178 24 179 25 180 26 181 27 182 28 183 29 184 30 185 31 186 32 187 33 188 34 189 35 190 36 191 37 192 38 193 39 194 40 195 41 196 42 197 43 198 44 199 45 200 46 201 47 202 48 203 49 204 50 205 51 206 52 207 53 208 54 209 55 210 56 211 57 212 58 213 59 214 60 215 61 216 62 217 63 218 64 219 65 220 66 221 67 222 68 223 69 224 70 225 71 226 72 227 73 228 74 22..."
},
{
"input": "100 1",
"output": "1"
},
{
"input": "100 13",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13"
},
{
"input": "100 77",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77"
},
{
"input": "100 103",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103"
},
{
"input": "100 200",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "100 199",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "100 201",
"output": "201 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "100 300",
"output": "201 1 202 2 203 3 204 4 205 5 206 6 207 7 208 8 209 9 210 10 211 11 212 12 213 13 214 14 215 15 216 16 217 17 218 18 219 19 220 20 221 21 222 22 223 23 224 24 225 25 226 26 227 27 228 28 229 29 230 30 231 31 232 32 233 33 234 34 235 35 236 36 237 37 238 38 239 39 240 40 241 41 242 42 243 43 244 44 245 45 246 46 247 47 248 48 249 49 250 50 251 51 252 52 253 53 254 54 255 55 256 56 257 57 258 58 259 59 260 60 261 61 262 62 263 63 264 64 265 65 266 66 267 67 268 68 269 69 270 70 271 71 272 72 273 73 274 74 27..."
},
{
"input": "100 399",
"output": "201 1 202 2 203 3 204 4 205 5 206 6 207 7 208 8 209 9 210 10 211 11 212 12 213 13 214 14 215 15 216 16 217 17 218 18 219 19 220 20 221 21 222 22 223 23 224 24 225 25 226 26 227 27 228 28 229 29 230 30 231 31 232 32 233 33 234 34 235 35 236 36 237 37 238 38 239 39 240 40 241 41 242 42 243 43 244 44 245 45 246 46 247 47 248 48 249 49 250 50 251 51 252 52 253 53 254 54 255 55 256 56 257 57 258 58 259 59 260 60 261 61 262 62 263 63 264 64 265 65 266 66 267 67 268 68 269 69 270 70 271 71 272 72 273 73 274 74 27..."
},
{
"input": "100 400",
"output": "201 1 202 2 203 3 204 4 205 5 206 6 207 7 208 8 209 9 210 10 211 11 212 12 213 13 214 14 215 15 216 16 217 17 218 18 219 19 220 20 221 21 222 22 223 23 224 24 225 25 226 26 227 27 228 28 229 29 230 30 231 31 232 32 233 33 234 34 235 35 236 36 237 37 238 38 239 39 240 40 241 41 242 42 243 43 244 44 245 45 246 46 247 47 248 48 249 49 250 50 251 51 252 52 253 53 254 54 255 55 256 56 257 57 258 58 259 59 260 60 261 61 262 62 263 63 264 64 265 65 266 66 267 67 268 68 269 69 270 70 271 71 272 72 273 73 274 74 27..."
},
{
"input": "3 9",
"output": "7 1 8 2 9 3 4 5 6"
}
] | 1,651,839,226
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 23
| 46
| 0
|
import sys
input = sys.stdin.readline
n, m = map(int, input().split())
n = n*4
a = list(range(n//2+1, n+1))
b = list(range(1, n//2+1))
for i in range(n//2):
if a[i] <= m:
print(a[i], end=' ')
if b[i] <= m:
print(b[i], end=' ')
|
Title: Seating On Bus
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Consider 2*n* rows of the seats in a bus. *n* rows of the seats on the left and *n* rows of the seats on the right. Each row can be filled by two people. So the total capacity of the bus is 4*n*.
Consider that *m* (*m*<=≤<=4*n*) people occupy the seats in the bus. The passengers entering the bus are numbered from 1 to *m* (in the order of their entering the bus). The pattern of the seat occupation is as below:
1-st row left window seat, 1-st row right window seat, 2-nd row left window seat, 2-nd row right window seat, ... , *n*-th row left window seat, *n*-th row right window seat.
After occupying all the window seats (for *m*<=><=2*n*) the non-window seats are occupied:
1-st row left non-window seat, 1-st row right non-window seat, ... , *n*-th row left non-window seat, *n*-th row right non-window seat.
All the passengers go to a single final destination. In the final destination, the passengers get off in the given order.
1-st row left non-window seat, 1-st row left window seat, 1-st row right non-window seat, 1-st row right window seat, ... , *n*-th row left non-window seat, *n*-th row left window seat, *n*-th row right non-window seat, *n*-th row right window seat.
You are given the values *n* and *m*. Output *m* numbers from 1 to *m*, the order in which the passengers will get off the bus.
Input Specification:
The only line contains two integers, *n* and *m* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=4*n*) — the number of pairs of rows and the number of passengers.
Output Specification:
Print *m* distinct integers from 1 to *m* — the order in which the passengers will get off the bus.
Demo Input:
['2 7\n', '9 36\n']
Demo Output:
['5 1 6 2 7 3 4\n', '19 1 20 2 21 3 22 4 23 5 24 6 25 7 26 8 27 9 28 10 29 11 30 12 31 13 32 14 33 15 34 16 35 17 36 18\n']
Note:
none
|
```python
import sys
input = sys.stdin.readline
n, m = map(int, input().split())
n = n*4
a = list(range(n//2+1, n+1))
b = list(range(1, n//2+1))
for i in range(n//2):
if a[i] <= m:
print(a[i], end=' ')
if b[i] <= m:
print(b[i], end=' ')
```
| 3
|
|
748
|
A
|
Santa Claus and a Place in a Class
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Santa Claus is the first who came to the Christmas Olympiad, and he is going to be the first to take his place at a desk! In the classroom there are *n* lanes of *m* desks each, and there are two working places at each of the desks. The lanes are numbered from 1 to *n* from the left to the right, the desks in a lane are numbered from 1 to *m* starting from the blackboard. Note that the lanes go perpendicularly to the blackboard, not along it (see picture).
The organizers numbered all the working places from 1 to 2*nm*. The places are numbered by lanes (i. e. all the places of the first lane go first, then all the places of the second lane, and so on), in a lane the places are numbered starting from the nearest to the blackboard (i. e. from the first desk in the lane), at each desk, the place on the left is numbered before the place on the right.
Santa Clause knows that his place has number *k*. Help him to determine at which lane at which desk he should sit, and whether his place is on the left or on the right!
|
The only line contains three integers *n*, *m* and *k* (1<=≤<=*n*,<=*m*<=≤<=10<=000, 1<=≤<=*k*<=≤<=2*nm*) — the number of lanes, the number of desks in each lane and the number of Santa Claus' place.
|
Print two integers: the number of lane *r*, the number of desk *d*, and a character *s*, which stands for the side of the desk Santa Claus. The character *s* should be "L", if Santa Clause should sit on the left, and "R" if his place is on the right.
|
[
"4 3 9\n",
"4 3 24\n",
"2 4 4\n"
] |
[
"2 2 L\n",
"4 3 R\n",
"1 2 R\n"
] |
The first and the second samples are shown on the picture. The green place corresponds to Santa Claus' place in the first example, the blue place corresponds to Santa Claus' place in the second example.
In the third sample there are two lanes with four desks in each, and Santa Claus has the fourth place. Thus, his place is in the first lane at the second desk on the right.
| 500
|
[
{
"input": "4 3 9",
"output": "2 2 L"
},
{
"input": "4 3 24",
"output": "4 3 R"
},
{
"input": "2 4 4",
"output": "1 2 R"
},
{
"input": "3 10 24",
"output": "2 2 R"
},
{
"input": "10 3 59",
"output": "10 3 L"
},
{
"input": "10000 10000 160845880",
"output": "8043 2940 R"
},
{
"input": "1 1 1",
"output": "1 1 L"
},
{
"input": "1 1 2",
"output": "1 1 R"
},
{
"input": "1 10000 1",
"output": "1 1 L"
},
{
"input": "1 10000 20000",
"output": "1 10000 R"
},
{
"input": "10000 1 1",
"output": "1 1 L"
},
{
"input": "10000 1 10000",
"output": "5000 1 R"
},
{
"input": "10000 1 20000",
"output": "10000 1 R"
},
{
"input": "3 2 1",
"output": "1 1 L"
},
{
"input": "3 2 2",
"output": "1 1 R"
},
{
"input": "3 2 3",
"output": "1 2 L"
},
{
"input": "3 2 4",
"output": "1 2 R"
},
{
"input": "3 2 5",
"output": "2 1 L"
},
{
"input": "3 2 6",
"output": "2 1 R"
},
{
"input": "3 2 7",
"output": "2 2 L"
},
{
"input": "3 2 8",
"output": "2 2 R"
},
{
"input": "3 2 9",
"output": "3 1 L"
},
{
"input": "3 2 10",
"output": "3 1 R"
},
{
"input": "3 2 11",
"output": "3 2 L"
},
{
"input": "3 2 12",
"output": "3 2 R"
},
{
"input": "300 2000 1068628",
"output": "268 314 R"
},
{
"input": "300 2000 584756",
"output": "147 378 R"
},
{
"input": "300 2000 268181",
"output": "68 91 L"
},
{
"input": "10000 9999 186450844",
"output": "9324 4745 R"
},
{
"input": "10000 9999 197114268",
"output": "9857 6990 R"
},
{
"input": "10000 9999 112390396",
"output": "5621 818 R"
},
{
"input": "10000 10000 1",
"output": "1 1 L"
},
{
"input": "10000 10000 2",
"output": "1 1 R"
},
{
"input": "10000 10000 100000001",
"output": "5001 1 L"
},
{
"input": "10000 10000 199999999",
"output": "10000 10000 L"
},
{
"input": "10000 10000 200000000",
"output": "10000 10000 R"
},
{
"input": "1 2 1",
"output": "1 1 L"
},
{
"input": "1 2 2",
"output": "1 1 R"
},
{
"input": "1 2 3",
"output": "1 2 L"
},
{
"input": "1 2 4",
"output": "1 2 R"
},
{
"input": "2 1 1",
"output": "1 1 L"
},
{
"input": "2 1 2",
"output": "1 1 R"
},
{
"input": "2 1 3",
"output": "2 1 L"
},
{
"input": "2 1 4",
"output": "2 1 R"
},
{
"input": "4 3 7",
"output": "2 1 L"
},
{
"input": "1 1 1",
"output": "1 1 L"
}
] | 1,482,662,686
| 5,986
|
Python 3
|
OK
|
TESTS
| 46
| 77
| 4,608,000
|
a=input().split()
if int(a[2])%2==0:
s='R'
else:
s='L'
k=0
if int(a[2])%(int(a[1])*2)>0:
k+=1
r=int(a[2])%(int(a[1])*2)//2+int(a[2])%(int(a[1])*2)%2
if r==0:
r=a[1]
print(int(a[2])//(int(a[1])*2)+k)
print(r)
print(s)
|
Title: Santa Claus and a Place in a Class
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Santa Claus is the first who came to the Christmas Olympiad, and he is going to be the first to take his place at a desk! In the classroom there are *n* lanes of *m* desks each, and there are two working places at each of the desks. The lanes are numbered from 1 to *n* from the left to the right, the desks in a lane are numbered from 1 to *m* starting from the blackboard. Note that the lanes go perpendicularly to the blackboard, not along it (see picture).
The organizers numbered all the working places from 1 to 2*nm*. The places are numbered by lanes (i. e. all the places of the first lane go first, then all the places of the second lane, and so on), in a lane the places are numbered starting from the nearest to the blackboard (i. e. from the first desk in the lane), at each desk, the place on the left is numbered before the place on the right.
Santa Clause knows that his place has number *k*. Help him to determine at which lane at which desk he should sit, and whether his place is on the left or on the right!
Input Specification:
The only line contains three integers *n*, *m* and *k* (1<=≤<=*n*,<=*m*<=≤<=10<=000, 1<=≤<=*k*<=≤<=2*nm*) — the number of lanes, the number of desks in each lane and the number of Santa Claus' place.
Output Specification:
Print two integers: the number of lane *r*, the number of desk *d*, and a character *s*, which stands for the side of the desk Santa Claus. The character *s* should be "L", if Santa Clause should sit on the left, and "R" if his place is on the right.
Demo Input:
['4 3 9\n', '4 3 24\n', '2 4 4\n']
Demo Output:
['2 2 L\n', '4 3 R\n', '1 2 R\n']
Note:
The first and the second samples are shown on the picture. The green place corresponds to Santa Claus' place in the first example, the blue place corresponds to Santa Claus' place in the second example.
In the third sample there are two lanes with four desks in each, and Santa Claus has the fourth place. Thus, his place is in the first lane at the second desk on the right.
|
```python
a=input().split()
if int(a[2])%2==0:
s='R'
else:
s='L'
k=0
if int(a[2])%(int(a[1])*2)>0:
k+=1
r=int(a[2])%(int(a[1])*2)//2+int(a[2])%(int(a[1])*2)%2
if r==0:
r=a[1]
print(int(a[2])//(int(a[1])*2)+k)
print(r)
print(s)
```
| 3
|
|
131
|
B
|
Opposites Attract
|
PROGRAMMING
| 1,200
|
[
"implementation",
"math"
] | null | null |
Everybody knows that opposites attract. That is the key principle of the "Perfect Matching" dating agency. The "Perfect Matching" matchmakers have classified each registered customer by his interests and assigned to the *i*-th client number *t**i* (<=-<=10<=≤<=*t**i*<=≤<=10). Of course, one number can be assigned to any number of customers.
"Perfect Matching" wants to advertise its services and publish the number of opposite couples, that is, the couples who have opposite values of *t*. Each couple consists of exactly two clients. The customer can be included in a couple an arbitrary number of times. Help the agency and write the program that will find the sought number by the given sequence *t*1,<=*t*2,<=...,<=*t**n*. For example, if *t*<==<=(1,<=<=-<=1,<=1,<=<=-<=1), then any two elements *t**i* and *t**j* form a couple if *i* and *j* have different parity. Consequently, in this case the sought number equals 4.
Of course, a client can't form a couple with him/herself.
|
The first line of the input data contains an integer *n* (1<=≤<=*n*<=≤<=105) which represents the number of registered clients of the "Couple Matching". The second line contains a sequence of integers *t*1,<=*t*2,<=...,<=*t**n* (<=-<=10<=≤<=*t**i*<=≤<=10), *t**i* — is the parameter of the *i*-th customer that has been assigned to the customer by the result of the analysis of his interests.
|
Print the number of couples of customs with opposite *t*. The opposite number for *x* is number <=-<=*x* (0 is opposite to itself). Couples that only differ in the clients' order are considered the same.
Note that the answer to the problem can be large enough, so you must use the 64-bit integer type for calculations. Please, do not use the %lld specificator to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specificator.
|
[
"5\n-3 3 0 0 3\n",
"3\n0 0 0\n"
] |
[
"3\n",
"3\n"
] |
In the first sample the couples of opposite clients are: (1,2), (1,5) и (3,4).
In the second sample any couple of clients is opposite.
| 1,000
|
[
{
"input": "5\n-3 3 0 0 3",
"output": "3"
},
{
"input": "3\n0 0 0",
"output": "3"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n5",
"output": "0"
},
{
"input": "2\n0 0",
"output": "1"
},
{
"input": "2\n-3 3",
"output": "1"
},
{
"input": "2\n1 5",
"output": "0"
},
{
"input": "4\n1 -1 1 -1",
"output": "4"
},
{
"input": "10\n1 -1 2 -2 3 -3 4 -4 0 0",
"output": "5"
},
{
"input": "5\n0 0 0 0 0",
"output": "10"
},
{
"input": "4\n4 4 4 -1",
"output": "0"
},
{
"input": "2\n10 -10",
"output": "1"
},
{
"input": "2\n-10 10",
"output": "1"
},
{
"input": "3\n-1 -1 2",
"output": "0"
},
{
"input": "2\n-1 2",
"output": "0"
},
{
"input": "7\n0 10 -10 10 -10 10 10",
"output": "8"
},
{
"input": "5\n-3 2 1 -1 3",
"output": "2"
},
{
"input": "4\n-10 10 -10 10",
"output": "4"
},
{
"input": "4\n1 -1 2 -2",
"output": "2"
}
] | 1,694,560,251
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 7
| 2,000
| 7,680,000
|
size = int(input())
couples = input().split(" ")
couples = [int(x) for x in couples]
count = 0
for x in range(len(couples)):
for y in range(x + 1, len(couples)):
if couples[x] + couples[y] == 0:
count += 1
print(count)
|
Title: Opposites Attract
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Everybody knows that opposites attract. That is the key principle of the "Perfect Matching" dating agency. The "Perfect Matching" matchmakers have classified each registered customer by his interests and assigned to the *i*-th client number *t**i* (<=-<=10<=≤<=*t**i*<=≤<=10). Of course, one number can be assigned to any number of customers.
"Perfect Matching" wants to advertise its services and publish the number of opposite couples, that is, the couples who have opposite values of *t*. Each couple consists of exactly two clients. The customer can be included in a couple an arbitrary number of times. Help the agency and write the program that will find the sought number by the given sequence *t*1,<=*t*2,<=...,<=*t**n*. For example, if *t*<==<=(1,<=<=-<=1,<=1,<=<=-<=1), then any two elements *t**i* and *t**j* form a couple if *i* and *j* have different parity. Consequently, in this case the sought number equals 4.
Of course, a client can't form a couple with him/herself.
Input Specification:
The first line of the input data contains an integer *n* (1<=≤<=*n*<=≤<=105) which represents the number of registered clients of the "Couple Matching". The second line contains a sequence of integers *t*1,<=*t*2,<=...,<=*t**n* (<=-<=10<=≤<=*t**i*<=≤<=10), *t**i* — is the parameter of the *i*-th customer that has been assigned to the customer by the result of the analysis of his interests.
Output Specification:
Print the number of couples of customs with opposite *t*. The opposite number for *x* is number <=-<=*x* (0 is opposite to itself). Couples that only differ in the clients' order are considered the same.
Note that the answer to the problem can be large enough, so you must use the 64-bit integer type for calculations. Please, do not use the %lld specificator to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specificator.
Demo Input:
['5\n-3 3 0 0 3\n', '3\n0 0 0\n']
Demo Output:
['3\n', '3\n']
Note:
In the first sample the couples of opposite clients are: (1,2), (1,5) и (3,4).
In the second sample any couple of clients is opposite.
|
```python
size = int(input())
couples = input().split(" ")
couples = [int(x) for x in couples]
count = 0
for x in range(len(couples)):
for y in range(x + 1, len(couples)):
if couples[x] + couples[y] == 0:
count += 1
print(count)
```
| 0
|
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.