contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,574,875,636
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 218
| 0
|
s = input()
mal = 0
bol = 0
for element in s:
if 'a'<=element<='z':
mal += 1
elif 'A'<=element<='Z':
bol += 1
if mal > bol:
print(s.lower())
elif mal < bol:
print(s.upper())
elif mal == bol:
print(s.lower())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
s = input()
mal = 0
bol = 0
for element in s:
if 'a'<=element<='z':
mal += 1
elif 'A'<=element<='Z':
bol += 1
if mal > bol:
print(s.lower())
elif mal < bol:
print(s.upper())
elif mal == bol:
print(s.lower())
```
| 3.9455
|
804
|
B
|
Minimum number of steps
|
PROGRAMMING
| 1,400
|
[
"combinatorics",
"greedy",
"implementation",
"math"
] | null | null |
We have a string of letters 'a' and 'b'. We want to perform some operations on it. On each step we choose one of substrings "ab" in the string and replace it with the string "bba". If we have no "ab" as a substring, our job is done. Print the minimum number of steps we should perform to make our job done modulo 109<=+<=7.
The string "ab" appears as a substring if there is a letter 'b' right after the letter 'a' somewhere in the string.
|
The first line contains the initial string consisting of letters 'a' and 'b' only with length from 1 to 106.
|
Print the minimum number of steps modulo 109<=+<=7.
|
[
"ab\n",
"aab\n"
] |
[
"1\n",
"3\n"
] |
The first example: "ab" → "bba".
The second example: "aab" → "abba" → "bbaba" → "bbbbaa".
| 1,000
|
[
{
"input": "ab",
"output": "1"
},
{
"input": "aab",
"output": "3"
},
{
"input": "aaaaabaabababaaaaaba",
"output": "17307"
},
{
"input": "abaabaaabbabaabab",
"output": "1795"
},
{
"input": "abbaa",
"output": "2"
},
{
"input": "abbaaabaabaaaaabbbbaababaaaaabaabbaaaaabbaabbaaaabbbabbbabb",
"output": "690283580"
},
{
"input": "aababbaaaabbaabbbbbbbbabbababbbaaabbaaabbabbba",
"output": "2183418"
},
{
"input": "aabbaababbabbbaabbaababaaaabbaaaabaaaaaababbaaaabaababbabbbb",
"output": "436420225"
},
{
"input": "aaabaaaabbababbaabbababbbbaaaaaaabbabbba",
"output": "8431094"
},
{
"input": "abbbbababbabbbbbabaabbbaabbbbbbbaaab",
"output": "8180"
},
{
"input": "bbababbbaabaaaaaaaabbabbbb",
"output": "40979"
},
{
"input": "abbbaaabbbbbabaabbaaabbbababbbaabaabababababa",
"output": "2065758"
},
{
"input": "abaaaaaabaaaabbabbaaabbbbabababaaaaabbaabbaaaaabbbaababaaaaaaabbbbbaaaaabaababbabababbabbbbaabbaabbabbbabaabbaabbaaaaaab",
"output": "235606597"
},
{
"input": "abbbbbbbbbbbbbbbbbbbbbbbbbbaababaaaaaaabaabaaababaabaababaaabababaababab",
"output": "7"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbaaaaaaaaabaabaaababaabaababaaabababaabbbbbbb",
"output": "557763786"
}
] | 1,622,874,942
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 13
| 1,000
| 3,174,400
|
s1=input()
cnt=0
cntb=0
ind=s1.index('a')
s=s1[ind:]
i=len(s)-1
while(i>=0):
if cntb==0 and s[i]=='a':
i-=1
continue
elif s[i]=='b':
cntb+=1
elif s[i]=='a':
cnt+=cntb
cntb*=2
i-=1
print(cnt%1000000007)
|
Title: Minimum number of steps
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
We have a string of letters 'a' and 'b'. We want to perform some operations on it. On each step we choose one of substrings "ab" in the string and replace it with the string "bba". If we have no "ab" as a substring, our job is done. Print the minimum number of steps we should perform to make our job done modulo 109<=+<=7.
The string "ab" appears as a substring if there is a letter 'b' right after the letter 'a' somewhere in the string.
Input Specification:
The first line contains the initial string consisting of letters 'a' and 'b' only with length from 1 to 106.
Output Specification:
Print the minimum number of steps modulo 109<=+<=7.
Demo Input:
['ab\n', 'aab\n']
Demo Output:
['1\n', '3\n']
Note:
The first example: "ab" → "bba".
The second example: "aab" → "abba" → "bbaba" → "bbbbaa".
|
```python
s1=input()
cnt=0
cntb=0
ind=s1.index('a')
s=s1[ind:]
i=len(s)-1
while(i>=0):
if cntb==0 and s[i]=='a':
i-=1
continue
elif s[i]=='b':
cntb+=1
elif s[i]=='a':
cnt+=cntb
cntb*=2
i-=1
print(cnt%1000000007)
```
| 0
|
|
918
|
B
|
Radio Station
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] | null | null |
As the guys fried the radio station facilities, the school principal gave them tasks as a punishment. Dustin's task was to add comments to nginx configuration for school's website. The school has *n* servers. Each server has a name and an ip (names aren't necessarily unique, but ips are). Dustin knows the ip and name of each server. For simplicity, we'll assume that an nginx command is of form "command ip;" where command is a string consisting of English lowercase letter only, and ip is the ip of one of school servers.
Each ip is of form "a.b.c.d" where *a*, *b*, *c* and *d* are non-negative integers less than or equal to 255 (with no leading zeros). The nginx configuration file Dustin has to add comments to has *m* commands. Nobody ever memorizes the ips of servers, so to understand the configuration better, Dustin has to comment the name of server that the ip belongs to at the end of each line (after each command). More formally, if a line is "command ip;" Dustin has to replace it with "command ip; #name" where name is the name of the server with ip equal to ip.
Dustin doesn't know anything about nginx, so he panicked again and his friends asked you to do his task for him.
|
The first line of input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000).
The next *n* lines contain the names and ips of the servers. Each line contains a string name, name of the server and a string ip, ip of the server, separated by space (1<=≤<=|*name*|<=≤<=10, *name* only consists of English lowercase letters). It is guaranteed that all ip are distinct.
The next *m* lines contain the commands in the configuration file. Each line is of form "command ip;" (1<=≤<=|*command*|<=≤<=10, command only consists of English lowercase letters). It is guaranteed that ip belongs to one of the *n* school servers.
|
Print *m* lines, the commands in the configuration file after Dustin did his task.
|
[
"2 2\nmain 192.168.0.2\nreplica 192.168.0.1\nblock 192.168.0.1;\nproxy 192.168.0.2;\n",
"3 5\ngoogle 8.8.8.8\ncodeforces 212.193.33.27\nserver 138.197.64.57\nredirect 138.197.64.57;\nblock 8.8.8.8;\ncf 212.193.33.27;\nunblock 8.8.8.8;\ncheck 138.197.64.57;\n"
] |
[
"block 192.168.0.1; #replica\nproxy 192.168.0.2; #main\n",
"redirect 138.197.64.57; #server\nblock 8.8.8.8; #google\ncf 212.193.33.27; #codeforces\nunblock 8.8.8.8; #google\ncheck 138.197.64.57; #server\n"
] |
none
| 1,000
|
[
{
"input": "2 2\nmain 192.168.0.2\nreplica 192.168.0.1\nblock 192.168.0.1;\nproxy 192.168.0.2;",
"output": "block 192.168.0.1; #replica\nproxy 192.168.0.2; #main"
},
{
"input": "3 5\ngoogle 8.8.8.8\ncodeforces 212.193.33.27\nserver 138.197.64.57\nredirect 138.197.64.57;\nblock 8.8.8.8;\ncf 212.193.33.27;\nunblock 8.8.8.8;\ncheck 138.197.64.57;",
"output": "redirect 138.197.64.57; #server\nblock 8.8.8.8; #google\ncf 212.193.33.27; #codeforces\nunblock 8.8.8.8; #google\ncheck 138.197.64.57; #server"
},
{
"input": "10 10\nittmcs 112.147.123.173\njkt 228.40.73.178\nfwckqtz 88.28.31.198\nkal 224.226.34.213\nnacuyokm 49.57.13.44\nfouynv 243.18.250.17\ns 45.248.83.247\ne 75.69.23.169\nauwoqlch 100.44.219.187\nlkldjq 46.123.169.140\ngjcylatwzi 46.123.169.140;\ndxfi 88.28.31.198;\ngv 46.123.169.140;\nety 88.28.31.198;\notbmgcrn 46.123.169.140;\nw 112.147.123.173;\np 75.69.23.169;\nvdsnigk 46.123.169.140;\nmmc 46.123.169.140;\ngtc 49.57.13.44;",
"output": "gjcylatwzi 46.123.169.140; #lkldjq\ndxfi 88.28.31.198; #fwckqtz\ngv 46.123.169.140; #lkldjq\nety 88.28.31.198; #fwckqtz\notbmgcrn 46.123.169.140; #lkldjq\nw 112.147.123.173; #ittmcs\np 75.69.23.169; #e\nvdsnigk 46.123.169.140; #lkldjq\nmmc 46.123.169.140; #lkldjq\ngtc 49.57.13.44; #nacuyokm"
},
{
"input": "1 1\nervbfot 185.32.99.2\nzygoumbmx 185.32.99.2;",
"output": "zygoumbmx 185.32.99.2; #ervbfot"
},
{
"input": "1 2\ny 245.182.246.189\nlllq 245.182.246.189;\nxds 245.182.246.189;",
"output": "lllq 245.182.246.189; #y\nxds 245.182.246.189; #y"
},
{
"input": "2 1\ntdwmshz 203.115.124.110\neksckjya 201.80.191.212\nzbtjzzue 203.115.124.110;",
"output": "zbtjzzue 203.115.124.110; #tdwmshz"
},
{
"input": "8 5\nfhgkq 5.19.189.178\nphftablcr 75.18.177.178\nxnpcg 158.231.167.176\ncfahrkq 26.165.124.191\nfkgtnqtfoh 230.13.13.129\nt 101.24.94.85\nvjoirslx 59.6.179.72\ntwktmskb 38.194.117.184\nrvzzlygosc 26.165.124.191;\ndcsgxrkgv 101.24.94.85;\nyvmyppn 59.6.179.72;\ngpdjjuq 75.18.177.178;\nvdviz 101.24.94.85;",
"output": "rvzzlygosc 26.165.124.191; #cfahrkq\ndcsgxrkgv 101.24.94.85; #t\nyvmyppn 59.6.179.72; #vjoirslx\ngpdjjuq 75.18.177.178; #phftablcr\nvdviz 101.24.94.85; #t"
},
{
"input": "2 1\nmain 1.1.1.1\nget 11.1.1.1\ncommand 11.1.1.1;",
"output": "command 11.1.1.1; #get"
},
{
"input": "2 2\nmain 0.0.0.255\nmainn 0.0.2.55\nblock 0.0.0.255;\nblock 0.0.2.55;",
"output": "block 0.0.0.255; #main\nblock 0.0.2.55; #mainn"
},
{
"input": "2 2\nmain 0.0.63.0\nreplica 0.38.0.56\nblock 0.0.63.0;\nproxy 0.38.0.56;",
"output": "block 0.0.63.0; #main\nproxy 0.38.0.56; #replica"
},
{
"input": "2 2\nmain 192.168.10.12\nreplica 192.167.10.12\nblock 192.168.10.12;\nproxy 192.167.10.12;",
"output": "block 192.168.10.12; #main\nproxy 192.167.10.12; #replica"
},
{
"input": "2 1\nneserver 185.218.47.91\nserver 255.255.255.255\nblock 255.255.255.255;",
"output": "block 255.255.255.255; #server"
},
{
"input": "2 1\nalp 22.222.30.10\nbet 222.22.30.10\nblock 22.222.30.10;",
"output": "block 22.222.30.10; #alp"
}
] | 1,569,701,641
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 28
| 233
| 307,200
|
number = list(map(int,input().split()))
all_IP = []
for i in range(number[0]):
s = list(map(str , input().split()))
s[1] = s[1]+';'
all_IP.append(s)
for i in range(number[1]):
x = input()
z = list(map(str , x.split()))
ip = z[1]
for j in range(number[0]):
if all_IP[j][1] == ip:
ans = x +" #" + str(all_IP[j][0])
print(ans)
break
|
Title: Radio Station
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As the guys fried the radio station facilities, the school principal gave them tasks as a punishment. Dustin's task was to add comments to nginx configuration for school's website. The school has *n* servers. Each server has a name and an ip (names aren't necessarily unique, but ips are). Dustin knows the ip and name of each server. For simplicity, we'll assume that an nginx command is of form "command ip;" where command is a string consisting of English lowercase letter only, and ip is the ip of one of school servers.
Each ip is of form "a.b.c.d" where *a*, *b*, *c* and *d* are non-negative integers less than or equal to 255 (with no leading zeros). The nginx configuration file Dustin has to add comments to has *m* commands. Nobody ever memorizes the ips of servers, so to understand the configuration better, Dustin has to comment the name of server that the ip belongs to at the end of each line (after each command). More formally, if a line is "command ip;" Dustin has to replace it with "command ip; #name" where name is the name of the server with ip equal to ip.
Dustin doesn't know anything about nginx, so he panicked again and his friends asked you to do his task for him.
Input Specification:
The first line of input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000).
The next *n* lines contain the names and ips of the servers. Each line contains a string name, name of the server and a string ip, ip of the server, separated by space (1<=≤<=|*name*|<=≤<=10, *name* only consists of English lowercase letters). It is guaranteed that all ip are distinct.
The next *m* lines contain the commands in the configuration file. Each line is of form "command ip;" (1<=≤<=|*command*|<=≤<=10, command only consists of English lowercase letters). It is guaranteed that ip belongs to one of the *n* school servers.
Output Specification:
Print *m* lines, the commands in the configuration file after Dustin did his task.
Demo Input:
['2 2\nmain 192.168.0.2\nreplica 192.168.0.1\nblock 192.168.0.1;\nproxy 192.168.0.2;\n', '3 5\ngoogle 8.8.8.8\ncodeforces 212.193.33.27\nserver 138.197.64.57\nredirect 138.197.64.57;\nblock 8.8.8.8;\ncf 212.193.33.27;\nunblock 8.8.8.8;\ncheck 138.197.64.57;\n']
Demo Output:
['block 192.168.0.1; #replica\nproxy 192.168.0.2; #main\n', 'redirect 138.197.64.57; #server\nblock 8.8.8.8; #google\ncf 212.193.33.27; #codeforces\nunblock 8.8.8.8; #google\ncheck 138.197.64.57; #server\n']
Note:
none
|
```python
number = list(map(int,input().split()))
all_IP = []
for i in range(number[0]):
s = list(map(str , input().split()))
s[1] = s[1]+';'
all_IP.append(s)
for i in range(number[1]):
x = input()
z = list(map(str , x.split()))
ip = z[1]
for j in range(number[0]):
if all_IP[j][1] == ip:
ans = x +" #" + str(all_IP[j][0])
print(ans)
break
```
| 3
|
|
767
|
A
|
Snacktower
|
PROGRAMMING
| 1,100
|
[
"data structures",
"implementation"
] | null | null |
According to an old legeng, a long time ago Ankh-Morpork residents did something wrong to miss Fortune, and she cursed them. She said that at some time *n* snacks of distinct sizes will fall on the city, and the residents should build a Snacktower of them by placing snacks one on another. Of course, big snacks should be at the bottom of the tower, while small snacks should be at the top.
Years passed, and once different snacks started to fall onto the city, and the residents began to build the Snacktower.
However, they faced some troubles. Each day exactly one snack fell onto the city, but their order was strange. So, at some days the residents weren't able to put the new stack on the top of the Snacktower: they had to wait until all the bigger snacks fell. Of course, in order to not to anger miss Fortune again, the residents placed each snack on the top of the tower immediately as they could do it.
Write a program that models the behavior of Ankh-Morpork residents.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the total number of snacks.
The second line contains *n* integers, the *i*-th of them equals the size of the snack which fell on the *i*-th day. Sizes are distinct integers from 1 to *n*.
|
Print *n* lines. On the *i*-th of them print the sizes of the snacks which the residents placed on the top of the Snacktower on the *i*-th day in the order they will do that. If no snack is placed on some day, leave the corresponding line empty.
|
[
"3\n3 1 2\n",
"5\n4 5 1 2 3\n"
] |
[
"3\n \n2 1",
"5 4\n \n \n3 2 1\n"
] |
In the example a snack of size 3 fell on the first day, and the residents immediately placed it. On the second day a snack of size 1 fell, and the residents weren't able to place it because they were missing the snack of size 2. On the third day a snack of size 2 fell, and the residents immediately placed it. Right after that they placed the snack of size 1 which had fallen before.
| 500
|
[
{
"input": "3\n3 1 2",
"output": "3 \n\n2 1 "
},
{
"input": "5\n4 5 1 2 3",
"output": "5 4 \n\n\n3 2 1 "
},
{
"input": "1\n1",
"output": "1 "
},
{
"input": "2\n1 2",
"output": "2 1 "
},
{
"input": "10\n5 1 6 2 8 3 4 10 9 7",
"output": "10 \n9 8 \n7 6 5 4 3 2 1 "
},
{
"input": "30\n16 10 4 29 5 28 12 21 11 30 18 6 14 3 17 22 20 15 9 1 27 19 24 26 13 25 2 23 8 7",
"output": "30 29 28 \n\n\n\n\n\n\n\n\n\n\n27 \n\n\n26 \n\n25 24 \n\n23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 \n8 \n7 6 5 4 3 2 1 "
},
{
"input": "100\n98 52 63 2 18 96 31 58 84 40 41 45 66 100 46 71 26 48 81 20 73 91 68 76 13 93 17 29 64 95 79 21 55 75 19 85 54 51 89 78 15 87 43 59 36 1 90 35 65 56 62 28 86 5 82 49 3 99 33 9 92 32 74 69 27 22 77 16 44 94 34 6 57 70 23 12 61 25 8 11 67 47 83 88 10 14 30 7 97 60 42 37 24 38 53 50 4 80 72 39",
"output": "100 \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n99 98 \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 \n\n\n\n\n\n\n\n\n80 79 78 77 76 75 74 73 \n72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 \n39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "2\n2 1",
"output": "2 \n1 "
}
] | 1,660,305,942
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 25
| 187
| 14,131,200
|
n = int(input()); arr = list(map(int, input().split()))
turn = n; fell = [False]*n
for i in range(n):
fell[arr[i]-1] = True
if arr[i] == turn:
while fell[turn - 1] and turn >= 1:
print(turn, end=' ')
turn -= 1
print()
|
Title: Snacktower
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
According to an old legeng, a long time ago Ankh-Morpork residents did something wrong to miss Fortune, and she cursed them. She said that at some time *n* snacks of distinct sizes will fall on the city, and the residents should build a Snacktower of them by placing snacks one on another. Of course, big snacks should be at the bottom of the tower, while small snacks should be at the top.
Years passed, and once different snacks started to fall onto the city, and the residents began to build the Snacktower.
However, they faced some troubles. Each day exactly one snack fell onto the city, but their order was strange. So, at some days the residents weren't able to put the new stack on the top of the Snacktower: they had to wait until all the bigger snacks fell. Of course, in order to not to anger miss Fortune again, the residents placed each snack on the top of the tower immediately as they could do it.
Write a program that models the behavior of Ankh-Morpork residents.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the total number of snacks.
The second line contains *n* integers, the *i*-th of them equals the size of the snack which fell on the *i*-th day. Sizes are distinct integers from 1 to *n*.
Output Specification:
Print *n* lines. On the *i*-th of them print the sizes of the snacks which the residents placed on the top of the Snacktower on the *i*-th day in the order they will do that. If no snack is placed on some day, leave the corresponding line empty.
Demo Input:
['3\n3 1 2\n', '5\n4 5 1 2 3\n']
Demo Output:
['3\n\xa0\n2 1', '5 4\n\xa0\n\xa0\n3 2 1\n']
Note:
In the example a snack of size 3 fell on the first day, and the residents immediately placed it. On the second day a snack of size 1 fell, and the residents weren't able to place it because they were missing the snack of size 2. On the third day a snack of size 2 fell, and the residents immediately placed it. Right after that they placed the snack of size 1 which had fallen before.
|
```python
n = int(input()); arr = list(map(int, input().split()))
turn = n; fell = [False]*n
for i in range(n):
fell[arr[i]-1] = True
if arr[i] == turn:
while fell[turn - 1] and turn >= 1:
print(turn, end=' ')
turn -= 1
print()
```
| 3
|
|
296
|
A
|
Yaroslav and Permutations
|
PROGRAMMING
| 1,100
|
[
"greedy",
"math"
] | null | null |
Yaroslav has an array that consists of *n* integers. In one second Yaroslav can swap two neighboring array elements. Now Yaroslav is wondering if he can obtain an array where any two neighboring elements would be distinct in a finite time.
Help Yaroslav.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000) — the array elements.
|
In the single line print "YES" (without the quotes) if Yaroslav can obtain the array he needs, and "NO" (without the quotes) otherwise.
|
[
"1\n1\n",
"3\n1 1 2\n",
"4\n7 7 7 7\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
In the first sample the initial array fits well.
In the second sample Yaroslav can get array: 1, 2, 1. He can swap the last and the second last elements to obtain it.
In the third sample Yarosav can't get the array he needs.
| 500
|
[
{
"input": "1\n1",
"output": "YES"
},
{
"input": "3\n1 1 2",
"output": "YES"
},
{
"input": "4\n7 7 7 7",
"output": "NO"
},
{
"input": "4\n479 170 465 146",
"output": "YES"
},
{
"input": "5\n996 437 605 996 293",
"output": "YES"
},
{
"input": "6\n727 539 896 668 36 896",
"output": "YES"
},
{
"input": "7\n674 712 674 674 674 674 674",
"output": "NO"
},
{
"input": "8\n742 742 742 742 742 289 742 742",
"output": "NO"
},
{
"input": "9\n730 351 806 806 806 630 85 757 967",
"output": "YES"
},
{
"input": "10\n324 539 83 440 834 640 440 440 440 440",
"output": "YES"
},
{
"input": "7\n925 830 925 98 987 162 356",
"output": "YES"
},
{
"input": "68\n575 32 53 351 151 942 725 967 431 108 192 8 338 458 288 754 384 946 910 210 759 222 589 423 947 507 31 414 169 901 592 763 656 411 360 625 538 549 484 596 42 603 351 292 837 375 21 597 22 349 200 669 485 282 735 54 1000 419 939 901 789 128 468 729 894 649 484 808",
"output": "YES"
},
{
"input": "22\n618 814 515 310 617 936 452 601 250 520 557 799 304 225 9 845 610 990 703 196 486 94",
"output": "YES"
},
{
"input": "44\n459 581 449 449 449 449 449 449 449 623 449 449 449 449 449 449 449 449 889 449 203 273 329 449 449 449 449 449 449 845 882 323 22 449 449 893 449 449 449 449 449 870 449 402",
"output": "NO"
},
{
"input": "90\n424 3 586 183 286 89 427 618 758 833 933 170 155 722 190 977 330 369 693 426 556 435 550 442 513 146 61 719 754 140 424 280 997 688 530 550 438 867 950 194 196 298 417 287 106 489 283 456 735 115 702 317 672 787 264 314 356 186 54 913 809 833 946 314 757 322 559 647 983 482 145 197 223 130 162 536 451 174 467 45 660 293 440 254 25 155 511 746 650 187",
"output": "YES"
},
{
"input": "14\n959 203 478 315 788 788 373 834 488 519 774 764 193 103",
"output": "YES"
},
{
"input": "81\n544 528 528 528 528 4 506 528 32 528 528 528 528 528 528 528 528 975 528 528 528 528 528 528 528 528 528 528 528 528 528 20 528 528 528 528 528 528 528 528 852 528 528 120 528 528 61 11 528 528 528 228 528 165 883 528 488 475 628 528 528 528 528 528 528 597 528 528 528 528 528 528 528 528 528 528 528 412 528 521 925",
"output": "NO"
},
{
"input": "89\n354 356 352 355 355 355 352 354 354 352 355 356 355 352 354 356 354 355 355 354 353 352 352 355 355 356 352 352 353 356 352 353 354 352 355 352 353 353 353 354 353 354 354 353 356 353 353 354 354 354 354 353 352 353 355 356 356 352 356 354 353 352 355 354 356 356 356 354 354 356 354 355 354 355 353 352 354 355 352 355 355 354 356 353 353 352 356 352 353",
"output": "YES"
},
{
"input": "71\n284 284 285 285 285 284 285 284 284 285 284 285 284 284 285 284 285 285 285 285 284 284 285 285 284 284 284 285 284 285 284 285 285 284 284 284 285 284 284 285 285 285 284 284 285 284 285 285 284 285 285 284 285 284 284 284 285 285 284 285 284 285 285 285 285 284 284 285 285 284 285",
"output": "NO"
},
{
"input": "28\n602 216 214 825 814 760 814 28 76 814 814 288 814 814 222 707 11 490 814 543 914 705 814 751 976 814 814 99",
"output": "YES"
},
{
"input": "48\n546 547 914 263 986 945 914 914 509 871 324 914 153 571 914 914 914 528 970 566 544 914 914 914 410 914 914 589 609 222 914 889 691 844 621 68 914 36 914 39 630 749 914 258 945 914 727 26",
"output": "YES"
},
{
"input": "56\n516 76 516 197 516 427 174 516 706 813 94 37 516 815 516 516 937 483 16 516 842 516 638 691 516 635 516 516 453 263 516 516 635 257 125 214 29 81 516 51 362 516 677 516 903 516 949 654 221 924 516 879 516 516 972 516",
"output": "YES"
},
{
"input": "46\n314 723 314 314 314 235 314 314 314 314 270 314 59 972 314 216 816 40 314 314 314 314 314 314 314 381 314 314 314 314 314 314 314 789 314 957 114 942 314 314 29 314 314 72 314 314",
"output": "NO"
},
{
"input": "72\n169 169 169 599 694 81 250 529 865 406 817 169 667 169 965 169 169 663 65 169 903 169 942 763 169 807 169 603 169 169 13 169 169 810 169 291 169 169 169 169 169 169 169 713 169 440 169 169 169 169 169 480 169 169 867 169 169 169 169 169 169 169 169 393 169 169 459 169 99 169 601 800",
"output": "NO"
},
{
"input": "100\n317 316 317 316 317 316 317 316 317 316 316 317 317 316 317 316 316 316 317 316 317 317 316 317 316 316 316 316 316 316 317 316 317 317 317 317 317 317 316 316 316 317 316 317 316 317 316 317 317 316 317 316 317 317 316 317 316 317 316 317 316 316 316 317 317 317 317 317 316 317 317 316 316 316 316 317 317 316 317 316 316 316 316 316 316 317 316 316 317 317 317 317 317 317 317 317 317 316 316 317",
"output": "NO"
},
{
"input": "100\n510 510 510 162 969 32 510 511 510 510 911 183 496 875 903 461 510 510 123 578 510 510 510 510 510 755 510 673 510 510 763 510 510 909 510 435 487 959 807 510 368 788 557 448 284 332 510 949 510 510 777 112 857 926 487 510 510 510 678 510 510 197 829 427 698 704 409 509 510 238 314 851 510 651 510 455 682 510 714 635 973 510 443 878 510 510 510 591 510 24 596 510 43 183 510 510 671 652 214 784",
"output": "YES"
},
{
"input": "100\n476 477 474 476 476 475 473 476 474 475 473 477 476 476 474 476 474 475 476 477 473 473 473 474 474 476 473 473 476 476 475 476 473 474 473 473 477 475 475 475 476 475 477 477 477 476 475 475 475 473 476 477 475 476 477 473 474 477 473 475 476 476 474 477 476 474 473 477 473 475 477 473 476 474 477 473 475 477 473 476 476 475 476 475 474 473 477 473 475 473 477 473 473 474 475 473 477 476 477 474",
"output": "YES"
},
{
"input": "100\n498 498 498 498 498 499 498 499 499 499 498 498 498 498 499 498 499 499 498 499 498 498 498 499 499 499 498 498 499 499 498 498 498 499 498 499 498 498 498 499 498 499 498 498 498 498 499 498 498 499 498 498 499 498 499 499 498 499 499 499 498 498 498 498 499 498 499 498 499 499 499 499 498 498 499 499 498 499 499 498 498 499 499 498 498 499 499 499 498 498 499 498 498 498 499 499 499 498 498 499",
"output": "NO"
},
{
"input": "100\n858 53 816 816 816 816 816 816 816 181 816 816 816 816 579 879 816 948 171 816 816 150 866 816 816 816 897 816 816 816 816 816 816 706 816 539 816 816 816 816 816 816 423 487 816 615 254 816 816 816 816 83 816 816 816 816 816 816 816 816 816 816 816 136 775 999 816 816 816 644 816 816 816 816 927 816 802 816 856 816 816 816 816 816 816 816 816 816 816 700 816 816 816 816 982 477 816 891 806 816",
"output": "NO"
},
{
"input": "100\n167 169 169 167 169 169 167 167 167 167 168 166 170 170 169 170 170 170 169 168 166 167 170 169 167 169 168 169 166 170 166 167 170 166 166 167 169 166 166 169 166 167 168 168 170 167 168 166 168 170 167 168 167 169 169 166 168 167 170 168 167 169 168 169 166 168 168 169 169 166 170 168 167 169 170 168 167 169 168 167 168 168 166 169 170 170 166 166 167 170 167 168 167 167 169 169 166 166 169 167",
"output": "YES"
},
{
"input": "100\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "NO"
},
{
"input": "99\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "NO"
},
{
"input": "100\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "YES"
},
{
"input": "99\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "YES"
},
{
"input": "2\n1 1",
"output": "NO"
},
{
"input": "1\n1000",
"output": "YES"
},
{
"input": "12\n2 2 4 4 4 4 6 6 6 6 6 6",
"output": "YES"
}
] | 1,560,860,938
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 186
| 0
|
n = int( input() )
a = list( map( int, input().strip().split( ' ' ) ) )
m = max( set( a ), key=a.count )
if (n == 1):
print( "YES" )
elif (m > n / 2):
print( "NO" )
else:
print( "YES" )
|
Title: Yaroslav and Permutations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Yaroslav has an array that consists of *n* integers. In one second Yaroslav can swap two neighboring array elements. Now Yaroslav is wondering if he can obtain an array where any two neighboring elements would be distinct in a finite time.
Help Yaroslav.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000) — the array elements.
Output Specification:
In the single line print "YES" (without the quotes) if Yaroslav can obtain the array he needs, and "NO" (without the quotes) otherwise.
Demo Input:
['1\n1\n', '3\n1 1 2\n', '4\n7 7 7 7\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
In the first sample the initial array fits well.
In the second sample Yaroslav can get array: 1, 2, 1. He can swap the last and the second last elements to obtain it.
In the third sample Yarosav can't get the array he needs.
|
```python
n = int( input() )
a = list( map( int, input().strip().split( ' ' ) ) )
m = max( set( a ), key=a.count )
if (n == 1):
print( "YES" )
elif (m > n / 2):
print( "NO" )
else:
print( "YES" )
```
| 0
|
|
965
|
A
|
Paper Airplanes
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes.
A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy?
|
The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively.
|
Print a single integer — the minimum number of packs they should buy.
|
[
"5 3 2 3\n",
"5 3 100 1\n"
] |
[
"4\n",
"5\n"
] |
In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs.
In the second sample they have to buy a pack for each person as they can't share sheets.
| 500
|
[
{
"input": "5 3 2 3",
"output": "4"
},
{
"input": "5 3 100 1",
"output": "5"
},
{
"input": "10000 10000 1 1",
"output": "100000000"
},
{
"input": "1 1 10000 10000",
"output": "1"
},
{
"input": "300 300 21 23",
"output": "196"
},
{
"input": "300 2 37 51",
"output": "6"
},
{
"input": "2 400 23 57",
"output": "1"
},
{
"input": "1 1 1 1",
"output": "1"
},
{
"input": "10000 10000 3 2",
"output": "16670000"
},
{
"input": "1 2 1 2",
"output": "1"
},
{
"input": "1 1 2 2",
"output": "1"
},
{
"input": "1 1 10 10",
"output": "1"
},
{
"input": "5324 5439 32 13",
"output": "69622"
},
{
"input": "9000 1 2432 1",
"output": "9000"
},
{
"input": "230 1234 9124 23",
"output": "10"
},
{
"input": "11 1 1 1",
"output": "11"
},
{
"input": "6246 8489 1227 9",
"output": "4858"
},
{
"input": "9 20 5 7",
"output": "6"
}
] | 1,524,709,048
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 18
| 78
| 7,065,600
|
k, n, s, p = [int(x) for x in input().split()]
ans = ((n + s - 1) // s * k + p - 1) // p
print(ans)
|
Title: Paper Airplanes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes.
A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy?
Input Specification:
The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively.
Output Specification:
Print a single integer — the minimum number of packs they should buy.
Demo Input:
['5 3 2 3\n', '5 3 100 1\n']
Demo Output:
['4\n', '5\n']
Note:
In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs.
In the second sample they have to buy a pack for each person as they can't share sheets.
|
```python
k, n, s, p = [int(x) for x in input().split()]
ans = ((n + s - 1) // s * k + p - 1) // p
print(ans)
```
| 3
|
|
124
|
B
|
Permutations
|
PROGRAMMING
| 1,400
|
[
"brute force",
"combinatorics",
"implementation"
] | null | null |
You are given *n* *k*-digit integers. You have to rearrange the digits in the integers so that the difference between the largest and the smallest number was minimum. Digits should be rearranged by the same rule in all integers.
|
The first line contains integers *n* and *k* — the number and digit capacity of numbers correspondingly (1<=≤<=*n*,<=*k*<=≤<=8). Next *n* lines contain *k*-digit positive integers. Leading zeroes are allowed both in the initial integers and the integers resulting from the rearranging of digits.
|
Print a single number: the minimally possible difference between the largest and the smallest number after the digits are rearranged in all integers by the same rule.
|
[
"6 4\n5237\n2753\n7523\n5723\n5327\n2537\n",
"3 3\n010\n909\n012\n",
"7 5\n50808\n36603\n37198\n44911\n29994\n42543\n50156\n"
] |
[
"2700\n",
"3\n",
"20522\n"
] |
In the first sample, if we rearrange the digits in numbers as (3,1,4,2), then the 2-nd and the 4-th numbers will equal 5237 and 2537 correspondingly (they will be maximum and minimum for such order of digits).
In the second sample, if we swap the second digits and the first ones, we get integers 100, 99 and 102.
| 1,000
|
[
{
"input": "6 4\n5237\n2753\n7523\n5723\n5327\n2537",
"output": "2700"
},
{
"input": "3 3\n010\n909\n012",
"output": "3"
},
{
"input": "7 5\n50808\n36603\n37198\n44911\n29994\n42543\n50156",
"output": "20522"
},
{
"input": "5 5\n61374\n74304\n41924\n46010\n09118",
"output": "64592"
},
{
"input": "8 8\n68785928\n11981277\n32480720\n72495162\n69969623\n42118868\n64235849\n81412116",
"output": "52901157"
},
{
"input": "7 1\n1\n0\n8\n5\n4\n9\n8",
"output": "9"
},
{
"input": "3 8\n34848224\n16307102\n25181102",
"output": "8612277"
},
{
"input": "2 8\n13633861\n68468345",
"output": "14445725"
},
{
"input": "4 4\n0950\n0634\n9264\n8684",
"output": "3738"
},
{
"input": "6 5\n65777\n80932\n32260\n49089\n00936\n85557",
"output": "41439"
},
{
"input": "5 6\n687443\n279213\n765651\n611680\n500192",
"output": "258067"
},
{
"input": "8 6\n034753\n917195\n222679\n778596\n980006\n467267\n482763\n807481",
"output": "647026"
},
{
"input": "8 6\n075967\n240855\n352399\n791547\n103244\n982259\n409866\n926586",
"output": "491255"
},
{
"input": "3 1\n7\n2\n9",
"output": "7"
},
{
"input": "6 4\n5407\n4617\n3050\n7647\n8647\n1993",
"output": "6474"
},
{
"input": "8 5\n47553\n55138\n81768\n78902\n50691\n73010\n93969\n01675",
"output": "71123"
},
{
"input": "8 7\n5945843\n9094433\n0750024\n6255984\n1784849\n7275947\n6513944\n0145523",
"output": "5152379"
},
{
"input": "8 7\n8112819\n8982110\n5457941\n4575033\n5203331\n7410823\n0532182\n8151054",
"output": "6194602"
},
{
"input": "8 8\n63315032\n20587190\n05461152\n76872565\n71177578\n53541174\n00451913\n85740357",
"output": "60622457"
},
{
"input": "2 3\n135\n725",
"output": "4"
},
{
"input": "7 1\n9\n5\n8\n9\n7\n6\n9",
"output": "4"
},
{
"input": "5 3\n560\n978\n543\n846\n714",
"output": "435"
},
{
"input": "7 2\n53\n74\n84\n62\n14\n77\n59",
"output": "69"
},
{
"input": "3 4\n0537\n2174\n5299",
"output": "3583"
},
{
"input": "7 5\n13532\n16394\n97663\n73133\n22712\n58185\n65035",
"output": "26455"
},
{
"input": "8 5\n07936\n07927\n46068\n99158\n90958\n41283\n59266\n87841",
"output": "52364"
},
{
"input": "8 6\n867468\n695388\n700723\n444270\n545657\n178053\n315040\n554471",
"output": "559559"
},
{
"input": "7 7\n6575460\n6965366\n1912357\n7080608\n2561692\n5209630\n0439095",
"output": "5917123"
},
{
"input": "1 2\n96",
"output": "0"
},
{
"input": "1 3\n289",
"output": "0"
},
{
"input": "1 8\n78795220",
"output": "0"
},
{
"input": "8 7\n2407792\n7023368\n2609925\n0587109\n3543873\n6602371\n4579875\n9893509",
"output": "6790457"
},
{
"input": "4 6\n065169\n150326\n924608\n490012",
"output": "488134"
},
{
"input": "4 4\n8851\n6190\n0521\n1659",
"output": "6596"
},
{
"input": "4 4\n4381\n3147\n7017\n5593",
"output": "3690"
},
{
"input": "8 4\n0344\n9196\n1379\n5470\n0989\n8316\n7096\n7918",
"output": "7801"
},
{
"input": "1 6\n430254",
"output": "0"
},
{
"input": "8 1\n4\n0\n8\n5\n9\n0\n4\n7",
"output": "9"
},
{
"input": "5 2\n60\n08\n77\n66\n03",
"output": "74"
},
{
"input": "3 1\n9\n8\n2",
"output": "7"
},
{
"input": "7 2\n89\n00\n59\n90\n99\n22\n55",
"output": "99"
},
{
"input": "2 4\n7694\n6577",
"output": "712"
},
{
"input": "8 8\n68785928\n11981277\n32480720\n72495162\n69969623\n42118868\n64235849\n81412116",
"output": "52901157"
},
{
"input": "2 7\n9183508\n9276377",
"output": "26912"
},
{
"input": "5 4\n7411\n3080\n9578\n5902\n3225",
"output": "6498"
},
{
"input": "3 4\n0136\n4556\n4268",
"output": "2134"
},
{
"input": "6 8\n99358096\n38390629\n71597322\n35940809\n48949759\n66204248",
"output": "53570178"
},
{
"input": "7 2\n23\n11\n88\n25\n22\n45\n10",
"output": "78"
},
{
"input": "2 3\n834\n630",
"output": "24"
},
{
"input": "4 2\n87\n03\n95\n23",
"output": "48"
},
{
"input": "2 8\n10715643\n97664296",
"output": "1244714"
},
{
"input": "6 1\n9\n3\n1\n3\n4\n5",
"output": "8"
},
{
"input": "8 5\n47553\n55138\n81768\n78902\n50691\n73010\n93969\n01675",
"output": "71123"
},
{
"input": "4 4\n7603\n0859\n5241\n7680",
"output": "5518"
},
{
"input": "1 7\n4605461",
"output": "0"
},
{
"input": "3 4\n3061\n3404\n6670",
"output": "2916"
},
{
"input": "8 4\n1847\n0962\n3216\n0772\n6399\n3082\n7997\n0625",
"output": "7246"
},
{
"input": "2 6\n834527\n764560",
"output": "577"
},
{
"input": "5 6\n959808\n303464\n414335\n758650\n828038",
"output": "486245"
},
{
"input": "4 1\n0\n7\n5\n1",
"output": "7"
},
{
"input": "6 7\n4565736\n9842969\n1412800\n6411011\n5744909\n3791659",
"output": "4066781"
},
{
"input": "4 1\n0\n7\n5\n1",
"output": "7"
},
{
"input": "1 3\n250",
"output": "0"
},
{
"input": "2 1\n2\n0",
"output": "2"
},
{
"input": "8 8\n96805230\n73119021\n06552907\n86283347\n88650846\n19155689\n37032451\n19310120",
"output": "53604668"
},
{
"input": "3 2\n64\n94\n65",
"output": "10"
},
{
"input": "8 4\n8008\n4983\n0295\n0353\n5838\n1960\n0270\n7144",
"output": "7475"
},
{
"input": "4 8\n22025344\n54085308\n77633421\n59238322",
"output": "7681556"
},
{
"input": "5 3\n504\n878\n599\n683\n083",
"output": "615"
},
{
"input": "5 4\n7663\n4755\n2941\n4588\n0232",
"output": "5346"
},
{
"input": "6 2\n97\n57\n40\n99\n22\n94",
"output": "77"
},
{
"input": "6 7\n4104025\n1370353\n3472874\n5258456\n5595923\n0279404",
"output": "2790148"
},
{
"input": "8 2\n42\n86\n25\n30\n27\n64\n67\n38",
"output": "61"
},
{
"input": "5 2\n52\n22\n05\n37\n74",
"output": "51"
},
{
"input": "2 2\n63\n50",
"output": "13"
},
{
"input": "6 7\n4104025\n1370353\n3472874\n5258456\n5595923\n0279404",
"output": "2790148"
},
{
"input": "6 2\n95\n56\n06\n46\n77\n51",
"output": "62"
},
{
"input": "3 5\n97424\n96460\n47766",
"output": "9536"
},
{
"input": "2 3\n596\n246",
"output": "35"
},
{
"input": "3 1\n1\n2\n2",
"output": "1"
},
{
"input": "4 2\n87\n03\n95\n23",
"output": "48"
},
{
"input": "7 5\n41078\n41257\n35324\n70082\n66783\n99954\n85784",
"output": "56901"
},
{
"input": "8 7\n8943041\n2427704\n3775080\n2956111\n1345704\n0937172\n1979973\n7081540",
"output": "3544246"
},
{
"input": "6 6\n505845\n903151\n055779\n733849\n508266\n029177",
"output": "249045"
},
{
"input": "4 4\n1871\n9417\n7444\n4294",
"output": "5368"
},
{
"input": "2 5\n60106\n07866",
"output": "5224"
},
{
"input": "3 3\n195\n860\n567",
"output": "258"
},
{
"input": "8 5\n68186\n57779\n78079\n47451\n69788\n82172\n75373\n50157",
"output": "32237"
},
{
"input": "4 7\n5342341\n5194611\n4032103\n8739798",
"output": "4056779"
},
{
"input": "4 8\n91401735\n53979237\n20857777\n94594293",
"output": "34567247"
},
{
"input": "1 2\n95",
"output": "0"
},
{
"input": "6 4\n0443\n7108\n7211\n4287\n6439\n7711",
"output": "5301"
},
{
"input": "6 7\n5794383\n4078451\n0263676\n7682294\n7436158\n3363189",
"output": "3560125"
},
{
"input": "2 5\n07259\n51985",
"output": "23657"
},
{
"input": "3 3\n624\n125\n097",
"output": "247"
},
{
"input": "8 1\n9\n7\n6\n2\n9\n6\n4\n8",
"output": "7"
},
{
"input": "6 3\n530\n862\n874\n932\n972\n157",
"output": "442"
},
{
"input": "3 2\n51\n39\n97",
"output": "58"
},
{
"input": "8 4\n4650\n1735\n4269\n8023\n0948\n9685\n3675\n6017",
"output": "6836"
},
{
"input": "5 3\n168\n513\n110\n386\n501",
"output": "403"
},
{
"input": "6 2\n01\n81\n60\n27\n23\n67",
"output": "70"
},
{
"input": "4 4\n2759\n7250\n3572\n8067",
"output": "2028"
},
{
"input": "8 5\n12658\n00588\n23491\n09985\n63973\n78517\n98187\n29863",
"output": "68592"
},
{
"input": "3 1\n5\n4\n2",
"output": "3"
},
{
"input": "7 8\n24925537\n07626274\n77060131\n82415056\n70422753\n60455207\n32176884",
"output": "54680138"
},
{
"input": "5 8\n94157433\n85577189\n62547277\n11815893\n35445851",
"output": "15679126"
},
{
"input": "5 5\n31164\n27213\n17981\n48806\n01273",
"output": "33367"
},
{
"input": "3 6\n743197\n172242\n635654",
"output": "261245"
},
{
"input": "4 6\n760130\n653002\n902824\n380915",
"output": "268111"
},
{
"input": "8 8\n83239439\n62184887\n58968944\n39808261\n68740623\n38480328\n81965504\n52600488",
"output": "44481119"
},
{
"input": "8 2\n99\n20\n22\n39\n33\n60\n54\n08",
"output": "91"
},
{
"input": "1 7\n3545113",
"output": "0"
},
{
"input": "6 7\n3761949\n8095136\n4875085\n5017784\n4459097\n4354762",
"output": "4126934"
},
{
"input": "6 8\n50157346\n63836375\n03176371\n83637145\n28631038\n18617159",
"output": "24702445"
},
{
"input": "1 5\n84932",
"output": "0"
},
{
"input": "4 3\n204\n515\n280\n840",
"output": "467"
},
{
"input": "8 2\n40\n41\n02\n55\n26\n52\n60\n25",
"output": "58"
},
{
"input": "2 5\n90526\n32565",
"output": "586"
},
{
"input": "4 4\n3058\n2370\n0288\n5983",
"output": "2972"
},
{
"input": "6 7\n9085507\n7716507\n1952887\n6569746\n1900754\n9212439",
"output": "3180457"
},
{
"input": "5 2\n01\n07\n63\n71\n99",
"output": "89"
},
{
"input": "6 4\n4505\n3672\n4248\n2783\n9780\n6579",
"output": "4484"
},
{
"input": "2 3\n281\n498",
"output": "127"
},
{
"input": "8 5\n16966\n36762\n49579\n71703\n66646\n41125\n94022\n26623",
"output": "66868"
},
{
"input": "1 6\n170086",
"output": "0"
},
{
"input": "4 1\n4\n2\n2\n2",
"output": "2"
},
{
"input": "3 8\n12418144\n74773130\n10504811",
"output": "22901234"
},
{
"input": "6 7\n3761949\n8095136\n4875085\n5017784\n4459097\n4354762",
"output": "4126934"
}
] | 1,690,461,455
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 1
| 122
| 2,867,200
|
def permute(vis,ds):
if len(ds)==k:
result.append(ds[:])
else:
for i in nums:
if (not vis[i]):
ds.append(i)
vis[i]=True
permute(vis,ds)
vis[i]=False
ds.pop()
n,k = list(map(int,input().split()))
nums = []
result = []
for i in range(k):
nums.append(i)
val = []
for i in range(n):
x = input()
val.append(x)
vis = [False]*n
permute(vis,ds=[])
ans = float('inf')
for i in result:
m = 0; mi = float('inf')
for j in val:
num = j[i[0]]+j[i[1]]+j[i[2]]+j[i[3]]
m = max(m,int(num))
mi = min(mi,int(num))
ans = min(ans,m-mi)
print(ans)
|
Title: Permutations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given *n* *k*-digit integers. You have to rearrange the digits in the integers so that the difference between the largest and the smallest number was minimum. Digits should be rearranged by the same rule in all integers.
Input Specification:
The first line contains integers *n* and *k* — the number and digit capacity of numbers correspondingly (1<=≤<=*n*,<=*k*<=≤<=8). Next *n* lines contain *k*-digit positive integers. Leading zeroes are allowed both in the initial integers and the integers resulting from the rearranging of digits.
Output Specification:
Print a single number: the minimally possible difference between the largest and the smallest number after the digits are rearranged in all integers by the same rule.
Demo Input:
['6 4\n5237\n2753\n7523\n5723\n5327\n2537\n', '3 3\n010\n909\n012\n', '7 5\n50808\n36603\n37198\n44911\n29994\n42543\n50156\n']
Demo Output:
['2700\n', '3\n', '20522\n']
Note:
In the first sample, if we rearrange the digits in numbers as (3,1,4,2), then the 2-nd and the 4-th numbers will equal 5237 and 2537 correspondingly (they will be maximum and minimum for such order of digits).
In the second sample, if we swap the second digits and the first ones, we get integers 100, 99 and 102.
|
```python
def permute(vis,ds):
if len(ds)==k:
result.append(ds[:])
else:
for i in nums:
if (not vis[i]):
ds.append(i)
vis[i]=True
permute(vis,ds)
vis[i]=False
ds.pop()
n,k = list(map(int,input().split()))
nums = []
result = []
for i in range(k):
nums.append(i)
val = []
for i in range(n):
x = input()
val.append(x)
vis = [False]*n
permute(vis,ds=[])
ans = float('inf')
for i in result:
m = 0; mi = float('inf')
for j in val:
num = j[i[0]]+j[i[1]]+j[i[2]]+j[i[3]]
m = max(m,int(num))
mi = min(mi,int(num))
ans = min(ans,m-mi)
print(ans)
```
| -1
|
|
704
|
B
|
Ant Man
|
PROGRAMMING
| 2,500
|
[
"dp",
"graphs",
"greedy"
] | null | null |
Scott Lang is at war with Darren Cross. There are *n* chairs in a hall where they are, numbered with 1,<=2,<=...,<=*n* from left to right. The *i*-th chair is located at coordinate *x**i*. Scott is on chair number *s* and Cross is on chair number *e*. Scott can jump to all other chairs (not only neighboring chairs). He wants to start at his position (chair number *s*), visit each chair exactly once and end up on chair number *e* with Cross.
As we all know, Scott can shrink or grow big (grow big only to his normal size), so at any moment of time he can be either small or large (normal). The thing is, he can only shrink or grow big while being on a chair (not in the air while jumping to another chair). Jumping takes time, but shrinking and growing big takes no time. Jumping from chair number *i* to chair number *j* takes |*x**i*<=-<=*x**j*| seconds. Also, jumping off a chair and landing on a chair takes extra amount of time.
If Scott wants to jump to a chair on his left, he can only be small, and if he wants to jump to a chair on his right he should be large.
Jumping off the *i*-th chair takes:
- *c**i* extra seconds if he's small. - *d**i* extra seconds otherwise (he's large).
Also, landing on *i*-th chair takes:
- *b**i* extra seconds if he's small. - *a**i* extra seconds otherwise (he's large).
In simpler words, jumping from *i*-th chair to *j*-th chair takes exactly:
- |*x**i*<=-<=*x**j*|<=+<=*c**i*<=+<=*b**j* seconds if *j*<=<<=*i*. - |*x**i*<=-<=*x**j*|<=+<=*d**i*<=+<=*a**j* seconds otherwise (*j*<=><=*i*).
Given values of *x*, *a*, *b*, *c*, *d* find the minimum time Scott can get to Cross, assuming he wants to visit each chair exactly once.
|
The first line of the input contains three integers *n*,<=*s* and *e* (2<=≤<=*n*<=≤<=5000,<=1<=≤<=*s*,<=*e*<=≤<=*n*,<=*s*<=≠<=*e*) — the total number of chairs, starting and ending positions of Scott.
The second line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x*1<=<<=*x*2<=<<=...<=<<=*x**n*<=≤<=109).
The third line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1,<=*a*2,<=...,<=*a**n*<=≤<=109).
The fourth line contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b*1,<=*b*2,<=...,<=*b**n*<=≤<=109).
The fifth line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c*1,<=*c*2,<=...,<=*c**n*<=≤<=109).
The sixth line contains *n* integers *d*1,<=*d*2,<=...,<=*d**n* (1<=≤<=*d*1,<=*d*2,<=...,<=*d**n*<=≤<=109).
|
Print the minimum amount of time Scott needs to get to the Cross while visiting each chair exactly once.
|
[
"7 4 3\n8 11 12 16 17 18 20\n17 16 20 2 20 5 13\n17 8 8 16 12 15 13\n12 4 16 4 15 7 6\n8 14 2 11 17 12 8\n"
] |
[
"139\n"
] |
In the sample testcase, an optimal solution would be <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/5bbd3e094ffa5a72e263dfaec7aeaff795bc22a3.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Spent time would be 17 + 24 + 23 + 20 + 33 + 22 = 139.
| 1,250
|
[
{
"input": "7 4 3\n8 11 12 16 17 18 20\n17 16 20 2 20 5 13\n17 8 8 16 12 15 13\n12 4 16 4 15 7 6\n8 14 2 11 17 12 8",
"output": "139"
},
{
"input": "2 1 2\n75475634 804928248\n476927808 284875072\n503158867 627937890\n322595515 786026685\n645468307 669240390",
"output": "1659795993"
},
{
"input": "2 2 1\n396750123 498712414\n41068575 397815498\n975619613 324859334\n264886117 99828622\n52238294 539721972",
"output": "1177410526"
},
{
"input": "3 2 1\n374288891 535590429 751244358\n124321145 232930851 266089174\n543529670 773363571 319728747\n580543238 582720391 468188689\n490702144 598813561 138628383",
"output": "2469230490"
},
{
"input": "5 4 1\n291882089 358502890 412106895 564718673 837699009\n657489855 690430685 632939232 373282330 398630021\n753287868 667584659 79866982 603966291 850348020\n738379364 480642952 593942770 930919906 485781288\n903492853 141752547 984789430 897217447 909607734",
"output": "5175751243"
},
{
"input": "10 8 1\n71550121 96204862 223219513 312183499 402690754 446173607 668171337 796619138 799843967 983359971\n905549873 673542337 566661387 879397647 434495917 631413076 150918417 579868000 224422012 126195703\n525305826 535526356 404334728 653535984 998133227 879226371 59632864 356493387 62611196 827258251\n296576565 204244054 812713672 780267148 614679390 447700005 102067050 544546349 116002772 761999375\n546951131 622980885 937972790 529946158 992070269 723690994 343766215 374461155 343698323 996408310",
"output": "8924243769"
},
{
"input": "8 3 1\n58265855 250839457 317463343 432130709 479851779 538085060 652509537 687041819\n126496650 186774359 331193631 836310042 255380788 756411639 690869710 176576709\n222368048 906033133 8623893 807375696 461796409 362923880 194114590 733391789\n137574156 670510137 237249112 673135534 595041001 875171159 112263159 649035661\n806391318 956639323 312576627 140089445 824235612 590430725 170794245 24820918",
"output": "7373256613"
},
{
"input": "2 1 2\n445124518 897457879\n106020849 17627833\n993819963 891100983\n222379086 338599698\n19224513 39444281",
"output": "489185707"
},
{
"input": "3 1 3\n140847557 466570047 534914399\n93013372 106184897 87868332\n798881865 348785541 412639907\n541420868 474507814 209232335\n35025208 96472847 130874791",
"output": "719618126"
},
{
"input": "2 2 1\n30771656 606524344\n997641489 998433881\n28784768 365665640\n391019116 560756524\n999852227 998301460",
"output": "1165293980"
},
{
"input": "3 3 1\n101399784 425546473 843762421\n567904823 879017062 918453203\n254552488 116158914 179175464\n273461838 396254505 362710994\n886094289 597198515 822610701",
"output": "1872039538"
},
{
"input": "2 1 2\n1 2\n1 1\n1 1\n1 1\n1 1",
"output": "3"
},
{
"input": "2 2 1\n1 2\n1 1\n1 1\n1 1\n1 1",
"output": "3"
},
{
"input": "2 1 2\n1 1000000000\n1000000000 1\n1 1\n1 1\n1 1000000000",
"output": "1000000001"
},
{
"input": "2 2 1\n1 1000000000\n1 1\n1000000000 1\n1 1000000000\n1 1",
"output": "2999999999"
},
{
"input": "3 1 2\n1 2 3\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "7"
},
{
"input": "3 3 2\n1 2 3\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "7"
},
{
"input": "3 1 3\n1 2 3\n1000000000 1000000000 1000000000\n1000000000 1000000000 1000000000\n1000000000 1000000000 1000000000\n1000000000 1000000000 1000000000",
"output": "4000000002"
},
{
"input": "2 1 2\n511643468 985543586\n1000000000 1\n1 1000000000\n1000000000 1\n1 1000000000",
"output": "473900120"
},
{
"input": "2 2 1\n326677749 688620949\n1000000000 1\n1 1000000000\n1000000000 1\n1 1000000000",
"output": "361943202"
}
] | 1,688,098,875
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 1
| 46
| 512,000
|
import sys,math
from bisect import bisect_left , bisect_right
def rd(): return sys.stdin.readline().strip()
def rdl(typ,sep=" "): return list(map(typ, rd().split(sep)))
def wt(x,sep="\n") : sys.stdout.write(str(x) + sep) # string / num
def wtBoolUp(x): wt("YES" if x==True else "NO") # True = YES/ False =NO
def wtBoolLow(x): wt("Yes" if x==True else "No") # True = Yes/ False =No
def wtlArr(arr,sep=" "): sys.stdout.write(sep.join(map(str,arr)) + "\n") if arr else None # Print arr in single line
def wtlsArr(arr): sys.stdout.write("\n".join(map(str,arr)) + "\n") if arr else None # Print arr in mult lines
def wtlsArrArr(arr): # print Arrays in multiple lines
for a in arr: wtlArr(a)
# for dfs use this and use 'yield' during dfs and at last
from types import GeneratorType
def bootstrap(f, stack=[]):
def wrappedfunc(*args, **kwargs):
if stack:
return f(*args, **kwargs)
else:
to = f(*args, **kwargs)
while True:
if type(to) is GeneratorType:
stack.append(to)
to = next(to)
else:
stack.pop()
if not stack:
break
to = stack[-1].send(to)
return to
return wrappedfunc
# >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
INF = float("inf")
mod = 10**9 + 7
def binPow(a,b,mod) :
res = 1
while b :
if b % 2:
res = res * a % mod
a = a * a % mod
b //= 2
return res
def invMod(x,mod): return pow(x,mod-2,mod)
def getFacts(n,mod): # O(n)
fact = [1]*(n+1)
for i in range(2,n+1): fact[i] = (i*fact[i-1])%mod
return fact
def nCr(n, r, fact, mod) : # O(logMOD)
num = fact[n] # numerator
den = (fact[r] * fact[n - r]) % mod # denominator
return (num * invMod(den, mod)) % mod
def lcm(num1,num2):
hcf = math.gcd(num1,num2)
lcm_ = (num1*num2)//hcf
return lcm_
def sqrtFloat(num): # req : https://codeforces.com/contest/1809/problem/B
l, r = 0 , num
res = 0
while l <= r :
mid = (l+r)//2
if mid*mid <= num :
res = mid
l = mid + 1
else : #number will be on l side
r = mid-1
return res + 0.1*(res*res != num)
def prefixSum(arr): # 0 at last of prefix sum
pref = [0]*(len(arr)+1)
for i in range(len(arr)): pref[i] = arr[i] + pref[i-1]
return pref
def prefixXor(arr): # 0 at last of prefix Xor
pref = [0]*(len(arr)+1)
for i in range(len(arr)): pref[i] = arr[i] ^ pref[i-1]
return pref
def apSum(n): return n*(n+1)//2 # [1,n]
def apSumRange(l,r) : return apSum(r)-apSum(l-1) # [l,r]
def hypot(p1,p2):
return ((p2[0]-p1[0])**2 + (p2[1]-p1[1])**2)**0.5
def manhat(p1,p2):
return abs(p2[0]-p1[0]) + abs(p2[1]-p1[1])
def comb(n,r): # for small x otherwise TC higher
res = 1
for i in range(r) : res = res*(n-i)//(i+1) # res*(n-i) % (i+1) == 0 always
return res
def powerArr(base,n,mod):
pwr = [1]*n
for i in range(1,n):
pwr[i] = (base*pwr[i-1]) % mod
return pwr
def getClosest(num,sortArr,notTake=-INF,notTakeCnt=1):
idx = bisect_left(sortArr,num) # find closest to x , not take notTake
closeArr = []
for i in range(max(0,idx-2),min(len(sortArr),idx+3)) : # [idx-2,idx-1,idx,idx+1,idx+2]
if notTakeCnt>0 and sortArr[i] == notTake:
notTakeCnt -= 1
continue
closeArr.append(sortArr[i])
return min(closeArr, key=lambda x:abs(x-num),default=-INF)
def group(arr, notTake=INF): # grouping of similar elements
n = len(arr)
res = []
i = 0
while i < n:
st = i
while i+1 <n and arr[i] == arr[i+1] :
i += 1
if arr[st] != notTake:
res.append([arr[st],st,i,i-st+1])
i += 1
return res
def dirnsRD() : return [(0,1),(1,0)]
def dirnsLU() : return [(0,-1),(-1,0)]
def dirns(): return dirnsRD() + dirnsLU()
def dirnsDiag(): return dirns() + [(1,1),(1,-1),(-1,1),(-1,-1)]
def chessDirns(): return [(-2,-1),(-1,-2),(1,-2),(2,-1),(2,1),(1,2),(-1,2),(-2,1)]
def cntBits(n): return bin(n).count("1")
def isRepSumP2(num, x): return cntBits(num) <= x <= num # num in sum two's power in x moves ?
def binry(decimal): return bin(decimal).replace('0b', '')
def deciml(binary): return int(str(binary),2)
def printAllBin(arr):
maxLen = len(binry(max(arr)))
for x in arr:
curr = binry(x)
res = " ".join(list("0"*(maxLen-len(curr))+curr))
wt( res + f" <- {x}")
def c2i(ch,up=0): return ord(ch) - ord('A' if up else 'a') # ch to integer
def i2c(n,up=0): return chr(ord('A' if up else 'a') + n) # integer to ch
def setPrec(num, cnt): return round(num, cnt)
def flush(): sys.stdout.flush()
def clearCache(func): func.cache_clear() # used to clear the lru cache for every new test case
# >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
''' ॐॐ _/\_ हर हर महादेव _/\_ ॐॐ '''
# sys.setrecursionlimit(300_005)
# mod = 10**9 + 7
## Landing off (curr i->j) :
# -xi + di if j>i (neigh bigger) else xi + ci
# Landing to (i -> j curr) :
# -xi + bi if j<i (neigh bigger) else xi + ai
# Similar to : https://oj.uz/submission/768389
# https://codeforces.com/blog/entry/92602?#comment-813699
def solve():
n,s,e = rdl(int)
X = rdl(int)
A = rdl(int)
B = rdl(int)
C = rdl(int)
D = rdl(int)
## -----------------------------------------
dp = [[INF]*(n+10) for _ in range(n+10)]
dp[0][0] = 0 # initially no component and let i = 0
for i in range(n):
for comp in range(i+1):
if i+1 == s:
# Create new Component at leftMost , landing off, neigh will bigger
dp[i+1][comp+1] = min(dp[i+1][comp+1], dp[i][comp] - X[i] + D[i] )
# Merge with components (leftMost start), landing off, neigh is smaller
dp[i+1][comp] = min(dp[i+1][comp], dp[i][comp] + X[i] + C[i] )
# Merge two components not allowed since want at first
continue
if i+1 == e:
# Create new Component at rightMost, landing to , neigh will bigger
dp[i+1][comp+1] = min(dp[i+1][comp+1], dp[i][comp] - X[i] + B[i] )
# Merge with components (rightMost end), landing to , neigh is smaller
dp[i+1][comp] = min(dp[i+1][comp], dp[i][comp] + X[i] + A[i] )
# Merge two components not allowed since want at last
continue
# Create new Component from here neigh will bigger , land to & off
places = comp - (i+1 >s) - (i+1 >e)
if places >=0 :
dp[i+1][comp+1] = min(dp[i+1][comp+1], dp[i][comp] - 2*X[i] + D[i] + B[i] )
## Merge with components
# AT start, i(curr) -> j and i->j(curr) and j<i
places = comp - (i+1 >s)
if places>0:
dp[i+1][comp] = min(dp[i+1][comp], dp[i][comp] + C[i]+B[i] )
# AT end i(curr) -> j and i->j(curr) and j>i
places = comp - (i+1 >e)
if places>0:
dp[i+1][comp] = min(dp[i+1][comp], dp[i][comp] + A[i]+D[i] )
# Merge two components, neigh is smaller, land to & off
dp[i+1][comp-1] = min(dp[i+1][comp-1], dp[i][comp] + 2*X[i] + A[i] + C[i])
return dp[n][1]
# Don't forget the mod and recursion limit
wt(solve())
|
Title: Ant Man
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Scott Lang is at war with Darren Cross. There are *n* chairs in a hall where they are, numbered with 1,<=2,<=...,<=*n* from left to right. The *i*-th chair is located at coordinate *x**i*. Scott is on chair number *s* and Cross is on chair number *e*. Scott can jump to all other chairs (not only neighboring chairs). He wants to start at his position (chair number *s*), visit each chair exactly once and end up on chair number *e* with Cross.
As we all know, Scott can shrink or grow big (grow big only to his normal size), so at any moment of time he can be either small or large (normal). The thing is, he can only shrink or grow big while being on a chair (not in the air while jumping to another chair). Jumping takes time, but shrinking and growing big takes no time. Jumping from chair number *i* to chair number *j* takes |*x**i*<=-<=*x**j*| seconds. Also, jumping off a chair and landing on a chair takes extra amount of time.
If Scott wants to jump to a chair on his left, he can only be small, and if he wants to jump to a chair on his right he should be large.
Jumping off the *i*-th chair takes:
- *c**i* extra seconds if he's small. - *d**i* extra seconds otherwise (he's large).
Also, landing on *i*-th chair takes:
- *b**i* extra seconds if he's small. - *a**i* extra seconds otherwise (he's large).
In simpler words, jumping from *i*-th chair to *j*-th chair takes exactly:
- |*x**i*<=-<=*x**j*|<=+<=*c**i*<=+<=*b**j* seconds if *j*<=<<=*i*. - |*x**i*<=-<=*x**j*|<=+<=*d**i*<=+<=*a**j* seconds otherwise (*j*<=><=*i*).
Given values of *x*, *a*, *b*, *c*, *d* find the minimum time Scott can get to Cross, assuming he wants to visit each chair exactly once.
Input Specification:
The first line of the input contains three integers *n*,<=*s* and *e* (2<=≤<=*n*<=≤<=5000,<=1<=≤<=*s*,<=*e*<=≤<=*n*,<=*s*<=≠<=*e*) — the total number of chairs, starting and ending positions of Scott.
The second line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x*1<=<<=*x*2<=<<=...<=<<=*x**n*<=≤<=109).
The third line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1,<=*a*2,<=...,<=*a**n*<=≤<=109).
The fourth line contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b*1,<=*b*2,<=...,<=*b**n*<=≤<=109).
The fifth line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c*1,<=*c*2,<=...,<=*c**n*<=≤<=109).
The sixth line contains *n* integers *d*1,<=*d*2,<=...,<=*d**n* (1<=≤<=*d*1,<=*d*2,<=...,<=*d**n*<=≤<=109).
Output Specification:
Print the minimum amount of time Scott needs to get to the Cross while visiting each chair exactly once.
Demo Input:
['7 4 3\n8 11 12 16 17 18 20\n17 16 20 2 20 5 13\n17 8 8 16 12 15 13\n12 4 16 4 15 7 6\n8 14 2 11 17 12 8\n']
Demo Output:
['139\n']
Note:
In the sample testcase, an optimal solution would be <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/5bbd3e094ffa5a72e263dfaec7aeaff795bc22a3.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Spent time would be 17 + 24 + 23 + 20 + 33 + 22 = 139.
|
```python
import sys,math
from bisect import bisect_left , bisect_right
def rd(): return sys.stdin.readline().strip()
def rdl(typ,sep=" "): return list(map(typ, rd().split(sep)))
def wt(x,sep="\n") : sys.stdout.write(str(x) + sep) # string / num
def wtBoolUp(x): wt("YES" if x==True else "NO") # True = YES/ False =NO
def wtBoolLow(x): wt("Yes" if x==True else "No") # True = Yes/ False =No
def wtlArr(arr,sep=" "): sys.stdout.write(sep.join(map(str,arr)) + "\n") if arr else None # Print arr in single line
def wtlsArr(arr): sys.stdout.write("\n".join(map(str,arr)) + "\n") if arr else None # Print arr in mult lines
def wtlsArrArr(arr): # print Arrays in multiple lines
for a in arr: wtlArr(a)
# for dfs use this and use 'yield' during dfs and at last
from types import GeneratorType
def bootstrap(f, stack=[]):
def wrappedfunc(*args, **kwargs):
if stack:
return f(*args, **kwargs)
else:
to = f(*args, **kwargs)
while True:
if type(to) is GeneratorType:
stack.append(to)
to = next(to)
else:
stack.pop()
if not stack:
break
to = stack[-1].send(to)
return to
return wrappedfunc
# >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
INF = float("inf")
mod = 10**9 + 7
def binPow(a,b,mod) :
res = 1
while b :
if b % 2:
res = res * a % mod
a = a * a % mod
b //= 2
return res
def invMod(x,mod): return pow(x,mod-2,mod)
def getFacts(n,mod): # O(n)
fact = [1]*(n+1)
for i in range(2,n+1): fact[i] = (i*fact[i-1])%mod
return fact
def nCr(n, r, fact, mod) : # O(logMOD)
num = fact[n] # numerator
den = (fact[r] * fact[n - r]) % mod # denominator
return (num * invMod(den, mod)) % mod
def lcm(num1,num2):
hcf = math.gcd(num1,num2)
lcm_ = (num1*num2)//hcf
return lcm_
def sqrtFloat(num): # req : https://codeforces.com/contest/1809/problem/B
l, r = 0 , num
res = 0
while l <= r :
mid = (l+r)//2
if mid*mid <= num :
res = mid
l = mid + 1
else : #number will be on l side
r = mid-1
return res + 0.1*(res*res != num)
def prefixSum(arr): # 0 at last of prefix sum
pref = [0]*(len(arr)+1)
for i in range(len(arr)): pref[i] = arr[i] + pref[i-1]
return pref
def prefixXor(arr): # 0 at last of prefix Xor
pref = [0]*(len(arr)+1)
for i in range(len(arr)): pref[i] = arr[i] ^ pref[i-1]
return pref
def apSum(n): return n*(n+1)//2 # [1,n]
def apSumRange(l,r) : return apSum(r)-apSum(l-1) # [l,r]
def hypot(p1,p2):
return ((p2[0]-p1[0])**2 + (p2[1]-p1[1])**2)**0.5
def manhat(p1,p2):
return abs(p2[0]-p1[0]) + abs(p2[1]-p1[1])
def comb(n,r): # for small x otherwise TC higher
res = 1
for i in range(r) : res = res*(n-i)//(i+1) # res*(n-i) % (i+1) == 0 always
return res
def powerArr(base,n,mod):
pwr = [1]*n
for i in range(1,n):
pwr[i] = (base*pwr[i-1]) % mod
return pwr
def getClosest(num,sortArr,notTake=-INF,notTakeCnt=1):
idx = bisect_left(sortArr,num) # find closest to x , not take notTake
closeArr = []
for i in range(max(0,idx-2),min(len(sortArr),idx+3)) : # [idx-2,idx-1,idx,idx+1,idx+2]
if notTakeCnt>0 and sortArr[i] == notTake:
notTakeCnt -= 1
continue
closeArr.append(sortArr[i])
return min(closeArr, key=lambda x:abs(x-num),default=-INF)
def group(arr, notTake=INF): # grouping of similar elements
n = len(arr)
res = []
i = 0
while i < n:
st = i
while i+1 <n and arr[i] == arr[i+1] :
i += 1
if arr[st] != notTake:
res.append([arr[st],st,i,i-st+1])
i += 1
return res
def dirnsRD() : return [(0,1),(1,0)]
def dirnsLU() : return [(0,-1),(-1,0)]
def dirns(): return dirnsRD() + dirnsLU()
def dirnsDiag(): return dirns() + [(1,1),(1,-1),(-1,1),(-1,-1)]
def chessDirns(): return [(-2,-1),(-1,-2),(1,-2),(2,-1),(2,1),(1,2),(-1,2),(-2,1)]
def cntBits(n): return bin(n).count("1")
def isRepSumP2(num, x): return cntBits(num) <= x <= num # num in sum two's power in x moves ?
def binry(decimal): return bin(decimal).replace('0b', '')
def deciml(binary): return int(str(binary),2)
def printAllBin(arr):
maxLen = len(binry(max(arr)))
for x in arr:
curr = binry(x)
res = " ".join(list("0"*(maxLen-len(curr))+curr))
wt( res + f" <- {x}")
def c2i(ch,up=0): return ord(ch) - ord('A' if up else 'a') # ch to integer
def i2c(n,up=0): return chr(ord('A' if up else 'a') + n) # integer to ch
def setPrec(num, cnt): return round(num, cnt)
def flush(): sys.stdout.flush()
def clearCache(func): func.cache_clear() # used to clear the lru cache for every new test case
# >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
''' ॐॐ _/\_ हर हर महादेव _/\_ ॐॐ '''
# sys.setrecursionlimit(300_005)
# mod = 10**9 + 7
## Landing off (curr i->j) :
# -xi + di if j>i (neigh bigger) else xi + ci
# Landing to (i -> j curr) :
# -xi + bi if j<i (neigh bigger) else xi + ai
# Similar to : https://oj.uz/submission/768389
# https://codeforces.com/blog/entry/92602?#comment-813699
def solve():
n,s,e = rdl(int)
X = rdl(int)
A = rdl(int)
B = rdl(int)
C = rdl(int)
D = rdl(int)
## -----------------------------------------
dp = [[INF]*(n+10) for _ in range(n+10)]
dp[0][0] = 0 # initially no component and let i = 0
for i in range(n):
for comp in range(i+1):
if i+1 == s:
# Create new Component at leftMost , landing off, neigh will bigger
dp[i+1][comp+1] = min(dp[i+1][comp+1], dp[i][comp] - X[i] + D[i] )
# Merge with components (leftMost start), landing off, neigh is smaller
dp[i+1][comp] = min(dp[i+1][comp], dp[i][comp] + X[i] + C[i] )
# Merge two components not allowed since want at first
continue
if i+1 == e:
# Create new Component at rightMost, landing to , neigh will bigger
dp[i+1][comp+1] = min(dp[i+1][comp+1], dp[i][comp] - X[i] + B[i] )
# Merge with components (rightMost end), landing to , neigh is smaller
dp[i+1][comp] = min(dp[i+1][comp], dp[i][comp] + X[i] + A[i] )
# Merge two components not allowed since want at last
continue
# Create new Component from here neigh will bigger , land to & off
places = comp - (i+1 >s) - (i+1 >e)
if places >=0 :
dp[i+1][comp+1] = min(dp[i+1][comp+1], dp[i][comp] - 2*X[i] + D[i] + B[i] )
## Merge with components
# AT start, i(curr) -> j and i->j(curr) and j<i
places = comp - (i+1 >s)
if places>0:
dp[i+1][comp] = min(dp[i+1][comp], dp[i][comp] + C[i]+B[i] )
# AT end i(curr) -> j and i->j(curr) and j>i
places = comp - (i+1 >e)
if places>0:
dp[i+1][comp] = min(dp[i+1][comp], dp[i][comp] + A[i]+D[i] )
# Merge two components, neigh is smaller, land to & off
dp[i+1][comp-1] = min(dp[i+1][comp-1], dp[i][comp] + 2*X[i] + A[i] + C[i])
return dp[n][1]
# Don't forget the mod and recursion limit
wt(solve())
```
| 0
|
|
523
|
A
|
Rotate, Flip and Zoom
|
PROGRAMMING
| 1,200
|
[
"*special",
"implementation"
] | null | null |
Polycarp is writing the prototype of a graphic editor. He has already made up his mind that the basic image transformations in his editor will be: rotate the image 90 degrees clockwise, flip the image horizontally (symmetry relative to the vertical line, that is, the right part of the image moves to the left, and vice versa) and zooming on the image. He is sure that that there is a large number of transformations that can be expressed through these three.
He has recently stopped implementing all three transformations for monochrome images. To test this feature, he asked you to write a code that will consecutively perform three actions with a monochrome image: first it will rotate the image 90 degrees clockwise, then it will flip the image horizontally and finally, it will zoom in twice on the image (that is, it will double all the linear sizes).
Implement this feature to help Polycarp test his editor.
|
The first line contains two integers, *w* and *h* (1<=≤<=*w*,<=*h*<=≤<=100) — the width and height of an image in pixels. The picture is given in *h* lines, each line contains *w* characters — each character encodes the color of the corresponding pixel of the image. The line consists only of characters "." and "*", as the image is monochrome.
|
Print 2*w* lines, each containing 2*h* characters — the result of consecutive implementing of the three transformations, described above.
|
[
"3 2\n.*.\n.*.\n",
"9 20\n**.......\n****.....\n******...\n*******..\n..******.\n....****.\n......***\n*.....***\n*********\n*********\n*********\n*********\n....**...\n...****..\n..******.\n.********\n****..***\n***...***\n**.....**\n*.......*\n"
] |
[
"....\n....\n****\n****\n....\n....\n",
"********......**********........********\n********......**********........********\n********........********......********..\n********........********......********..\n..********......********....********....\n..********......********....********....\n..********......********..********......\n..********......********..********......\n....********....****************........\n....********....****************........\n....********....****************........\n....********....****************........\n......******************..**********....\n......******************..**********....\n........****************....**********..\n........****************....**********..\n............************......**********\n............************......**********\n"
] |
none
| 500
|
[
{
"input": "3 2\n.*.\n.*.",
"output": "....\n....\n****\n****\n....\n...."
},
{
"input": "9 20\n**.......\n****.....\n******...\n*******..\n..******.\n....****.\n......***\n*.....***\n*********\n*********\n*********\n*********\n....**...\n...****..\n..******.\n.********\n****..***\n***...***\n**.....**\n*.......*",
"output": "********......**********........********\n********......**********........********\n********........********......********..\n********........********......********..\n..********......********....********....\n..********......********....********....\n..********......********..********......\n..********......********..********......\n....********....****************........\n....********....****************........\n....********....****************........\n....********....****************........\n......*..."
},
{
"input": "1 100\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.",
"output": "........................................................................................................................................................................................................\n........................................................................................................................................................................................................"
},
{
"input": "1 100\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*",
"output": "********************************************************************************************************************************************************************************************************\n********************************************************************************************************************************************************************************************************"
},
{
"input": "1 100\n.\n*\n.\n.\n.\n*\n.\n.\n.\n*\n*\n*\n.\n.\n.\n.\n.\n.\n*\n.\n.\n.\n*\n.\n*\n.\n.\n*\n*\n.\n*\n.\n.\n*\n.\n.\n*\n*\n.\n.\n.\n.\n.\n*\n.\n*\n.\n*\n.\n.\n.\n.\n*\n*\n*\n.\n.\n.\n.\n*\n.\n.\n*\n*\n*\n*\n.\n*\n*\n*\n*\n*\n.\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n.\n.\n*\n*\n*\n*\n*\n*\n*\n.\n.\n*\n.\n.\n*\n*\n.",
"output": "..**......**......******............**......**..**....****..**....**....****..........**..**..**........******........**....********..**********..********************....**************....**....****..\n..**......**......******............**......**..**....****..**....**....****..........**..**..**........******........**....********..**********..********************....**************....**....****.."
},
{
"input": "100 1\n****************************************************************************************************",
"output": "**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n..."
},
{
"input": "100 1\n*...***.....**.*...*.*.**.************.**..**.*..**..**.*.**...***.*...*.*..*.*.*......**..*..*...**",
"output": "**\n**\n..\n..\n..\n..\n..\n..\n**\n**\n**\n**\n**\n**\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n**\n**\n**\n**\n..\n..\n**\n**\n..\n..\n..\n..\n..\n..\n**\n**\n..\n..\n**\n**\n..\n..\n**\n**\n**\n**\n..\n..\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n..\n..\n**\n**\n**\n**\n..\n..\n..\n..\n**\n**\n**\n**\n..\n..\n**\n**\n..\n..\n..\n..\n**\n**\n**\n**\n..\n..\n..\n..\n**\n**\n**\n**\n..\n..\n**\n**\n..\n..\n**\n**\n**\n**\n..\n..\n..\n..\n..\n..\n**\n**\n..."
},
{
"input": "1 1\n.",
"output": "..\n.."
},
{
"input": "1 1\n*",
"output": "**\n**"
},
{
"input": "2 2\n.*\n*.",
"output": "..**\n..**\n**..\n**.."
},
{
"input": "1 2\n*\n.",
"output": "**..\n**.."
},
{
"input": "2 1\n*.",
"output": "**\n**\n..\n.."
}
] | 1,426,371,189
| 25,989
|
Python 3
|
OK
|
TESTS
| 24
| 62
| 102,400
|
w, h = map(int, input().split())
a = []
for i in range(h):
a.append(list(input()))
b = [[0 for j in range(h)] for i in range(w)]
for i in range(h):
for j in range(w):
b[j][i] = a[i][j]
for i in range(w):
x = ''
for j in range(h):
x = x + b[i][j] + b[i][j]
print(x)
print(x)
|
Title: Rotate, Flip and Zoom
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is writing the prototype of a graphic editor. He has already made up his mind that the basic image transformations in his editor will be: rotate the image 90 degrees clockwise, flip the image horizontally (symmetry relative to the vertical line, that is, the right part of the image moves to the left, and vice versa) and zooming on the image. He is sure that that there is a large number of transformations that can be expressed through these three.
He has recently stopped implementing all three transformations for monochrome images. To test this feature, he asked you to write a code that will consecutively perform three actions with a monochrome image: first it will rotate the image 90 degrees clockwise, then it will flip the image horizontally and finally, it will zoom in twice on the image (that is, it will double all the linear sizes).
Implement this feature to help Polycarp test his editor.
Input Specification:
The first line contains two integers, *w* and *h* (1<=≤<=*w*,<=*h*<=≤<=100) — the width and height of an image in pixels. The picture is given in *h* lines, each line contains *w* characters — each character encodes the color of the corresponding pixel of the image. The line consists only of characters "." and "*", as the image is monochrome.
Output Specification:
Print 2*w* lines, each containing 2*h* characters — the result of consecutive implementing of the three transformations, described above.
Demo Input:
['3 2\n.*.\n.*.\n', '9 20\n**.......\n****.....\n******...\n*******..\n..******.\n....****.\n......***\n*.....***\n*********\n*********\n*********\n*********\n....**...\n...****..\n..******.\n.********\n****..***\n***...***\n**.....**\n*.......*\n']
Demo Output:
['....\n....\n****\n****\n....\n....\n', '********......**********........********\n********......**********........********\n********........********......********..\n********........********......********..\n..********......********....********....\n..********......********....********....\n..********......********..********......\n..********......********..********......\n....********....****************........\n....********....****************........\n....********....****************........\n....********....****************........\n......******************..**********....\n......******************..**********....\n........****************....**********..\n........****************....**********..\n............************......**********\n............************......**********\n']
Note:
none
|
```python
w, h = map(int, input().split())
a = []
for i in range(h):
a.append(list(input()))
b = [[0 for j in range(h)] for i in range(w)]
for i in range(h):
for j in range(w):
b[j][i] = a[i][j]
for i in range(w):
x = ''
for j in range(h):
x = x + b[i][j] + b[i][j]
print(x)
print(x)
```
| 3
|
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,691,604,657
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 0
| 62
| 2,867,200
|
# list = input().split("\n")
list = []
while True:
line = input()
if line:
list.append(line)
else:
break
input = '\n'.join(list)
new_list = []
for i in list:
index = list.index(i)
new_word = ""
if index == 0:
continue
elif len(i) > 10:
new_word += i[0]
new_word += str(len(i) - 2)
new_word += i[-1]
new_list.append(new_word)
else:
new_list.append(i)
for i in new_list:
print(i)
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
# list = input().split("\n")
list = []
while True:
line = input()
if line:
list.append(line)
else:
break
input = '\n'.join(list)
new_list = []
for i in list:
index = list.index(i)
new_word = ""
if index == 0:
continue
elif len(i) > 10:
new_word += i[0]
new_word += str(len(i) - 2)
new_word += i[-1]
new_list.append(new_word)
else:
new_list.append(i)
for i in new_list:
print(i)
```
| -1
|
580
|
C
|
Kefa and Park
|
PROGRAMMING
| 1,500
|
[
"dfs and similar",
"graphs",
"trees"
] | null | null |
Kefa decided to celebrate his first big salary by going to the restaurant.
He lives by an unusual park. The park is a rooted tree consisting of *n* vertices with the root at vertex 1. Vertex 1 also contains Kefa's house. Unfortunaely for our hero, the park also contains cats. Kefa has already found out what are the vertices with cats in them.
The leaf vertices of the park contain restaurants. Kefa wants to choose a restaurant where he will go, but unfortunately he is very afraid of cats, so there is no way he will go to the restaurant if the path from the restaurant to his house contains more than *m* consecutive vertices with cats.
Your task is to help Kefa count the number of restaurants where he can go.
|
The first line contains two integers, *n* and *m* (2<=≤<=*n*<=≤<=105, 1<=≤<=*m*<=≤<=*n*) — the number of vertices of the tree and the maximum number of consecutive vertices with cats that is still ok for Kefa.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where each *a**i* either equals to 0 (then vertex *i* has no cat), or equals to 1 (then vertex *i* has a cat).
Next *n*<=-<=1 lines contains the edges of the tree in the format "*x**i* *y**i*" (without the quotes) (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, *x**i*<=≠<=*y**i*), where *x**i* and *y**i* are the vertices of the tree, connected by an edge.
It is guaranteed that the given set of edges specifies a tree.
|
A single integer — the number of distinct leaves of a tree the path to which from Kefa's home contains at most *m* consecutive vertices with cats.
|
[
"4 1\n1 1 0 0\n1 2\n1 3\n1 4\n",
"7 1\n1 0 1 1 0 0 0\n1 2\n1 3\n2 4\n2 5\n3 6\n3 7\n"
] |
[
"2\n",
"2\n"
] |
Let us remind you that a tree is a connected graph on *n* vertices and *n* - 1 edge. A rooted tree is a tree with a special vertex called root. In a rooted tree among any two vertices connected by an edge, one vertex is a parent (the one closer to the root), and the other one is a child. A vertex is called a leaf, if it has no children.
Note to the first sample test: <img class="tex-graphics" src="https://espresso.codeforces.com/785114b4b3f5336f02078c25750f87c5a1d0b4be.png" style="max-width: 100.0%;max-height: 100.0%;"/> The vertices containing cats are marked red. The restaurants are at vertices 2, 3, 4. Kefa can't go only to the restaurant located at vertex 2.
Note to the second sample test: <img class="tex-graphics" src="https://espresso.codeforces.com/e5c07640680c837aec99126d94287872e69aa09a.png" style="max-width: 100.0%;max-height: 100.0%;"/> The restaurants are located at vertices 4, 5, 6, 7. Kefa can't go to restaurants 6, 7.
| 1,500
|
[
{
"input": "4 1\n1 1 0 0\n1 2\n1 3\n1 4",
"output": "2"
},
{
"input": "7 1\n1 0 1 1 0 0 0\n1 2\n1 3\n2 4\n2 5\n3 6\n3 7",
"output": "2"
},
{
"input": "3 2\n1 1 1\n1 2\n2 3",
"output": "0"
},
{
"input": "5 2\n1 1 0 1 1\n1 2\n2 3\n3 4\n4 5",
"output": "1"
},
{
"input": "6 1\n1 0 1 1 0 0\n1 2\n1 3\n1 4\n1 5\n1 6",
"output": "3"
},
{
"input": "7 3\n1 1 1 1 1 0 1\n1 2\n1 3\n2 4\n3 5\n5 6\n6 7",
"output": "2"
},
{
"input": "15 2\n1 0 1 0 1 0 0 0 0 0 0 0 0 0 0\n1 2\n1 3\n2 4\n2 5\n3 6\n3 7\n4 8\n4 9\n5 10\n5 11\n6 12\n6 13\n7 14\n7 15",
"output": "8"
},
{
"input": "2 1\n1 1\n2 1",
"output": "0"
},
{
"input": "12 3\n1 0 1 0 1 1 1 1 0 0 0 0\n6 7\n12 1\n9 7\n1 4\n10 7\n7 1\n11 8\n5 1\n3 7\n5 8\n4 2",
"output": "7"
}
] | 1,696,490,334
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 467
| 25,600,000
|
############ ---- Input Functions and Setup ---- ############
import sys
import math
from collections import Counter, defaultdict, deque
from functools import cmp_to_key
def inp(): # int input
return(int(input()))
def inlt(): # int list input
return(list(map(int,input().split())))
def insr(): # string input -> char list
s = input()
return(list(s[:len(s)]))
def invr(): # a b c input
return(map(int,input().split()))
####################################################
n,m=invr()
nodes=inlt()
adjlist=[[] for _ in range(n)]
for i in range(n-1):
x,v = invr()
adjlist[x-1].append(v-1)
adjlist[v-1].append(x-1)
visited=[False]*n
visited[0]=True
stack=[]
stack.append((0,0))
count=0
while stack:
u,cats=stack.pop()
if nodes[u]==1:cats+=1
else:cats=0
if cats>m:
continue
isLeaf=True
for v in adjlist[u]:
if not visited[v]:
isLeaf=False
visited[v]=True
stack.append((v,cats))
if isLeaf:count+=1
print(count)
|
Title: Kefa and Park
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kefa decided to celebrate his first big salary by going to the restaurant.
He lives by an unusual park. The park is a rooted tree consisting of *n* vertices with the root at vertex 1. Vertex 1 also contains Kefa's house. Unfortunaely for our hero, the park also contains cats. Kefa has already found out what are the vertices with cats in them.
The leaf vertices of the park contain restaurants. Kefa wants to choose a restaurant where he will go, but unfortunately he is very afraid of cats, so there is no way he will go to the restaurant if the path from the restaurant to his house contains more than *m* consecutive vertices with cats.
Your task is to help Kefa count the number of restaurants where he can go.
Input Specification:
The first line contains two integers, *n* and *m* (2<=≤<=*n*<=≤<=105, 1<=≤<=*m*<=≤<=*n*) — the number of vertices of the tree and the maximum number of consecutive vertices with cats that is still ok for Kefa.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where each *a**i* either equals to 0 (then vertex *i* has no cat), or equals to 1 (then vertex *i* has a cat).
Next *n*<=-<=1 lines contains the edges of the tree in the format "*x**i* *y**i*" (without the quotes) (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, *x**i*<=≠<=*y**i*), where *x**i* and *y**i* are the vertices of the tree, connected by an edge.
It is guaranteed that the given set of edges specifies a tree.
Output Specification:
A single integer — the number of distinct leaves of a tree the path to which from Kefa's home contains at most *m* consecutive vertices with cats.
Demo Input:
['4 1\n1 1 0 0\n1 2\n1 3\n1 4\n', '7 1\n1 0 1 1 0 0 0\n1 2\n1 3\n2 4\n2 5\n3 6\n3 7\n']
Demo Output:
['2\n', '2\n']
Note:
Let us remind you that a tree is a connected graph on *n* vertices and *n* - 1 edge. A rooted tree is a tree with a special vertex called root. In a rooted tree among any two vertices connected by an edge, one vertex is a parent (the one closer to the root), and the other one is a child. A vertex is called a leaf, if it has no children.
Note to the first sample test: <img class="tex-graphics" src="https://espresso.codeforces.com/785114b4b3f5336f02078c25750f87c5a1d0b4be.png" style="max-width: 100.0%;max-height: 100.0%;"/> The vertices containing cats are marked red. The restaurants are at vertices 2, 3, 4. Kefa can't go only to the restaurant located at vertex 2.
Note to the second sample test: <img class="tex-graphics" src="https://espresso.codeforces.com/e5c07640680c837aec99126d94287872e69aa09a.png" style="max-width: 100.0%;max-height: 100.0%;"/> The restaurants are located at vertices 4, 5, 6, 7. Kefa can't go to restaurants 6, 7.
|
```python
############ ---- Input Functions and Setup ---- ############
import sys
import math
from collections import Counter, defaultdict, deque
from functools import cmp_to_key
def inp(): # int input
return(int(input()))
def inlt(): # int list input
return(list(map(int,input().split())))
def insr(): # string input -> char list
s = input()
return(list(s[:len(s)]))
def invr(): # a b c input
return(map(int,input().split()))
####################################################
n,m=invr()
nodes=inlt()
adjlist=[[] for _ in range(n)]
for i in range(n-1):
x,v = invr()
adjlist[x-1].append(v-1)
adjlist[v-1].append(x-1)
visited=[False]*n
visited[0]=True
stack=[]
stack.append((0,0))
count=0
while stack:
u,cats=stack.pop()
if nodes[u]==1:cats+=1
else:cats=0
if cats>m:
continue
isLeaf=True
for v in adjlist[u]:
if not visited[v]:
isLeaf=False
visited[v]=True
stack.append((v,cats))
if isLeaf:count+=1
print(count)
```
| 3
|
|
275
|
A
|
Lights Out
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Lenny is playing a game on a 3<=×<=3 grid of lights. In the beginning of the game all lights are switched on. Pressing any of the lights will toggle it and all side-adjacent lights. The goal of the game is to switch all the lights off. We consider the toggling as follows: if the light was switched on then it will be switched off, if it was switched off then it will be switched on.
Lenny has spent some time playing with the grid and by now he has pressed each light a certain number of times. Given the number of times each light is pressed, you have to print the current state of each light.
|
The input consists of three rows. Each row contains three integers each between 0 to 100 inclusive. The *j*-th number in the *i*-th row is the number of times the *j*-th light of the *i*-th row of the grid is pressed.
|
Print three lines, each containing three characters. The *j*-th character of the *i*-th line is "1" if and only if the corresponding light is switched on, otherwise it's "0".
|
[
"1 0 0\n0 0 0\n0 0 1\n",
"1 0 1\n8 8 8\n2 0 3\n"
] |
[
"001\n010\n100\n",
"010\n011\n100\n"
] |
none
| 500
|
[
{
"input": "1 0 0\n0 0 0\n0 0 1",
"output": "001\n010\n100"
},
{
"input": "1 0 1\n8 8 8\n2 0 3",
"output": "010\n011\n100"
},
{
"input": "13 85 77\n25 50 45\n65 79 9",
"output": "000\n010\n000"
},
{
"input": "96 95 5\n8 84 74\n67 31 61",
"output": "011\n011\n101"
},
{
"input": "24 54 37\n60 63 6\n1 84 26",
"output": "110\n101\n011"
},
{
"input": "23 10 40\n15 6 40\n92 80 77",
"output": "101\n100\n000"
},
{
"input": "62 74 80\n95 74 93\n2 47 95",
"output": "010\n001\n110"
},
{
"input": "80 83 48\n26 0 66\n47 76 37",
"output": "000\n000\n010"
},
{
"input": "32 15 65\n7 54 36\n5 51 3",
"output": "111\n101\n001"
},
{
"input": "22 97 12\n71 8 24\n100 21 64",
"output": "100\n001\n100"
},
{
"input": "46 37 13\n87 0 50\n90 8 55",
"output": "111\n011\n000"
},
{
"input": "57 43 58\n20 82 83\n66 16 52",
"output": "111\n010\n110"
},
{
"input": "45 56 93\n47 51 59\n18 51 63",
"output": "101\n011\n100"
},
{
"input": "47 66 67\n14 1 37\n27 81 69",
"output": "001\n001\n110"
},
{
"input": "26 69 69\n85 18 23\n14 22 74",
"output": "110\n001\n010"
},
{
"input": "10 70 65\n94 27 25\n74 66 30",
"output": "111\n010\n100"
},
{
"input": "97 1 74\n15 99 1\n88 68 86",
"output": "001\n011\n000"
},
{
"input": "36 48 42\n45 41 66\n26 64 1",
"output": "001\n111\n010"
},
{
"input": "52 81 97\n29 77 71\n66 11 2",
"output": "100\n100\n111"
},
{
"input": "18 66 33\n19 49 49\n48 46 26",
"output": "011\n100\n000"
},
{
"input": "68 79 52\n51 39 100\n29 14 26",
"output": "110\n000\n111"
},
{
"input": "91 69 77\n91 26 64\n91 88 57",
"output": "001\n011\n110"
},
{
"input": "16 69 64\n48 21 80\n81 51 51",
"output": "010\n101\n111"
},
{
"input": "96 14 2\n100 18 12\n65 34 89",
"output": "111\n010\n010"
},
{
"input": "93 95 90\n8 59 42\n53 13 19",
"output": "100\n001\n111"
},
{
"input": "71 84 18\n100 19 67\n9 76 15",
"output": "010\n010\n001"
},
{
"input": "38 93 85\n21 88 64\n4 96 25",
"output": "111\n011\n000"
},
{
"input": "75 20 20\n60 5 78\n77 4 69",
"output": "011\n001\n000"
},
{
"input": "65 70 96\n19 6 83\n33 37 82",
"output": "100\n000\n011"
},
{
"input": "11 13 60\n17 13 46\n42 21 39",
"output": "000\n011\n101"
},
{
"input": "0 0 0\n0 0 0\n0 0 0",
"output": "111\n111\n111"
},
{
"input": "0 0 0\n0 1 0\n0 0 0",
"output": "101\n000\n101"
},
{
"input": "0 0 0\n0 0 0\n0 0 1",
"output": "111\n110\n100"
}
] | 1,643,454,029
| 4,529
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 15
| 0
|
initial=[[1 for i in range(3)] for j in range(3)]
matrix=[]
for i in range(3):
t=list(map(int,input().split()))
matrix.append(t)
for i in range(3):
for j in range(3):
if matrix[i][j]%2==1:
initial[i][i]=1-initial[i][j]
if i<2:
initial[i+1][j]=1-initial[i+1][j]
if j<2:
initial[i][j+1]=1-initial[i][j+1]
if i>0:
initial[i-1][j]=1-initial[i-1][j]
if j>0:
initial[i][j-1]=1-initial[i][j-1]
for i in range(3):
for j in range(3):
print(initial[i][j],end=" ")
print()
|
Title: Lights Out
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Lenny is playing a game on a 3<=×<=3 grid of lights. In the beginning of the game all lights are switched on. Pressing any of the lights will toggle it and all side-adjacent lights. The goal of the game is to switch all the lights off. We consider the toggling as follows: if the light was switched on then it will be switched off, if it was switched off then it will be switched on.
Lenny has spent some time playing with the grid and by now he has pressed each light a certain number of times. Given the number of times each light is pressed, you have to print the current state of each light.
Input Specification:
The input consists of three rows. Each row contains three integers each between 0 to 100 inclusive. The *j*-th number in the *i*-th row is the number of times the *j*-th light of the *i*-th row of the grid is pressed.
Output Specification:
Print three lines, each containing three characters. The *j*-th character of the *i*-th line is "1" if and only if the corresponding light is switched on, otherwise it's "0".
Demo Input:
['1 0 0\n0 0 0\n0 0 1\n', '1 0 1\n8 8 8\n2 0 3\n']
Demo Output:
['001\n010\n100\n', '010\n011\n100\n']
Note:
none
|
```python
initial=[[1 for i in range(3)] for j in range(3)]
matrix=[]
for i in range(3):
t=list(map(int,input().split()))
matrix.append(t)
for i in range(3):
for j in range(3):
if matrix[i][j]%2==1:
initial[i][i]=1-initial[i][j]
if i<2:
initial[i+1][j]=1-initial[i+1][j]
if j<2:
initial[i][j+1]=1-initial[i][j+1]
if i>0:
initial[i-1][j]=1-initial[i-1][j]
if j>0:
initial[i][j-1]=1-initial[i][j-1]
for i in range(3):
for j in range(3):
print(initial[i][j],end=" ")
print()
```
| 0
|
|
980
|
B
|
Marlin
|
PROGRAMMING
| 1,600
|
[
"constructive algorithms"
] | null | null |
The city of Fishtopia can be imagined as a grid of $4$ rows and an odd number of columns. It has two main villages; the first is located at the top-left cell $(1,1)$, people who stay there love fishing at the Tuna pond at the bottom-right cell $(4, n)$. The second village is located at $(4, 1)$ and its people love the Salmon pond at $(1, n)$.
The mayor of Fishtopia wants to place $k$ hotels in the city, each one occupying one cell. To allow people to enter the city from anywhere, hotels should not be placed on the border cells.
A person can move from one cell to another if those cells are not occupied by hotels and share a side.
Can you help the mayor place the hotels in a way such that there are equal number of shortest paths from each village to its preferred pond?
|
The first line of input contain two integers, $n$ and $k$ ($3 \leq n \leq 99$, $0 \leq k \leq 2\times(n-2)$), $n$ is odd, the width of the city, and the number of hotels to be placed, respectively.
|
Print "YES", if it is possible to place all the hotels in a way that satisfies the problem statement, otherwise print "NO".
If it is possible, print an extra $4$ lines that describe the city, each line should have $n$ characters, each of which is "#" if that cell has a hotel on it, or "." if not.
|
[
"7 2\n",
"5 3\n"
] |
[
"YES\n.......\n.#.....\n.#.....\n.......\n",
"YES\n.....\n.###.\n.....\n.....\n"
] |
none
| 1,000
|
[
{
"input": "7 2",
"output": "YES\n.......\n.#.....\n.#.....\n......."
},
{
"input": "5 3",
"output": "YES\n.....\n.###.\n.....\n....."
},
{
"input": "3 2",
"output": "YES\n...\n.#.\n.#.\n..."
},
{
"input": "3 0",
"output": "YES\n...\n...\n...\n..."
},
{
"input": "49 1",
"output": "YES\n.................................................\n........................#........................\n.................................................\n................................................."
},
{
"input": "9 4",
"output": "YES\n.........\n.##......\n.##......\n........."
},
{
"input": "9 5",
"output": "YES\n.........\n.#.#.....\n.###.....\n........."
},
{
"input": "99 193",
"output": "YES\n...................................................................................................\n.###############################################################################################.#.\n.#################################################################################################.\n..................................................................................................."
},
{
"input": "99 14",
"output": "YES\n...................................................................................................\n.#######...........................................................................................\n.#######...........................................................................................\n..................................................................................................."
},
{
"input": "57 15",
"output": "YES\n.........................................................\n.######.#................................................\n.########................................................\n........................................................."
},
{
"input": "99 3",
"output": "YES\n...................................................................................................\n................................................###................................................\n...................................................................................................\n..................................................................................................."
},
{
"input": "3 1",
"output": "YES\n...\n.#.\n...\n..."
},
{
"input": "9 9",
"output": "YES\n.........\n.###.#...\n.#####...\n........."
},
{
"input": "67 9",
"output": "YES\n...................................................................\n.###.#.............................................................\n.#####.............................................................\n..................................................................."
},
{
"input": "99 99",
"output": "YES\n...................................................................................................\n.################################################.#................................................\n.##################################################................................................\n..................................................................................................."
},
{
"input": "31 32",
"output": "YES\n...............................\n.################..............\n.################..............\n..............................."
},
{
"input": "5 1",
"output": "YES\n.....\n..#..\n.....\n....."
},
{
"input": "5 2",
"output": "YES\n.....\n.#...\n.#...\n....."
},
{
"input": "5 4",
"output": "YES\n.....\n.##..\n.##..\n....."
},
{
"input": "5 6",
"output": "YES\n.....\n.###.\n.###.\n....."
},
{
"input": "5 5",
"output": "YES\n.....\n.#.#.\n.###.\n....."
},
{
"input": "7 9",
"output": "YES\n.......\n.###.#.\n.#####.\n......."
},
{
"input": "7 10",
"output": "YES\n.......\n.#####.\n.#####.\n......."
},
{
"input": "19 12",
"output": "YES\n...................\n.######............\n.######............\n..................."
},
{
"input": "19 3",
"output": "YES\n...................\n........###........\n...................\n..................."
},
{
"input": "37 14",
"output": "YES\n.....................................\n.#######.............................\n.#######.............................\n....................................."
},
{
"input": "37 15",
"output": "YES\n.....................................\n.######.#............................\n.########............................\n....................................."
},
{
"input": "37 37",
"output": "YES\n.....................................\n.#################.#.................\n.###################.................\n....................................."
},
{
"input": "37 36",
"output": "YES\n.....................................\n.##################..................\n.##################..................\n....................................."
},
{
"input": "37 35",
"output": "YES\n.....................................\n.################.#..................\n.##################..................\n....................................."
},
{
"input": "37 34",
"output": "YES\n.....................................\n.#################...................\n.#################...................\n....................................."
},
{
"input": "37 38",
"output": "YES\n.....................................\n.###################.................\n.###################.................\n....................................."
},
{
"input": "37 39",
"output": "YES\n.....................................\n.##################.#................\n.####################................\n....................................."
},
{
"input": "37 40",
"output": "YES\n.....................................\n.####################................\n.####################................\n....................................."
},
{
"input": "5 0",
"output": "YES\n.....\n.....\n.....\n....."
},
{
"input": "67 1",
"output": "YES\n...................................................................\n.................................#.................................\n...................................................................\n..................................................................."
},
{
"input": "37 19",
"output": "YES\n.....................................\n.########.#..........................\n.##########..........................\n....................................."
},
{
"input": "77 7",
"output": "YES\n.............................................................................\n.##.#........................................................................\n.####........................................................................\n............................................................................."
},
{
"input": "33 47",
"output": "YES\n.................................\n.######################.#........\n.########################........\n................................."
},
{
"input": "33 48",
"output": "YES\n.................................\n.########################........\n.########################........\n................................."
},
{
"input": "23 40",
"output": "YES\n.......................\n.####################..\n.####################..\n......................."
},
{
"input": "23 39",
"output": "YES\n.......................\n.##################.#..\n.####################..\n......................."
},
{
"input": "49 3",
"output": "YES\n.................................................\n.......................###.......................\n.................................................\n................................................."
},
{
"input": "99 1",
"output": "YES\n...................................................................................................\n.................................................#.................................................\n...................................................................................................\n..................................................................................................."
},
{
"input": "77 0",
"output": "YES\n.............................................................................\n.............................................................................\n.............................................................................\n............................................................................."
},
{
"input": "99 0",
"output": "YES\n...................................................................................................\n...................................................................................................\n...................................................................................................\n..................................................................................................."
},
{
"input": "99 5",
"output": "YES\n...................................................................................................\n.#.#...............................................................................................\n.###...............................................................................................\n..................................................................................................."
},
{
"input": "99 4",
"output": "YES\n...................................................................................................\n.##................................................................................................\n.##................................................................................................\n..................................................................................................."
},
{
"input": "99 20",
"output": "YES\n...................................................................................................\n.##########........................................................................................\n.##########........................................................................................\n..................................................................................................."
},
{
"input": "99 194",
"output": "YES\n...................................................................................................\n.#################################################################################################.\n.#################################################################################################.\n..................................................................................................."
},
{
"input": "99 192",
"output": "YES\n...................................................................................................\n.################################################################################################..\n.################################################################################################..\n..................................................................................................."
},
{
"input": "99 190",
"output": "YES\n...................................................................................................\n.###############################################################################################...\n.###############################################################################################...\n..................................................................................................."
},
{
"input": "99 189",
"output": "YES\n...................................................................................................\n.#############################################################################################.#...\n.###############################################################################################...\n..................................................................................................."
},
{
"input": "99 177",
"output": "YES\n...................................................................................................\n.#######################################################################################.#.........\n.#########################################################################################.........\n..................................................................................................."
},
{
"input": "99 154",
"output": "YES\n...................................................................................................\n.#############################################################################.....................\n.#############################################################################.....................\n..................................................................................................."
},
{
"input": "99 127",
"output": "YES\n...................................................................................................\n.##############################################################.#..................................\n.################################################################..................................\n..................................................................................................."
},
{
"input": "99 55",
"output": "YES\n...................................................................................................\n.##########################.#......................................................................\n.############################......................................................................\n..................................................................................................."
},
{
"input": "99 40",
"output": "YES\n...................................................................................................\n.####################..............................................................................\n.####################..............................................................................\n..................................................................................................."
},
{
"input": "97 190",
"output": "YES\n.................................................................................................\n.###############################################################################################.\n.###############################################################################################.\n................................................................................................."
},
{
"input": "97 100",
"output": "YES\n.................................................................................................\n.##################################################..............................................\n.##################################################..............................................\n................................................................................................."
},
{
"input": "97 111",
"output": "YES\n.................................................................................................\n.######################################################.#........................................\n.########################################################........................................\n................................................................................................."
},
{
"input": "97 64",
"output": "YES\n.................................................................................................\n.################################................................................................\n.################################................................................................\n................................................................................................."
},
{
"input": "97 77",
"output": "YES\n.................................................................................................\n.#####################################.#.........................................................\n.#######################################.........................................................\n................................................................................................."
},
{
"input": "91 77",
"output": "YES\n...........................................................................................\n.#####################################.#...................................................\n.#######################################...................................................\n..........................................................................................."
},
{
"input": "91 128",
"output": "YES\n...........................................................................................\n.################################################################..........................\n.################################################################..........................\n..........................................................................................."
},
{
"input": "91 113",
"output": "YES\n...........................................................................................\n.#######################################################.#.................................\n.#########################################################.................................\n..........................................................................................."
},
{
"input": "55 55",
"output": "YES\n.......................................................\n.##########################.#..........................\n.############################..........................\n......................................................."
},
{
"input": "43 34",
"output": "YES\n...........................................\n.#################.........................\n.#################.........................\n..........................................."
},
{
"input": "13 21",
"output": "YES\n.............\n.#########.#.\n.###########.\n............."
},
{
"input": "27 50",
"output": "YES\n...........................\n.#########################.\n.#########################.\n..........................."
},
{
"input": "27 49",
"output": "YES\n...........................\n.#######################.#.\n.#########################.\n..........................."
},
{
"input": "27 48",
"output": "YES\n...........................\n.########################..\n.########################..\n..........................."
},
{
"input": "27 40",
"output": "YES\n...........................\n.####################......\n.####################......\n..........................."
},
{
"input": "87 80",
"output": "YES\n.......................................................................................\n.########################################..............................................\n.########################################..............................................\n......................................................................................."
},
{
"input": "69 17",
"output": "YES\n.....................................................................\n.#######.#...........................................................\n.#########...........................................................\n....................................................................."
},
{
"input": "39 73",
"output": "YES\n.......................................\n.###################################.#.\n.#####################################.\n......................................."
},
{
"input": "39 72",
"output": "YES\n.......................................\n.####################################..\n.####################################..\n......................................."
},
{
"input": "33 57",
"output": "YES\n.................................\n.###########################.#...\n.#############################...\n................................."
},
{
"input": "33 54",
"output": "YES\n.................................\n.###########################.....\n.###########################.....\n................................."
},
{
"input": "99 2",
"output": "YES\n...................................................................................................\n.#.................................................................................................\n.#.................................................................................................\n..................................................................................................."
},
{
"input": "99 7",
"output": "YES\n...................................................................................................\n.##.#..............................................................................................\n.####..............................................................................................\n..................................................................................................."
},
{
"input": "99 37",
"output": "YES\n...................................................................................................\n.#################.#...............................................................................\n.###################...............................................................................\n..................................................................................................."
},
{
"input": "57 67",
"output": "YES\n.........................................................\n.################################.#......................\n.##################################......................\n........................................................."
},
{
"input": "57 34",
"output": "YES\n.........................................................\n.#################.......................................\n.#################.......................................\n........................................................."
},
{
"input": "73 17",
"output": "YES\n.........................................................................\n.#######.#...............................................................\n.#########...............................................................\n........................................................................."
},
{
"input": "73 43",
"output": "YES\n.........................................................................\n.####################.#..................................................\n.######################..................................................\n........................................................................."
},
{
"input": "7 3",
"output": "YES\n.......\n..###..\n.......\n......."
},
{
"input": "7 7",
"output": "YES\n.......\n.##.#..\n.####..\n......."
}
] | 1,525,792,964
| 1,063
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 0
| 61
| 6,963,200
|
n, k = list(map(int, input().split()))
if 2 * (n - 2) < k or k % 2 == 1:
print('NO')
else:
print('YES')
total = 0
arr = []
for j in range(4):
arr.append(['.' for i in range(n)])
for i in range(1, n - 1):
for j in range(1, 3):
if total < k:
arr[j][i] = '#'
total += 1
for i in arr:
s = str(i[0])
for j in range(1, len(i)):
s += ' ' + i[j]
print(s)
|
Title: Marlin
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The city of Fishtopia can be imagined as a grid of $4$ rows and an odd number of columns. It has two main villages; the first is located at the top-left cell $(1,1)$, people who stay there love fishing at the Tuna pond at the bottom-right cell $(4, n)$. The second village is located at $(4, 1)$ and its people love the Salmon pond at $(1, n)$.
The mayor of Fishtopia wants to place $k$ hotels in the city, each one occupying one cell. To allow people to enter the city from anywhere, hotels should not be placed on the border cells.
A person can move from one cell to another if those cells are not occupied by hotels and share a side.
Can you help the mayor place the hotels in a way such that there are equal number of shortest paths from each village to its preferred pond?
Input Specification:
The first line of input contain two integers, $n$ and $k$ ($3 \leq n \leq 99$, $0 \leq k \leq 2\times(n-2)$), $n$ is odd, the width of the city, and the number of hotels to be placed, respectively.
Output Specification:
Print "YES", if it is possible to place all the hotels in a way that satisfies the problem statement, otherwise print "NO".
If it is possible, print an extra $4$ lines that describe the city, each line should have $n$ characters, each of which is "#" if that cell has a hotel on it, or "." if not.
Demo Input:
['7 2\n', '5 3\n']
Demo Output:
['YES\n.......\n.#.....\n.#.....\n.......\n', 'YES\n.....\n.###.\n.....\n.....\n']
Note:
none
|
```python
n, k = list(map(int, input().split()))
if 2 * (n - 2) < k or k % 2 == 1:
print('NO')
else:
print('YES')
total = 0
arr = []
for j in range(4):
arr.append(['.' for i in range(n)])
for i in range(1, n - 1):
for j in range(1, 3):
if total < k:
arr[j][i] = '#'
total += 1
for i in arr:
s = str(i[0])
for j in range(1, len(i)):
s += ' ' + i[j]
print(s)
```
| 0
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
For a given positive integer *n* denote its *k*-rounding as the minimum positive integer *x*, such that *x* ends with *k* or more zeros in base 10 and is divisible by *n*.
For example, 4-rounding of 375 is 375·80<==<=30000. 30000 is the minimum integer such that it ends with 4 or more zeros and is divisible by 375.
Write a program that will perform the *k*-rounding of *n*.
|
The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=8).
|
Print the *k*-rounding of *n*.
|
[
"375 4\n",
"10000 1\n",
"38101 0\n",
"123456789 8\n"
] |
[
"30000\n",
"10000\n",
"38101\n",
"12345678900000000\n"
] |
none
| 0
|
[
{
"input": "375 4",
"output": "30000"
},
{
"input": "10000 1",
"output": "10000"
},
{
"input": "38101 0",
"output": "38101"
},
{
"input": "123456789 8",
"output": "12345678900000000"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "2 0",
"output": "2"
},
{
"input": "100 0",
"output": "100"
},
{
"input": "1000000000 0",
"output": "1000000000"
},
{
"input": "160 2",
"output": "800"
},
{
"input": "3 0",
"output": "3"
},
{
"input": "10 0",
"output": "10"
},
{
"input": "1 1",
"output": "10"
},
{
"input": "2 1",
"output": "10"
},
{
"input": "3 1",
"output": "30"
},
{
"input": "4 1",
"output": "20"
},
{
"input": "5 1",
"output": "10"
},
{
"input": "6 1",
"output": "30"
},
{
"input": "7 1",
"output": "70"
},
{
"input": "8 1",
"output": "40"
},
{
"input": "9 1",
"output": "90"
},
{
"input": "10 1",
"output": "10"
},
{
"input": "11 1",
"output": "110"
},
{
"input": "12 1",
"output": "60"
},
{
"input": "16 2",
"output": "400"
},
{
"input": "2 2",
"output": "100"
},
{
"input": "1 2",
"output": "100"
},
{
"input": "5 2",
"output": "100"
},
{
"input": "15 2",
"output": "300"
},
{
"input": "36 2",
"output": "900"
},
{
"input": "1 8",
"output": "100000000"
},
{
"input": "8 8",
"output": "100000000"
},
{
"input": "96 8",
"output": "300000000"
},
{
"input": "175 8",
"output": "700000000"
},
{
"input": "9999995 8",
"output": "199999900000000"
},
{
"input": "999999999 8",
"output": "99999999900000000"
},
{
"input": "12345678 8",
"output": "617283900000000"
},
{
"input": "78125 8",
"output": "100000000"
},
{
"input": "390625 8",
"output": "100000000"
},
{
"input": "1953125 8",
"output": "500000000"
},
{
"input": "9765625 8",
"output": "2500000000"
},
{
"input": "68359375 8",
"output": "17500000000"
},
{
"input": "268435456 8",
"output": "104857600000000"
},
{
"input": "125829120 8",
"output": "9830400000000"
},
{
"input": "128000 8",
"output": "400000000"
},
{
"input": "300000 8",
"output": "300000000"
},
{
"input": "3711871 8",
"output": "371187100000000"
},
{
"input": "55555 8",
"output": "1111100000000"
},
{
"input": "222222222 8",
"output": "11111111100000000"
},
{
"input": "479001600 8",
"output": "7484400000000"
},
{
"input": "655360001 7",
"output": "6553600010000000"
},
{
"input": "655360001 8",
"output": "65536000100000000"
},
{
"input": "1000000000 1",
"output": "1000000000"
},
{
"input": "1000000000 7",
"output": "1000000000"
},
{
"input": "1000000000 8",
"output": "1000000000"
},
{
"input": "100000000 8",
"output": "100000000"
},
{
"input": "10000000 8",
"output": "100000000"
},
{
"input": "1000000 8",
"output": "100000000"
},
{
"input": "10000009 8",
"output": "1000000900000000"
},
{
"input": "10000005 8",
"output": "200000100000000"
},
{
"input": "10000002 8",
"output": "500000100000000"
},
{
"input": "999999997 8",
"output": "99999999700000000"
},
{
"input": "999999997 7",
"output": "9999999970000000"
},
{
"input": "999999995 8",
"output": "19999999900000000"
},
{
"input": "123 8",
"output": "12300000000"
},
{
"input": "24 2",
"output": "600"
},
{
"input": "16 4",
"output": "10000"
},
{
"input": "123456787 8",
"output": "12345678700000000"
},
{
"input": "100000000 8",
"output": "100000000"
},
{
"input": "7 1",
"output": "70"
},
{
"input": "101 1",
"output": "1010"
},
{
"input": "50 2",
"output": "100"
},
{
"input": "999999818 1",
"output": "4999999090"
},
{
"input": "2 1",
"output": "10"
},
{
"input": "123 1",
"output": "1230"
},
{
"input": "16 1",
"output": "80"
},
{
"input": "1 1",
"output": "10"
},
{
"input": "1000000000 8",
"output": "1000000000"
},
{
"input": "15304 6",
"output": "1913000000"
},
{
"input": "3 8",
"output": "300000000"
},
{
"input": "4 2",
"output": "100"
},
{
"input": "100000 7",
"output": "10000000"
},
{
"input": "5 8",
"output": "100000000"
},
{
"input": "16724 6",
"output": "4181000000"
},
{
"input": "999999999 1",
"output": "9999999990"
},
{
"input": "999999990 8",
"output": "9999999900000000"
},
{
"input": "999999999 8",
"output": "99999999900000000"
},
{
"input": "100000 1",
"output": "100000"
},
{
"input": "8 3",
"output": "1000"
},
{
"input": "16768 6",
"output": "262000000"
},
{
"input": "123456789 1",
"output": "1234567890"
},
{
"input": "2 8",
"output": "100000000"
},
{
"input": "999999937 8",
"output": "99999993700000000"
},
{
"input": "5 1",
"output": "10"
},
{
"input": "2000000 7",
"output": "10000000"
},
{
"input": "1999998 2",
"output": "99999900"
},
{
"input": "125 3",
"output": "1000"
}
] | 1,581,094,276
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 96
| 155
| 0
|
def gcd(a,b):
if b==0:
return a
return gcd(b,a%b)
def lcm(a,b):
return a*b//gcd(a,b)
n,k=map(int,input().split())
print(lcm(n,10**k))
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
For a given positive integer *n* denote its *k*-rounding as the minimum positive integer *x*, such that *x* ends with *k* or more zeros in base 10 and is divisible by *n*.
For example, 4-rounding of 375 is 375·80<==<=30000. 30000 is the minimum integer such that it ends with 4 or more zeros and is divisible by 375.
Write a program that will perform the *k*-rounding of *n*.
Input Specification:
The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=8).
Output Specification:
Print the *k*-rounding of *n*.
Demo Input:
['375 4\n', '10000 1\n', '38101 0\n', '123456789 8\n']
Demo Output:
['30000\n', '10000\n', '38101\n', '12345678900000000\n']
Note:
none
|
```python
def gcd(a,b):
if b==0:
return a
return gcd(b,a%b)
def lcm(a,b):
return a*b//gcd(a,b)
n,k=map(int,input().split())
print(lcm(n,10**k))
```
| 3
|
|
379
|
A
|
New Year Candles
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
|
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
|
Print a single integer — the number of hours Vasily can light up the room for.
|
[
"4 2\n",
"6 3\n"
] |
[
"7\n",
"8\n"
] |
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
| 500
|
[
{
"input": "4 2",
"output": "7"
},
{
"input": "6 3",
"output": "8"
},
{
"input": "1000 1000",
"output": "1001"
},
{
"input": "123 5",
"output": "153"
},
{
"input": "1000 2",
"output": "1999"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "2 2",
"output": "3"
},
{
"input": "3 2",
"output": "5"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "999 2",
"output": "1997"
},
{
"input": "1000 3",
"output": "1499"
},
{
"input": "1000 4",
"output": "1333"
},
{
"input": "1 1000",
"output": "1"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "10 4",
"output": "13"
},
{
"input": "4 3",
"output": "5"
},
{
"input": "91 5",
"output": "113"
},
{
"input": "777 17",
"output": "825"
},
{
"input": "100 4",
"output": "133"
},
{
"input": "5 3",
"output": "7"
},
{
"input": "6 4",
"output": "7"
},
{
"input": "26 8",
"output": "29"
},
{
"input": "9 4",
"output": "11"
},
{
"input": "20 3",
"output": "29"
},
{
"input": "17 3",
"output": "25"
}
] | 1,646,839,492
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 32
| 62
| 0
|
a, b = list(map(int, input().split()))
h = a
while a >= b:
a-=b
a+=1
h+=1
print(h)
|
Title: New Year Candles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
Input Specification:
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
Output Specification:
Print a single integer — the number of hours Vasily can light up the room for.
Demo Input:
['4 2\n', '6 3\n']
Demo Output:
['7\n', '8\n']
Note:
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
|
```python
a, b = list(map(int, input().split()))
h = a
while a >= b:
a-=b
a+=1
h+=1
print(h)
```
| 3
|
|
520
|
A
|
Pangram
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices.
You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of characters in the string.
The second line contains the string. The string consists only of uppercase and lowercase Latin letters.
|
Output "YES", if the string is a pangram and "NO" otherwise.
|
[
"12\ntoosmallword\n",
"35\nTheQuickBrownFoxJumpsOverTheLazyDog\n"
] |
[
"NO\n",
"YES\n"
] |
none
| 500
|
[
{
"input": "12\ntoosmallword",
"output": "NO"
},
{
"input": "35\nTheQuickBrownFoxJumpsOverTheLazyDog",
"output": "YES"
},
{
"input": "1\na",
"output": "NO"
},
{
"input": "26\nqwertyuiopasdfghjklzxcvbnm",
"output": "YES"
},
{
"input": "26\nABCDEFGHIJKLMNOPQRSTUVWXYZ",
"output": "YES"
},
{
"input": "48\nthereisasyetinsufficientdataforameaningfulanswer",
"output": "NO"
},
{
"input": "30\nToBeOrNotToBeThatIsTheQuestion",
"output": "NO"
},
{
"input": "30\njackdawslovemybigsphinxofquarz",
"output": "NO"
},
{
"input": "31\nTHEFIVEBOXINGWIZARDSJUMPQUICKLY",
"output": "YES"
},
{
"input": "26\naaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "NO"
},
{
"input": "26\nMGJYIZDKsbhpVeNFlquRTcWoAx",
"output": "YES"
},
{
"input": "26\nfWMOhAPsbIVtyUEZrGNQXDklCJ",
"output": "YES"
},
{
"input": "26\nngPMVFSThiRCwLEuyOAbKxQzDJ",
"output": "YES"
},
{
"input": "25\nnxYTzLFwzNolAumjgcAboyxAj",
"output": "NO"
},
{
"input": "26\npRWdodGdxUESvcScPGbUoooZsC",
"output": "NO"
},
{
"input": "66\nBovdMlDzTaqKllZILFVfxbLGsRnzmtVVTmqiIDTYrossLEPlmsPrkUYtWEsGHVOnFj",
"output": "NO"
},
{
"input": "100\nmKtsiDRJypUieHIkvJaMFkwaKxcCIbBszZQLIyPpCDCjhNpAnYFngLjRpnKWpKWtGnwoSteeZXuFHWQxxxOpFlNeYTwKocsXuCoa",
"output": "YES"
},
{
"input": "26\nEoqxUbsLjPytUHMiFnvcGWZdRK",
"output": "NO"
},
{
"input": "26\nvCUFRKElZOnjmXGylWQaHDiPst",
"output": "NO"
},
{
"input": "26\nWtrPuaHdXLKJMsnvQfgOiJZBEY",
"output": "NO"
},
{
"input": "26\npGiFluRteQwkaVoPszJyNBChxM",
"output": "NO"
},
{
"input": "26\ncTUpqjPmANrdbzSFhlWIoKxgVY",
"output": "NO"
},
{
"input": "26\nLndjgvAEuICHKxPwqYztosrmBN",
"output": "NO"
},
{
"input": "26\nMdaXJrCipnOZLykfqHWEStevbU",
"output": "NO"
},
{
"input": "26\nEjDWsVxfKTqGXRnUMOLYcIzPba",
"output": "NO"
},
{
"input": "26\nxKwzRMpunYaqsdfaBgJcVElTHo",
"output": "NO"
},
{
"input": "26\nnRYUQsTwCPLZkgshfEXvBdoiMa",
"output": "NO"
},
{
"input": "26\nHNCQPfJutyAlDGsvRxZWMEbIdO",
"output": "NO"
},
{
"input": "26\nDaHJIpvKznQcmUyWsTGObXRFDe",
"output": "NO"
},
{
"input": "26\nkqvAnFAiRhzlJbtyuWedXSPcOG",
"output": "NO"
},
{
"input": "26\nhlrvgdwsIOyjcmUZXtAKEqoBpF",
"output": "NO"
},
{
"input": "26\njLfXXiMhBTcAwQVReGnpKzdsYu",
"output": "NO"
},
{
"input": "26\nlNMcVuwItjxRBGAekjhyDsQOzf",
"output": "NO"
},
{
"input": "26\nRkSwbNoYldUGtAZvpFMcxhIJFE",
"output": "NO"
},
{
"input": "26\nDqspXZJTuONYieKgaHLMBwfVSC",
"output": "NO"
},
{
"input": "26\necOyUkqNljFHRVXtIpWabGMLDz",
"output": "NO"
},
{
"input": "26\nEKAvqZhBnPmVCDRlgWJfOusxYI",
"output": "NO"
},
{
"input": "26\naLbgqeYchKdMrsZxIPFvTOWNjA",
"output": "NO"
},
{
"input": "26\nxfpBLsndiqtacOCHGmeWUjRkYz",
"output": "NO"
},
{
"input": "26\nXsbRKtqleZPNIVCdfUhyagAomJ",
"output": "NO"
},
{
"input": "26\nAmVtbrwquEthZcjKPLiyDgSoNF",
"output": "NO"
},
{
"input": "26\nOhvXDcwqAUmSEPRZGnjFLiKtNB",
"output": "NO"
},
{
"input": "26\nEKWJqCFLRmstxVBdYuinpbhaOg",
"output": "NO"
},
{
"input": "26\nmnbvcxxlkjhgfdsapoiuytrewq",
"output": "NO"
},
{
"input": "26\naAbcdefghijklmnopqrstuvwxy",
"output": "NO"
},
{
"input": "30\nABCDEFGHTYRIOPLabcdefghtyriopl",
"output": "NO"
},
{
"input": "25\nabcdefghijklmnopqrstuvwxy",
"output": "NO"
},
{
"input": "26\nabcdefhijklmnopqrstVxyzABC",
"output": "NO"
},
{
"input": "25\nqwertyuiopasdfghjklxcvbnm",
"output": "NO"
},
{
"input": "34\nTheQuickBrownFoxJumpsOverTheLayDog",
"output": "NO"
},
{
"input": "26\nabcdefghigklmnopqrstuvwxyz",
"output": "NO"
},
{
"input": "26\nabcdefghijklmnopqrstuvwxyA",
"output": "NO"
},
{
"input": "50\nqazwsxedcrfvtgbyhnujmikolQWERTYUIOASDFGHJKLZXCVBNM",
"output": "NO"
},
{
"input": "35\nTheQuickBrownFoxJumpsOverTheLasyDog",
"output": "NO"
},
{
"input": "25\nbcdefghijklmnopqrstuvwxyz",
"output": "NO"
},
{
"input": "38\nAbCdEfGhIjKlMnOpQrStVwXyZzzzzzzaaaaaaa",
"output": "NO"
},
{
"input": "26\nabcdefghiklmnopqrstvxyzABC",
"output": "NO"
},
{
"input": "26\nabcdefghijklmnopqrstuvwxzZ",
"output": "NO"
},
{
"input": "50\nabcdefghijklmnopqrstuvwxyABCDEFGHIJKLMNOPQRSTUVWXY",
"output": "NO"
}
] | 1,696,826,400
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 59
| 46
| 0
|
n=int(input());b=input().upper()
for i in range(65,91):
if chr(i) in b:
continue
else:
print("NO")
break
else:
print("YES")
|
Title: Pangram
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices.
You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of characters in the string.
The second line contains the string. The string consists only of uppercase and lowercase Latin letters.
Output Specification:
Output "YES", if the string is a pangram and "NO" otherwise.
Demo Input:
['12\ntoosmallword\n', '35\nTheQuickBrownFoxJumpsOverTheLazyDog\n']
Demo Output:
['NO\n', 'YES\n']
Note:
none
|
```python
n=int(input());b=input().upper()
for i in range(65,91):
if chr(i) in b:
continue
else:
print("NO")
break
else:
print("YES")
```
| 3
|
|
864
|
A
|
Fair Game
|
PROGRAMMING
| 1,000
|
[
"implementation",
"sortings"
] | null | null |
Petya and Vasya decided to play a game. They have *n* cards (*n* is an even number). A single integer is written on each card.
Before the game Petya will choose an integer and after that Vasya will choose another integer (different from the number that Petya chose). During the game each player takes all the cards with number he chose. For example, if Petya chose number 5 before the game he will take all cards on which 5 is written and if Vasya chose number 10 before the game he will take all cards on which 10 is written.
The game is considered fair if Petya and Vasya can take all *n* cards, and the number of cards each player gets is the same.
Determine whether Petya and Vasya can choose integer numbers before the game so that the game is fair.
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=100) — number of cards. It is guaranteed that *n* is an even number.
The following *n* lines contain a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (one integer per line, 1<=≤<=*a**i*<=≤<=100) — numbers written on the *n* cards.
|
If it is impossible for Petya and Vasya to choose numbers in such a way that the game will be fair, print "NO" (without quotes) in the first line. In this case you should not print anything more.
In the other case print "YES" (without quotes) in the first line. In the second line print two distinct integers — number that Petya should choose and the number that Vasya should choose to make the game fair. If there are several solutions, print any of them.
|
[
"4\n11\n27\n27\n11\n",
"2\n6\n6\n",
"6\n10\n20\n30\n20\n10\n20\n",
"6\n1\n1\n2\n2\n3\n3\n"
] |
[
"YES\n11 27\n",
"NO\n",
"NO\n",
"NO\n"
] |
In the first example the game will be fair if, for example, Petya chooses number 11, and Vasya chooses number 27. Then the will take all cards — Petya will take cards 1 and 4, and Vasya will take cards 2 and 3. Thus, each of them will take exactly two cards.
In the second example fair game is impossible because the numbers written on the cards are equal, but the numbers that Petya and Vasya should choose should be distinct.
In the third example it is impossible to take all cards. Petya and Vasya can take at most five cards — for example, Petya can choose number 10 and Vasya can choose number 20. But for the game to be fair it is necessary to take 6 cards.
| 500
|
[
{
"input": "4\n11\n27\n27\n11",
"output": "YES\n11 27"
},
{
"input": "2\n6\n6",
"output": "NO"
},
{
"input": "6\n10\n20\n30\n20\n10\n20",
"output": "NO"
},
{
"input": "6\n1\n1\n2\n2\n3\n3",
"output": "NO"
},
{
"input": "2\n1\n100",
"output": "YES\n1 100"
},
{
"input": "2\n1\n1",
"output": "NO"
},
{
"input": "2\n100\n100",
"output": "NO"
},
{
"input": "14\n43\n43\n43\n43\n43\n43\n43\n43\n43\n43\n43\n43\n43\n43",
"output": "NO"
},
{
"input": "100\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32",
"output": "YES\n14 32"
},
{
"input": "2\n50\n100",
"output": "YES\n50 100"
},
{
"input": "2\n99\n100",
"output": "YES\n99 100"
},
{
"input": "4\n4\n4\n5\n5",
"output": "YES\n4 5"
},
{
"input": "10\n10\n10\n10\n10\n10\n23\n23\n23\n23\n23",
"output": "YES\n10 23"
},
{
"input": "20\n34\n34\n34\n34\n34\n34\n34\n34\n34\n34\n11\n11\n11\n11\n11\n11\n11\n11\n11\n11",
"output": "YES\n11 34"
},
{
"input": "40\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30",
"output": "YES\n20 30"
},
{
"input": "58\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "YES\n1 100"
},
{
"input": "98\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99",
"output": "YES\n2 99"
},
{
"input": "100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100",
"output": "YES\n1 100"
},
{
"input": "100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2",
"output": "YES\n1 2"
},
{
"input": "100\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12",
"output": "YES\n12 49"
},
{
"input": "100\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94",
"output": "YES\n15 94"
},
{
"input": "100\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42",
"output": "YES\n33 42"
},
{
"input": "100\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35",
"output": "YES\n16 35"
},
{
"input": "100\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44",
"output": "YES\n33 44"
},
{
"input": "100\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98",
"output": "YES\n54 98"
},
{
"input": "100\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12",
"output": "YES\n12 81"
},
{
"input": "100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100",
"output": "NO"
},
{
"input": "100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "NO"
},
{
"input": "40\n20\n20\n30\n30\n20\n20\n20\n30\n30\n20\n20\n30\n30\n30\n30\n20\n30\n30\n30\n30\n20\n20\n30\n30\n30\n20\n30\n20\n30\n20\n30\n20\n20\n20\n30\n20\n20\n20\n30\n30",
"output": "NO"
},
{
"input": "58\n100\n100\n100\n100\n100\n1\n1\n1\n1\n1\n1\n100\n100\n1\n100\n1\n100\n100\n1\n1\n100\n100\n1\n100\n1\n100\n100\n1\n1\n100\n1\n1\n1\n100\n1\n1\n1\n1\n100\n1\n100\n100\n100\n100\n100\n1\n1\n100\n100\n100\n100\n1\n100\n1\n1\n1\n1\n1",
"output": "NO"
},
{
"input": "98\n2\n99\n99\n99\n99\n2\n99\n99\n99\n2\n2\n99\n2\n2\n2\n2\n99\n99\n2\n99\n2\n2\n99\n99\n99\n99\n2\n2\n99\n2\n99\n99\n2\n2\n99\n2\n99\n2\n99\n2\n2\n2\n99\n2\n2\n2\n2\n99\n99\n99\n99\n2\n2\n2\n2\n2\n2\n2\n2\n99\n2\n99\n99\n2\n2\n99\n99\n99\n99\n99\n99\n99\n99\n2\n99\n2\n99\n2\n2\n2\n99\n99\n99\n99\n99\n99\n2\n99\n99\n2\n2\n2\n2\n2\n99\n99\n99\n2",
"output": "NO"
},
{
"input": "100\n100\n1\n100\n1\n1\n100\n1\n1\n1\n100\n100\n1\n100\n1\n100\n100\n1\n1\n1\n100\n1\n100\n1\n100\n100\n1\n100\n1\n100\n1\n1\n1\n1\n1\n100\n1\n100\n100\n100\n1\n100\n100\n1\n100\n1\n1\n100\n100\n100\n1\n100\n100\n1\n1\n100\n100\n1\n100\n1\n100\n1\n1\n100\n100\n100\n100\n100\n100\n1\n100\n100\n1\n100\n100\n1\n100\n1\n1\n1\n100\n100\n1\n100\n1\n100\n1\n1\n1\n1\n100\n1\n1\n100\n1\n100\n100\n1\n100\n1\n100",
"output": "NO"
},
{
"input": "100\n100\n100\n100\n1\n100\n1\n1\n1\n100\n1\n1\n1\n1\n100\n1\n100\n1\n100\n1\n100\n100\n100\n1\n100\n1\n1\n1\n100\n1\n1\n1\n1\n1\n100\n100\n1\n100\n1\n1\n100\n1\n1\n100\n1\n100\n100\n100\n1\n100\n100\n100\n1\n100\n1\n100\n100\n100\n1\n1\n100\n100\n100\n100\n1\n100\n36\n100\n1\n100\n1\n100\n100\n100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n100\n1\n1\n100\n100\n100\n100\n100\n1\n100\n1\n100\n1\n1\n100\n100\n1\n100",
"output": "NO"
},
{
"input": "100\n2\n1\n1\n2\n2\n1\n1\n1\n1\n2\n1\n1\n1\n2\n2\n2\n1\n1\n1\n2\n1\n2\n2\n2\n2\n1\n1\n2\n1\n1\n2\n1\n27\n1\n1\n1\n2\n2\n2\n1\n2\n1\n2\n1\n1\n2\n2\n2\n2\n2\n2\n2\n2\n1\n2\n2\n2\n2\n1\n2\n1\n1\n1\n1\n1\n2\n1\n1\n1\n2\n2\n2\n2\n2\n2\n1\n1\n1\n1\n2\n2\n1\n2\n2\n1\n1\n1\n2\n1\n2\n2\n1\n1\n2\n1\n1\n1\n2\n2\n1",
"output": "NO"
},
{
"input": "100\n99\n99\n100\n99\n99\n100\n100\n100\n99\n100\n99\n99\n100\n99\n99\n99\n99\n99\n99\n100\n100\n100\n99\n100\n100\n99\n100\n99\n100\n100\n99\n100\n99\n99\n99\n100\n99\n10\n99\n100\n100\n100\n99\n100\n100\n100\n100\n100\n100\n100\n99\n100\n100\n100\n99\n99\n100\n99\n100\n99\n100\n100\n99\n99\n99\n99\n100\n99\n100\n100\n100\n100\n100\n100\n99\n99\n100\n100\n99\n99\n99\n99\n99\n99\n100\n99\n99\n100\n100\n99\n100\n99\n99\n100\n99\n99\n99\n99\n100\n100",
"output": "NO"
},
{
"input": "100\n29\n43\n43\n29\n43\n29\n29\n29\n43\n29\n29\n29\n29\n43\n29\n29\n29\n29\n43\n29\n29\n29\n43\n29\n29\n29\n43\n43\n43\n43\n43\n43\n29\n29\n43\n43\n43\n29\n43\n43\n43\n29\n29\n29\n43\n29\n29\n29\n43\n43\n43\n43\n29\n29\n29\n29\n43\n29\n43\n43\n29\n29\n43\n43\n29\n29\n95\n29\n29\n29\n43\n43\n29\n29\n29\n29\n29\n43\n43\n43\n43\n29\n29\n43\n43\n43\n43\n43\n43\n29\n43\n43\n43\n43\n43\n43\n29\n43\n29\n43",
"output": "NO"
},
{
"input": "100\n98\n98\n98\n88\n88\n88\n88\n98\n98\n88\n98\n88\n98\n88\n88\n88\n88\n88\n98\n98\n88\n98\n98\n98\n88\n88\n88\n98\n98\n88\n88\n88\n98\n88\n98\n88\n98\n88\n88\n98\n98\n98\n88\n88\n98\n98\n88\n88\n88\n88\n88\n98\n98\n98\n88\n98\n88\n88\n98\n98\n88\n98\n88\n88\n98\n88\n88\n98\n27\n88\n88\n88\n98\n98\n88\n88\n98\n98\n98\n98\n98\n88\n98\n88\n98\n98\n98\n98\n88\n88\n98\n88\n98\n88\n98\n98\n88\n98\n98\n88",
"output": "NO"
},
{
"input": "100\n50\n1\n1\n50\n50\n50\n50\n1\n50\n100\n50\n50\n50\n100\n1\n100\n1\n100\n50\n50\n50\n50\n50\n1\n50\n1\n100\n1\n1\n50\n100\n50\n50\n100\n50\n50\n100\n1\n50\n50\n100\n1\n1\n50\n1\n100\n50\n50\n100\n100\n1\n100\n1\n50\n100\n50\n50\n1\n1\n50\n100\n50\n100\n100\n100\n50\n50\n1\n1\n50\n100\n1\n50\n100\n100\n1\n50\n50\n50\n100\n50\n50\n100\n1\n50\n50\n50\n50\n1\n50\n50\n50\n50\n1\n50\n50\n100\n1\n50\n100",
"output": "NO"
},
{
"input": "100\n45\n45\n45\n45\n45\n45\n44\n44\n44\n43\n45\n44\n44\n45\n44\n44\n45\n44\n43\n44\n43\n43\n43\n45\n43\n45\n44\n45\n43\n44\n45\n45\n45\n45\n45\n45\n45\n45\n43\n45\n43\n43\n45\n44\n45\n45\n45\n44\n45\n45\n45\n45\n45\n45\n44\n43\n45\n45\n43\n44\n45\n45\n45\n45\n44\n45\n45\n45\n43\n43\n44\n44\n43\n45\n43\n45\n45\n45\n44\n44\n43\n43\n44\n44\n44\n43\n45\n43\n44\n43\n45\n43\n43\n45\n45\n44\n45\n43\n43\n45",
"output": "NO"
},
{
"input": "100\n12\n12\n97\n15\n97\n12\n15\n97\n12\n97\n12\n12\n97\n12\n15\n12\n12\n15\n12\n12\n97\n12\n12\n15\n15\n12\n97\n15\n12\n97\n15\n12\n12\n15\n15\n15\n97\n15\n97\n12\n12\n12\n12\n12\n97\n12\n97\n12\n15\n15\n12\n15\n12\n15\n12\n12\n12\n12\n12\n12\n12\n12\n97\n97\n12\n12\n97\n12\n97\n97\n15\n97\n12\n97\n97\n12\n12\n12\n97\n97\n15\n12\n12\n15\n12\n15\n97\n97\n12\n15\n12\n12\n97\n12\n15\n15\n15\n15\n12\n12",
"output": "NO"
},
{
"input": "12\n2\n3\n1\n3\n3\n1\n2\n1\n2\n1\n3\n2",
"output": "NO"
},
{
"input": "48\n99\n98\n100\n100\n99\n100\n99\n100\n100\n98\n99\n98\n98\n99\n98\n99\n98\n100\n100\n98\n100\n98\n99\n100\n98\n99\n98\n99\n99\n100\n98\n99\n99\n98\n100\n99\n98\n99\n98\n100\n100\n100\n99\n98\n99\n98\n100\n100",
"output": "NO"
},
{
"input": "4\n1\n3\n3\n3",
"output": "NO"
},
{
"input": "6\n1\n1\n1\n1\n2\n2",
"output": "NO"
},
{
"input": "4\n1\n1\n1\n2",
"output": "NO"
},
{
"input": "4\n1\n2\n2\n2",
"output": "NO"
},
{
"input": "4\n1\n2\n3\n4",
"output": "NO"
},
{
"input": "8\n1\n1\n2\n2\n3\n3\n4\n4",
"output": "NO"
},
{
"input": "4\n1\n3\n2\n4",
"output": "NO"
},
{
"input": "4\n10\n10\n10\n20",
"output": "NO"
},
{
"input": "4\n11\n12\n13\n13",
"output": "NO"
},
{
"input": "4\n1\n1\n1\n3",
"output": "NO"
},
{
"input": "6\n1\n1\n2\n2\n2\n2",
"output": "NO"
},
{
"input": "10\n1\n1\n2\n2\n2\n3\n3\n4\n4\n4",
"output": "NO"
}
] | 1,592,511,771
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 54
| 140
| 0
|
q = 1;
a = []
temp = ""
n = int(input())
while n > 0:
n-=1
a.append(int(input()))
#print(a)
temp = list(set(a))
#print(temp)
if len(temp)==2 and a.count(temp[0])==a.count(temp[1]):
print("YES")
print(*temp)
else:
print("NO")
|
Title: Fair Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya and Vasya decided to play a game. They have *n* cards (*n* is an even number). A single integer is written on each card.
Before the game Petya will choose an integer and after that Vasya will choose another integer (different from the number that Petya chose). During the game each player takes all the cards with number he chose. For example, if Petya chose number 5 before the game he will take all cards on which 5 is written and if Vasya chose number 10 before the game he will take all cards on which 10 is written.
The game is considered fair if Petya and Vasya can take all *n* cards, and the number of cards each player gets is the same.
Determine whether Petya and Vasya can choose integer numbers before the game so that the game is fair.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=100) — number of cards. It is guaranteed that *n* is an even number.
The following *n* lines contain a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (one integer per line, 1<=≤<=*a**i*<=≤<=100) — numbers written on the *n* cards.
Output Specification:
If it is impossible for Petya and Vasya to choose numbers in such a way that the game will be fair, print "NO" (without quotes) in the first line. In this case you should not print anything more.
In the other case print "YES" (without quotes) in the first line. In the second line print two distinct integers — number that Petya should choose and the number that Vasya should choose to make the game fair. If there are several solutions, print any of them.
Demo Input:
['4\n11\n27\n27\n11\n', '2\n6\n6\n', '6\n10\n20\n30\n20\n10\n20\n', '6\n1\n1\n2\n2\n3\n3\n']
Demo Output:
['YES\n11 27\n', 'NO\n', 'NO\n', 'NO\n']
Note:
In the first example the game will be fair if, for example, Petya chooses number 11, and Vasya chooses number 27. Then the will take all cards — Petya will take cards 1 and 4, and Vasya will take cards 2 and 3. Thus, each of them will take exactly two cards.
In the second example fair game is impossible because the numbers written on the cards are equal, but the numbers that Petya and Vasya should choose should be distinct.
In the third example it is impossible to take all cards. Petya and Vasya can take at most five cards — for example, Petya can choose number 10 and Vasya can choose number 20. But for the game to be fair it is necessary to take 6 cards.
|
```python
q = 1;
a = []
temp = ""
n = int(input())
while n > 0:
n-=1
a.append(int(input()))
#print(a)
temp = list(set(a))
#print(temp)
if len(temp)==2 and a.count(temp[0])==a.count(temp[1]):
print("YES")
print(*temp)
else:
print("NO")
```
| 3
|
|
650
|
A
|
Watchmen
|
PROGRAMMING
| 1,400
|
[
"data structures",
"geometry",
"math"
] | null | null |
Watchmen are in a danger and Doctor Manhattan together with his friend Daniel Dreiberg should warn them as soon as possible. There are *n* watchmen on a plane, the *i*-th watchman is located at point (*x**i*,<=*y**i*).
They need to arrange a plan, but there are some difficulties on their way. As you know, Doctor Manhattan considers the distance between watchmen *i* and *j* to be |*x**i*<=-<=*x**j*|<=+<=|*y**i*<=-<=*y**j*|. Daniel, as an ordinary person, calculates the distance using the formula .
The success of the operation relies on the number of pairs (*i*,<=*j*) (1<=≤<=*i*<=<<=*j*<=≤<=*n*), such that the distance between watchman *i* and watchmen *j* calculated by Doctor Manhattan is equal to the distance between them calculated by Daniel. You were asked to compute the number of such pairs.
|
The first line of the input contains the single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of watchmen.
Each of the following *n* lines contains two integers *x**i* and *y**i* (|*x**i*|,<=|*y**i*|<=≤<=109).
Some positions may coincide.
|
Print the number of pairs of watchmen such that the distance between them calculated by Doctor Manhattan is equal to the distance calculated by Daniel.
|
[
"3\n1 1\n7 5\n1 5\n",
"6\n0 0\n0 1\n0 2\n-1 1\n0 1\n1 1\n"
] |
[
"2\n",
"11\n"
] |
In the first sample, the distance between watchman 1 and watchman 2 is equal to |1 - 7| + |1 - 5| = 10 for Doctor Manhattan and <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/bcb5b7064b5f02088da0fdcf677e6fda495dd0df.png" style="max-width: 100.0%;max-height: 100.0%;"/> for Daniel. For pairs (1, 1), (1, 5) and (7, 5), (1, 5) Doctor Manhattan and Daniel will calculate the same distances.
| 500
|
[
{
"input": "3\n1 1\n7 5\n1 5",
"output": "2"
},
{
"input": "6\n0 0\n0 1\n0 2\n-1 1\n0 1\n1 1",
"output": "11"
},
{
"input": "10\n46 -55\n46 45\n46 45\n83 -55\n46 45\n83 -55\n46 45\n83 45\n83 45\n46 -55",
"output": "33"
},
{
"input": "1\n-5 -90",
"output": "0"
},
{
"input": "2\n315 845\n-669 -762",
"output": "0"
},
{
"input": "3\n8911 7861\n-6888 7861\n8911 7861",
"output": "3"
},
{
"input": "2\n-1 1000000000\n0 -1",
"output": "0"
},
{
"input": "2\n1000000000 0\n-7 1",
"output": "0"
},
{
"input": "2\n1 4\n2 1",
"output": "0"
},
{
"input": "2\n1 0\n0 2333333",
"output": "0"
},
{
"input": "2\n2 1\n1 2",
"output": "0"
},
{
"input": "2\n1 1000000000\n2 -1000000000",
"output": "0"
},
{
"input": "2\n0 1000000000\n1 -7",
"output": "0"
},
{
"input": "2\n1 0\n0 19990213",
"output": "0"
}
] | 1,457,413,639
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 71
| 1,809
| 24,473,600
|
from operator import itemgetter
n=int(input().strip())
ans=0
l=[]
for i in range(n):
l.append([int(x) for x in input().strip().split()])
l.sort(key=itemgetter(1))
x=l[0][1]
y=1
for i in range(1,len(l)):
if l[i][1]!=x:
ans=ans+(y*(y-1))//2
x=l[i][1]
y=1
else:
y=y+1
ans=ans+(y*(y-1))//2
l.sort()
x=l[0][0]
y=1
for i in range(1,len(l)):
if l[i][0]!=x:
ans=ans+(y*(y-1))//2
x=l[i][0]
y=1
else:
y=y+1
ans=ans+(y*(y-1))//2
x0,x1=l[0][0],l[0][1]
y=1
for i in range(1,len(l)):
if l[i][0]!=x0 or l[i][1]!=x1:
ans=ans-(y*(y-1))//2
x0,x1=l[i][0],l[i][1]
y=1
else:
y=y+1
ans=ans-(y*(y-1))//2
print(ans)
|
Title: Watchmen
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Watchmen are in a danger and Doctor Manhattan together with his friend Daniel Dreiberg should warn them as soon as possible. There are *n* watchmen on a plane, the *i*-th watchman is located at point (*x**i*,<=*y**i*).
They need to arrange a plan, but there are some difficulties on their way. As you know, Doctor Manhattan considers the distance between watchmen *i* and *j* to be |*x**i*<=-<=*x**j*|<=+<=|*y**i*<=-<=*y**j*|. Daniel, as an ordinary person, calculates the distance using the formula .
The success of the operation relies on the number of pairs (*i*,<=*j*) (1<=≤<=*i*<=<<=*j*<=≤<=*n*), such that the distance between watchman *i* and watchmen *j* calculated by Doctor Manhattan is equal to the distance between them calculated by Daniel. You were asked to compute the number of such pairs.
Input Specification:
The first line of the input contains the single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of watchmen.
Each of the following *n* lines contains two integers *x**i* and *y**i* (|*x**i*|,<=|*y**i*|<=≤<=109).
Some positions may coincide.
Output Specification:
Print the number of pairs of watchmen such that the distance between them calculated by Doctor Manhattan is equal to the distance calculated by Daniel.
Demo Input:
['3\n1 1\n7 5\n1 5\n', '6\n0 0\n0 1\n0 2\n-1 1\n0 1\n1 1\n']
Demo Output:
['2\n', '11\n']
Note:
In the first sample, the distance between watchman 1 and watchman 2 is equal to |1 - 7| + |1 - 5| = 10 for Doctor Manhattan and <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/bcb5b7064b5f02088da0fdcf677e6fda495dd0df.png" style="max-width: 100.0%;max-height: 100.0%;"/> for Daniel. For pairs (1, 1), (1, 5) and (7, 5), (1, 5) Doctor Manhattan and Daniel will calculate the same distances.
|
```python
from operator import itemgetter
n=int(input().strip())
ans=0
l=[]
for i in range(n):
l.append([int(x) for x in input().strip().split()])
l.sort(key=itemgetter(1))
x=l[0][1]
y=1
for i in range(1,len(l)):
if l[i][1]!=x:
ans=ans+(y*(y-1))//2
x=l[i][1]
y=1
else:
y=y+1
ans=ans+(y*(y-1))//2
l.sort()
x=l[0][0]
y=1
for i in range(1,len(l)):
if l[i][0]!=x:
ans=ans+(y*(y-1))//2
x=l[i][0]
y=1
else:
y=y+1
ans=ans+(y*(y-1))//2
x0,x1=l[0][0],l[0][1]
y=1
for i in range(1,len(l)):
if l[i][0]!=x0 or l[i][1]!=x1:
ans=ans-(y*(y-1))//2
x0,x1=l[i][0],l[i][1]
y=1
else:
y=y+1
ans=ans-(y*(y-1))//2
print(ans)
```
| 3
|
|
347
|
B
|
Fixed Points
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation",
"math"
] | null | null |
A permutation of length *n* is an integer sequence such that each integer from 0 to (*n*<=-<=1) appears exactly once in it. For example, sequence [0,<=2,<=1] is a permutation of length 3 while both [0,<=2,<=2] and [1,<=2,<=3] are not.
A fixed point of a function is a point that is mapped to itself by the function. A permutation can be regarded as a bijective function. We'll get a definition of a fixed point in a permutation. An integer *i* is a fixed point of permutation *a*0,<=*a*1,<=...,<=*a**n*<=-<=1 if and only if *a**i*<==<=*i*. For example, permutation [0,<=2,<=1] has 1 fixed point and permutation [0,<=1,<=2] has 3 fixed points.
You are given permutation *a*. You are allowed to swap two elements of the permutation at most once. Your task is to maximize the number of fixed points in the resulting permutation. Note that you are allowed to make at most one swap operation.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105). The second line contains *n* integers *a*0,<=*a*1,<=...,<=*a**n*<=-<=1 — the given permutation.
|
Print a single integer — the maximum possible number of fixed points in the permutation after at most one swap operation.
|
[
"5\n0 1 3 4 2\n"
] |
[
"3\n"
] |
none
| 1,000
|
[
{
"input": "5\n0 1 3 4 2",
"output": "3"
},
{
"input": "10\n6 9 4 7 8 2 3 5 0 1",
"output": "2"
},
{
"input": "100\n99 5 40 32 4 31 38 57 94 47 26 16 89 72 9 80 55 86 78 90 42 41 46 74 56 97 21 48 66 27 93 85 88 59 64 95 10 45 12 22 84 60 8 98 62 51 14 65 39 30 11 71 92 19 76 43 87 54 15 53 37 6 25 18 96 35 13 91 2 3 0 23 1 7 49 75 81 33 50 52 63 44 69 36 17 61 24 20 68 34 73 29 70 83 58 79 82 28 77 67",
"output": "3"
},
{
"input": "3\n0 1 2",
"output": "3"
},
{
"input": "3\n2 1 0",
"output": "3"
},
{
"input": "3\n1 2 0",
"output": "1"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "5\n0 1 2 3 4",
"output": "5"
},
{
"input": "4\n0 1 2 3",
"output": "4"
},
{
"input": "7\n0 1 2 4 3 6 5",
"output": "5"
},
{
"input": "6\n0 1 2 3 5 4",
"output": "6"
}
] | 1,567,337,464
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 10
| 342
| 7,372,800
|
n=int(input())
a=list(map(int,input().split()))
c=0
f=0
li=[0]*n
for i in range(n):
li[a[i]]=i
for i in range(n):
if a[i]==i:
c+=1
else:
if a[i]==li[i] and f==0:
f=1
c+=2
if f==0:
print(c+1)
else:
print(c)
|
Title: Fixed Points
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A permutation of length *n* is an integer sequence such that each integer from 0 to (*n*<=-<=1) appears exactly once in it. For example, sequence [0,<=2,<=1] is a permutation of length 3 while both [0,<=2,<=2] and [1,<=2,<=3] are not.
A fixed point of a function is a point that is mapped to itself by the function. A permutation can be regarded as a bijective function. We'll get a definition of a fixed point in a permutation. An integer *i* is a fixed point of permutation *a*0,<=*a*1,<=...,<=*a**n*<=-<=1 if and only if *a**i*<==<=*i*. For example, permutation [0,<=2,<=1] has 1 fixed point and permutation [0,<=1,<=2] has 3 fixed points.
You are given permutation *a*. You are allowed to swap two elements of the permutation at most once. Your task is to maximize the number of fixed points in the resulting permutation. Note that you are allowed to make at most one swap operation.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105). The second line contains *n* integers *a*0,<=*a*1,<=...,<=*a**n*<=-<=1 — the given permutation.
Output Specification:
Print a single integer — the maximum possible number of fixed points in the permutation after at most one swap operation.
Demo Input:
['5\n0 1 3 4 2\n']
Demo Output:
['3\n']
Note:
none
|
```python
n=int(input())
a=list(map(int,input().split()))
c=0
f=0
li=[0]*n
for i in range(n):
li[a[i]]=i
for i in range(n):
if a[i]==i:
c+=1
else:
if a[i]==li[i] and f==0:
f=1
c+=2
if f==0:
print(c+1)
else:
print(c)
```
| 0
|
|
929
|
A
|
Прокат велосипедов
|
PROGRAMMING
| 1,400
|
[
"*special",
"greedy",
"implementation"
] | null | null |
Как известно, в теплую погоду многие жители крупных городов пользуются сервисами городского велопроката. Вот и Аркадий сегодня будет добираться от школы до дома, используя городские велосипеды.
Школа и дом находятся на одной прямой улице, кроме того, на той же улице есть *n* точек, где можно взять велосипед в прокат или сдать его. Первый велопрокат находится в точке *x*1 километров вдоль улицы, второй — в точке *x*2 и так далее, *n*-й велопрокат находится в точке *x**n*. Школа Аркадия находится в точке *x*1 (то есть там же, где и первый велопрокат), а дом — в точке *x**n* (то есть там же, где и *n*-й велопрокат). Известно, что *x**i*<=<<=*x**i*<=+<=1 для всех 1<=≤<=*i*<=<<=*n*.
Согласно правилам пользования велопроката, Аркадий может брать велосипед в прокат только на ограниченное время, после этого он должен обязательно вернуть его в одной из точек велопроката, однако, он тут же может взять новый велосипед, и отсчет времени пойдет заново. Аркадий может брать не более одного велосипеда в прокат одновременно. Если Аркадий решает взять велосипед в какой-то точке проката, то он сдаёт тот велосипед, на котором он до него доехал, берёт ровно один новый велосипед и продолжает на нём своё движение.
За отведенное время, независимо от выбранного велосипеда, Аркадий успевает проехать не больше *k* километров вдоль улицы.
Определите, сможет ли Аркадий доехать на велосипедах от школы до дома, и если да, то какое минимальное число раз ему необходимо будет взять велосипед в прокат, включая первый велосипед? Учтите, что Аркадий не намерен сегодня ходить пешком.
|
В первой строке следуют два целых числа *n* и *k* (2<=≤<=*n*<=≤<=1<=000, 1<=≤<=*k*<=≤<=100<=000) — количество велопрокатов и максимальное расстояние, которое Аркадий может проехать на одном велосипеде.
В следующей строке следует последовательность целых чисел *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x*1<=<<=*x*2<=<<=...<=<<=*x**n*<=≤<=100<=000) — координаты точек, в которых находятся велопрокаты. Гарантируется, что координаты велопрокатов заданы в порядке возрастания.
|
Если Аркадий не сможет добраться от школы до дома только на велосипедах, выведите -1. В противном случае, выведите минимальное количество велосипедов, которые Аркадию нужно взять в точках проката.
|
[
"4 4\n3 6 8 10\n",
"2 9\n10 20\n",
"12 3\n4 6 7 9 10 11 13 15 17 18 20 21\n"
] |
[
"2\n",
"-1\n",
"6\n"
] |
В первом примере Аркадий должен взять первый велосипед в первом велопрокате и доехать на нём до второго велопроката. Во втором велопрокате он должен взять новый велосипед, на котором он сможет добраться до четвертого велопроката, рядом с которым и находится его дом. Поэтому Аркадию нужно всего два велосипеда, чтобы добраться от школы до дома.
Во втором примере всего два велопроката, расстояние между которыми 10. Но максимальное расстояние, которое можно проехать на одном велосипеде, равно 9. Поэтому Аркадий не сможет добраться от школы до дома только на велосипедах.
| 500
|
[
{
"input": "4 4\n3 6 8 10",
"output": "2"
},
{
"input": "2 9\n10 20",
"output": "-1"
},
{
"input": "12 3\n4 6 7 9 10 11 13 15 17 18 20 21",
"output": "6"
},
{
"input": "2 1\n11164 11165",
"output": "1"
},
{
"input": "3 7\n45823 45825 45829",
"output": "1"
},
{
"input": "2 100000\n0 100000",
"output": "1"
},
{
"input": "50 15001\n1269 1580 5431 5916 6642 14145 15760 19922 20589 22062 24138 33454 33505 35916 37012 42577 43140 49457 54720 55188 56205 56639 56870 57997 58379 59088 59297 61805 61861 63005 64013 68848 71182 71497 72715 73008 75616 76042 76614 80690 83089 85033 86408 92392 92763 93833 95085 95815 97152 99379",
"output": "8"
},
{
"input": "5 7\n6219 6222 6229 6231 6236",
"output": "3"
},
{
"input": "10 448\n78449 78573 78599 78742 78748 78759 78853 79091 79298 79324",
"output": "3"
},
{
"input": "20 19191\n11272 12386 14108 24663 24932 26547 29656 44677 45436 45654 48562 62367 71049 71238 78182 84042 88736 92026 96836 99343",
"output": "6"
},
{
"input": "2 100000\n1 100000",
"output": "1"
},
{
"input": "2 99999\n0 100000",
"output": "-1"
},
{
"input": "2 2\n1 3",
"output": "1"
},
{
"input": "2 2\n1 2",
"output": "1"
},
{
"input": "2 2\n1 4",
"output": "-1"
},
{
"input": "10 1\n1 2 3 4 5 6 7 8 9 10",
"output": "9"
}
] | 1,520,022,564
| 17,664
|
Python 3
|
OK
|
TESTS
| 52
| 62
| 5,632,000
|
n, k = map(int, input().split())
cor = [int(x) for x in input().split()]
N = 1
kon = n
tek = 0
while tek!=kon-1:
for i in range(tek+1,kon):
if cor[i]-cor[tek]>k:
break
if cor[kon-1] - cor[tek] <= k:
break
if i==tek+1:
N=-1
break
tek=i-1
N+=1
print (N)
|
Title: Прокат велосипедов
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Как известно, в теплую погоду многие жители крупных городов пользуются сервисами городского велопроката. Вот и Аркадий сегодня будет добираться от школы до дома, используя городские велосипеды.
Школа и дом находятся на одной прямой улице, кроме того, на той же улице есть *n* точек, где можно взять велосипед в прокат или сдать его. Первый велопрокат находится в точке *x*1 километров вдоль улицы, второй — в точке *x*2 и так далее, *n*-й велопрокат находится в точке *x**n*. Школа Аркадия находится в точке *x*1 (то есть там же, где и первый велопрокат), а дом — в точке *x**n* (то есть там же, где и *n*-й велопрокат). Известно, что *x**i*<=<<=*x**i*<=+<=1 для всех 1<=≤<=*i*<=<<=*n*.
Согласно правилам пользования велопроката, Аркадий может брать велосипед в прокат только на ограниченное время, после этого он должен обязательно вернуть его в одной из точек велопроката, однако, он тут же может взять новый велосипед, и отсчет времени пойдет заново. Аркадий может брать не более одного велосипеда в прокат одновременно. Если Аркадий решает взять велосипед в какой-то точке проката, то он сдаёт тот велосипед, на котором он до него доехал, берёт ровно один новый велосипед и продолжает на нём своё движение.
За отведенное время, независимо от выбранного велосипеда, Аркадий успевает проехать не больше *k* километров вдоль улицы.
Определите, сможет ли Аркадий доехать на велосипедах от школы до дома, и если да, то какое минимальное число раз ему необходимо будет взять велосипед в прокат, включая первый велосипед? Учтите, что Аркадий не намерен сегодня ходить пешком.
Input Specification:
В первой строке следуют два целых числа *n* и *k* (2<=≤<=*n*<=≤<=1<=000, 1<=≤<=*k*<=≤<=100<=000) — количество велопрокатов и максимальное расстояние, которое Аркадий может проехать на одном велосипеде.
В следующей строке следует последовательность целых чисел *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x*1<=<<=*x*2<=<<=...<=<<=*x**n*<=≤<=100<=000) — координаты точек, в которых находятся велопрокаты. Гарантируется, что координаты велопрокатов заданы в порядке возрастания.
Output Specification:
Если Аркадий не сможет добраться от школы до дома только на велосипедах, выведите -1. В противном случае, выведите минимальное количество велосипедов, которые Аркадию нужно взять в точках проката.
Demo Input:
['4 4\n3 6 8 10\n', '2 9\n10 20\n', '12 3\n4 6 7 9 10 11 13 15 17 18 20 21\n']
Demo Output:
['2\n', '-1\n', '6\n']
Note:
В первом примере Аркадий должен взять первый велосипед в первом велопрокате и доехать на нём до второго велопроката. Во втором велопрокате он должен взять новый велосипед, на котором он сможет добраться до четвертого велопроката, рядом с которым и находится его дом. Поэтому Аркадию нужно всего два велосипеда, чтобы добраться от школы до дома.
Во втором примере всего два велопроката, расстояние между которыми 10. Но максимальное расстояние, которое можно проехать на одном велосипеде, равно 9. Поэтому Аркадий не сможет добраться от школы до дома только на велосипедах.
|
```python
n, k = map(int, input().split())
cor = [int(x) for x in input().split()]
N = 1
kon = n
tek = 0
while tek!=kon-1:
for i in range(tek+1,kon):
if cor[i]-cor[tek]>k:
break
if cor[kon-1] - cor[tek] <= k:
break
if i==tek+1:
N=-1
break
tek=i-1
N+=1
print (N)
```
| 3
|
|
802
|
G
|
Fake News (easy)
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
|
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
|
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
|
[
"abcheaibcdi\n",
"hiedi\n"
] |
[
"YES",
"NO"
] |
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
| 0
|
[
{
"input": "abcheaibcdi",
"output": "YES"
},
{
"input": "hiedi",
"output": "NO"
},
{
"input": "ihied",
"output": "NO"
},
{
"input": "diehi",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "iheid",
"output": "NO"
},
{
"input": "eihdi",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "edhii",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "eufyajkssayhjhqcwxmctecaeepjwmfoscqprpcxsqfwnlgzsmmuwuoruantipholrauvxydfvftwfzhnckxswussvlidcojiciflpvkcxkkcmmvtfvxrkwcpeelwsuzqgamamdtdgzscmikvojfvqehblmjczkvtdeymgertgkwfwfukafqlfdhtedcctixhyetdypswgagrpyto",
"output": "YES"
},
{
"input": "arfbvxgdvqzuloojjrwoyqqbxamxybaqltfimofulusfebodjkwwrgwcppkwiodtpjaraglyplgerrpqjkpoggjmfxhwtqrijpijrcyxnoodvwpyjfpvqaoazllbrpzananbrvvybboedidtuvqquklkpeflfaltukjhzjgiofombhbmqbihgtapswykfvlgdoapjqntvqsaohmbvnphvyyhvhavslamczuqifxnwknkaenqmlvetrqogqxmlptgrmqvxzdxdmwobjesmgxckpmawtioavwdngyiwkzypfnxcovwzdohshwlavwsthdssiadhiwmhpvgkrbezm",
"output": "YES"
},
{
"input": "zcectngbqnejjjtsfrluummmqabzqbyccshjqbrjthzhlbmzjfxugvjouwhumsgrnopiyakfadjnbsesamhynsbfbfunupwbxvohfmpwlcpxhovwpfpciclatgmiufwdvtsqrsdcymvkldpnhfeisrzhyhhlkwdzthgprvkpyldeysvbmcibqkpudyrraqdlxpjecvwcvuiklcrsbgvqasmxmtxqzmawcjtozioqlfflinnxpeexbzloaeqjvglbdeufultpjqexvjjjkzemtzuzmxvawilcqdrcjzpqyhtwfphuonzwkotthsaxrmwtnlmcdylxqcfffyndqeouztluqwlhnkkvzwcfiscikv",
"output": "YES"
},
{
"input": "plqaykgovxkvsiahdbglktdlhcqwelxxmtlyymrsyubxdskvyjkrowvcbpdofpjqspsrgpakdczletxujzlsegepzleipiyycpinzxgwjsgslnxsotouddgfcybozfpjhhocpybfjbaywsehbcfrayvancbrumdfngqytnhihyxnlvilrqyhnxeckprqafofelospffhtwguzjbbjlzbqrtiielbvzutzgpqxosiaqznndgobcluuqlhmffiowkjdlkokehtjdyjvmxsiyxureflmdomerfekxdvtitvwzmdsdzplkpbtafxqfpudnhfqpoiwvjnylanunmagoweobdvfjgepbsymfutrjarlxclhgavpytiiqwvojrptofuvlohzeguxdsrihsbucelhhuedltnnjgzxwyblbqvnoliiydfinzlogbvucwykryzcyibnniggbkdkdcdgcsbvvnavtyhtkanrblpvomvjs",
"output": "YES"
},
{
"input": "fbldqzggeunkpwcfirxanmntbfrudijltoertsdvcvcmbwodbibsrxendzebvxwydpasaqnisrijctsuatihxxygbeovhxjdptdcppkvfytdpjspvrannxavmkmisqtygntxkdlousdypyfkrpzapysfpdbyprufwzhunlsfugojddkmxzinatiwfxdqmgyrnjnxvrclhxyuwxtshoqdjptmeecvgmrlvuwqtmnfnfeeiwcavwnqmyustawbjodzwsqmnjxhpqmgpysierlwbbdzcwprpsexyvreewcmlbvaiytjlxdqdaqftefdlmtmmjcwvfejshymhnouoshdzqcwzxpzupkbcievodzqkqvyjuuxxwepxjalvkzufnveji",
"output": "YES"
},
{
"input": "htsyljgoelbbuipivuzrhmfpkgderqpoprlxdpasxhpmxvaztccldtmujjzjmcpdvsdghzpretlsyyiljhjznseaacruriufswuvizwwuvdioazophhyytvbiogttnnouauxllbdn",
"output": "YES"
},
{
"input": "ikmxzqdzxqlvgeojsnhqzciujslwjyzzexnregabdqztpplosdakimjxmuqccbnwvzbajoiqgdobccwnrwmixohrbdarhoeeelzbpigiybtesybwefpcfx",
"output": "YES"
},
{
"input": "bpvbpjvbdfiodsmahxpcubjxdykesubnypalhypantshkjffmxjmelblqnjdmtaltneuyudyevkgedkqrdmrfeemgpghwrifcwincfixokfgurhqbcfzeajrgkgpwqwsepudxulywowwxzdxkumsicsvnzfxspmjpaixgejeaoyoibegosqoyoydmphfpbutrrewyjecowjckvpcceoamtfbitdneuwqfvnagswlskmsmkhmxyfsrpqwhxzocyffiumcy",
"output": "YES"
},
{
"input": "vllsexwrazvlfvhvrtqeohvzzresjdiuhomfpgqcxpqdevplecuaepixhlijatxzegciizpvyvxuembiplwklahlqibykfideysjygagjbgqkbhdhkatddcwlxboinfuomnpc",
"output": "YES"
},
{
"input": "pnjdwpxmvfoqkjtbhquqcuredrkwqzzfjmdvpnbqtypzdovemhhclkvigjvtprrpzbrbcbatkucaqteuciuozytsptvsskkeplaxdaqmjkmef",
"output": "NO"
},
{
"input": "jpwfhvlxvsdhtuozvlmnfiotrgapgjxtcsgcjnodcztupysvvvmjpzqkpommadppdrykuqkcpzojcwvlogvkddedwbggkrhuvtsvdiokehlkdlnukcufjvqxnikcdawvexxwffxtriqbdmkahxdtygodzohwtdmmuvmatdkvweqvaehaxiefpevkvqpyxsrhtmgjsdfcwzqobibeduooldrmglbinrepmunizheqzvgqvpdskhxfidxfnbisyizhepwyrcykcmjxnkyfjgrqlkixcvysa",
"output": "YES"
},
{
"input": "aftcrvuumeqbfvaqlltscnuhkpcifrrhnutjinxdhhdbzvizlrapzjdatuaynoplgjketupgaejciosofuhcgcjdcucarfvtsofgubtphijciswsvidnvpztlaarydkeqxzwdhfbmullkimerukusbrdnnujviydldrwhdfllsjtziwfeaiqotbiprespmxjulnyunkdtcghrzvhtcychkwatqqmladxpvmvlkzscthylbzkpgwlzfjqwarqvdeyngekqvrhrftpxnkfcibbowvnqdkulcdydspcubwlgoyinpnzgidbgunparnueddzwtzdiavbprbbg",
"output": "YES"
},
{
"input": "oagjghsidigeh",
"output": "NO"
},
{
"input": "chdhzpfzabupskiusjoefrwmjmqkbmdgboicnszkhdrlegeqjsldurmbshijadlwsycselhlnudndpdhcnhruhhvsgbthpruiqfirxkhpqhzhqdfpyozolbionodypfcqfeqbkcgmqkizgeyyelzeoothexcoaahedgrvoemqcwccbvoeqawqeuusyjxmgjkpfwcdttfmwunzuwvsihliexlzygqcgpbdiawfvqukikhbjerjkyhpcknlndaystrgsinghlmekbvhntcpypmchcwoglsmwwdulqneuabuuuvtyrnjxfcgoothalwkzzfxakneusezgnnepkpipzromqubraiggqndliz",
"output": "YES"
},
{
"input": "lgirxqkrkgjcutpqitmffvbujcljkqardlalyigxorscczuzikoylcxenryhskoavymexysvmhbsvhtycjlmzhijpuvcjshyfeycvvcfyzytzoyvxajpqdjtfiatnvxnyeqtfcagfftafllhhjhplbdsrfpctkqpinpdfrtlzyjllfbeffputywcckupyslkbbzpgcnxgbmhtqeqqehpdaokkjtatrhyiuusjhwgiiiikxpzdueasemosmmccoakafgvxduwiuflovhhfhffgnnjhoperhhjtvocpqytjxkmrknnknqeglffhfuplopmktykxuvcmbwpoeisrlyyhdpxfvzseucofyhziuiikihpqheqdyzwigeaqzhxzvporgisxgvhyicqyejovqloibhbunsvsunpvmdckkbuokitdzleilfwutcvuuytpupizinfjrzhxudsmjcjyfcpfgthujjowdwtgbvi",
"output": "YES"
},
{
"input": "uuehrvufgerqbzyzksmqnewacotuimawhlbycdbsmhshrsbqwybbkwjwsrkwptvlbbwjiivqugzrxxwgidrcrhrwsmwgeoleptfamzefgaeyxouxocrpvomjrazmxrnffdwrrmblgdiabdncvfougtmjgvvazasnygdrigbsrieoonirlivfyodvulouslxosswgpdexuldmkdbpdlgutiotvxjyecbrsvbmqxrlcpcipjjncduyqtohlzybvlemmfdeubihwlwqglkgjvnwrbgydcpwklmjeewqklmqdbajqgrpnynaxfvxjzgibqerxyhnxenrmcdqaaeksbzyrcaepozqpetaurlhjuxxhwppuhgoihxdxbmxeiahyaqkbknktlzkheaarjoqqrsyeducvoygwalgarldcdlqogfvsncejssmx",
"output": "YES"
},
{
"input": "iiopulfjxoitgiusqrhgbkiyzinphjtclodbkkydetylvuimkhdkklmyoacmekdvjpuxcrvqnjhqhhbfenlpzpwijtykqziocilvtpqhxuyrphdlamawjuzgjwiebkqyrzyqgtkcrhntjxqmcgkrqcslogjegfrivzidfedeegwbbsopvxvdoididlpypjogxaodtueebbwuwilacunqpozczcgrpaxxrtogpxgfkudtxchoravrrdtimhenwmnafxaruuojduxxglefejycfcyxllfimkszmbrhcwpnwjqgwvzysmlaaifdxfjjpgjmcksiigpanappjdloiolojmcqbnpnjjzaufdpjaknylmyvolhwypygwepmqwpiglpcnpypnudhdzpdvgzosyjthzcwtytxq",
"output": "YES"
}
] | 1,633,731,471
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 31
| 0
|
v = ['h', 'e','i','d','i']
for c in s:
if c == v[0]:
v.pop(0)
if (v == []):
print("YES")
else:
print("NO")
|
Title: Fake News (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
Input Specification:
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
Output Specification:
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
Demo Input:
['abcheaibcdi\n', 'hiedi\n']
Demo Output:
['YES', 'NO']
Note:
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
|
```python
v = ['h', 'e','i','d','i']
for c in s:
if c == v[0]:
v.pop(0)
if (v == []):
print("YES")
else:
print("NO")
```
| -1
|
|
822
|
A
|
I'm bored with life
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"number theory"
] | null | null |
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
|
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
|
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
|
[
"4 3\n"
] |
[
"6\n"
] |
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
| 500
|
[
{
"input": "4 3",
"output": "6"
},
{
"input": "10 399603090",
"output": "3628800"
},
{
"input": "6 973151934",
"output": "720"
},
{
"input": "2 841668075",
"output": "2"
},
{
"input": "7 415216919",
"output": "5040"
},
{
"input": "3 283733059",
"output": "6"
},
{
"input": "11 562314608",
"output": "39916800"
},
{
"input": "3 990639260",
"output": "6"
},
{
"input": "11 859155400",
"output": "39916800"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "5 3",
"output": "6"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "5 4",
"output": "24"
},
{
"input": "1 12",
"output": "1"
},
{
"input": "9 7",
"output": "5040"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "6 11",
"output": "720"
},
{
"input": "6 7",
"output": "720"
},
{
"input": "11 11",
"output": "39916800"
},
{
"input": "4 999832660",
"output": "24"
},
{
"input": "7 999228288",
"output": "5040"
},
{
"input": "11 999257105",
"output": "39916800"
},
{
"input": "11 999286606",
"output": "39916800"
},
{
"input": "3 999279109",
"output": "6"
},
{
"input": "999632727 11",
"output": "39916800"
},
{
"input": "999625230 7",
"output": "5040"
},
{
"input": "999617047 3",
"output": "6"
},
{
"input": "999646548 7",
"output": "5040"
},
{
"input": "999639051 3",
"output": "6"
},
{
"input": "12 12",
"output": "479001600"
},
{
"input": "12 1",
"output": "1"
},
{
"input": "1213 5",
"output": "120"
},
{
"input": "8 9",
"output": "40320"
},
{
"input": "12 9",
"output": "362880"
},
{
"input": "12 1000000000",
"output": "479001600"
},
{
"input": "1000000000 1",
"output": "1"
},
{
"input": "12 13",
"output": "479001600"
},
{
"input": "2 29845",
"output": "2"
},
{
"input": "10 21",
"output": "3628800"
},
{
"input": "12 20",
"output": "479001600"
},
{
"input": "15 12",
"output": "479001600"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000 12",
"output": "479001600"
},
{
"input": "11 30",
"output": "39916800"
},
{
"input": "17 12",
"output": "479001600"
},
{
"input": "4 19",
"output": "24"
},
{
"input": "12 15",
"output": "479001600"
},
{
"input": "20 6",
"output": "720"
},
{
"input": "10 20",
"output": "3628800"
},
{
"input": "10 10",
"output": "3628800"
},
{
"input": "22 12",
"output": "479001600"
},
{
"input": "20 12",
"output": "479001600"
},
{
"input": "12 23",
"output": "479001600"
},
{
"input": "12 22",
"output": "479001600"
},
{
"input": "18 3",
"output": "6"
},
{
"input": "14 10",
"output": "3628800"
},
{
"input": "14 12",
"output": "479001600"
},
{
"input": "8 3",
"output": "6"
},
{
"input": "5 5",
"output": "120"
}
] | 1,691,506,196
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
import math
def GCD(A,B):
while B:
A,B = B,A % B
return A
def factorial(A,B):
return factorial_gcd(min(A,B)
def factorial_gcd(N):
if(N == 0):
return 1
return N * factorial_gcd(N -1)
A,B = map(int,input().split())
result = factorial(A,B)
print(result)
|
Title: I'm bored with life
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
Input Specification:
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
Output Specification:
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
Demo Input:
['4 3\n']
Demo Output:
['6\n']
Note:
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
|
```python
import math
def GCD(A,B):
while B:
A,B = B,A % B
return A
def factorial(A,B):
return factorial_gcd(min(A,B)
def factorial_gcd(N):
if(N == 0):
return 1
return N * factorial_gcd(N -1)
A,B = map(int,input().split())
result = factorial(A,B)
print(result)
```
| -1
|
|
43
|
A
|
Football
|
PROGRAMMING
| 1,000
|
[
"strings"
] |
A. Football
|
2
|
256
|
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
|
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
|
[
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] |
[
"ABC\n",
"A\n"
] |
none
| 500
|
[
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,692,777,990
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 124
| 307,200
|
from collections import Counter
n = int(input())
li =[]
for i in range(n):
t=input()
li.append(t)
c = Counter(li)
t = max(c, key=c.get)
print(t)
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none
|
```python
from collections import Counter
n = int(input())
li =[]
for i in range(n):
t=input()
li.append(t)
c = Counter(li)
t = max(c, key=c.get)
print(t)
```
| 3.968428
|
43
|
A
|
Football
|
PROGRAMMING
| 1,000
|
[
"strings"
] |
A. Football
|
2
|
256
|
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
|
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
|
[
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] |
[
"ABC\n",
"A\n"
] |
none
| 500
|
[
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,628,157,350
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 2
| 92
| 6,963,200
|
n = int(input())
g = {}
if n == 1:
print(input())
quit()
for i in range(n):
t = input()
if t not in g:
g[t] = 0
g[t] += 1
teams = list(g.keys())
goals = list(g.values())
print(teams[0] if goals[0] > goals[1] else teams[1])
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none
|
```python
n = int(input())
g = {}
if n == 1:
print(input())
quit()
for i in range(n):
t = input()
if t not in g:
g[t] = 0
g[t] += 1
teams = list(g.keys())
goals = list(g.values())
print(teams[0] if goals[0] > goals[1] else teams[1])
```
| -1
|
822
|
A
|
I'm bored with life
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"number theory"
] | null | null |
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
|
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
|
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
|
[
"4 3\n"
] |
[
"6\n"
] |
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
| 500
|
[
{
"input": "4 3",
"output": "6"
},
{
"input": "10 399603090",
"output": "3628800"
},
{
"input": "6 973151934",
"output": "720"
},
{
"input": "2 841668075",
"output": "2"
},
{
"input": "7 415216919",
"output": "5040"
},
{
"input": "3 283733059",
"output": "6"
},
{
"input": "11 562314608",
"output": "39916800"
},
{
"input": "3 990639260",
"output": "6"
},
{
"input": "11 859155400",
"output": "39916800"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "5 3",
"output": "6"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "5 4",
"output": "24"
},
{
"input": "1 12",
"output": "1"
},
{
"input": "9 7",
"output": "5040"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "6 11",
"output": "720"
},
{
"input": "6 7",
"output": "720"
},
{
"input": "11 11",
"output": "39916800"
},
{
"input": "4 999832660",
"output": "24"
},
{
"input": "7 999228288",
"output": "5040"
},
{
"input": "11 999257105",
"output": "39916800"
},
{
"input": "11 999286606",
"output": "39916800"
},
{
"input": "3 999279109",
"output": "6"
},
{
"input": "999632727 11",
"output": "39916800"
},
{
"input": "999625230 7",
"output": "5040"
},
{
"input": "999617047 3",
"output": "6"
},
{
"input": "999646548 7",
"output": "5040"
},
{
"input": "999639051 3",
"output": "6"
},
{
"input": "12 12",
"output": "479001600"
},
{
"input": "12 1",
"output": "1"
},
{
"input": "1213 5",
"output": "120"
},
{
"input": "8 9",
"output": "40320"
},
{
"input": "12 9",
"output": "362880"
},
{
"input": "12 1000000000",
"output": "479001600"
},
{
"input": "1000000000 1",
"output": "1"
},
{
"input": "12 13",
"output": "479001600"
},
{
"input": "2 29845",
"output": "2"
},
{
"input": "10 21",
"output": "3628800"
},
{
"input": "12 20",
"output": "479001600"
},
{
"input": "15 12",
"output": "479001600"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000 12",
"output": "479001600"
},
{
"input": "11 30",
"output": "39916800"
},
{
"input": "17 12",
"output": "479001600"
},
{
"input": "4 19",
"output": "24"
},
{
"input": "12 15",
"output": "479001600"
},
{
"input": "20 6",
"output": "720"
},
{
"input": "10 20",
"output": "3628800"
},
{
"input": "10 10",
"output": "3628800"
},
{
"input": "22 12",
"output": "479001600"
},
{
"input": "20 12",
"output": "479001600"
},
{
"input": "12 23",
"output": "479001600"
},
{
"input": "12 22",
"output": "479001600"
},
{
"input": "18 3",
"output": "6"
},
{
"input": "14 10",
"output": "3628800"
},
{
"input": "14 12",
"output": "479001600"
},
{
"input": "8 3",
"output": "6"
},
{
"input": "5 5",
"output": "120"
}
] | 1,670,685,020
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 59
| 46
| 0
|
import math
ab = input().split()
a = max(int(ab[0]),int(ab[1]))
b = min(int(ab[0]),int(ab[1]))
A,B =1,1
for i in range(1,b+1):
B*=i
for i in range(1,a+1):
A*=i
if A%B==0 :
break
print(math.gcd(A,B))
|
Title: I'm bored with life
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
Input Specification:
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
Output Specification:
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
Demo Input:
['4 3\n']
Demo Output:
['6\n']
Note:
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
|
```python
import math
ab = input().split()
a = max(int(ab[0]),int(ab[1]))
b = min(int(ab[0]),int(ab[1]))
A,B =1,1
for i in range(1,b+1):
B*=i
for i in range(1,a+1):
A*=i
if A%B==0 :
break
print(math.gcd(A,B))
```
| 3
|
|
659
|
C
|
Tanya and Toys
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation"
] | null | null |
In Berland recently a new collection of toys went on sale. This collection consists of 109 types of toys, numbered with integers from 1 to 109. A toy from the new collection of the *i*-th type costs *i* bourles.
Tania has managed to collect *n* different types of toys *a*1,<=*a*2,<=...,<=*a**n* from the new collection. Today is Tanya's birthday, and her mother decided to spend no more than *m* bourles on the gift to the daughter. Tanya will choose several different types of toys from the new collection as a gift. Of course, she does not want to get a type of toy which she already has.
Tanya wants to have as many distinct types of toys in her collection as possible as the result. The new collection is too diverse, and Tanya is too little, so she asks you to help her in this.
|
The first line contains two integers *n* (1<=≤<=*n*<=≤<=100<=000) and *m* (1<=≤<=*m*<=≤<=109) — the number of types of toys that Tanya already has and the number of bourles that her mom is willing to spend on buying new toys.
The next line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the types of toys that Tanya already has.
|
In the first line print a single integer *k* — the number of different types of toys that Tanya should choose so that the number of different types of toys in her collection is maximum possible. Of course, the total cost of the selected toys should not exceed *m*.
In the second line print *k* distinct space-separated integers *t*1,<=*t*2,<=...,<=*t**k* (1<=≤<=*t**i*<=≤<=109) — the types of toys that Tanya should choose.
If there are multiple answers, you may print any of them. Values of *t**i* can be printed in any order.
|
[
"3 7\n1 3 4\n",
"4 14\n4 6 12 8\n"
] |
[
"2\n2 5 \n",
"4\n7 2 3 1\n"
] |
In the first sample mom should buy two toys: one toy of the 2-nd type and one toy of the 5-th type. At any other purchase for 7 bourles (assuming that the toys of types 1, 3 and 4 have already been bought), it is impossible to buy two and more toys.
| 1,000
|
[
{
"input": "3 7\n1 3 4",
"output": "2\n2 5 "
},
{
"input": "4 14\n4 6 12 8",
"output": "4\n1 2 3 5 "
},
{
"input": "5 6\n97746 64770 31551 96547 65684",
"output": "3\n1 2 3 "
},
{
"input": "10 10\n94125 56116 29758 94024 29289 31663 99794 35076 25328 58656",
"output": "4\n1 2 3 4 "
},
{
"input": "30 38\n9560 64176 75619 53112 54160 68775 12655 13118 99502 89757 78434 42521 19210 1927 34097 5416 56110 44786 59126 44266 79240 65567 54602 25325 37171 2879 89291 89121 39568 28162",
"output": "8\n1 2 3 4 5 6 7 8 "
},
{
"input": "1 999999298\n85187",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "1 999999119\n34421",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "1 1000000000\n1",
"output": "44719\n2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "1 1000000000\n44720",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "1 1000000000\n44719",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "1 1000000000\n44721",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "3 1000000000\n123456789 234567891 345678912",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "2 5\n999999999 1000000000",
"output": "2\n1 2 "
},
{
"input": "2 1000000000\n1 1000000000",
"output": "44719\n2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "3 100000\n1000000000 100000000 1",
"output": "445\n2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 ..."
},
{
"input": "5 5\n100000000 200000000 300000000 400000000 1000000000",
"output": "2\n1 2 "
},
{
"input": "6 3\n1 2 3 4 5 6",
"output": "0"
},
{
"input": "2 1\n1 2",
"output": "0"
},
{
"input": "1 1000000000\n1000000000",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "5 1000000\n1000000000 100000000 10000000 99999999 123456789",
"output": "1413\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "2 10000000\n1234567 123456",
"output": "4471\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "1 1\n1000000000",
"output": "1\n1 "
},
{
"input": "1 1000000000\n9999999",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "5 10000\n1000000000 888888888 777777777 666666666 959595959",
"output": "140\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 "
},
{
"input": "3 1\n1000000000 999999999 999999998",
"output": "1\n1 "
},
{
"input": "5 100000000\n100000000 999999999 1 2 3",
"output": "14138\n4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 15..."
},
{
"input": "3 55\n100000000 1000000000 999999999",
"output": "10\n1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "2 10\n5 10000009",
"output": "4\n1 2 3 4 "
},
{
"input": "3 10000000\n999999999 999999998 999999997",
"output": "4471\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "1 1100\n1000000000",
"output": "46\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 "
},
{
"input": "1 40\n1000000000",
"output": "8\n1 2 3 4 5 6 7 8 "
}
] | 1,572,981,801
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 7
| 170
| 5,324,800
|
x,y=map(int,input().split())
a=list(map(int,input().split()))
i=1
j=0
lol=[]
while y>=i:
if j<len(a):
if a[j]==i:
j+=1
i+=1
else:
lol.append(i)
y-=i
i+=1
else:
lol.append(i)
y-=i
i+=1
print(len(lol))
print(*lol)
|
Title: Tanya and Toys
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In Berland recently a new collection of toys went on sale. This collection consists of 109 types of toys, numbered with integers from 1 to 109. A toy from the new collection of the *i*-th type costs *i* bourles.
Tania has managed to collect *n* different types of toys *a*1,<=*a*2,<=...,<=*a**n* from the new collection. Today is Tanya's birthday, and her mother decided to spend no more than *m* bourles on the gift to the daughter. Tanya will choose several different types of toys from the new collection as a gift. Of course, she does not want to get a type of toy which she already has.
Tanya wants to have as many distinct types of toys in her collection as possible as the result. The new collection is too diverse, and Tanya is too little, so she asks you to help her in this.
Input Specification:
The first line contains two integers *n* (1<=≤<=*n*<=≤<=100<=000) and *m* (1<=≤<=*m*<=≤<=109) — the number of types of toys that Tanya already has and the number of bourles that her mom is willing to spend on buying new toys.
The next line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the types of toys that Tanya already has.
Output Specification:
In the first line print a single integer *k* — the number of different types of toys that Tanya should choose so that the number of different types of toys in her collection is maximum possible. Of course, the total cost of the selected toys should not exceed *m*.
In the second line print *k* distinct space-separated integers *t*1,<=*t*2,<=...,<=*t**k* (1<=≤<=*t**i*<=≤<=109) — the types of toys that Tanya should choose.
If there are multiple answers, you may print any of them. Values of *t**i* can be printed in any order.
Demo Input:
['3 7\n1 3 4\n', '4 14\n4 6 12 8\n']
Demo Output:
['2\n2 5 \n', '4\n7 2 3 1\n']
Note:
In the first sample mom should buy two toys: one toy of the 2-nd type and one toy of the 5-th type. At any other purchase for 7 bourles (assuming that the toys of types 1, 3 and 4 have already been bought), it is impossible to buy two and more toys.
|
```python
x,y=map(int,input().split())
a=list(map(int,input().split()))
i=1
j=0
lol=[]
while y>=i:
if j<len(a):
if a[j]==i:
j+=1
i+=1
else:
lol.append(i)
y-=i
i+=1
else:
lol.append(i)
y-=i
i+=1
print(len(lol))
print(*lol)
```
| 0
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
It was recycling day in Kekoland. To celebrate it Adil and Bera went to Central Perk where they can take bottles from the ground and put them into a recycling bin.
We can think Central Perk as coordinate plane. There are *n* bottles on the ground, the *i*-th bottle is located at position (*x**i*,<=*y**i*). Both Adil and Bera can carry only one bottle at once each.
For both Adil and Bera the process looks as follows:
1. Choose to stop or to continue to collect bottles. 1. If the choice was to continue then choose some bottle and walk towards it. 1. Pick this bottle and walk to the recycling bin. 1. Go to step 1.
Adil and Bera may move independently. They are allowed to pick bottles simultaneously, all bottles may be picked by any of the two, it's allowed that one of them stays still while the other one continues to pick bottles.
They want to organize the process such that the total distance they walk (the sum of distance walked by Adil and distance walked by Bera) is minimum possible. Of course, at the end all bottles should lie in the recycling bin.
|
First line of the input contains six integers *a**x*, *a**y*, *b**x*, *b**y*, *t**x* and *t**y* (0<=≤<=*a**x*,<=*a**y*,<=*b**x*,<=*b**y*,<=*t**x*,<=*t**y*<=≤<=109) — initial positions of Adil, Bera and recycling bin respectively.
The second line contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of bottles on the ground.
Then follow *n* lines, each of them contains two integers *x**i* and *y**i* (0<=≤<=*x**i*,<=*y**i*<=≤<=109) — position of the *i*-th bottle.
It's guaranteed that positions of Adil, Bera, recycling bin and all bottles are distinct.
|
Print one real number — the minimum possible total distance Adil and Bera need to walk in order to put all bottles into recycling bin. Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6.
Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if .
|
[
"3 1 1 2 0 0\n3\n1 1\n2 1\n2 3\n",
"5 0 4 2 2 0\n5\n5 2\n3 0\n5 5\n3 5\n3 3\n"
] |
[
"11.084259940083\n",
"33.121375178000\n"
] |
Consider the first sample.
Adil will use the following path: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/37eea809c04afe04f2670475cc5b21df4a90afd1.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
Bera will use the following path: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/08e917ff238fec015f897516a95529b6d9aed5c7.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
Adil's path will be <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f58aa00f71a0b723b5de3c8e56ce41dc8afec7f8.png" style="max-width: 100.0%;max-height: 100.0%;"/> units long, while Bera's path will be <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/3615db76a2cdd77d711b73d2894f03bdd52af736.png" style="max-width: 100.0%;max-height: 100.0%;"/> units long.
| 0
|
[
{
"input": "3 1 1 2 0 0\n3\n1 1\n2 1\n2 3",
"output": "11.084259940083"
},
{
"input": "5 0 4 2 2 0\n5\n5 2\n3 0\n5 5\n3 5\n3 3",
"output": "33.121375178000"
},
{
"input": "107 50 116 37 104 118\n12\n16 78\n95 113\n112 84\n5 88\n54 85\n112 80\n19 98\n25 14\n48 76\n95 70\n77 94\n38 32",
"output": "1576.895607473206"
},
{
"input": "446799 395535 281981 494983 755701 57488\n20\n770380 454998\n147325 211816\n818964 223521\n408463 253399\n49120 253709\n478114 283776\n909705 631953\n303154 889956\n126532 258846\n597028 708070\n147061 192478\n39515 879057\n911737 878857\n26966 701951\n616099 715301\n998385 735514\n277633 346417\n642301 188888\n617247 256225\n668067 352814",
"output": "22423982.398765542000"
},
{
"input": "0 0 214409724 980408402 975413181 157577991\n4\n390610378 473484159\n920351980 785918656\n706277914 753279807\n159291646 213569247",
"output": "4854671149.842136400000"
},
{
"input": "214409724 980408402 0 0 975413181 157577991\n4\n390610378 473484159\n920351980 785918656\n706277914 753279807\n159291646 213569247",
"output": "4854671149.842136400000"
},
{
"input": "383677880 965754167 658001115 941943959 0 0\n10\n9412 5230\n4896 7518\n3635 6202\n2365 1525\n241 1398\n7004 5166\n1294 9162\n3898 6706\n6135 8199\n4195 4410",
"output": "1039303750.884648200000"
},
{
"input": "825153337 326797826 774256604 103765336 0 0\n21\n6537 9734\n3998 8433\n560 7638\n1937 2557\n3487 244\n8299 4519\n73 9952\n2858 3719\n9267 5675\n9584 7636\n9234 1049\n7415 6018\n7653 9345\n7752 9628\n7476 8917\n7207 2352\n2602 4612\n1971 3307\n5530 3694\n2393 8573\n7506 9810",
"output": "781520533.726828810000"
},
{
"input": "214409724 980408402 975413181 157577991 0 0\n4\n3721 6099\n5225 4247\n940 340\n8612 7341",
"output": "988090959.937532070000"
},
{
"input": "235810013 344493922 0 0 975204641 211157253\n18\n977686151 621301932\n408277582 166435161\n595105725 194278844\n967498841 705149530\n551735395 659209387\n492239556 317614998\n741520864 843275770\n585383143 903832112\n272581169 285871890\n339100580 134101148\n920610054 824829107\n657996186 852771589\n948065129 573712142\n615254670 698346010\n365251531 883011553\n304877602 625498272\n418150850 280945187\n731399551 643859052",
"output": "20756961047.556908000000"
},
{
"input": "0 0 1 1 2 2\n1\n1 3",
"output": "3.414213562373"
},
{
"input": "10000 1000 151 121 10 10\n2\n1 1\n2 2",
"output": "227.449066182313"
},
{
"input": "5 5 10 10 15 15\n2\n1 1\n11 11",
"output": "32.526911934581"
},
{
"input": "1000000 1000000 1 1 0 0\n1\n2 2",
"output": "4.242640687119"
},
{
"input": "100 0 0 1 0 0\n2\n1 1\n1 2",
"output": "6.478708664619"
},
{
"input": "0 0 1000000000 1000000000 1 1\n2\n0 1\n1 0",
"output": "4.000000000000"
},
{
"input": "1000 1000 0 0 1 1\n1\n2 2",
"output": "4.242640687119"
},
{
"input": "1 0 1000000 0 0 0\n2\n1 1\n2 2",
"output": "7.892922226992"
},
{
"input": "3 0 100 100 0 0\n2\n1 0\n2 0",
"output": "5.000000000000"
},
{
"input": "0 100 0 101 0 0\n1\n0 99",
"output": "100.000000000000"
},
{
"input": "1000 1000 3 3 0 0\n2\n1 0\n0 1",
"output": "6.605551275464"
},
{
"input": "0 5 0 6 0 7\n1\n0 100",
"output": "187.000000000000"
},
{
"input": "1 1 1000000 1000000 0 0\n2\n1 2\n2 1",
"output": "7.708203932499"
},
{
"input": "1 0 10000000 1000000 0 0\n2\n1 1\n2 2",
"output": "7.892922226992"
},
{
"input": "2 2 10 2 6 5\n2\n6 2\n5 5",
"output": "9.000000000000"
},
{
"input": "100000001 100000001 100000000 100000000 1 1\n1\n1 0",
"output": "141421356.530202720000"
},
{
"input": "1000 1000 1001 1001 0 0\n2\n1 1\n2 2",
"output": "1417.041989497841"
},
{
"input": "1000000000 1000000000 999999999 999999999 1 1\n4\n1 2\n1 3\n2 2\n2 3",
"output": "1414213568.487842800000"
},
{
"input": "0 100 1 1 1 0\n2\n2 1\n0 1",
"output": "5.242640687119"
},
{
"input": "0 100 0 1 0 0\n5\n0 2\n0 3\n0 4\n0 5\n0 6",
"output": "39.000000000000"
},
{
"input": "100 0 0 100 0 0\n2\n0 1\n1 0",
"output": "102.000000000000"
},
{
"input": "0 0 1000000 1000000 0 1\n2\n1 1\n2 2",
"output": "6.886349517373"
},
{
"input": "0 0 1000 1000 1 0\n2\n1 1\n1 2",
"output": "6.236067977500"
},
{
"input": "1 0 100000 100000 0 0\n1\n2 0",
"output": "3.000000000000"
},
{
"input": "5 5 5 4 4 5\n2\n3 4\n3 5",
"output": "5.414213562373"
},
{
"input": "10000 10000 9000 9000 0 0\n3\n1 1\n2 2\n3 3",
"output": "12736.407342732093"
},
{
"input": "1 1 1000 1000 0 0\n3\n2 2\n3 3\n4 4",
"output": "24.041630560343"
},
{
"input": "7 0 8 0 0 0\n2\n1 0\n1 1",
"output": "9.496976092671"
},
{
"input": "1 3 3 3 2 1\n2\n2 3\n3 1",
"output": "5.000000000000"
},
{
"input": "1 2 3 4 5 6\n1\n1 1",
"output": "7.403124237433"
},
{
"input": "1000000000 1000000000 0 0 1 1\n5\n2 2\n2 3\n2 4\n2 5\n2 6",
"output": "33.294904485247"
},
{
"input": "2 1 1 2 0 0\n1\n1 1",
"output": "2.414213562373"
},
{
"input": "1 0 100000 0 0 0\n2\n1 1\n2 2",
"output": "7.892922226992"
},
{
"input": "0 100 1 100 1 0\n2\n2 1\n0 1",
"output": "103.242640687119"
},
{
"input": "0 0 2 0 1 5\n2\n1 0\n1 20",
"output": "36.000000000000"
},
{
"input": "1000 1000 999 999 0 0\n2\n1 0\n0 1",
"output": "1415.092419071783"
},
{
"input": "5 0 1000 1000 2 0\n2\n4 0\n6 7",
"output": "19.124515496597"
},
{
"input": "10000 0 1000000 0 0 0\n2\n1 1\n2 2",
"output": "10003.657054289499"
},
{
"input": "0 100 0 101 0 0\n2\n0 1\n0 2",
"output": "102.000000000000"
},
{
"input": "0 0 10000 10000 1 0\n2\n2 0\n3 0",
"output": "7.000000000000"
},
{
"input": "3 1 1 2 0 0\n1\n1 1",
"output": "2.414213562373"
},
{
"input": "1000 0 0 1000 0 0\n2\n1 0\n0 1",
"output": "1002.000000000000"
},
{
"input": "1 1 1000000 1000000 0 0\n2\n2 1\n1 2",
"output": "7.708203932499"
},
{
"input": "1000 1000 2000 2000 1 1\n3\n2 2\n1 2\n3 3",
"output": "1417.627775935468"
},
{
"input": "0 0 1000000000 1000000000 1 1\n4\n2 2\n3 3\n4 4\n5 5",
"output": "29.698484809835"
},
{
"input": "10000000 1 2 1 1 1\n3\n1 3\n1 4\n1 5",
"output": "18.123105625618"
},
{
"input": "3 7 5 7 4 4\n2\n4 6\n4 0",
"output": "11.414213562373"
},
{
"input": "0 0 3 0 1 5\n2\n1 0\n1 20",
"output": "36.000000000000"
},
{
"input": "0 0 0 1 1000 3\n2\n1000 2\n1000 1",
"output": "1004.000000000000"
},
{
"input": "1000000000 0 0 1 0 0\n2\n0 2\n0 3",
"output": "9.000000000000"
},
{
"input": "0 1000000000 1000000000 0 0 0\n1\n1 1",
"output": "1000000000.414213500000"
},
{
"input": "1000 1000 1000 1001 0 0\n2\n0 1\n1 1",
"output": "1416.213562373095"
},
{
"input": "1002 0 1001 0 0 0\n1\n1000 0",
"output": "1001.000000000000"
},
{
"input": "1002 0 1001 0 0 0\n2\n2 0\n1 0",
"output": "1003.000000000000"
},
{
"input": "3 0 0 100 0 0\n2\n1 0\n2 0",
"output": "5.000000000000"
},
{
"input": "10 10 0 0 0 1\n2\n1 0\n1 1",
"output": "4.414213562373"
},
{
"input": "1000 1000 1001 1001 0 0\n2\n0 1\n1 1",
"output": "1416.213562373095"
},
{
"input": "0 100 0 200 0 0\n2\n0 1\n0 2",
"output": "102.000000000000"
},
{
"input": "100 100 0 0 1 1\n1\n2 2",
"output": "4.242640687119"
},
{
"input": "123123 154345 123123 123123 2 2\n3\n3 3\n4 4\n5 5",
"output": "174127.873294312070"
},
{
"input": "0 1 0 2 0 0\n1\n1 0",
"output": "2.414213562373"
},
{
"input": "1 2 3 4 1000 1000\n1\n156 608",
"output": "1553.668251715911"
},
{
"input": "0 0 10 0 5 0\n3\n4 1\n5 1\n6 1",
"output": "10.365746312737"
},
{
"input": "0 0 0 1 1000000000 999999999\n1\n1000000000 1000000000",
"output": "1414213562.665988200000"
},
{
"input": "1231231 2342342 123124 123151 12315 12312\n1\n354345 234234",
"output": "664238.053973730540"
},
{
"input": "0 0 1000000 0 1 1\n2\n0 1\n3 0",
"output": "6.472135955000"
},
{
"input": "1000 1000 2000 2000 1 1\n1\n2 2",
"output": "1412.799348810722"
},
{
"input": "10 20 10 0 10 10\n2\n10 11\n10 9",
"output": "12.000000000000"
},
{
"input": "1000000000 1 1 1000000000 0 0\n1\n2 2",
"output": "1000000000.828427200000"
},
{
"input": "0 0 1000 1000 1 0\n2\n2 0\n3 0",
"output": "7.000000000000"
},
{
"input": "1000 0 100000000 100000000 0 0\n2\n999 0\n1100 0",
"output": "3198.000000000000"
},
{
"input": "2 2 1000000000 1000000000 0 0\n3\n1 1\n5 5\n100 100",
"output": "296.984848098350"
},
{
"input": "2 0 4 0 0 0\n1\n3 0",
"output": "4.000000000000"
},
{
"input": "2 2 1000 1000 0 0\n2\n1 1\n1 2",
"output": "6.064495102246"
},
{
"input": "0 0 1000000000 1000000000 0 1\n3\n1 0\n2 0\n3 0",
"output": "13.210904837709"
},
{
"input": "1 10000 10000 1 0 0\n2\n1 100\n100 1",
"output": "10200.014999625020"
},
{
"input": "5 0 6 0 0 0\n2\n2 0\n0 2",
"output": "9.000000000000"
},
{
"input": "2 4 1000000000 1000000000 0 0\n4\n2 3\n2 1\n3 2\n1 2",
"output": "20.760925736391"
},
{
"input": "0 100 1 1 0 0\n2\n0 1\n3 1",
"output": "7.162277660168"
},
{
"input": "0 0 10 0 8 2\n1\n6 0",
"output": "6.828427124746"
},
{
"input": "0 9 0 8 0 1\n1\n0 0",
"output": "9.000000000000"
},
{
"input": "100 0 0 100 0 0\n2\n40 0\n0 40",
"output": "180.000000000000"
},
{
"input": "0 0 0 1 1000 3\n2\n1000 1\n1000 2",
"output": "1004.000000000000"
},
{
"input": "1 1 123123 123123 2 2\n3\n3 3\n4 4\n5 5",
"output": "18.384776310850"
},
{
"input": "999999999 999999999 1000000000 1000000000 1 1\n1\n1 0",
"output": "1414213561.251774800000"
},
{
"input": "3 2 1 1 0 0\n1\n2 2",
"output": "3.828427124746"
},
{
"input": "0 0 1 1 100 100\n2\n101 101\n102 102",
"output": "148.492424049175"
},
{
"input": "1 15 4 10 1 1\n2\n1 10\n4 5",
"output": "22.000000000000"
},
{
"input": "100 0 0 100 0 0\n2\n60 0\n0 40",
"output": "180.000000000000"
},
{
"input": "0 0 0 1000 1 0\n4\n0 1\n0 2\n0 3\n0 4",
"output": "21.457116088945"
},
{
"input": "0 0 100 0 3 0\n1\n2 0",
"output": "3.000000000000"
},
{
"input": "0 0 100 0 98 2\n1\n98 0",
"output": "4.000000000000"
},
{
"input": "1 1 2 2 3 3\n1\n0 0",
"output": "5.656854249492"
},
{
"input": "2 2 1 1 0 0\n1\n1 2",
"output": "3.236067977500"
},
{
"input": "10000000 1 2 1 1 1\n3\n1 40\n1 20\n1 5",
"output": "124.012818406262"
},
{
"input": "1000 1000 1001 1000 0 0\n3\n1 1\n1 2\n1 3",
"output": "1421.848684511914"
},
{
"input": "10000 10000 9999 9999 0 0\n3\n0 1\n0 2\n0 3",
"output": "14147.600248963827"
}
] | 1,689,638,830
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 0
|
print("_RANDOM_GUESS_1689638830.3904395")# 1689638830.390459
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It was recycling day in Kekoland. To celebrate it Adil and Bera went to Central Perk where they can take bottles from the ground and put them into a recycling bin.
We can think Central Perk as coordinate plane. There are *n* bottles on the ground, the *i*-th bottle is located at position (*x**i*,<=*y**i*). Both Adil and Bera can carry only one bottle at once each.
For both Adil and Bera the process looks as follows:
1. Choose to stop or to continue to collect bottles. 1. If the choice was to continue then choose some bottle and walk towards it. 1. Pick this bottle and walk to the recycling bin. 1. Go to step 1.
Adil and Bera may move independently. They are allowed to pick bottles simultaneously, all bottles may be picked by any of the two, it's allowed that one of them stays still while the other one continues to pick bottles.
They want to organize the process such that the total distance they walk (the sum of distance walked by Adil and distance walked by Bera) is minimum possible. Of course, at the end all bottles should lie in the recycling bin.
Input Specification:
First line of the input contains six integers *a**x*, *a**y*, *b**x*, *b**y*, *t**x* and *t**y* (0<=≤<=*a**x*,<=*a**y*,<=*b**x*,<=*b**y*,<=*t**x*,<=*t**y*<=≤<=109) — initial positions of Adil, Bera and recycling bin respectively.
The second line contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of bottles on the ground.
Then follow *n* lines, each of them contains two integers *x**i* and *y**i* (0<=≤<=*x**i*,<=*y**i*<=≤<=109) — position of the *i*-th bottle.
It's guaranteed that positions of Adil, Bera, recycling bin and all bottles are distinct.
Output Specification:
Print one real number — the minimum possible total distance Adil and Bera need to walk in order to put all bottles into recycling bin. Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6.
Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if .
Demo Input:
['3 1 1 2 0 0\n3\n1 1\n2 1\n2 3\n', '5 0 4 2 2 0\n5\n5 2\n3 0\n5 5\n3 5\n3 3\n']
Demo Output:
['11.084259940083\n', '33.121375178000\n']
Note:
Consider the first sample.
Adil will use the following path: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/37eea809c04afe04f2670475cc5b21df4a90afd1.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
Bera will use the following path: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/08e917ff238fec015f897516a95529b6d9aed5c7.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
Adil's path will be <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f58aa00f71a0b723b5de3c8e56ce41dc8afec7f8.png" style="max-width: 100.0%;max-height: 100.0%;"/> units long, while Bera's path will be <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/3615db76a2cdd77d711b73d2894f03bdd52af736.png" style="max-width: 100.0%;max-height: 100.0%;"/> units long.
|
```python
print("_RANDOM_GUESS_1689638830.3904395")# 1689638830.390459
```
| 0
|
|
895
|
D
|
String Mark
|
PROGRAMMING
| 2,100
|
[
"combinatorics",
"math",
"strings"
] | null | null |
At the Byteland State University marks are strings of the same length. Mark *x* is considered better than *y* if string *y* is lexicographically smaller than *x*.
Recently at the BSU was an important test work on which Vasya recived the mark *a*. It is very hard for the teacher to remember the exact mark of every student, but he knows the mark *b*, such that every student recieved mark strictly smaller than *b*.
Vasya isn't satisfied with his mark so he decided to improve it. He can swap characters in the string corresponding to his mark as many times as he like. Now he want to know only the number of different ways to improve his mark so that his teacher didn't notice something suspicious.
More formally: you are given two strings *a*, *b* of the same length and you need to figure out the number of different strings *c* such that:
1) *c* can be obtained from *a* by swapping some characters, in other words *c* is a permutation of *a*.
2) String *a* is lexicographically smaller than *c*.
3) String *c* is lexicographically smaller than *b*.
For two strings *x* and *y* of the same length it is true that *x* is lexicographically smaller than *y* if there exists such *i*, that *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=...,<=*x**i*<=-<=1<==<=*y**i*<=-<=1,<=*x**i*<=<<=*y**i*.
Since the answer can be very large, you need to find answer modulo 109<=+<=7.
|
First line contains string *a*, second line contains string *b*. Strings *a*,<=*b* consist of lowercase English letters. Their lengths are equal and don't exceed 106.
It is guaranteed that *a* is lexicographically smaller than *b*.
|
Print one integer — the number of different strings satisfying the condition of the problem modulo 109<=+<=7.
|
[
"abc\nddd\n",
"abcdef\nabcdeg\n",
"abacaba\nubuduba\n"
] |
[
"5\n",
"0\n",
"64\n"
] |
In first sample from string *abc* can be obtained strings *acb*, *bac*, *bca*, *cab*, *cba*, all of them are larger than *abc*, but smaller than *ddd*. So the answer is 5.
In second sample any string obtained from *abcdef* is larger than *abcdeg*. So the answer is 0.
| 2,000
|
[
{
"input": "abc\nddd",
"output": "5"
},
{
"input": "abcdef\nabcdeg",
"output": "0"
},
{
"input": "abacaba\nubuduba",
"output": "64"
},
{
"input": "aac\nbbb",
"output": "1"
},
{
"input": "aaaccc\nbbbbbb",
"output": "9"
},
{
"input": "aaaaaa\nzzzzzz",
"output": "0"
},
{
"input": "abcde\nzzzzz",
"output": "119"
},
{
"input": "a\nc",
"output": "0"
},
{
"input": "aaa\nccc",
"output": "0"
},
{
"input": "abacabadaba\ndabacabaaba",
"output": "5586"
},
{
"input": "ujfawuezgiy\nvuqvvsivvwe",
"output": "1730501"
},
{
"input": "jvmzmvqexcqycjcpuqimvyovcffrdwtexpqhxswzytoaokvnexkzgycpmbgvsnyifkwvfbirtwnprmrlotlnhkogjlmxmgruklcuqstwfwoswux\nvzsmohqcjpzdhfyjbljviodktdsfbmaujgtsryzlcwdvccykofgxibzrxoqrvfarjduntkenwwqwuvzzxamztghkusejmucljoedfrqpcwunkru",
"output": "845854724"
},
{
"input": "izybggxalv\nrbqjamqnyg",
"output": "183497"
},
{
"input": "wdtzolgzsx\nxnlokxihzw",
"output": "229771"
},
{
"input": "hoazcxoypk\njdmafdaqwm",
"output": "116556"
},
{
"input": "qdgvzritpdtoqkq\nvlulirhbfjbcmdp",
"output": "862600433"
},
{
"input": "qszbyqbjgs\nqszbyqbjgt",
"output": "0"
},
{
"input": "ftmhkyguxvbuqaiuxbmj\nftmhkyguxvbuqaiuxbmk",
"output": "0"
},
{
"input": "dkvctjuqhtotnlwkoiaegcbsigoqvfbjtbhsniksnsauinmcoffbyberonxcpsucpacnaopnjfytkbaqpsxvjppjxzcsrlqkufjt\ndkvctjuqhtotnlwkoiaegcbsigoqvfbjtbhsniksnsauinmcoffbyberonxcpsucpacnaopnjfytkbaqpsxvjppjxzcsrlqkufju",
"output": "0"
},
{
"input": "acehlmnssx\nzzzzzzzzzz",
"output": "1814399"
},
{
"input": "acceeffghhijjjklmmoqqqssstuuwwxyy\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz",
"output": "615090736"
},
{
"input": "aaaabbbcccdeeffffgghhhiiiiijjjjjjjkklllmmnnnnnnooopppqqqqssttuuvvvvwwwxyyzzzzzz\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz",
"output": "56953494"
},
{
"input": "aaaabbbccddddeeeeffffffggggggghhhiijjjjjjjkkkllmmmmmmmmmnnnopppppppqqqqrrrrsssttttuuuuuvvvvvvwwwwwxxxxxyyyyyyyzzz\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz",
"output": "362472550"
}
] | 1,511,719,030
| 6,730
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
PRETESTS
| 9
| 4,000
| 43,315,200
|
import itertools
A = str(input())
b = str(input())
arr = []
def toString(List):
return ''.join(List)
def permute(a, l, r):
if l == r:
if b > toString(a) > A:
arr.append(toString(a))
else:
for i in range(l, r + 1):
a[l], a[i] = a[i], a[l]
permute(a, l + 1, r)
a[l], a[i] = a[i], a[l] # backtrack
permute(list(A), 0, len(A) - 1)
print(len(set(arr)))
|
Title: String Mark
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
At the Byteland State University marks are strings of the same length. Mark *x* is considered better than *y* if string *y* is lexicographically smaller than *x*.
Recently at the BSU was an important test work on which Vasya recived the mark *a*. It is very hard for the teacher to remember the exact mark of every student, but he knows the mark *b*, such that every student recieved mark strictly smaller than *b*.
Vasya isn't satisfied with his mark so he decided to improve it. He can swap characters in the string corresponding to his mark as many times as he like. Now he want to know only the number of different ways to improve his mark so that his teacher didn't notice something suspicious.
More formally: you are given two strings *a*, *b* of the same length and you need to figure out the number of different strings *c* such that:
1) *c* can be obtained from *a* by swapping some characters, in other words *c* is a permutation of *a*.
2) String *a* is lexicographically smaller than *c*.
3) String *c* is lexicographically smaller than *b*.
For two strings *x* and *y* of the same length it is true that *x* is lexicographically smaller than *y* if there exists such *i*, that *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=...,<=*x**i*<=-<=1<==<=*y**i*<=-<=1,<=*x**i*<=<<=*y**i*.
Since the answer can be very large, you need to find answer modulo 109<=+<=7.
Input Specification:
First line contains string *a*, second line contains string *b*. Strings *a*,<=*b* consist of lowercase English letters. Their lengths are equal and don't exceed 106.
It is guaranteed that *a* is lexicographically smaller than *b*.
Output Specification:
Print one integer — the number of different strings satisfying the condition of the problem modulo 109<=+<=7.
Demo Input:
['abc\nddd\n', 'abcdef\nabcdeg\n', 'abacaba\nubuduba\n']
Demo Output:
['5\n', '0\n', '64\n']
Note:
In first sample from string *abc* can be obtained strings *acb*, *bac*, *bca*, *cab*, *cba*, all of them are larger than *abc*, but smaller than *ddd*. So the answer is 5.
In second sample any string obtained from *abcdef* is larger than *abcdeg*. So the answer is 0.
|
```python
import itertools
A = str(input())
b = str(input())
arr = []
def toString(List):
return ''.join(List)
def permute(a, l, r):
if l == r:
if b > toString(a) > A:
arr.append(toString(a))
else:
for i in range(l, r + 1):
a[l], a[i] = a[i], a[l]
permute(a, l + 1, r)
a[l], a[i] = a[i], a[l] # backtrack
permute(list(A), 0, len(A) - 1)
print(len(set(arr)))
```
| 0
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,689,844,986
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 30
| 0
|
n, m, v = map(int, input().split())
if m % a == 0:
x = m // v
else:
x = m // v + 1
if n % a == 0:
y = n // v
else:
y = n // v + 1
print(x * y)
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
n, m, v = map(int, input().split())
if m % a == 0:
x = m // v
else:
x = m // v + 1
if n % a == 0:
y = n // v
else:
y = n // v + 1
print(x * y)
```
| -1
|
899
|
C
|
Dividing the numbers
|
PROGRAMMING
| 1,300
|
[
"constructive algorithms",
"graphs",
"math"
] | null | null |
Petya has *n* integers: 1,<=2,<=3,<=...,<=*n*. He wants to split these integers in two non-empty groups in such a way that the absolute difference of sums of integers in each group is as small as possible.
Help Petya to split the integers. Each of *n* integers should be exactly in one group.
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=60<=000) — the number of integers Petya has.
|
Print the smallest possible absolute difference in the first line.
In the second line print the size of the first group, followed by the integers in that group. You can print these integers in arbitrary order. If there are multiple answers, print any of them.
|
[
"4\n",
"2\n"
] |
[
"0\n2 1 4 \n",
"1\n1 1 \n"
] |
In the first example you have to put integers 1 and 4 in the first group, and 2 and 3 in the second. This way the sum in each group is 5, and the absolute difference is 0.
In the second example there are only two integers, and since both groups should be non-empty, you have to put one integer in the first group and one in the second. This way the absolute difference of sums of integers in each group is 1.
| 1,500
|
[
{
"input": "4",
"output": "0\n2 1 4 "
},
{
"input": "2",
"output": "1\n1 1 "
},
{
"input": "3",
"output": "0\n1\n3 "
},
{
"input": "5",
"output": "1\n3\n1 2 5 "
},
{
"input": "59998",
"output": "1\n29999 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "60000",
"output": "0\n30000 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "59991",
"output": "0\n29995\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "59989",
"output": "1\n29995\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "6",
"output": "1\n3 1 4 5 "
},
{
"input": "7",
"output": "0\n3\n1 6 7 "
},
{
"input": "8",
"output": "0\n4 1 4 5 8 "
},
{
"input": "9",
"output": "1\n5\n1 2 3 8 9 "
},
{
"input": "10",
"output": "1\n5 1 4 5 8 9 "
},
{
"input": "11",
"output": "0\n5\n1 2 9 10 11 "
},
{
"input": "12",
"output": "0\n6 1 4 5 8 9 12 "
},
{
"input": "13",
"output": "1\n7\n1 2 3 4 11 12 13 "
},
{
"input": "14",
"output": "1\n7 1 4 5 8 9 12 13 "
},
{
"input": "15",
"output": "0\n7\n1 2 3 12 13 14 15 "
},
{
"input": "16",
"output": "0\n8 1 4 5 8 9 12 13 16 "
},
{
"input": "17",
"output": "1\n9\n1 2 3 4 5 14 15 16 17 "
},
{
"input": "18",
"output": "1\n9 1 4 5 8 9 12 13 16 17 "
},
{
"input": "19",
"output": "0\n9\n1 2 3 4 15 16 17 18 19 "
},
{
"input": "20",
"output": "0\n10 1 4 5 8 9 12 13 16 17 20 "
},
{
"input": "21",
"output": "1\n11\n1 2 3 4 5 6 17 18 19 20 21 "
},
{
"input": "22",
"output": "1\n11 1 4 5 8 9 12 13 16 17 20 21 "
},
{
"input": "23",
"output": "0\n11\n1 2 3 4 5 18 19 20 21 22 23 "
},
{
"input": "24",
"output": "0\n12 1 4 5 8 9 12 13 16 17 20 21 24 "
},
{
"input": "59999",
"output": "0\n29999\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "59997",
"output": "1\n29999\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "59996",
"output": "0\n29998 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "59995",
"output": "0\n29997\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "59994",
"output": "1\n29997 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "59993",
"output": "1\n29997\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "59992",
"output": "0\n29996 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "59990",
"output": "1\n29995 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "100",
"output": "0\n50 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 "
},
{
"input": "1000",
"output": "0\n500 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 28..."
},
{
"input": "10001",
"output": "1\n5001\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "103",
"output": "0\n51\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 "
},
{
"input": "1002",
"output": "1\n501 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 28..."
},
{
"input": "31724",
"output": "0\n15862 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "2032",
"output": "0\n1016 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 2..."
},
{
"input": "42620",
"output": "0\n21310 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "18076",
"output": "0\n9038 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 2..."
},
{
"input": "53520",
"output": "0\n26760 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "37193",
"output": "1\n18597\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "12645",
"output": "1\n6323\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "53237",
"output": "1\n26619\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "28693",
"output": "1\n14347\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "4145",
"output": "1\n2073\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "36042",
"output": "1\n18021 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "16646",
"output": "1\n8323 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 2..."
},
{
"input": "57238",
"output": "1\n28619 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "27542",
"output": "1\n13771 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "8146",
"output": "1\n4073 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 2..."
},
{
"input": "46659",
"output": "0\n23329\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "27259",
"output": "0\n13629\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "2715",
"output": "0\n1357\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "38159",
"output": "0\n19079\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "18759",
"output": "0\n9379\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
}
] | 1,514,997,903
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 31
| 5,529,600
|
n = int(input())
if n == 2:
print(1, "1 1", sep='\n')
elif n == 3:
print(0, "1 3", sep='\n')
elif n & 1:
print(1, n >> 1, sep='\n')
for i in range(2, n+1, 2):
print(i, end=' ')
else:
print(0, n >> 1)
for i in range(1, n+1, 2):
print(i, end=' ')
|
Title: Dividing the numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya has *n* integers: 1,<=2,<=3,<=...,<=*n*. He wants to split these integers in two non-empty groups in such a way that the absolute difference of sums of integers in each group is as small as possible.
Help Petya to split the integers. Each of *n* integers should be exactly in one group.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=60<=000) — the number of integers Petya has.
Output Specification:
Print the smallest possible absolute difference in the first line.
In the second line print the size of the first group, followed by the integers in that group. You can print these integers in arbitrary order. If there are multiple answers, print any of them.
Demo Input:
['4\n', '2\n']
Demo Output:
['0\n2 1 4 \n', '1\n1 1 \n']
Note:
In the first example you have to put integers 1 and 4 in the first group, and 2 and 3 in the second. This way the sum in each group is 5, and the absolute difference is 0.
In the second example there are only two integers, and since both groups should be non-empty, you have to put one integer in the first group and one in the second. This way the absolute difference of sums of integers in each group is 1.
|
```python
n = int(input())
if n == 2:
print(1, "1 1", sep='\n')
elif n == 3:
print(0, "1 3", sep='\n')
elif n & 1:
print(1, n >> 1, sep='\n')
for i in range(2, n+1, 2):
print(i, end=' ')
else:
print(0, n >> 1)
for i in range(1, n+1, 2):
print(i, end=' ')
```
| 0
|
|
617
|
A
|
Elephant
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=><=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house.
|
The first line of the input contains an integer *x* (1<=≤<=*x*<=≤<=1<=000<=000) — The coordinate of the friend's house.
|
Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*.
|
[
"5\n",
"12\n"
] |
[
"1\n",
"3\n"
] |
In the first sample the elephant needs to make one step of length 5 to reach the point *x*.
In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves.
| 500
|
[
{
"input": "5",
"output": "1"
},
{
"input": "12",
"output": "3"
},
{
"input": "999999",
"output": "200000"
},
{
"input": "41",
"output": "9"
},
{
"input": "1000000",
"output": "200000"
},
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "3",
"output": "1"
},
{
"input": "4",
"output": "1"
},
{
"input": "534204",
"output": "106841"
},
{
"input": "469569",
"output": "93914"
},
{
"input": "502877",
"output": "100576"
},
{
"input": "942212",
"output": "188443"
},
{
"input": "97",
"output": "20"
},
{
"input": "53",
"output": "11"
},
{
"input": "89",
"output": "18"
},
{
"input": "574",
"output": "115"
},
{
"input": "716",
"output": "144"
},
{
"input": "729",
"output": "146"
},
{
"input": "8901",
"output": "1781"
},
{
"input": "3645",
"output": "729"
},
{
"input": "4426",
"output": "886"
},
{
"input": "46573",
"output": "9315"
},
{
"input": "86380",
"output": "17276"
},
{
"input": "94190",
"output": "18838"
},
{
"input": "999990",
"output": "199998"
},
{
"input": "999991",
"output": "199999"
},
{
"input": "999992",
"output": "199999"
},
{
"input": "999993",
"output": "199999"
},
{
"input": "999994",
"output": "199999"
},
{
"input": "999995",
"output": "199999"
},
{
"input": "999996",
"output": "200000"
},
{
"input": "999997",
"output": "200000"
},
{
"input": "999998",
"output": "200000"
}
] | 1,694,872,367
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 34
| 61
| 0
|
x = int(input())
n = x%5
if (n<0): print(1)
elif (n>0): print(int(((x-n)/5)+1))
else: print(int(((x-n)/5)))
|
Title: Elephant
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=><=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house.
Input Specification:
The first line of the input contains an integer *x* (1<=≤<=*x*<=≤<=1<=000<=000) — The coordinate of the friend's house.
Output Specification:
Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*.
Demo Input:
['5\n', '12\n']
Demo Output:
['1\n', '3\n']
Note:
In the first sample the elephant needs to make one step of length 5 to reach the point *x*.
In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves.
|
```python
x = int(input())
n = x%5
if (n<0): print(1)
elif (n>0): print(int(((x-n)/5)+1))
else: print(int(((x-n)/5)))
```
| 3
|
|
453
|
A
|
Little Pony and Expected Maximum
|
PROGRAMMING
| 1,600
|
[
"probabilities"
] | null | null |
Twilight Sparkle was playing Ludo with her friends Rainbow Dash, Apple Jack and Flutter Shy. But she kept losing. Having returned to the castle, Twilight Sparkle became interested in the dice that were used in the game.
The dice has *m* faces: the first face of the dice contains a dot, the second one contains two dots, and so on, the *m*-th face contains *m* dots. Twilight Sparkle is sure that when the dice is tossed, each face appears with probability . Also she knows that each toss is independent from others. Help her to calculate the expected maximum number of dots she could get after tossing the dice *n* times.
|
A single line contains two integers *m* and *n* (1<=≤<=*m*,<=*n*<=≤<=105).
|
Output a single real number corresponding to the expected maximum. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=<=-<=4.
|
[
"6 1\n",
"6 3\n",
"2 2\n"
] |
[
"3.500000000000\n",
"4.958333333333\n",
"1.750000000000\n"
] |
Consider the third test example. If you've made two tosses:
1. You can get 1 in the first toss, and 2 in the second. Maximum equals to 2. 1. You can get 1 in the first toss, and 1 in the second. Maximum equals to 1. 1. You can get 2 in the first toss, and 1 in the second. Maximum equals to 2. 1. You can get 2 in the first toss, and 2 in the second. Maximum equals to 2.
The probability of each outcome is 0.25, that is expectation equals to:
You can read about expectation using the following link: http://en.wikipedia.org/wiki/Expected_value
| 500
|
[
{
"input": "6 1",
"output": "3.500000000000"
},
{
"input": "6 3",
"output": "4.958333333333"
},
{
"input": "2 2",
"output": "1.750000000000"
},
{
"input": "5 4",
"output": "4.433600000000"
},
{
"input": "5 8",
"output": "4.814773760000"
},
{
"input": "3 10",
"output": "2.982641534996"
},
{
"input": "3 6",
"output": "2.910836762689"
},
{
"input": "1 8",
"output": "1.000000000000"
},
{
"input": "24438 9",
"output": "21994.699969310015"
},
{
"input": "94444 9",
"output": "85000.099992058866"
},
{
"input": "8 66716",
"output": "8.000000000000"
},
{
"input": "4 25132",
"output": "4.000000000000"
},
{
"input": "51520 73331",
"output": "51519.682650242677"
},
{
"input": "54230 31747",
"output": "54228.743352775018"
},
{
"input": "24236 90163",
"output": "24235.975171545670"
},
{
"input": "26946 99523",
"output": "26945.974480086279"
},
{
"input": "50323 7",
"output": "44033.124988408454"
},
{
"input": "53033 3",
"output": "39775.249995286234"
},
{
"input": "55743 5",
"output": "46452.999992525307"
},
{
"input": "59964 79",
"output": "59214.949890211828"
},
{
"input": "1 1",
"output": "1.000000000000"
},
{
"input": "1 1",
"output": "1.000000000000"
},
{
"input": "3 1",
"output": "2.000000000000"
},
{
"input": "1 2",
"output": "1.000000000000"
},
{
"input": "53513 34040",
"output": "53511.875329020870"
},
{
"input": "100000 100000",
"output": "99999.418033254507"
},
{
"input": "1 100000",
"output": "1.000000000000"
},
{
"input": "100000 1",
"output": "50000.499999999935"
},
{
"input": "2 100000",
"output": "2.000000000000"
},
{
"input": "100000 2",
"output": "66667.166665000332"
},
{
"input": "50000 100000",
"output": "49999.843487110789"
},
{
"input": "99999 1111",
"output": "99909.571915885972"
},
{
"input": "99999 99999",
"output": "99998.418033254609"
},
{
"input": "1000 1000",
"output": "999.419018443269"
},
{
"input": "50000 50000",
"output": "49999.418043215679"
},
{
"input": "88888 88888",
"output": "88887.418034499773"
},
{
"input": "99999 100000",
"output": "99998.418042461126"
},
{
"input": "100000 555",
"output": "99820.643422392372"
},
{
"input": "10000 10000",
"output": "9999.418122897887"
},
{
"input": "100000 5001",
"output": "99980.503829474910"
},
{
"input": "100000 1000",
"output": "99900.599066768002"
}
] | 1,578,081,246
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 93
| 0
|
m, n = (int(x) for x in input().split(' '))
print(sum(i * (i/m)**n - ((i-1)/m)**n for i in range(1, m+1)))
|
Title: Little Pony and Expected Maximum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Twilight Sparkle was playing Ludo with her friends Rainbow Dash, Apple Jack and Flutter Shy. But she kept losing. Having returned to the castle, Twilight Sparkle became interested in the dice that were used in the game.
The dice has *m* faces: the first face of the dice contains a dot, the second one contains two dots, and so on, the *m*-th face contains *m* dots. Twilight Sparkle is sure that when the dice is tossed, each face appears with probability . Also she knows that each toss is independent from others. Help her to calculate the expected maximum number of dots she could get after tossing the dice *n* times.
Input Specification:
A single line contains two integers *m* and *n* (1<=≤<=*m*,<=*n*<=≤<=105).
Output Specification:
Output a single real number corresponding to the expected maximum. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=<=-<=4.
Demo Input:
['6 1\n', '6 3\n', '2 2\n']
Demo Output:
['3.500000000000\n', '4.958333333333\n', '1.750000000000\n']
Note:
Consider the third test example. If you've made two tosses:
1. You can get 1 in the first toss, and 2 in the second. Maximum equals to 2. 1. You can get 1 in the first toss, and 1 in the second. Maximum equals to 1. 1. You can get 2 in the first toss, and 1 in the second. Maximum equals to 2. 1. You can get 2 in the first toss, and 2 in the second. Maximum equals to 2.
The probability of each outcome is 0.25, that is expectation equals to:
You can read about expectation using the following link: http://en.wikipedia.org/wiki/Expected_value
|
```python
m, n = (int(x) for x in input().split(' '))
print(sum(i * (i/m)**n - ((i-1)/m)**n for i in range(1, m+1)))
```
| 0
|
|
822
|
A
|
I'm bored with life
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"number theory"
] | null | null |
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
|
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
|
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
|
[
"4 3\n"
] |
[
"6\n"
] |
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
| 500
|
[
{
"input": "4 3",
"output": "6"
},
{
"input": "10 399603090",
"output": "3628800"
},
{
"input": "6 973151934",
"output": "720"
},
{
"input": "2 841668075",
"output": "2"
},
{
"input": "7 415216919",
"output": "5040"
},
{
"input": "3 283733059",
"output": "6"
},
{
"input": "11 562314608",
"output": "39916800"
},
{
"input": "3 990639260",
"output": "6"
},
{
"input": "11 859155400",
"output": "39916800"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "5 3",
"output": "6"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "5 4",
"output": "24"
},
{
"input": "1 12",
"output": "1"
},
{
"input": "9 7",
"output": "5040"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "6 11",
"output": "720"
},
{
"input": "6 7",
"output": "720"
},
{
"input": "11 11",
"output": "39916800"
},
{
"input": "4 999832660",
"output": "24"
},
{
"input": "7 999228288",
"output": "5040"
},
{
"input": "11 999257105",
"output": "39916800"
},
{
"input": "11 999286606",
"output": "39916800"
},
{
"input": "3 999279109",
"output": "6"
},
{
"input": "999632727 11",
"output": "39916800"
},
{
"input": "999625230 7",
"output": "5040"
},
{
"input": "999617047 3",
"output": "6"
},
{
"input": "999646548 7",
"output": "5040"
},
{
"input": "999639051 3",
"output": "6"
},
{
"input": "12 12",
"output": "479001600"
},
{
"input": "12 1",
"output": "1"
},
{
"input": "1213 5",
"output": "120"
},
{
"input": "8 9",
"output": "40320"
},
{
"input": "12 9",
"output": "362880"
},
{
"input": "12 1000000000",
"output": "479001600"
},
{
"input": "1000000000 1",
"output": "1"
},
{
"input": "12 13",
"output": "479001600"
},
{
"input": "2 29845",
"output": "2"
},
{
"input": "10 21",
"output": "3628800"
},
{
"input": "12 20",
"output": "479001600"
},
{
"input": "15 12",
"output": "479001600"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000 12",
"output": "479001600"
},
{
"input": "11 30",
"output": "39916800"
},
{
"input": "17 12",
"output": "479001600"
},
{
"input": "4 19",
"output": "24"
},
{
"input": "12 15",
"output": "479001600"
},
{
"input": "20 6",
"output": "720"
},
{
"input": "10 20",
"output": "3628800"
},
{
"input": "10 10",
"output": "3628800"
},
{
"input": "22 12",
"output": "479001600"
},
{
"input": "20 12",
"output": "479001600"
},
{
"input": "12 23",
"output": "479001600"
},
{
"input": "12 22",
"output": "479001600"
},
{
"input": "18 3",
"output": "6"
},
{
"input": "14 10",
"output": "3628800"
},
{
"input": "14 12",
"output": "479001600"
},
{
"input": "8 3",
"output": "6"
},
{
"input": "5 5",
"output": "120"
}
] | 1,665,593,010
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 59
| 46
| 0
|
def minfact(j,k):
n=min(j,k)
fact=1
for i in range(1,n+1):
fact*=i
print(fact)
j,k=[int(item) for item in input().split(' ')]
minfact(j,k)
|
Title: I'm bored with life
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
Input Specification:
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
Output Specification:
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
Demo Input:
['4 3\n']
Demo Output:
['6\n']
Note:
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
|
```python
def minfact(j,k):
n=min(j,k)
fact=1
for i in range(1,n+1):
fact*=i
print(fact)
j,k=[int(item) for item in input().split(' ')]
minfact(j,k)
```
| 3
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,560,759,649
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 218
| 0
|
n = int(input())
ar = list(map(int, input().split()))
fl = (ar[1] % 2 + ar[0] % 2 + ar[2] % 2) // 2
i = 0
while True:
if ar[i] % 2 != fl:
print(i + 1)
break
i += 1
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
n = int(input())
ar = list(map(int, input().split()))
fl = (ar[1] % 2 + ar[0] % 2 + ar[2] % 2) // 2
i = 0
while True:
if ar[i] % 2 != fl:
print(i + 1)
break
i += 1
```
| 3.9455
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,658,515,147
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 92
| 0
|
n, m = map(int, input().split())
import math
print(math.floor(n*m*0.5))
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
n, m = map(int, input().split())
import math
print(math.floor(n*m*0.5))
```
| 3.977
|
807
|
A
|
Is it rated?
|
PROGRAMMING
| 900
|
[
"implementation",
"sortings"
] | null | null |
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
|
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
|
[
"6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n",
"4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n",
"5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n"
] |
[
"rated\n",
"unrated\n",
"maybe\n"
] |
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not.
| 500
|
[
{
"input": "6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884",
"output": "rated"
},
{
"input": "4\n1500 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n1 1\n1 1",
"output": "maybe"
},
{
"input": "2\n4126 4126\n4126 4126",
"output": "maybe"
},
{
"input": "10\n446 446\n1331 1331\n3594 3594\n1346 1902\n91 91\n3590 3590\n2437 2437\n4007 3871\n2797 699\n1423 1423",
"output": "rated"
},
{
"input": "10\n4078 4078\n2876 2876\n1061 1061\n3721 3721\n143 143\n2992 2992\n3279 3279\n3389 3389\n1702 1702\n1110 1110",
"output": "unrated"
},
{
"input": "10\n4078 4078\n3721 3721\n3389 3389\n3279 3279\n2992 2992\n2876 2876\n1702 1702\n1110 1110\n1061 1061\n143 143",
"output": "maybe"
},
{
"input": "2\n3936 3936\n2967 2967",
"output": "maybe"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 1\n1 2",
"output": "rated"
},
{
"input": "2\n2967 2967\n3936 3936",
"output": "unrated"
},
{
"input": "3\n1200 1200\n1200 1200\n1300 1300",
"output": "unrated"
},
{
"input": "3\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "3\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n3 2\n3 2",
"output": "rated"
},
{
"input": "3\n5 5\n4 4\n3 4",
"output": "rated"
},
{
"input": "3\n200 200\n200 200\n300 300",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n3 3",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2245 2245\n1699 1699",
"output": "maybe"
},
{
"input": "2\n10 10\n8 8",
"output": "maybe"
},
{
"input": "3\n1500 1500\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n100 100\n100 100\n70 70\n80 80",
"output": "unrated"
},
{
"input": "2\n1 2\n2 1",
"output": "rated"
},
{
"input": "3\n5 5\n4 3\n3 3",
"output": "rated"
},
{
"input": "3\n1600 1650\n1500 1550\n1400 1450",
"output": "rated"
},
{
"input": "4\n2000 2000\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n1500 1500\n1400 1400\n1400 1400\n1700 1700",
"output": "unrated"
},
{
"input": "2\n1600 1600\n1400 1400",
"output": "maybe"
},
{
"input": "2\n3 1\n9 8",
"output": "rated"
},
{
"input": "2\n2 1\n1 1",
"output": "rated"
},
{
"input": "4\n4123 4123\n4123 4123\n2670 2670\n3670 3670",
"output": "unrated"
},
{
"input": "2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n10 11\n5 4",
"output": "rated"
},
{
"input": "2\n15 14\n13 12",
"output": "rated"
},
{
"input": "2\n2 1\n2 2",
"output": "rated"
},
{
"input": "3\n2670 2670\n3670 3670\n4106 4106",
"output": "unrated"
},
{
"input": "3\n4 5\n3 3\n2 2",
"output": "rated"
},
{
"input": "2\n10 9\n10 10",
"output": "rated"
},
{
"input": "3\n1011 1011\n1011 999\n2200 2100",
"output": "rated"
},
{
"input": "2\n3 3\n5 5",
"output": "unrated"
},
{
"input": "2\n1500 1500\n3000 2000",
"output": "rated"
},
{
"input": "2\n5 6\n5 5",
"output": "rated"
},
{
"input": "3\n2000 2000\n1500 1501\n500 500",
"output": "rated"
},
{
"input": "2\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n1 2\n1 1",
"output": "rated"
},
{
"input": "4\n3123 3123\n2777 2777\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n15 14\n14 13",
"output": "rated"
},
{
"input": "4\n3000 3000\n2900 2900\n3000 3000\n2900 2900",
"output": "unrated"
},
{
"input": "6\n30 3060\n24 2194\n26 2903\n24 2624\n37 2991\n24 2884",
"output": "rated"
},
{
"input": "2\n100 99\n100 100",
"output": "rated"
},
{
"input": "4\n2 2\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n100 101\n100 100\n100 100",
"output": "rated"
},
{
"input": "4\n1000 1001\n900 900\n950 950\n890 890",
"output": "rated"
},
{
"input": "2\n2 3\n1 1",
"output": "rated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n3 2\n2 2",
"output": "rated"
},
{
"input": "2\n3 2\n3 3",
"output": "rated"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n3 2\n3 3\n3 3",
"output": "rated"
},
{
"input": "4\n1500 1501\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "3\n1000 1000\n500 500\n400 300",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n3000 3000",
"output": "unrated"
},
{
"input": "2\n1 1\n2 3",
"output": "rated"
},
{
"input": "2\n6 2\n6 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n1699 1699\n2777 2777\n2246 2246\n2246 2246",
"output": "unrated"
},
{
"input": "2\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2241 2241\n1699 1699",
"output": "maybe"
},
{
"input": "2\n20 30\n10 5",
"output": "rated"
},
{
"input": "3\n1 1\n2 2\n1 1",
"output": "unrated"
},
{
"input": "2\n1 2\n3 3",
"output": "rated"
},
{
"input": "5\n5 5\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 2\n2 1",
"output": "rated"
},
{
"input": "2\n100 100\n90 89",
"output": "rated"
},
{
"input": "2\n1000 900\n2000 2000",
"output": "rated"
},
{
"input": "2\n50 10\n10 50",
"output": "rated"
},
{
"input": "2\n200 200\n100 100",
"output": "maybe"
},
{
"input": "3\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "3\n1000 1000\n300 300\n100 100",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n3 3\n4 4",
"output": "unrated"
},
{
"input": "2\n5 3\n6 3",
"output": "rated"
},
{
"input": "2\n1200 1100\n1200 1000",
"output": "rated"
},
{
"input": "2\n5 5\n4 4",
"output": "maybe"
},
{
"input": "2\n5 5\n3 3",
"output": "maybe"
},
{
"input": "5\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n1100 1100",
"output": "unrated"
},
{
"input": "5\n10 10\n9 9\n8 8\n7 7\n6 6",
"output": "maybe"
},
{
"input": "3\n1000 1000\n300 300\n10 10",
"output": "maybe"
},
{
"input": "5\n6 6\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n3 3\n1 1",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n1000 1000\n700 700",
"output": "maybe"
},
{
"input": "2\n4 3\n5 3",
"output": "rated"
},
{
"input": "2\n1000 1000\n1100 1100",
"output": "unrated"
},
{
"input": "4\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "3\n1 1\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n1 2\n1 3",
"output": "rated"
},
{
"input": "2\n3 3\n1 2",
"output": "rated"
},
{
"input": "4\n1501 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "5\n1 1\n2 2\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "2\n10 10\n1 2",
"output": "rated"
},
{
"input": "6\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n1900 1900",
"output": "unrated"
},
{
"input": "6\n3123 3123\n2777 2777\n3000 3000\n2246 2246\n2246 2246\n1699 1699",
"output": "unrated"
},
{
"input": "2\n100 100\n110 110",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n3 3\n3 2\n4 4",
"output": "rated"
},
{
"input": "3\n5 2\n4 4\n3 3",
"output": "rated"
},
{
"input": "4\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n1 1\n3 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n2699 2699",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n3 4",
"output": "rated"
},
{
"input": "3\n1 2\n2 2\n3 3",
"output": "rated"
},
{
"input": "3\n1 2\n1 2\n1 2",
"output": "rated"
},
{
"input": "2\n2 1\n2 1",
"output": "rated"
},
{
"input": "2\n1 2\n3 4",
"output": "rated"
},
{
"input": "2\n3 2\n2 3",
"output": "rated"
},
{
"input": "3\n1500 1500\n1600 1600\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1 1\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n2 2",
"output": "unrated"
},
{
"input": "2\n10 12\n8 8",
"output": "rated"
},
{
"input": "5\n1200 1200\n1500 1500\n1500 1500\n1500 1500\n1500 1500",
"output": "unrated"
},
{
"input": "2\n1 2\n2 2",
"output": "rated"
},
{
"input": "3\n1500 1400\n1200 1200\n1100 1100",
"output": "rated"
},
{
"input": "2\n10 12\n10 10",
"output": "rated"
},
{
"input": "3\n1500 1500\n1400 1400\n1300 1300",
"output": "maybe"
},
{
"input": "3\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "3\n2 6\n3 5\n4 4",
"output": "rated"
},
{
"input": "2\n5 6\n4 6",
"output": "rated"
},
{
"input": "4\n10 10\n10 10\n7 7\n8 8",
"output": "unrated"
},
{
"input": "2\n4 4\n3 3",
"output": "maybe"
}
] | 1,572,652,650
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 150
| 124
| 204,800
|
def inp():
return map(int, input().split())
def arr_inp():
return [int(x) for x in input().split()]
def print_arr(arr):
print(*arr, sep=' ')
n = int(input())
count, max = 0, 4127
for i in range(n):
a, b = inp()
if (a == b):
if(a<=max):
count += 1
max=a
else:
print('rated')
exit()
if(count==n):
print('maybe')
else:
print('unrated')
|
Title: Is it rated?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
Output Specification:
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
Demo Input:
['6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n', '4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n', '5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n']
Demo Output:
['rated\n', 'unrated\n', 'maybe\n']
Note:
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not.
|
```python
def inp():
return map(int, input().split())
def arr_inp():
return [int(x) for x in input().split()]
def print_arr(arr):
print(*arr, sep=' ')
n = int(input())
count, max = 0, 4127
for i in range(n):
a, b = inp()
if (a == b):
if(a<=max):
count += 1
max=a
else:
print('rated')
exit()
if(count==n):
print('maybe')
else:
print('unrated')
```
| 3
|
|
12
|
A
|
Super Agent
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Super Agent
|
2
|
256
|
There is a very secret base in Potatoland where potato mash is made according to a special recipe. The neighbours from Porridgia decided to seize this recipe and to sell it to Pilauland. For this mission they have been preparing special agent Pearlo for many years. When, finally, Pearlo learned all secrets of espionage, he penetrated into the Potatoland territory and reached the secret base.
Now he is standing at the entrance, but to get inside he need to pass combination lock. Minute ago one of the workers entered the password on the terminal and opened the door. The terminal is a square digital keyboard 3<=×<=3 with digits from 1 to 9.
Pearlo knows that the password consists from distinct digits and is probably symmetric with respect to the central button of the terminal. He has heat sensor which allowed him to detect the digits which the worker pressed. Now he wants to check whether the password entered by the worker is symmetric with respect to the central button of the terminal. This fact can Help Pearlo to reduce the number of different possible password combinations.
|
Input contains the matrix of three rows of three symbols each. Symbol «X» means that the corresponding button was pressed, and «.» means that is was not pressed. The matrix may contain no «X», also it may contain no «.».
|
Print YES if the password is symmetric with respect to the central button of the terminal and NO otherwise.
|
[
"XX.\n...\n.XX\n",
"X.X\nX..\n...\n"
] |
[
"YES\n",
"NO\n"
] |
If you are not familiar with the term «central symmetry», you may look into http://en.wikipedia.org/wiki/Central_symmetry
| 0
|
[
{
"input": "XX.\n...\n.XX",
"output": "YES"
},
{
"input": ".X.\n.X.\n.X.",
"output": "YES"
},
{
"input": "XXX\nXXX\nXXX",
"output": "YES"
},
{
"input": "XXX\nX.X\nXXX",
"output": "YES"
},
{
"input": "X..\n.X.\n..X",
"output": "YES"
},
{
"input": "...\nX.X\nX..",
"output": "NO"
},
{
"input": ".X.\nX.X\n.X.",
"output": "YES"
},
{
"input": "X.X\n.X.\nX.X",
"output": "YES"
},
{
"input": "...\n...\n..X",
"output": "NO"
},
{
"input": "XXX\n...\nXXX",
"output": "YES"
},
{
"input": "..X\nX..\n..X",
"output": "NO"
},
{
"input": ".X.\n...\nX.X",
"output": "NO"
},
{
"input": "X.X\nX.X\nX.X",
"output": "YES"
},
{
"input": ".X.\nX.X\nXX.",
"output": "NO"
},
{
"input": "...\nXXX\nXXX",
"output": "NO"
},
{
"input": "XXX\n..X\nXXX",
"output": "NO"
},
{
"input": "X..\nX.X\n.X.",
"output": "NO"
},
{
"input": "...\n..X\nXXX",
"output": "NO"
},
{
"input": "..X\nX.X\nX..",
"output": "YES"
},
{
"input": "..X\n..X\nXXX",
"output": "NO"
},
{
"input": "X..\nX..\nX..",
"output": "NO"
},
{
"input": "XXX\n.X.\nXXX",
"output": "YES"
},
{
"input": "..X\n...\nX..",
"output": "YES"
},
{
"input": "...\n...\nX..",
"output": "NO"
},
{
"input": "...\n...\n.X.",
"output": "NO"
},
{
"input": "...\n...\n..X",
"output": "NO"
},
{
"input": "...\n.X.\nX..",
"output": "NO"
}
] | 1,637,858,947
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 92
| 0
|
a=input()
b=input()
c=input()
if b[0]==b[1]:
if a==c or a==c[::-1]:
print("YES")
else:
print("NO")
else:
print("NO")
|
Title: Super Agent
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There is a very secret base in Potatoland where potato mash is made according to a special recipe. The neighbours from Porridgia decided to seize this recipe and to sell it to Pilauland. For this mission they have been preparing special agent Pearlo for many years. When, finally, Pearlo learned all secrets of espionage, he penetrated into the Potatoland territory and reached the secret base.
Now he is standing at the entrance, but to get inside he need to pass combination lock. Minute ago one of the workers entered the password on the terminal and opened the door. The terminal is a square digital keyboard 3<=×<=3 with digits from 1 to 9.
Pearlo knows that the password consists from distinct digits and is probably symmetric with respect to the central button of the terminal. He has heat sensor which allowed him to detect the digits which the worker pressed. Now he wants to check whether the password entered by the worker is symmetric with respect to the central button of the terminal. This fact can Help Pearlo to reduce the number of different possible password combinations.
Input Specification:
Input contains the matrix of three rows of three symbols each. Symbol «X» means that the corresponding button was pressed, and «.» means that is was not pressed. The matrix may contain no «X», also it may contain no «.».
Output Specification:
Print YES if the password is symmetric with respect to the central button of the terminal and NO otherwise.
Demo Input:
['XX.\n...\n.XX\n', 'X.X\nX..\n...\n']
Demo Output:
['YES\n', 'NO\n']
Note:
If you are not familiar with the term «central symmetry», you may look into http://en.wikipedia.org/wiki/Central_symmetry
|
```python
a=input()
b=input()
c=input()
if b[0]==b[1]:
if a==c or a==c[::-1]:
print("YES")
else:
print("NO")
else:
print("NO")
```
| 0
|
4
|
A
|
Watermelon
|
PROGRAMMING
| 800
|
[
"brute force",
"math"
] |
A. Watermelon
|
1
|
64
|
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
|
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
|
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
|
[
"8\n"
] |
[
"YES\n"
] |
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
| 0
|
[
{
"input": "8",
"output": "YES"
},
{
"input": "5",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "3",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "1",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "10",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "53",
"output": "NO"
},
{
"input": "77",
"output": "NO"
},
{
"input": "32",
"output": "YES"
},
{
"input": "44",
"output": "YES"
},
{
"input": "98",
"output": "YES"
},
{
"input": "99",
"output": "NO"
},
{
"input": "90",
"output": "YES"
},
{
"input": "67",
"output": "NO"
},
{
"input": "100",
"output": "YES"
},
{
"input": "88",
"output": "YES"
}
] | 1,691,010,650
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 0
| 0
|
melon = int(input("Weight: "))
if(melon % 2 == 0 and melon != 2):
print("YES")
else:
print("NO")
|
Title: Watermelon
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
Input Specification:
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Output Specification:
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
Demo Input:
['8\n']
Demo Output:
['YES\n']
Note:
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
|
```python
melon = int(input("Weight: "))
if(melon % 2 == 0 and melon != 2):
print("YES")
else:
print("NO")
```
| 0
|
816
|
B
|
Karen and Coffee
|
PROGRAMMING
| 1,400
|
[
"binary search",
"data structures",
"implementation"
] | null | null |
To stay woke and attentive during classes, Karen needs some coffee!
Karen, a coffee aficionado, wants to know the optimal temperature for brewing the perfect cup of coffee. Indeed, she has spent some time reading several recipe books, including the universally acclaimed "The Art of the Covfefe".
She knows *n* coffee recipes. The *i*-th recipe suggests that coffee should be brewed between *l**i* and *r**i* degrees, inclusive, to achieve the optimal taste.
Karen thinks that a temperature is admissible if at least *k* recipes recommend it.
Karen has a rather fickle mind, and so she asks *q* questions. In each question, given that she only wants to prepare coffee with a temperature between *a* and *b*, inclusive, can you tell her how many admissible integer temperatures fall within the range?
|
The first line of input contains three integers, *n*, *k* (1<=≤<=*k*<=≤<=*n*<=≤<=200000), and *q* (1<=≤<=*q*<=≤<=200000), the number of recipes, the minimum number of recipes a certain temperature must be recommended by to be admissible, and the number of questions Karen has, respectively.
The next *n* lines describe the recipes. Specifically, the *i*-th line among these contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=200000), describing that the *i*-th recipe suggests that the coffee be brewed between *l**i* and *r**i* degrees, inclusive.
The next *q* lines describe the questions. Each of these lines contains *a* and *b*, (1<=≤<=*a*<=≤<=*b*<=≤<=200000), describing that she wants to know the number of admissible integer temperatures between *a* and *b* degrees, inclusive.
|
For each question, output a single integer on a line by itself, the number of admissible integer temperatures between *a* and *b* degrees, inclusive.
|
[
"3 2 4\n91 94\n92 97\n97 99\n92 94\n93 97\n95 96\n90 100\n",
"2 1 1\n1 1\n200000 200000\n90 100\n"
] |
[
"3\n3\n0\n4\n",
"0\n"
] |
In the first test case, Karen knows 3 recipes.
1. The first one recommends brewing the coffee between 91 and 94 degrees, inclusive. 1. The second one recommends brewing the coffee between 92 and 97 degrees, inclusive. 1. The third one recommends brewing the coffee between 97 and 99 degrees, inclusive.
A temperature is admissible if at least 2 recipes recommend it.
She asks 4 questions.
In her first question, she wants to know the number of admissible integer temperatures between 92 and 94 degrees, inclusive. There are 3: 92, 93 and 94 degrees are all admissible.
In her second question, she wants to know the number of admissible integer temperatures between 93 and 97 degrees, inclusive. There are 3: 93, 94 and 97 degrees are all admissible.
In her third question, she wants to know the number of admissible integer temperatures between 95 and 96 degrees, inclusive. There are none.
In her final question, she wants to know the number of admissible integer temperatures between 90 and 100 degrees, inclusive. There are 4: 92, 93, 94 and 97 degrees are all admissible.
In the second test case, Karen knows 2 recipes.
1. The first one, "wikiHow to make Cold Brew Coffee", recommends brewing the coffee at exactly 1 degree. 1. The second one, "What good is coffee that isn't brewed at at least 36.3306 times the temperature of the surface of the sun?", recommends brewing the coffee at exactly 200000 degrees.
A temperature is admissible if at least 1 recipe recommends it.
In her first and only question, she wants to know the number of admissible integer temperatures that are actually reasonable. There are none.
| 1,000
|
[
{
"input": "3 2 4\n91 94\n92 97\n97 99\n92 94\n93 97\n95 96\n90 100",
"output": "3\n3\n0\n4"
},
{
"input": "2 1 1\n1 1\n200000 200000\n90 100",
"output": "0"
},
{
"input": "1 1 1\n1 1\n1 1",
"output": "1"
},
{
"input": "1 1 1\n200000 200000\n200000 200000",
"output": "1"
}
] | 1,632,673,797
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 3
| 140
| 29,696,000
|
'''3 2 4
91 94
92 97
97 99
92 94
93 97
95 96
90 100
'''
n,k,q=map(int,input().split())
hasha=[0 for i in range(200002)]
mini=1000000000000000000
maxi=-1
for i in range(n):
l,r=map(int,input().split())
mini=min(mini,l)
maxi=max(maxi,r)
hasha[l]+=1
hasha[r+1]-=1
#print(hasha[0:100])
prefix=[0 for i in range(200002)]
prefix[0]=hasha[0]
r=[0 for i in range(200002)]
for i in range(mini-1,200002):
prefix[i]=prefix[i-1]+hasha[i]
if(prefix[i]==k):
r[i]=1
#print(r)
prefix_2=[0 for i in range(200002)]
prefix_2[0]=r[0]
for i in range(mini-1,200002):
prefix_2[i]=prefix_2[i-1]+r[i]
for i in range(q):
a,b=map(int,input().split())
ans=prefix_2[b]-prefix_2[a-1]
print(ans)
#print(prefix[0:100])
|
Title: Karen and Coffee
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
To stay woke and attentive during classes, Karen needs some coffee!
Karen, a coffee aficionado, wants to know the optimal temperature for brewing the perfect cup of coffee. Indeed, she has spent some time reading several recipe books, including the universally acclaimed "The Art of the Covfefe".
She knows *n* coffee recipes. The *i*-th recipe suggests that coffee should be brewed between *l**i* and *r**i* degrees, inclusive, to achieve the optimal taste.
Karen thinks that a temperature is admissible if at least *k* recipes recommend it.
Karen has a rather fickle mind, and so she asks *q* questions. In each question, given that she only wants to prepare coffee with a temperature between *a* and *b*, inclusive, can you tell her how many admissible integer temperatures fall within the range?
Input Specification:
The first line of input contains three integers, *n*, *k* (1<=≤<=*k*<=≤<=*n*<=≤<=200000), and *q* (1<=≤<=*q*<=≤<=200000), the number of recipes, the minimum number of recipes a certain temperature must be recommended by to be admissible, and the number of questions Karen has, respectively.
The next *n* lines describe the recipes. Specifically, the *i*-th line among these contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=200000), describing that the *i*-th recipe suggests that the coffee be brewed between *l**i* and *r**i* degrees, inclusive.
The next *q* lines describe the questions. Each of these lines contains *a* and *b*, (1<=≤<=*a*<=≤<=*b*<=≤<=200000), describing that she wants to know the number of admissible integer temperatures between *a* and *b* degrees, inclusive.
Output Specification:
For each question, output a single integer on a line by itself, the number of admissible integer temperatures between *a* and *b* degrees, inclusive.
Demo Input:
['3 2 4\n91 94\n92 97\n97 99\n92 94\n93 97\n95 96\n90 100\n', '2 1 1\n1 1\n200000 200000\n90 100\n']
Demo Output:
['3\n3\n0\n4\n', '0\n']
Note:
In the first test case, Karen knows 3 recipes.
1. The first one recommends brewing the coffee between 91 and 94 degrees, inclusive. 1. The second one recommends brewing the coffee between 92 and 97 degrees, inclusive. 1. The third one recommends brewing the coffee between 97 and 99 degrees, inclusive.
A temperature is admissible if at least 2 recipes recommend it.
She asks 4 questions.
In her first question, she wants to know the number of admissible integer temperatures between 92 and 94 degrees, inclusive. There are 3: 92, 93 and 94 degrees are all admissible.
In her second question, she wants to know the number of admissible integer temperatures between 93 and 97 degrees, inclusive. There are 3: 93, 94 and 97 degrees are all admissible.
In her third question, she wants to know the number of admissible integer temperatures between 95 and 96 degrees, inclusive. There are none.
In her final question, she wants to know the number of admissible integer temperatures between 90 and 100 degrees, inclusive. There are 4: 92, 93, 94 and 97 degrees are all admissible.
In the second test case, Karen knows 2 recipes.
1. The first one, "wikiHow to make Cold Brew Coffee", recommends brewing the coffee at exactly 1 degree. 1. The second one, "What good is coffee that isn't brewed at at least 36.3306 times the temperature of the surface of the sun?", recommends brewing the coffee at exactly 200000 degrees.
A temperature is admissible if at least 1 recipe recommends it.
In her first and only question, she wants to know the number of admissible integer temperatures that are actually reasonable. There are none.
|
```python
'''3 2 4
91 94
92 97
97 99
92 94
93 97
95 96
90 100
'''
n,k,q=map(int,input().split())
hasha=[0 for i in range(200002)]
mini=1000000000000000000
maxi=-1
for i in range(n):
l,r=map(int,input().split())
mini=min(mini,l)
maxi=max(maxi,r)
hasha[l]+=1
hasha[r+1]-=1
#print(hasha[0:100])
prefix=[0 for i in range(200002)]
prefix[0]=hasha[0]
r=[0 for i in range(200002)]
for i in range(mini-1,200002):
prefix[i]=prefix[i-1]+hasha[i]
if(prefix[i]==k):
r[i]=1
#print(r)
prefix_2=[0 for i in range(200002)]
prefix_2[0]=r[0]
for i in range(mini-1,200002):
prefix_2[i]=prefix_2[i-1]+r[i]
for i in range(q):
a,b=map(int,input().split())
ans=prefix_2[b]-prefix_2[a-1]
print(ans)
#print(prefix[0:100])
```
| 0
|
|
339
|
A
|
Helpful Maths
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings",
"strings"
] | null | null |
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
|
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
|
Print the new sum that Xenia can count.
|
[
"3+2+1\n",
"1+1+3+1+3\n",
"2\n"
] |
[
"1+2+3\n",
"1+1+1+3+3\n",
"2\n"
] |
none
| 500
|
[
{
"input": "3+2+1",
"output": "1+2+3"
},
{
"input": "1+1+3+1+3",
"output": "1+1+1+3+3"
},
{
"input": "2",
"output": "2"
},
{
"input": "2+2+1+1+3",
"output": "1+1+2+2+3"
},
{
"input": "2+1+2+2+2+3+1+3+1+2",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "1+2+1+2+2+2+2+1+3+3",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "2+3+3+1+2+2+2+1+1+2+1+3+2+2+3+3+2+2+3+3+3+1+1+1+3+3+3+2+1+3+2+3+2+1+1+3+3+3+1+2+2+1+2+2+1+2+1+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "1",
"output": "1"
},
{
"input": "2+1+2+2+1+3+2+3+1+1+2+1+2+2+3+1+1+3+3+3+2+2+3+2+2+2+1+2+1+2+3+2+2+2+1+3+1+3+3+3+1+2+1+2+2+2+2+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "2+2+1+1+1+3+1+1+3+3+2+3+1+3+1+1+3+1+1+2+2+2+2+1+2+1+2+1+1+1+3+1+3+2+3+2+3+3+1+1+1+2+3+2+1+3+1+3+2+2",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3+2+3+3+2+2+1+2+1+2+3+1+2+3+2+3+2+1+2+2+1+1+2+2+3+2+1+3+1+1+3+2+2+2+2+3+3+2+2+3+3+1+1+2+3+3+2+3+3+3",
"output": "1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3",
"output": "3"
},
{
"input": "1+1",
"output": "1+1"
},
{
"input": "1+2",
"output": "1+2"
},
{
"input": "1+3",
"output": "1+3"
},
{
"input": "2+1",
"output": "1+2"
},
{
"input": "2+2",
"output": "2+2"
},
{
"input": "2+3",
"output": "2+3"
},
{
"input": "3+1",
"output": "1+3"
},
{
"input": "3+2",
"output": "2+3"
},
{
"input": "3+3",
"output": "3+3"
}
] | 1,699,167,346
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 92
| 0
|
nums = input().split('+')
nums.sort()
nums = '+'.join(nums)
print(nums)
|
Title: Helpful Maths
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
Input Specification:
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
Output Specification:
Print the new sum that Xenia can count.
Demo Input:
['3+2+1\n', '1+1+3+1+3\n', '2\n']
Demo Output:
['1+2+3\n', '1+1+1+3+3\n', '2\n']
Note:
none
|
```python
nums = input().split('+')
nums.sort()
nums = '+'.join(nums)
print(nums)
```
| 3
|
|
686
|
A
|
Free Ice Cream
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
|
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
|
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
|
[
"5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n",
"5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n"
] |
[
"22 1\n",
"3 2\n"
] |
Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
| 500
|
[
{
"input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20",
"output": "22 1"
},
{
"input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98",
"output": "3 2"
},
{
"input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000",
"output": "7000000000 0"
},
{
"input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46",
"output": "46 0"
},
{
"input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100",
"output": "700 0"
},
{
"input": "1 0\n- 526403222",
"output": "0 1"
},
{
"input": "1 897986543\n- 371188251",
"output": "526798292 0"
},
{
"input": "1 0\n+ 1",
"output": "1 0"
},
{
"input": "1 0\n- 1",
"output": "0 1"
},
{
"input": "1 10\n+ 10",
"output": "20 0"
},
{
"input": "1 3\n- 5",
"output": "3 1"
},
{
"input": "1 0\n- 5",
"output": "0 1"
},
{
"input": "1 0\n+ 5",
"output": "5 0"
}
] | 1,682,045,956
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 62
| 0
|
arr = input().split(" ")
n = int(arr[0])
x = int(arr[1])
r = 0
for _ in range(n):
p = input().split(" ")
c = p[0]
d = int(p[1])
if c == "+" :
x+=d
if c == "-" :
if x >= d :
x-=d
else :
r+=1
print(x,r)
|
Title: Free Ice Cream
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
Input Specification:
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
Output Specification:
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
Demo Input:
['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n']
Demo Output:
['22 1\n', '3 2\n']
Note:
Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
|
```python
arr = input().split(" ")
n = int(arr[0])
x = int(arr[1])
r = 0
for _ in range(n):
p = input().split(" ")
c = p[0]
d = int(p[1])
if c == "+" :
x+=d
if c == "-" :
if x >= d :
x-=d
else :
r+=1
print(x,r)
```
| 3
|
|
768
|
A
|
Oath of the Night's Watch
|
PROGRAMMING
| 900
|
[
"constructive algorithms",
"sortings"
] | null | null |
"Night gathers, and now my watch begins. It shall not end until my death. I shall take no wife, hold no lands, father no children. I shall wear no crowns and win no glory. I shall live and die at my post. I am the sword in the darkness. I am the watcher on the walls. I am the shield that guards the realms of men. I pledge my life and honor to the Night's Watch, for this night and all the nights to come." — The Night's Watch oath.
With that begins the watch of Jon Snow. He is assigned the task to support the stewards.
This time he has *n* stewards with him whom he has to provide support. Each steward has his own strength. Jon Snow likes to support a steward only if there exists at least one steward who has strength strictly less than him and at least one steward who has strength strictly greater than him.
Can you find how many stewards will Jon support?
|
First line consists of a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of stewards with Jon Snow.
Second line consists of *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) representing the values assigned to the stewards.
|
Output a single integer representing the number of stewards which Jon will feed.
|
[
"2\n1 5\n",
"3\n1 2 5\n"
] |
[
"0",
"1"
] |
In the first sample, Jon Snow cannot support steward with strength 1 because there is no steward with strength less than 1 and he cannot support steward with strength 5 because there is no steward with strength greater than 5.
In the second sample, Jon Snow can support steward with strength 2 because there are stewards with strength less than 2 and greater than 2.
| 500
|
[
{
"input": "2\n1 5",
"output": "0"
},
{
"input": "3\n1 2 5",
"output": "1"
},
{
"input": "4\n1 2 3 4",
"output": "2"
},
{
"input": "8\n7 8 9 4 5 6 1 2",
"output": "6"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n100",
"output": "0"
},
{
"input": "205\n5 5 3 3 6 2 9 3 8 9 6 6 10 8 1 5 3 3 1 2 9 9 9 3 9 10 3 9 8 3 5 6 6 4 6 9 2 9 10 9 5 6 6 7 4 2 6 3 4 1 10 1 7 2 7 7 3 2 6 5 5 2 9 3 8 8 7 6 6 4 2 2 6 2 3 5 7 2 2 10 1 4 6 9 2 3 7 2 2 7 4 4 9 10 7 5 8 6 5 3 6 10 2 7 5 6 6 8 3 3 9 4 3 5 7 9 3 2 1 1 3 2 1 9 3 1 4 4 10 2 5 5 8 1 4 8 5 3 1 10 8 6 5 8 3 5 4 5 4 4 6 7 2 8 10 8 7 6 6 9 6 7 1 10 3 2 5 10 4 4 5 4 3 4 8 5 3 8 10 3 10 9 7 2 1 8 6 4 6 5 8 10 2 6 7 4 9 4 5 1 8 7 10 3 1",
"output": "174"
},
{
"input": "4\n1000000000 99999999 1000000000 1000000000",
"output": "0"
},
{
"input": "3\n2 2 2",
"output": "0"
},
{
"input": "5\n1 1 1 1 1",
"output": "0"
},
{
"input": "3\n1 1 1",
"output": "0"
},
{
"input": "6\n1 1 3 3 2 2",
"output": "2"
},
{
"input": "7\n1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "4\n1 1 2 5",
"output": "1"
},
{
"input": "3\n0 0 0",
"output": "0"
},
{
"input": "5\n0 0 0 0 0",
"output": "0"
},
{
"input": "5\n1 1 1 1 5",
"output": "0"
},
{
"input": "5\n1 1 2 3 3",
"output": "1"
},
{
"input": "3\n1 1 3",
"output": "0"
},
{
"input": "3\n2 2 3",
"output": "0"
},
{
"input": "1\n6",
"output": "0"
},
{
"input": "5\n1 5 3 5 1",
"output": "1"
},
{
"input": "7\n1 2 2 2 2 2 3",
"output": "5"
},
{
"input": "4\n2 2 2 2",
"output": "0"
},
{
"input": "9\n2 2 2 3 4 5 6 6 6",
"output": "3"
},
{
"input": "10\n1 1 1 2 3 3 3 3 3 3",
"output": "1"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "0"
},
{
"input": "3\n0 0 1",
"output": "0"
},
{
"input": "9\n1 1 1 2 2 2 3 3 3",
"output": "3"
},
{
"input": "3\n1 2 2",
"output": "0"
},
{
"input": "6\n2 2 2 2 2 2",
"output": "0"
},
{
"input": "5\n2 2 2 2 2",
"output": "0"
},
{
"input": "5\n5 5 5 5 5",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "6\n1 2 5 5 5 5",
"output": "1"
},
{
"input": "5\n1 2 3 3 3",
"output": "1"
},
{
"input": "3\n1 1 2",
"output": "0"
},
{
"input": "6\n1 1 1 1 1 2",
"output": "0"
},
{
"input": "5\n1 1 2 4 4",
"output": "1"
},
{
"input": "3\n999999 5999999 9999999",
"output": "1"
},
{
"input": "4\n1 1 5 5",
"output": "0"
},
{
"input": "9\n1 1 1 2 2 2 4 4 4",
"output": "3"
},
{
"input": "5\n1 3 4 5 1",
"output": "2"
},
{
"input": "5\n3 3 3 3 3",
"output": "0"
},
{
"input": "5\n1 1 2 2 2",
"output": "0"
},
{
"input": "5\n2 1 1 1 3",
"output": "1"
},
{
"input": "5\n0 0 0 1 2",
"output": "1"
},
{
"input": "4\n2 2 2 3",
"output": "0"
},
{
"input": "7\n1 1 1 1 5 5 5",
"output": "0"
},
{
"input": "5\n1 2 3 4 4",
"output": "2"
},
{
"input": "2\n5 4",
"output": "0"
},
{
"input": "4\n5 5 5 5",
"output": "0"
},
{
"input": "5\n1 1 1 5 5",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "1\n3",
"output": "0"
},
{
"input": "3\n2 1 2",
"output": "0"
},
{
"input": "4\n1 2 2 2",
"output": "0"
},
{
"input": "8\n1000000000 1000000000 1000000000 999999999 999999999 999999999 999999998 999999998",
"output": "3"
},
{
"input": "5\n1 1 3 4 4",
"output": "1"
},
{
"input": "6\n1 1 2 2 3 3",
"output": "2"
},
{
"input": "4\n1 1 1 1",
"output": "0"
},
{
"input": "9\n1 2 3 4 1 5 6 7 8",
"output": "6"
},
{
"input": "8\n5 4 4 6 6 4 4 3",
"output": "5"
},
{
"input": "8\n4 3 3 3 3 3 3 3",
"output": "0"
},
{
"input": "7\n4 3 3 3 3 3 3",
"output": "0"
},
{
"input": "6\n4 3 3 3 3 3",
"output": "0"
},
{
"input": "5\n4 3 3 3 3",
"output": "0"
}
] | 1,684,216,840
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 88
| 171
| 10,956,800
|
n = int(input())
arr = list(map(int, input().split()))
def count(nums):
if len(nums) <= 2:
print(0)
return
less = nums[0]
large = nums[0]
res = 0
for index in range(len(nums)):
cur = nums[index]
less = min(less, cur)
large = max(large, cur)
for index in range(len(nums)):
cur = nums[index]
if cur > less and cur < large:
res += 1
print(res)
return
count(arr)
|
Title: Oath of the Night's Watch
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"Night gathers, and now my watch begins. It shall not end until my death. I shall take no wife, hold no lands, father no children. I shall wear no crowns and win no glory. I shall live and die at my post. I am the sword in the darkness. I am the watcher on the walls. I am the shield that guards the realms of men. I pledge my life and honor to the Night's Watch, for this night and all the nights to come." — The Night's Watch oath.
With that begins the watch of Jon Snow. He is assigned the task to support the stewards.
This time he has *n* stewards with him whom he has to provide support. Each steward has his own strength. Jon Snow likes to support a steward only if there exists at least one steward who has strength strictly less than him and at least one steward who has strength strictly greater than him.
Can you find how many stewards will Jon support?
Input Specification:
First line consists of a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of stewards with Jon Snow.
Second line consists of *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) representing the values assigned to the stewards.
Output Specification:
Output a single integer representing the number of stewards which Jon will feed.
Demo Input:
['2\n1 5\n', '3\n1 2 5\n']
Demo Output:
['0', '1']
Note:
In the first sample, Jon Snow cannot support steward with strength 1 because there is no steward with strength less than 1 and he cannot support steward with strength 5 because there is no steward with strength greater than 5.
In the second sample, Jon Snow can support steward with strength 2 because there are stewards with strength less than 2 and greater than 2.
|
```python
n = int(input())
arr = list(map(int, input().split()))
def count(nums):
if len(nums) <= 2:
print(0)
return
less = nums[0]
large = nums[0]
res = 0
for index in range(len(nums)):
cur = nums[index]
less = min(less, cur)
large = max(large, cur)
for index in range(len(nums)):
cur = nums[index]
if cur > less and cur < large:
res += 1
print(res)
return
count(arr)
```
| 3
|
|
242
|
B
|
Big Segment
|
PROGRAMMING
| 1,100
|
[
"implementation",
"sortings"
] | null | null |
A coordinate line has *n* segments, the *i*-th segment starts at the position *l**i* and ends at the position *r**i*. We will denote such a segment as [*l**i*,<=*r**i*].
You have suggested that one of the defined segments covers all others. In other words, there is such segment in the given set, which contains all other ones. Now you want to test your assumption. Find in the given set the segment which covers all other segments, and print its number. If such a segment doesn't exist, print -1.
Formally we will assume that segment [*a*,<=*b*] covers segment [*c*,<=*d*], if they meet this condition *a*<=≤<=*c*<=≤<=*d*<=≤<=*b*.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of segments. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two space-separated integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=109) — the borders of the *i*-th segment.
It is guaranteed that no two segments coincide.
|
Print a single integer — the number of the segment that covers all other segments in the set. If there's no solution, print -1.
The segments are numbered starting from 1 in the order in which they appear in the input.
|
[
"3\n1 1\n2 2\n3 3\n",
"6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10\n"
] |
[
"-1\n",
"3\n"
] |
none
| 1,000
|
[
{
"input": "3\n1 1\n2 2\n3 3",
"output": "-1"
},
{
"input": "6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10",
"output": "3"
},
{
"input": "4\n1 5\n2 2\n2 4\n2 5",
"output": "1"
},
{
"input": "5\n3 3\n1 3\n2 2\n2 3\n1 2",
"output": "2"
},
{
"input": "7\n7 7\n8 8\n3 7\n1 6\n1 7\n4 7\n2 8",
"output": "-1"
},
{
"input": "3\n2 5\n3 4\n2 3",
"output": "1"
},
{
"input": "16\n15 15\n8 12\n6 9\n15 16\n8 14\n3 12\n7 19\n9 13\n5 16\n9 17\n10 15\n9 14\n9 9\n18 19\n5 15\n6 19",
"output": "-1"
},
{
"input": "9\n1 10\n7 8\n6 7\n1 4\n5 9\n2 8\n3 10\n1 1\n2 3",
"output": "1"
},
{
"input": "1\n1 100000",
"output": "1"
},
{
"input": "6\n2 2\n3 3\n3 5\n4 5\n1 1\n1 5",
"output": "6"
},
{
"input": "33\n2 18\n4 14\n2 16\n10 12\n4 6\n9 17\n2 8\n4 12\n8 20\n1 10\n11 14\n11 17\n8 15\n3 16\n3 4\n6 9\n6 19\n4 17\n17 19\n6 16\n3 12\n1 7\n6 20\n8 16\n12 19\n1 3\n12 18\n6 11\n7 20\n16 18\n4 15\n3 15\n15 19",
"output": "-1"
},
{
"input": "34\n3 8\n5 9\n2 9\n1 4\n3 7\n3 3\n8 9\n6 10\n4 7\n6 7\n5 8\n5 10\n1 5\n8 8\n2 5\n3 5\n7 7\n2 8\n4 5\n1 1\n7 9\n5 6\n2 3\n1 2\n2 4\n8 10\n7 8\n1 3\n4 8\n9 10\n1 7\n10 10\n2 2\n1 8",
"output": "-1"
},
{
"input": "55\n3 4\n6 8\n9 10\n3 9\n9 9\n2 5\n4 8\n3 8\n8 10\n1 1\n4 9\n10 10\n6 6\n8 8\n1 8\n5 5\n4 5\n5 9\n2 2\n3 10\n4 6\n3 6\n1 6\n1 7\n6 10\n2 6\n3 7\n2 4\n4 4\n5 10\n1 4\n2 9\n1 3\n7 9\n7 8\n1 9\n1 10\n2 8\n8 9\n6 7\n1 2\n6 9\n7 7\n4 7\n3 3\n2 7\n4 10\n7 10\n2 3\n2 10\n5 7\n3 5\n5 8\n1 5\n5 6",
"output": "37"
},
{
"input": "1\n999999999 1000000000",
"output": "1"
},
{
"input": "3\n1 20\n2 22\n3 18",
"output": "-1"
},
{
"input": "1\n1000000000 1000000000",
"output": "1"
},
{
"input": "2\n100001 100008\n100005 100006",
"output": "1"
},
{
"input": "1\n1000000 10000000",
"output": "1"
},
{
"input": "3\n3 6\n2 4\n1 5",
"output": "-1"
},
{
"input": "2\n3 5\n1 2",
"output": "-1"
}
] | 1,675,523,974
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 342
| 12,595,200
|
# LUOGU_RID: 101472716
(n,),*a=[tuple(map(int,s.split()))for s in open(0)]
t=(min(x[0]for x in a),max(x[1]for x in a))
print(t in a and a.index(t)+1 or -1)
|
Title: Big Segment
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A coordinate line has *n* segments, the *i*-th segment starts at the position *l**i* and ends at the position *r**i*. We will denote such a segment as [*l**i*,<=*r**i*].
You have suggested that one of the defined segments covers all others. In other words, there is such segment in the given set, which contains all other ones. Now you want to test your assumption. Find in the given set the segment which covers all other segments, and print its number. If such a segment doesn't exist, print -1.
Formally we will assume that segment [*a*,<=*b*] covers segment [*c*,<=*d*], if they meet this condition *a*<=≤<=*c*<=≤<=*d*<=≤<=*b*.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of segments. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two space-separated integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=109) — the borders of the *i*-th segment.
It is guaranteed that no two segments coincide.
Output Specification:
Print a single integer — the number of the segment that covers all other segments in the set. If there's no solution, print -1.
The segments are numbered starting from 1 in the order in which they appear in the input.
Demo Input:
['3\n1 1\n2 2\n3 3\n', '6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10\n']
Demo Output:
['-1\n', '3\n']
Note:
none
|
```python
# LUOGU_RID: 101472716
(n,),*a=[tuple(map(int,s.split()))for s in open(0)]
t=(min(x[0]for x in a),max(x[1]for x in a))
print(t in a and a.index(t)+1 or -1)
```
| 3
|
|
854
|
A
|
Fraction
|
PROGRAMMING
| 800
|
[
"brute force",
"constructive algorithms",
"math"
] | null | null |
Petya is a big fan of mathematics, especially its part related to fractions. Recently he learned that a fraction is called proper iff its numerator is smaller than its denominator (*a*<=<<=*b*) and that the fraction is called irreducible if its numerator and its denominator are coprime (they do not have positive common divisors except 1).
During his free time, Petya thinks about proper irreducible fractions and converts them to decimals using the calculator. One day he mistakenly pressed addition button (<=+<=) instead of division button (÷) and got sum of numerator and denominator that was equal to *n* instead of the expected decimal notation.
Petya wanted to restore the original fraction, but soon he realized that it might not be done uniquely. That's why he decided to determine maximum possible proper irreducible fraction such that sum of its numerator and denominator equals *n*. Help Petya deal with this problem.
|
In the only line of input there is an integer *n* (3<=≤<=*n*<=≤<=1000), the sum of numerator and denominator of the fraction.
|
Output two space-separated positive integers *a* and *b*, numerator and denominator of the maximum possible proper irreducible fraction satisfying the given sum.
|
[
"3\n",
"4\n",
"12\n"
] |
[
"1 2\n",
"1 3\n",
"5 7\n"
] |
none
| 500
|
[
{
"input": "3",
"output": "1 2"
},
{
"input": "4",
"output": "1 3"
},
{
"input": "12",
"output": "5 7"
},
{
"input": "34",
"output": "15 19"
},
{
"input": "13",
"output": "6 7"
},
{
"input": "11",
"output": "5 6"
},
{
"input": "24",
"output": "11 13"
},
{
"input": "17",
"output": "8 9"
},
{
"input": "10",
"output": "3 7"
},
{
"input": "69",
"output": "34 35"
},
{
"input": "100",
"output": "49 51"
},
{
"input": "57",
"output": "28 29"
},
{
"input": "1000",
"output": "499 501"
},
{
"input": "999",
"output": "499 500"
},
{
"input": "998",
"output": "497 501"
},
{
"input": "997",
"output": "498 499"
},
{
"input": "996",
"output": "497 499"
},
{
"input": "995",
"output": "497 498"
},
{
"input": "994",
"output": "495 499"
},
{
"input": "5",
"output": "2 3"
},
{
"input": "6",
"output": "1 5"
},
{
"input": "8",
"output": "3 5"
},
{
"input": "9",
"output": "4 5"
},
{
"input": "423",
"output": "211 212"
},
{
"input": "876",
"output": "437 439"
},
{
"input": "29",
"output": "14 15"
}
] | 1,596,725,693
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 108
| 20,172,800
|
n=int(input())
r=n/2
if 2*r==n:
print(r-1,r+1)
else :
print(r,n-r)
|
Title: Fraction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya is a big fan of mathematics, especially its part related to fractions. Recently he learned that a fraction is called proper iff its numerator is smaller than its denominator (*a*<=<<=*b*) and that the fraction is called irreducible if its numerator and its denominator are coprime (they do not have positive common divisors except 1).
During his free time, Petya thinks about proper irreducible fractions and converts them to decimals using the calculator. One day he mistakenly pressed addition button (<=+<=) instead of division button (÷) and got sum of numerator and denominator that was equal to *n* instead of the expected decimal notation.
Petya wanted to restore the original fraction, but soon he realized that it might not be done uniquely. That's why he decided to determine maximum possible proper irreducible fraction such that sum of its numerator and denominator equals *n*. Help Petya deal with this problem.
Input Specification:
In the only line of input there is an integer *n* (3<=≤<=*n*<=≤<=1000), the sum of numerator and denominator of the fraction.
Output Specification:
Output two space-separated positive integers *a* and *b*, numerator and denominator of the maximum possible proper irreducible fraction satisfying the given sum.
Demo Input:
['3\n', '4\n', '12\n']
Demo Output:
['1 2\n', '1 3\n', '5 7\n']
Note:
none
|
```python
n=int(input())
r=n/2
if 2*r==n:
print(r-1,r+1)
else :
print(r,n-r)
```
| 0
|
|
379
|
A
|
New Year Candles
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
|
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
|
Print a single integer — the number of hours Vasily can light up the room for.
|
[
"4 2\n",
"6 3\n"
] |
[
"7\n",
"8\n"
] |
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
| 500
|
[
{
"input": "4 2",
"output": "7"
},
{
"input": "6 3",
"output": "8"
},
{
"input": "1000 1000",
"output": "1001"
},
{
"input": "123 5",
"output": "153"
},
{
"input": "1000 2",
"output": "1999"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "2 2",
"output": "3"
},
{
"input": "3 2",
"output": "5"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "999 2",
"output": "1997"
},
{
"input": "1000 3",
"output": "1499"
},
{
"input": "1000 4",
"output": "1333"
},
{
"input": "1 1000",
"output": "1"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "10 4",
"output": "13"
},
{
"input": "4 3",
"output": "5"
},
{
"input": "91 5",
"output": "113"
},
{
"input": "777 17",
"output": "825"
},
{
"input": "100 4",
"output": "133"
},
{
"input": "5 3",
"output": "7"
},
{
"input": "6 4",
"output": "7"
},
{
"input": "26 8",
"output": "29"
},
{
"input": "9 4",
"output": "11"
},
{
"input": "20 3",
"output": "29"
},
{
"input": "17 3",
"output": "25"
}
] | 1,688,357,935
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 46
| 0
|
n,m = input().split()
n,m = int(n),int(m)
ans=0
cnt = n
day = 1
while cnt>0:
if day==m:
cnt+=1
day=1
else:
day+=1
ans+=1
cnt-=1
print(ans)
# 10 +
|
Title: New Year Candles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
Input Specification:
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
Output Specification:
Print a single integer — the number of hours Vasily can light up the room for.
Demo Input:
['4 2\n', '6 3\n']
Demo Output:
['7\n', '8\n']
Note:
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
|
```python
n,m = input().split()
n,m = int(n),int(m)
ans=0
cnt = n
day = 1
while cnt>0:
if day==m:
cnt+=1
day=1
else:
day+=1
ans+=1
cnt-=1
print(ans)
# 10 +
```
| 3
|
|
5
|
B
|
Center Alignment
|
PROGRAMMING
| 1,200
|
[
"implementation",
"strings"
] |
B. Center Alignment
|
1
|
64
|
Almost every text editor has a built-in function of center text alignment. The developers of the popular in Berland text editor «Textpad» decided to introduce this functionality into the fourth release of the product.
You are to implement the alignment in the shortest possible time. Good luck!
|
The input file consists of one or more lines, each of the lines contains Latin letters, digits and/or spaces. The lines cannot start or end with a space. It is guaranteed that at least one of the lines has positive length. The length of each line and the total amount of the lines do not exceed 1000.
|
Format the given text, aligning it center. Frame the whole text with characters «*» of the minimum size. If a line cannot be aligned perfectly (for example, the line has even length, while the width of the block is uneven), you should place such lines rounding down the distance to the left or to the right edge and bringing them closer left or right alternatively (you should start with bringing left). Study the sample tests carefully to understand the output format better.
|
[
"This is\n\nCodeforces\nBeta\nRound\n5\n",
"welcome to the\nCodeforces\nBeta\nRound 5\n\nand\ngood luck\n"
] |
[
"************\n* This is *\n* *\n*Codeforces*\n* Beta *\n* Round *\n* 5 *\n************\n",
"****************\n*welcome to the*\n* Codeforces *\n* Beta *\n* Round 5 *\n* *\n* and *\n* good luck *\n****************\n"
] |
none
| 0
|
[
{
"input": "This is\n\nCodeforces\nBeta\nRound\n5",
"output": "************\n* This is *\n* *\n*Codeforces*\n* Beta *\n* Round *\n* 5 *\n************"
},
{
"input": "welcome to the\nCodeforces\nBeta\nRound 5\n\nand\ngood luck",
"output": "****************\n*welcome to the*\n* Codeforces *\n* Beta *\n* Round 5 *\n* *\n* and *\n* good luck *\n****************"
},
{
"input": "0\n2",
"output": "***\n*0*\n*2*\n***"
},
{
"input": "O\no\nd",
"output": "***\n*O*\n*o*\n*d*\n***"
},
{
"input": "0v uO M6Sy",
"output": "************\n*0v uO M6Sy*\n************"
},
{
"input": "fm v\nOL U W",
"output": "**********\n* fm v *\n*OL U W*\n**********"
},
{
"input": "vb\nJ\nyU\nZ",
"output": "****\n*vb*\n*J *\n*yU*\n* Z*\n****"
},
{
"input": "N\nSV\nEh\n6f\nX6\n9e",
"output": "****\n*N *\n*SV*\n*Eh*\n*6f*\n*X6*\n*9e*\n****"
},
{
"input": "Pj\nA\nFA\nP\nVJ\nU\nEb\nW",
"output": "****\n*Pj*\n*A *\n*FA*\n* P*\n*VJ*\n*U *\n*Eb*\n* W*\n****"
},
{
"input": "T\n7j\nS\nb\nq8\nVZ\nn\n4T\niZ\npA",
"output": "****\n*T *\n*7j*\n* S*\n*b *\n*q8*\n*VZ*\n* n*\n*4T*\n*iZ*\n*pA*\n****"
},
{
"input": "8\n\n\n\ny\nW\n\n\n\n3B\n\nw\nV\n\n\n\nL\nSr\n\n\nV\n\n5\n\nAq\n\n\n\nJ\nR\n\n04\nJ\nv\nhU\n\n\n\nY\nG\n4\n\nG\nb\n\n\n9\n\n6\nd\n\n2\n\n\nE\n7\n\nr\n\n\n\n\nKC\ns\nE\n\nab\n4\nx\n\n\n\n\n\nEe\n4\n\nl\n\np\n\nG\nM\n\n\nn\n\n\nm0\n\nw\n\n\nP\n\n\n\n0",
"output": "****\n*8 *\n* *\n* *\n* *\n* y*\n*W *\n* *\n* *\n* *\n*3B*\n* *\n* w*\n*V *\n* *\n* *\n* *\n* L*\n*Sr*\n* *\n* *\n*V *\n* *\n* 5*\n* *\n*Aq*\n* *\n* *\n* *\n*J *\n* R*\n* *\n*04*\n*J *\n* v*\n*hU*\n* *\n* *\n* *\n*Y *\n* G*\n*4 *\n* *\n* G*\n*b *\n* *\n* *\n* 9*\n* *\n*6 *\n* d*\n* *\n*2 *\n* *\n* *\n* E*\n*7 *\n* *\n* r*\n* *\n* *\n* *\n* *\n*KC*\n*s *\n* E*\n* *\n*ab*\n*4 *\n* x*\n* *\n* *\n* *\n* *\n* *\n*Ee*\n*4 *\n* *\n* l*\n* *\n*p *\n* *\n* G*\n*M *\n* *\n*..."
},
{
"input": "U",
"output": "***\n*U*\n***"
}
] | 1,547,856,658
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 156
| 0
|
import sys
s = sys.stdin.read()
lines = s.split('\n')
length = 0
left = 1
for inp in lines:
if len(inp) > length:
length = len(s)
print('*' * (length + 2))
for line in lines:
if (length - len(line)) % 2 == 0:
print('*' + ' ' * ((length - len(line)) // 2) + line + ' ' * ((length - len(line)) // 2) + '*')
elif left == 1:
print('*' + ' ' * ((length - len(line)) // 2) + line + ' ' * ((length - len(line)) // 2 + 1) + '*')
left = 0
else:
print('*' + ' ' * ((length - len(line)) // 2 + 1) + line + ' ' * ((length - len(line)) // 2) + '*')
left = 1
print('*' * (length + 2))
|
Title: Center Alignment
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Almost every text editor has a built-in function of center text alignment. The developers of the popular in Berland text editor «Textpad» decided to introduce this functionality into the fourth release of the product.
You are to implement the alignment in the shortest possible time. Good luck!
Input Specification:
The input file consists of one or more lines, each of the lines contains Latin letters, digits and/or spaces. The lines cannot start or end with a space. It is guaranteed that at least one of the lines has positive length. The length of each line and the total amount of the lines do not exceed 1000.
Output Specification:
Format the given text, aligning it center. Frame the whole text with characters «*» of the minimum size. If a line cannot be aligned perfectly (for example, the line has even length, while the width of the block is uneven), you should place such lines rounding down the distance to the left or to the right edge and bringing them closer left or right alternatively (you should start with bringing left). Study the sample tests carefully to understand the output format better.
Demo Input:
['This is\n\nCodeforces\nBeta\nRound\n5\n', 'welcome to the\nCodeforces\nBeta\nRound 5\n\nand\ngood luck\n']
Demo Output:
['************\n* This is *\n* *\n*Codeforces*\n* Beta *\n* Round *\n* 5 *\n************\n', '****************\n*welcome to the*\n* Codeforces *\n* Beta *\n* Round 5 *\n* *\n* and *\n* good luck *\n****************\n']
Note:
none
|
```python
import sys
s = sys.stdin.read()
lines = s.split('\n')
length = 0
left = 1
for inp in lines:
if len(inp) > length:
length = len(s)
print('*' * (length + 2))
for line in lines:
if (length - len(line)) % 2 == 0:
print('*' + ' ' * ((length - len(line)) // 2) + line + ' ' * ((length - len(line)) // 2) + '*')
elif left == 1:
print('*' + ' ' * ((length - len(line)) // 2) + line + ' ' * ((length - len(line)) // 2 + 1) + '*')
left = 0
else:
print('*' + ' ' * ((length - len(line)) // 2 + 1) + line + ' ' * ((length - len(line)) // 2) + '*')
left = 1
print('*' * (length + 2))
```
| 0
|
207
|
D1
|
The Beaver's Problem - 3
|
PROGRAMMING
| 1,800
|
[] | null | null |
The Smart Beaver from ABBYY came up with another splendid problem for the ABBYY Cup participants! This time the Beaver invites the contest participants to check out a problem on sorting documents by their subjects. Let's describe the problem:
You've got some training set of documents. For each document you know its subject. The subject in this problem is an integer from 1 to 3. Each of these numbers has a physical meaning. For instance, all documents with subject 3 are about trade.
You can download the training set of documents at the following link: http://download4.abbyy.com/a2/X2RZ2ZWXBG5VYWAL61H76ZQM/train.zip. The archive contains three directories with names "1", "2", "3". Directory named "1" contains documents on the 1-st subject, directory "2" contains documents on the 2-nd subject, and directory "3" contains documents on the 3-rd subject. Each document corresponds to exactly one file from some directory.
All documents have the following format: the first line contains the document identifier, the second line contains the name of the document, all subsequent lines contain the text of the document. The document identifier is used to make installing the problem more convenient and has no useful information for the participants.
You need to write a program that should indicate the subject for a given document. It is guaranteed that all documents given as input to your program correspond to one of the three subjects of the training set.
|
The first line contains integer *id* (0<=≤<=*id*<=≤<=106) — the document identifier. The second line contains the name of the document. The third and the subsequent lines contain the text of the document. It is guaranteed that the size of any given document will not exceed 10 kilobytes.
The tests for this problem are divided into 10 groups. Documents of groups 1 and 2 are taken from the training set, but their identifiers will not match the identifiers specified in the training set. Groups from the 3-rd to the 10-th are roughly sorted by the author in ascending order of difficulty (these groups contain documents which aren't present in the training set).
|
Print an integer from 1 to 3, inclusive — the number of the subject the given document corresponds to.
|
[] |
[] |
none
| 10
|
[
{
"input": "2000\nJAPAN FEBRUARY MONEY SUPPLY RISES 8.8 PCT\nTOKYO, March 17 - Japan's broadly defined money supply\naverage of M-2 plus certificate of deposits (CDs) rose a\npreliminary 8.8 pct in February from a year earlier, compared\nwith an 8.6 pct rise in January, the Bank of Japan said.\nThe seasonally adjusted February average of M-2 plus CDs\nsupply rose 0.8 pct from January, it said.\nUnadjusted M-2 plus CDs stood at an average 336,000 billion\nyen in February compared with 337,100 billion yen in January.",
"output": "2"
}
] | 1,673,005,507
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS1
| 2
| 31
| 0
|
# LUOGU_RID: 98853065
print("1")
|
Title: The Beaver's Problem - 3
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Smart Beaver from ABBYY came up with another splendid problem for the ABBYY Cup participants! This time the Beaver invites the contest participants to check out a problem on sorting documents by their subjects. Let's describe the problem:
You've got some training set of documents. For each document you know its subject. The subject in this problem is an integer from 1 to 3. Each of these numbers has a physical meaning. For instance, all documents with subject 3 are about trade.
You can download the training set of documents at the following link: http://download4.abbyy.com/a2/X2RZ2ZWXBG5VYWAL61H76ZQM/train.zip. The archive contains three directories with names "1", "2", "3". Directory named "1" contains documents on the 1-st subject, directory "2" contains documents on the 2-nd subject, and directory "3" contains documents on the 3-rd subject. Each document corresponds to exactly one file from some directory.
All documents have the following format: the first line contains the document identifier, the second line contains the name of the document, all subsequent lines contain the text of the document. The document identifier is used to make installing the problem more convenient and has no useful information for the participants.
You need to write a program that should indicate the subject for a given document. It is guaranteed that all documents given as input to your program correspond to one of the three subjects of the training set.
Input Specification:
The first line contains integer *id* (0<=≤<=*id*<=≤<=106) — the document identifier. The second line contains the name of the document. The third and the subsequent lines contain the text of the document. It is guaranteed that the size of any given document will not exceed 10 kilobytes.
The tests for this problem are divided into 10 groups. Documents of groups 1 and 2 are taken from the training set, but their identifiers will not match the identifiers specified in the training set. Groups from the 3-rd to the 10-th are roughly sorted by the author in ascending order of difficulty (these groups contain documents which aren't present in the training set).
Output Specification:
Print an integer from 1 to 3, inclusive — the number of the subject the given document corresponds to.
Note:
none
|
```python
# LUOGU_RID: 98853065
print("1")
```
| 0
|
|
195
|
B
|
After Training
|
PROGRAMMING
| 1,300
|
[
"data structures",
"implementation",
"math"
] | null | null |
After a team finished their training session on Euro football championship, Valeric was commissioned to gather the balls and sort them into baskets. Overall the stadium has *n* balls and *m* baskets. The baskets are positioned in a row from left to right and they are numbered with numbers from 1 to *m*, correspondingly. The balls are numbered with numbers from 1 to *n*.
Valeric decided to sort the balls in the order of increasing of their numbers by the following scheme. He will put each new ball in the basket with the least number of balls. And if he's got several variants, he chooses the basket which stands closer to the middle. That means that he chooses the basket for which is minimum, where *i* is the number of the basket. If in this case Valeric still has multiple variants, he chooses the basket with the minimum number.
For every ball print the number of the basket where it will go according to Valeric's scheme.
Note that the balls are sorted into baskets in the order of increasing numbers, that is, the first ball goes first, then goes the second ball and so on.
|
The first line contains two space-separated integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the number of balls and baskets, correspondingly.
|
Print *n* numbers, one per line. The *i*-th line must contain the number of the basket for the *i*-th ball.
|
[
"4 3\n",
"3 1\n"
] |
[
"2\n1\n3\n2\n",
"1\n1\n1\n"
] |
none
| 1,000
|
[
{
"input": "4 3",
"output": "2\n1\n3\n2"
},
{
"input": "3 1",
"output": "1\n1\n1"
},
{
"input": "10 3",
"output": "2\n1\n3\n2\n1\n3\n2\n1\n3\n2"
},
{
"input": "6 5",
"output": "3\n2\n4\n1\n5\n3"
},
{
"input": "2 6",
"output": "3\n4"
},
{
"input": "5 2",
"output": "1\n2\n1\n2\n1"
},
{
"input": "85702 100000",
"output": "50000\n50001\n49999\n50002\n49998\n50003\n49997\n50004\n49996\n50005\n49995\n50006\n49994\n50007\n49993\n50008\n49992\n50009\n49991\n50010\n49990\n50011\n49989\n50012\n49988\n50013\n49987\n50014\n49986\n50015\n49985\n50016\n49984\n50017\n49983\n50018\n49982\n50019\n49981\n50020\n49980\n50021\n49979\n50022\n49978\n50023\n49977\n50024\n49976\n50025\n49975\n50026\n49974\n50027\n49973\n50028\n49972\n50029\n49971\n50030\n49970\n50031\n49969\n50032\n49968\n50033\n49967\n50034\n49966\n50035\n49965\n50036\n49964\n..."
},
{
"input": "9 2",
"output": "1\n2\n1\n2\n1\n2\n1\n2\n1"
},
{
"input": "45 88",
"output": "44\n45\n43\n46\n42\n47\n41\n48\n40\n49\n39\n50\n38\n51\n37\n52\n36\n53\n35\n54\n34\n55\n33\n56\n32\n57\n31\n58\n30\n59\n29\n60\n28\n61\n27\n62\n26\n63\n25\n64\n24\n65\n23\n66\n22"
},
{
"input": "61 51",
"output": "26\n25\n27\n24\n28\n23\n29\n22\n30\n21\n31\n20\n32\n19\n33\n18\n34\n17\n35\n16\n36\n15\n37\n14\n38\n13\n39\n12\n40\n11\n41\n10\n42\n9\n43\n8\n44\n7\n45\n6\n46\n5\n47\n4\n48\n3\n49\n2\n50\n1\n51\n26\n25\n27\n24\n28\n23\n29\n22\n30\n21"
},
{
"input": "21 57",
"output": "29\n28\n30\n27\n31\n26\n32\n25\n33\n24\n34\n23\n35\n22\n36\n21\n37\n20\n38\n19\n39"
},
{
"input": "677 787",
"output": "394\n393\n395\n392\n396\n391\n397\n390\n398\n389\n399\n388\n400\n387\n401\n386\n402\n385\n403\n384\n404\n383\n405\n382\n406\n381\n407\n380\n408\n379\n409\n378\n410\n377\n411\n376\n412\n375\n413\n374\n414\n373\n415\n372\n416\n371\n417\n370\n418\n369\n419\n368\n420\n367\n421\n366\n422\n365\n423\n364\n424\n363\n425\n362\n426\n361\n427\n360\n428\n359\n429\n358\n430\n357\n431\n356\n432\n355\n433\n354\n434\n353\n435\n352\n436\n351\n437\n350\n438\n349\n439\n348\n440\n347\n441\n346\n442\n345\n443\n344\n444\n343\n4..."
},
{
"input": "37 849",
"output": "425\n424\n426\n423\n427\n422\n428\n421\n429\n420\n430\n419\n431\n418\n432\n417\n433\n416\n434\n415\n435\n414\n436\n413\n437\n412\n438\n411\n439\n410\n440\n409\n441\n408\n442\n407\n443"
},
{
"input": "453 855",
"output": "428\n427\n429\n426\n430\n425\n431\n424\n432\n423\n433\n422\n434\n421\n435\n420\n436\n419\n437\n418\n438\n417\n439\n416\n440\n415\n441\n414\n442\n413\n443\n412\n444\n411\n445\n410\n446\n409\n447\n408\n448\n407\n449\n406\n450\n405\n451\n404\n452\n403\n453\n402\n454\n401\n455\n400\n456\n399\n457\n398\n458\n397\n459\n396\n460\n395\n461\n394\n462\n393\n463\n392\n464\n391\n465\n390\n466\n389\n467\n388\n468\n387\n469\n386\n470\n385\n471\n384\n472\n383\n473\n382\n474\n381\n475\n380\n476\n379\n477\n378\n478\n377\n4..."
},
{
"input": "165 374",
"output": "187\n188\n186\n189\n185\n190\n184\n191\n183\n192\n182\n193\n181\n194\n180\n195\n179\n196\n178\n197\n177\n198\n176\n199\n175\n200\n174\n201\n173\n202\n172\n203\n171\n204\n170\n205\n169\n206\n168\n207\n167\n208\n166\n209\n165\n210\n164\n211\n163\n212\n162\n213\n161\n214\n160\n215\n159\n216\n158\n217\n157\n218\n156\n219\n155\n220\n154\n221\n153\n222\n152\n223\n151\n224\n150\n225\n149\n226\n148\n227\n147\n228\n146\n229\n145\n230\n144\n231\n143\n232\n142\n233\n141\n234\n140\n235\n139\n236\n138\n237\n137\n238\n1..."
},
{
"input": "328 3",
"output": "2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3..."
},
{
"input": "8 80",
"output": "40\n41\n39\n42\n38\n43\n37\n44"
},
{
"input": "90 544",
"output": "272\n273\n271\n274\n270\n275\n269\n276\n268\n277\n267\n278\n266\n279\n265\n280\n264\n281\n263\n282\n262\n283\n261\n284\n260\n285\n259\n286\n258\n287\n257\n288\n256\n289\n255\n290\n254\n291\n253\n292\n252\n293\n251\n294\n250\n295\n249\n296\n248\n297\n247\n298\n246\n299\n245\n300\n244\n301\n243\n302\n242\n303\n241\n304\n240\n305\n239\n306\n238\n307\n237\n308\n236\n309\n235\n310\n234\n311\n233\n312\n232\n313\n231\n314\n230\n315\n229\n316\n228\n317"
},
{
"input": "85 60",
"output": "30\n31\n29\n32\n28\n33\n27\n34\n26\n35\n25\n36\n24\n37\n23\n38\n22\n39\n21\n40\n20\n41\n19\n42\n18\n43\n17\n44\n16\n45\n15\n46\n14\n47\n13\n48\n12\n49\n11\n50\n10\n51\n9\n52\n8\n53\n7\n54\n6\n55\n5\n56\n4\n57\n3\n58\n2\n59\n1\n60\n30\n31\n29\n32\n28\n33\n27\n34\n26\n35\n25\n36\n24\n37\n23\n38\n22\n39\n21\n40\n20\n41\n19\n42\n18"
},
{
"input": "392 5",
"output": "3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3..."
},
{
"input": "8 87",
"output": "44\n43\n45\n42\n46\n41\n47\n40"
},
{
"input": "6 358",
"output": "179\n180\n178\n181\n177\n182"
},
{
"input": "501 70",
"output": "35\n36\n34\n37\n33\n38\n32\n39\n31\n40\n30\n41\n29\n42\n28\n43\n27\n44\n26\n45\n25\n46\n24\n47\n23\n48\n22\n49\n21\n50\n20\n51\n19\n52\n18\n53\n17\n54\n16\n55\n15\n56\n14\n57\n13\n58\n12\n59\n11\n60\n10\n61\n9\n62\n8\n63\n7\n64\n6\n65\n5\n66\n4\n67\n3\n68\n2\n69\n1\n70\n35\n36\n34\n37\n33\n38\n32\n39\n31\n40\n30\n41\n29\n42\n28\n43\n27\n44\n26\n45\n25\n46\n24\n47\n23\n48\n22\n49\n21\n50\n20\n51\n19\n52\n18\n53\n17\n54\n16\n55\n15\n56\n14\n57\n13\n58\n12\n59\n11\n60\n10\n61\n9\n62\n8\n63\n7\n64\n6\n65\n5\n6..."
},
{
"input": "3834 1",
"output": "1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1..."
},
{
"input": "1 8828",
"output": "4414"
},
{
"input": "69230 89906",
"output": "44953\n44954\n44952\n44955\n44951\n44956\n44950\n44957\n44949\n44958\n44948\n44959\n44947\n44960\n44946\n44961\n44945\n44962\n44944\n44963\n44943\n44964\n44942\n44965\n44941\n44966\n44940\n44967\n44939\n44968\n44938\n44969\n44937\n44970\n44936\n44971\n44935\n44972\n44934\n44973\n44933\n44974\n44932\n44975\n44931\n44976\n44930\n44977\n44929\n44978\n44928\n44979\n44927\n44980\n44926\n44981\n44925\n44982\n44924\n44983\n44923\n44984\n44922\n44985\n44921\n44986\n44920\n44987\n44919\n44988\n44918\n44989\n44917\n..."
},
{
"input": "27646 59913",
"output": "29957\n29956\n29958\n29955\n29959\n29954\n29960\n29953\n29961\n29952\n29962\n29951\n29963\n29950\n29964\n29949\n29965\n29948\n29966\n29947\n29967\n29946\n29968\n29945\n29969\n29944\n29970\n29943\n29971\n29942\n29972\n29941\n29973\n29940\n29974\n29939\n29975\n29938\n29976\n29937\n29977\n29936\n29978\n29935\n29979\n29934\n29980\n29933\n29981\n29932\n29982\n29931\n29983\n29930\n29984\n29929\n29985\n29928\n29986\n29927\n29987\n29926\n29988\n29925\n29989\n29924\n29990\n29923\n29991\n29922\n29992\n29921\n29993\n..."
},
{
"input": "37006 54783",
"output": "27392\n27391\n27393\n27390\n27394\n27389\n27395\n27388\n27396\n27387\n27397\n27386\n27398\n27385\n27399\n27384\n27400\n27383\n27401\n27382\n27402\n27381\n27403\n27380\n27404\n27379\n27405\n27378\n27406\n27377\n27407\n27376\n27408\n27375\n27409\n27374\n27410\n27373\n27411\n27372\n27412\n27371\n27413\n27370\n27414\n27369\n27415\n27368\n27416\n27367\n27417\n27366\n27418\n27365\n27419\n27364\n27420\n27363\n27421\n27362\n27422\n27361\n27423\n27360\n27424\n27359\n27425\n27358\n27426\n27357\n27427\n27356\n27428\n..."
},
{
"input": "1 100000",
"output": "50000"
},
{
"input": "100000 1",
"output": "1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1..."
},
{
"input": "100000 100000",
"output": "50000\n50001\n49999\n50002\n49998\n50003\n49997\n50004\n49996\n50005\n49995\n50006\n49994\n50007\n49993\n50008\n49992\n50009\n49991\n50010\n49990\n50011\n49989\n50012\n49988\n50013\n49987\n50014\n49986\n50015\n49985\n50016\n49984\n50017\n49983\n50018\n49982\n50019\n49981\n50020\n49980\n50021\n49979\n50022\n49978\n50023\n49977\n50024\n49976\n50025\n49975\n50026\n49974\n50027\n49973\n50028\n49972\n50029\n49971\n50030\n49970\n50031\n49969\n50032\n49968\n50033\n49967\n50034\n49966\n50035\n49965\n50036\n49964\n..."
},
{
"input": "100000 13",
"output": "7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n..."
},
{
"input": "100000 44",
"output": "22\n23\n21\n24\n20\n25\n19\n26\n18\n27\n17\n28\n16\n29\n15\n30\n14\n31\n13\n32\n12\n33\n11\n34\n10\n35\n9\n36\n8\n37\n7\n38\n6\n39\n5\n40\n4\n41\n3\n42\n2\n43\n1\n44\n22\n23\n21\n24\n20\n25\n19\n26\n18\n27\n17\n28\n16\n29\n15\n30\n14\n31\n13\n32\n12\n33\n11\n34\n10\n35\n9\n36\n8\n37\n7\n38\n6\n39\n5\n40\n4\n41\n3\n42\n2\n43\n1\n44\n22\n23\n21\n24\n20\n25\n19\n26\n18\n27\n17\n28\n16\n29\n15\n30\n14\n31\n13\n32\n12\n33\n11\n34\n10\n35\n9\n36\n8\n37\n7\n38\n6\n39\n5\n40\n4\n41\n3\n42\n2\n43\n1\n44\n22\n23\n21..."
},
{
"input": "100000 37820",
"output": "18910\n18911\n18909\n18912\n18908\n18913\n18907\n18914\n18906\n18915\n18905\n18916\n18904\n18917\n18903\n18918\n18902\n18919\n18901\n18920\n18900\n18921\n18899\n18922\n18898\n18923\n18897\n18924\n18896\n18925\n18895\n18926\n18894\n18927\n18893\n18928\n18892\n18929\n18891\n18930\n18890\n18931\n18889\n18932\n18888\n18933\n18887\n18934\n18886\n18935\n18885\n18936\n18884\n18937\n18883\n18938\n18882\n18939\n18881\n18940\n18880\n18941\n18879\n18942\n18878\n18943\n18877\n18944\n18876\n18945\n18875\n18946\n18874\n..."
},
{
"input": "99999 77777",
"output": "38889\n38888\n38890\n38887\n38891\n38886\n38892\n38885\n38893\n38884\n38894\n38883\n38895\n38882\n38896\n38881\n38897\n38880\n38898\n38879\n38899\n38878\n38900\n38877\n38901\n38876\n38902\n38875\n38903\n38874\n38904\n38873\n38905\n38872\n38906\n38871\n38907\n38870\n38908\n38869\n38909\n38868\n38910\n38867\n38911\n38866\n38912\n38865\n38913\n38864\n38914\n38863\n38915\n38862\n38916\n38861\n38917\n38860\n38918\n38859\n38919\n38858\n38920\n38857\n38921\n38856\n38922\n38855\n38923\n38854\n38924\n38853\n38925\n..."
},
{
"input": "1991 1935",
"output": "968\n967\n969\n966\n970\n965\n971\n964\n972\n963\n973\n962\n974\n961\n975\n960\n976\n959\n977\n958\n978\n957\n979\n956\n980\n955\n981\n954\n982\n953\n983\n952\n984\n951\n985\n950\n986\n949\n987\n948\n988\n947\n989\n946\n990\n945\n991\n944\n992\n943\n993\n942\n994\n941\n995\n940\n996\n939\n997\n938\n998\n937\n999\n936\n1000\n935\n1001\n934\n1002\n933\n1003\n932\n1004\n931\n1005\n930\n1006\n929\n1007\n928\n1008\n927\n1009\n926\n1010\n925\n1011\n924\n1012\n923\n1013\n922\n1014\n921\n1015\n920\n1016\n919\n1017..."
},
{
"input": "17 812",
"output": "406\n407\n405\n408\n404\n409\n403\n410\n402\n411\n401\n412\n400\n413\n399\n414\n398"
},
{
"input": "30078 300",
"output": "150\n151\n149\n152\n148\n153\n147\n154\n146\n155\n145\n156\n144\n157\n143\n158\n142\n159\n141\n160\n140\n161\n139\n162\n138\n163\n137\n164\n136\n165\n135\n166\n134\n167\n133\n168\n132\n169\n131\n170\n130\n171\n129\n172\n128\n173\n127\n174\n126\n175\n125\n176\n124\n177\n123\n178\n122\n179\n121\n180\n120\n181\n119\n182\n118\n183\n117\n184\n116\n185\n115\n186\n114\n187\n113\n188\n112\n189\n111\n190\n110\n191\n109\n192\n108\n193\n107\n194\n106\n195\n105\n196\n104\n197\n103\n198\n102\n199\n101\n200\n100\n201\n9..."
},
{
"input": "10500 5",
"output": "3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3..."
},
{
"input": "90091 322",
"output": "161\n162\n160\n163\n159\n164\n158\n165\n157\n166\n156\n167\n155\n168\n154\n169\n153\n170\n152\n171\n151\n172\n150\n173\n149\n174\n148\n175\n147\n176\n146\n177\n145\n178\n144\n179\n143\n180\n142\n181\n141\n182\n140\n183\n139\n184\n138\n185\n137\n186\n136\n187\n135\n188\n134\n189\n133\n190\n132\n191\n131\n192\n130\n193\n129\n194\n128\n195\n127\n196\n126\n197\n125\n198\n124\n199\n123\n200\n122\n201\n121\n202\n120\n203\n119\n204\n118\n205\n117\n206\n116\n207\n115\n208\n114\n209\n113\n210\n112\n211\n111\n212\n1..."
},
{
"input": "8471 92356",
"output": "46178\n46179\n46177\n46180\n46176\n46181\n46175\n46182\n46174\n46183\n46173\n46184\n46172\n46185\n46171\n46186\n46170\n46187\n46169\n46188\n46168\n46189\n46167\n46190\n46166\n46191\n46165\n46192\n46164\n46193\n46163\n46194\n46162\n46195\n46161\n46196\n46160\n46197\n46159\n46198\n46158\n46199\n46157\n46200\n46156\n46201\n46155\n46202\n46154\n46203\n46153\n46204\n46152\n46205\n46151\n46206\n46150\n46207\n46149\n46208\n46148\n46209\n46147\n46210\n46146\n46211\n46145\n46212\n46144\n46213\n46143\n46214\n46142\n..."
},
{
"input": "1 2",
"output": "1"
},
{
"input": "2 1",
"output": "1\n1"
},
{
"input": "52097 88310",
"output": "44155\n44156\n44154\n44157\n44153\n44158\n44152\n44159\n44151\n44160\n44150\n44161\n44149\n44162\n44148\n44163\n44147\n44164\n44146\n44165\n44145\n44166\n44144\n44167\n44143\n44168\n44142\n44169\n44141\n44170\n44140\n44171\n44139\n44172\n44138\n44173\n44137\n44174\n44136\n44175\n44135\n44176\n44134\n44177\n44133\n44178\n44132\n44179\n44131\n44180\n44130\n44181\n44129\n44182\n44128\n44183\n44127\n44184\n44126\n44185\n44125\n44186\n44124\n44187\n44123\n44188\n44122\n44189\n44121\n44190\n44120\n44191\n44119\n..."
}
] | 1,646,994,988
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 44
| 374
| 11,059,200
|
import math,sys;input=sys.stdin.readline;S=lambda:input().rstrip();I=lambda:int(S());M=lambda:map(int,S().split());L=lambda:list(M());mod1=1000000007;mod2=998244353
n,b = M()
j = b//2
i = j
if b%2==0:
j+=1
else:
i+=1
j+=1
while n>0:
if b%2==0:
if i==0 and j==b+1:
i = b//2
j = i+1
print(i)
n-=1
i-=1
if n>0:
print(j)
n-=1
j+=1
else:
if i==0 and j==b+1:
j = b//2 +1
i = j
if i==j:
print(i)
i-=1
j+=1
n-=1
continue
print(i)
n-=1
i-=1
if n>0:
print(j)
n-=1
j+=1
|
Title: After Training
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After a team finished their training session on Euro football championship, Valeric was commissioned to gather the balls and sort them into baskets. Overall the stadium has *n* balls and *m* baskets. The baskets are positioned in a row from left to right and they are numbered with numbers from 1 to *m*, correspondingly. The balls are numbered with numbers from 1 to *n*.
Valeric decided to sort the balls in the order of increasing of their numbers by the following scheme. He will put each new ball in the basket with the least number of balls. And if he's got several variants, he chooses the basket which stands closer to the middle. That means that he chooses the basket for which is minimum, where *i* is the number of the basket. If in this case Valeric still has multiple variants, he chooses the basket with the minimum number.
For every ball print the number of the basket where it will go according to Valeric's scheme.
Note that the balls are sorted into baskets in the order of increasing numbers, that is, the first ball goes first, then goes the second ball and so on.
Input Specification:
The first line contains two space-separated integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the number of balls and baskets, correspondingly.
Output Specification:
Print *n* numbers, one per line. The *i*-th line must contain the number of the basket for the *i*-th ball.
Demo Input:
['4 3\n', '3 1\n']
Demo Output:
['2\n1\n3\n2\n', '1\n1\n1\n']
Note:
none
|
```python
import math,sys;input=sys.stdin.readline;S=lambda:input().rstrip();I=lambda:int(S());M=lambda:map(int,S().split());L=lambda:list(M());mod1=1000000007;mod2=998244353
n,b = M()
j = b//2
i = j
if b%2==0:
j+=1
else:
i+=1
j+=1
while n>0:
if b%2==0:
if i==0 and j==b+1:
i = b//2
j = i+1
print(i)
n-=1
i-=1
if n>0:
print(j)
n-=1
j+=1
else:
if i==0 and j==b+1:
j = b//2 +1
i = j
if i==j:
print(i)
i-=1
j+=1
n-=1
continue
print(i)
n-=1
i-=1
if n>0:
print(j)
n-=1
j+=1
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,691,488,933
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 92
| 0
|
a=input()
s=0
d=0
for i in range(len(a)):
if a[i].isupper():
s+=1
else:
d+=1
if s>d:
print(a.upper())
else:
print(a.lower())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
a=input()
s=0
d=0
for i in range(len(a)):
if a[i].isupper():
s+=1
else:
d+=1
if s>d:
print(a.upper())
else:
print(a.lower())
```
| 3.977
|
805
|
B
|
3-palindrome
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms"
] | null | null |
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
|
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
|
[
"2\n",
"3\n"
] |
[
"aa\n",
"bba\n"
] |
A palindrome is a sequence of characters which reads the same backward and forward.
| 1,000
|
[
{
"input": "2",
"output": "aa"
},
{
"input": "3",
"output": "aab"
},
{
"input": "38",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "47",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "59",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "67",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "77",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "89",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "98",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "109",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "117",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "1",
"output": "a"
},
{
"input": "200000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "100000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "143670",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "104217",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "17879",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "131809",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "140873",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "77859",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "153022",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "179227",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "182801",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "5188",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "86539",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "12802",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "120289",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "132866",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "133377",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "31775",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "160397",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "161415",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "163623",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "22942",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "134767",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "52257",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "64905",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "183758",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "60131",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "146883",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "6",
"output": "aabbaa"
},
{
"input": "4",
"output": "aabb"
}
] | 1,597,786,658
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 124
| 921,600
|
# -*- coding: utf-8 -*-
"""
Created on Wed Aug 19 03:13:15 2020
@author: Dark Soul
"""
n=int(input(''))
s=''
cnt=0
if n==1:
print('a')
elif n==2:
print('ab')
else:
freq=n//2
rem=n&1
x='aa'
for i in range(freq):
s+=x
if x=='aa':
x='bb'
else:
x='aa'
if rem:
if x=='aa':
s+='a'
else:
s+='b'
print(s)
|
Title: 3-palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
Output Specification:
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
Demo Input:
['2\n', '3\n']
Demo Output:
['aa\n', 'bba\n']
Note:
A palindrome is a sequence of characters which reads the same backward and forward.
|
```python
# -*- coding: utf-8 -*-
"""
Created on Wed Aug 19 03:13:15 2020
@author: Dark Soul
"""
n=int(input(''))
s=''
cnt=0
if n==1:
print('a')
elif n==2:
print('ab')
else:
freq=n//2
rem=n&1
x='aa'
for i in range(freq):
s+=x
if x=='aa':
x='bb'
else:
x='aa'
if rem:
if x=='aa':
s+='a'
else:
s+='b'
print(s)
```
| 3
|
|
959
|
B
|
Mahmoud and Ehab and the message
|
PROGRAMMING
| 1,200
|
[
"dsu",
"greedy",
"implementation"
] | null | null |
Mahmoud wants to send a message to his friend Ehab. Their language consists of *n* words numbered from 1 to *n*. Some words have the same meaning so there are *k* groups of words such that all the words in some group have the same meaning.
Mahmoud knows that the *i*-th word can be sent with cost *a**i*. For each word in his message, Mahmoud can either replace it with another word of the same meaning or leave it as it is. Can you help Mahmoud determine the minimum cost of sending the message?
The cost of sending the message is the sum of the costs of sending every word in it.
|
The first line of input contains integers *n*, *k* and *m* (1<=≤<=*k*<=≤<=*n*<=≤<=105,<=1<=≤<=*m*<=≤<=105) — the number of words in their language, the number of groups of words, and the number of words in Mahmoud's message respectively.
The second line contains *n* strings consisting of lowercase English letters of length not exceeding 20 which represent the words. It's guaranteed that the words are distinct.
The third line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=109) where *a**i* is the cost of sending the *i*-th word.
The next *k* lines describe the groups of words of same meaning. The next *k* lines each start with an integer *x* (1<=≤<=*x*<=≤<=*n*) which means that there are *x* words in this group, followed by *x* integers which represent the indices of words in this group. It's guaranteed that each word appears in exactly one group.
The next line contains *m* space-separated words which represent Mahmoud's message. Each of these words appears in the list of language's words.
|
The only line should contain the minimum cost to send the message after replacing some words (maybe none) with some words of the same meaning.
|
[
"5 4 4\ni loser am the second\n100 1 1 5 10\n1 1\n1 3\n2 2 5\n1 4\ni am the second\n",
"5 4 4\ni loser am the second\n100 20 1 5 10\n1 1\n1 3\n2 2 5\n1 4\ni am the second\n"
] |
[
"107",
"116"
] |
In the first sample, Mahmoud should replace the word "second" with the word "loser" because it has less cost so the cost will be 100+1+5+1=107.
In the second sample, Mahmoud shouldn't do any replacement so the cost will be 100+1+5+10=116.
| 1,000
|
[
{
"input": "5 4 4\ni loser am the second\n100 1 1 5 10\n1 1\n1 3\n2 2 5\n1 4\ni am the second",
"output": "107"
},
{
"input": "5 4 4\ni loser am the second\n100 20 1 5 10\n1 1\n1 3\n2 2 5\n1 4\ni am the second",
"output": "116"
},
{
"input": "1 1 1\na\n1000000000\n1 1\na",
"output": "1000000000"
},
{
"input": "1 1 10\na\n1000000000\n1 1\na a a a a a a a a a",
"output": "10000000000"
}
] | 1,605,357,728
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 2
| 140
| 0
|
def find(dd,a):
if dd[a]==a:
return dd[a]
dd[a]=find(dd,dd[a])
return dd[a]
def union(dd,l,d,a,b,i,j):
x=find(dd,a)
y=find(dd,b)
if x!=y:
if l[i]<l[j]:
dd[y]=x
else:
dd[x]=y
n,k,m=map(int,input().split())
s=input().split()
d={}
dd={}
e={}
for i in range(n):
d[i+1]=s[i]
dd[s[i]]=s[i]
l=list(map(int,input().split()))
for i in range(n):
e[s[i]]=l[i]
for _ in range(k):
x=list(map(int,input().split()))
st=d[x[1]]
val=l[x[1]-1]
for i in range(2,len(x)):
union(dd,l,d,d[x[i]],d[x[i-1]],i,i-1)
ss=input().split()
ans=0
for i in ss:
ans+=e[dd[i]]
print(ans)
|
Title: Mahmoud and Ehab and the message
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mahmoud wants to send a message to his friend Ehab. Their language consists of *n* words numbered from 1 to *n*. Some words have the same meaning so there are *k* groups of words such that all the words in some group have the same meaning.
Mahmoud knows that the *i*-th word can be sent with cost *a**i*. For each word in his message, Mahmoud can either replace it with another word of the same meaning or leave it as it is. Can you help Mahmoud determine the minimum cost of sending the message?
The cost of sending the message is the sum of the costs of sending every word in it.
Input Specification:
The first line of input contains integers *n*, *k* and *m* (1<=≤<=*k*<=≤<=*n*<=≤<=105,<=1<=≤<=*m*<=≤<=105) — the number of words in their language, the number of groups of words, and the number of words in Mahmoud's message respectively.
The second line contains *n* strings consisting of lowercase English letters of length not exceeding 20 which represent the words. It's guaranteed that the words are distinct.
The third line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=109) where *a**i* is the cost of sending the *i*-th word.
The next *k* lines describe the groups of words of same meaning. The next *k* lines each start with an integer *x* (1<=≤<=*x*<=≤<=*n*) which means that there are *x* words in this group, followed by *x* integers which represent the indices of words in this group. It's guaranteed that each word appears in exactly one group.
The next line contains *m* space-separated words which represent Mahmoud's message. Each of these words appears in the list of language's words.
Output Specification:
The only line should contain the minimum cost to send the message after replacing some words (maybe none) with some words of the same meaning.
Demo Input:
['5 4 4\ni loser am the second\n100 1 1 5 10\n1 1\n1 3\n2 2 5\n1 4\ni am the second\n', '5 4 4\ni loser am the second\n100 20 1 5 10\n1 1\n1 3\n2 2 5\n1 4\ni am the second\n']
Demo Output:
['107', '116']
Note:
In the first sample, Mahmoud should replace the word "second" with the word "loser" because it has less cost so the cost will be 100+1+5+1=107.
In the second sample, Mahmoud shouldn't do any replacement so the cost will be 100+1+5+10=116.
|
```python
def find(dd,a):
if dd[a]==a:
return dd[a]
dd[a]=find(dd,dd[a])
return dd[a]
def union(dd,l,d,a,b,i,j):
x=find(dd,a)
y=find(dd,b)
if x!=y:
if l[i]<l[j]:
dd[y]=x
else:
dd[x]=y
n,k,m=map(int,input().split())
s=input().split()
d={}
dd={}
e={}
for i in range(n):
d[i+1]=s[i]
dd[s[i]]=s[i]
l=list(map(int,input().split()))
for i in range(n):
e[s[i]]=l[i]
for _ in range(k):
x=list(map(int,input().split()))
st=d[x[1]]
val=l[x[1]-1]
for i in range(2,len(x)):
union(dd,l,d,d[x[i]],d[x[i-1]],i,i-1)
ss=input().split()
ans=0
for i in ss:
ans+=e[dd[i]]
print(ans)
```
| 0
|
|
55
|
B
|
Smallest number
|
PROGRAMMING
| 1,600
|
[
"brute force"
] |
B. Smallest number
|
2
|
256
|
Recently, Vladimir got bad mark in algebra again. To avoid such unpleasant events in future he decided to train his arithmetic skills. He wrote four integer numbers *a*, *b*, *c*, *d* on the blackboard. During each of the next three minutes he took two numbers from the blackboard (not necessarily adjacent) and replaced them with their sum or their product. In the end he got one number. Unfortunately, due to the awful memory he forgot that number, but he remembers four original numbers, sequence of the operations and his surprise because of the very small result. Help Vladimir remember the forgotten number: find the smallest number that can be obtained from the original numbers by the given sequence of operations.
|
First line contains four integers separated by space: 0<=≤<=*a*,<=*b*,<=*c*,<=*d*<=≤<=1000 — the original numbers. Second line contains three signs ('+' or '*' each) separated by space — the sequence of the operations in the order of performing. ('+' stands for addition, '*' — multiplication)
|
Output one integer number — the minimal result which can be obtained.
Please, do not use %lld specificator to read or write 64-bit integers in C++. It is preffered to use cin (also you may use %I64d).
|
[
"1 1 1 1\n+ + *\n",
"2 2 2 2\n* * +\n",
"1 2 3 4\n* + +\n"
] |
[
"3\n",
"8\n",
"9\n"
] |
none
| 1,000
|
[
{
"input": "1 1 1 1\n+ + *",
"output": "3"
},
{
"input": "2 2 2 2\n* * +",
"output": "8"
},
{
"input": "1 2 3 4\n* + +",
"output": "9"
},
{
"input": "15 1 3 1\n* * +",
"output": "18"
},
{
"input": "8 1 7 14\n+ + +",
"output": "30"
},
{
"input": "7 17 3 25\n+ * +",
"output": "63"
},
{
"input": "13 87 4 17\n* * *",
"output": "76908"
},
{
"input": "7 0 8 15\n+ + *",
"output": "0"
},
{
"input": "52 0 43 239\n+ + +",
"output": "334"
},
{
"input": "1000 1000 999 1000\n* * *",
"output": "999000000000"
},
{
"input": "720 903 589 804\n* * *",
"output": "307887168960"
},
{
"input": "631 149 496 892\n* * +",
"output": "445884"
},
{
"input": "220 127 597 394\n* + +",
"output": "28931"
},
{
"input": "214 862 466 795\n+ + +",
"output": "2337"
},
{
"input": "346 290 587 525\n* * *",
"output": "30922279500"
},
{
"input": "323 771 559 347\n+ * *",
"output": "149067730"
},
{
"input": "633 941 836 254\n* + +",
"output": "162559"
},
{
"input": "735 111 769 553\n+ * *",
"output": "92320032"
},
{
"input": "622 919 896 120\n* * +",
"output": "667592"
},
{
"input": "652 651 142 661\n+ + +",
"output": "2106"
},
{
"input": "450 457 975 35\n* * *",
"output": "7017806250"
},
{
"input": "883 954 804 352\n* * +",
"output": "1045740"
},
{
"input": "847 206 949 358\n* + *",
"output": "62660050"
},
{
"input": "663 163 339 76\n+ + +",
"output": "1241"
},
{
"input": "990 330 253 553\n+ * +",
"output": "85033"
},
{
"input": "179 346 525 784\n* * *",
"output": "25492034400"
},
{
"input": "780 418 829 778\n+ + *",
"output": "997766"
},
{
"input": "573 598 791 124\n* * *",
"output": "33608874936"
},
{
"input": "112 823 202 223\n* * +",
"output": "137222"
},
{
"input": "901 166 994 315\n* + *",
"output": "47278294"
},
{
"input": "393 342 840 486\n+ * *",
"output": "178222356"
},
{
"input": "609 275 153 598\n+ + *",
"output": "226746"
},
{
"input": "56 828 386 57\n+ * *",
"output": "3875088"
},
{
"input": "944 398 288 986\n+ + *",
"output": "670464"
},
{
"input": "544 177 162 21\n+ + *",
"output": "18543"
},
{
"input": "105 238 316 265\n+ + +",
"output": "924"
},
{
"input": "31 353 300 911\n* * *",
"output": "2990721900"
},
{
"input": "46 378 310 194\n* * +",
"output": "77528"
},
{
"input": "702 534 357 657\n+ * *",
"output": "259077042"
},
{
"input": "492 596 219 470\n+ + *",
"output": "341202"
},
{
"input": "482 842 982 902\n+ * +",
"output": "407728"
},
{
"input": "827 578 394 351\n* * *",
"output": "66105361764"
},
{
"input": "901 884 426 451\n* + *",
"output": "170223210"
},
{
"input": "210 295 12 795\n* * +",
"output": "71490"
},
{
"input": "40 734 948 202\n+ * *",
"output": "13590560"
},
{
"input": "136 611 963 195\n+ + *",
"output": "240584"
},
{
"input": "695 74 871 760\n+ * +",
"output": "53061"
},
{
"input": "666 884 772 54\n* + +",
"output": "37620"
},
{
"input": "975 785 753 224\n+ * +",
"output": "170432"
},
{
"input": "35 187 126 596\n+ + +",
"output": "944"
},
{
"input": "243 386 431 35\n* + *",
"output": "3298015"
},
{
"input": "229 602 133 635\n* * +",
"output": "222313"
},
{
"input": "916 207 238 891\n+ + *",
"output": "423315"
},
{
"input": "922 145 883 357\n+ + *",
"output": "313490"
},
{
"input": "69 355 762 111\n* + +",
"output": "8776"
},
{
"input": "209 206 34 67\n* + *",
"output": "476374"
},
{
"input": "693 824 375 361\n* * +",
"output": "557339"
},
{
"input": "45 712 635 467\n* + +",
"output": "22362"
},
{
"input": "426 283 179 211\n+ + +",
"output": "1099"
},
{
"input": "802 387 686 12\n+ + +",
"output": "1887"
}
] | 1,674,046,295
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 60
| 92
| 0
|
def solve(index):
if index==3:
for x in arr:
if x>=0:
ans[0]=min(ans[0],x)
return
for i in range(4):
if arr[i] !=-1:
for j in range(4):
if i==j or arr[j]==-1:
continue
a,b=arr[i],arr[j]
if s[index]=='+':
arr[j]=a+b
arr[i]=-1
solve(index+1)
arr[j]=b
arr[i]=a
elif s[index]=='*':
arr[j]=a*b
arr[i]=-1
solve(index+1)
arr[j]=b
arr[i]=a
else:
continue
ans=[float('inf')]
arr=list(map(int,input().split()))
s=input().split()
solve(0)
print(*ans)
|
Title: Smallest number
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Recently, Vladimir got bad mark in algebra again. To avoid such unpleasant events in future he decided to train his arithmetic skills. He wrote four integer numbers *a*, *b*, *c*, *d* on the blackboard. During each of the next three minutes he took two numbers from the blackboard (not necessarily adjacent) and replaced them with their sum or their product. In the end he got one number. Unfortunately, due to the awful memory he forgot that number, but he remembers four original numbers, sequence of the operations and his surprise because of the very small result. Help Vladimir remember the forgotten number: find the smallest number that can be obtained from the original numbers by the given sequence of operations.
Input Specification:
First line contains four integers separated by space: 0<=≤<=*a*,<=*b*,<=*c*,<=*d*<=≤<=1000 — the original numbers. Second line contains three signs ('+' or '*' each) separated by space — the sequence of the operations in the order of performing. ('+' stands for addition, '*' — multiplication)
Output Specification:
Output one integer number — the minimal result which can be obtained.
Please, do not use %lld specificator to read or write 64-bit integers in C++. It is preffered to use cin (also you may use %I64d).
Demo Input:
['1 1 1 1\n+ + *\n', '2 2 2 2\n* * +\n', '1 2 3 4\n* + +\n']
Demo Output:
['3\n', '8\n', '9\n']
Note:
none
|
```python
def solve(index):
if index==3:
for x in arr:
if x>=0:
ans[0]=min(ans[0],x)
return
for i in range(4):
if arr[i] !=-1:
for j in range(4):
if i==j or arr[j]==-1:
continue
a,b=arr[i],arr[j]
if s[index]=='+':
arr[j]=a+b
arr[i]=-1
solve(index+1)
arr[j]=b
arr[i]=a
elif s[index]=='*':
arr[j]=a*b
arr[i]=-1
solve(index+1)
arr[j]=b
arr[i]=a
else:
continue
ans=[float('inf')]
arr=list(map(int,input().split()))
s=input().split()
solve(0)
print(*ans)
```
| 3.977
|
701
|
A
|
Cards
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation"
] | null | null |
There are *n* cards (*n* is even) in the deck. Each card has a positive integer written on it. *n*<=/<=2 people will play new card game. At the beginning of the game each player gets two cards, each card is given to exactly one player.
Find the way to distribute cards such that the sum of values written of the cards will be equal for each player. It is guaranteed that it is always possible.
|
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=100) — the number of cards in the deck. It is guaranteed that *n* is even.
The second line contains the sequence of *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100), where *a**i* is equal to the number written on the *i*-th card.
|
Print *n*<=/<=2 pairs of integers, the *i*-th pair denote the cards that should be given to the *i*-th player. Each card should be given to exactly one player. Cards are numbered in the order they appear in the input.
It is guaranteed that solution exists. If there are several correct answers, you are allowed to print any of them.
|
[
"6\n1 5 7 4 4 3\n",
"4\n10 10 10 10\n"
] |
[
"1 3\n6 2\n4 5\n",
"1 2\n3 4\n"
] |
In the first sample, cards are distributed in such a way that each player has the sum of numbers written on his cards equal to 8.
In the second sample, all values *a*<sub class="lower-index">*i*</sub> are equal. Thus, any distribution is acceptable.
| 500
|
[
{
"input": "6\n1 5 7 4 4 3",
"output": "1 3\n6 2\n4 5"
},
{
"input": "4\n10 10 10 10",
"output": "1 4\n2 3"
},
{
"input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "1 100\n2 99\n3 98\n4 97\n5 96\n6 95\n7 94\n8 93\n9 92\n10 91\n11 90\n12 89\n13 88\n14 87\n15 86\n16 85\n17 84\n18 83\n19 82\n20 81\n21 80\n22 79\n23 78\n24 77\n25 76\n26 75\n27 74\n28 73\n29 72\n30 71\n31 70\n32 69\n33 68\n34 67\n35 66\n36 65\n37 64\n38 63\n39 62\n40 61\n41 60\n42 59\n43 58\n44 57\n45 56\n46 55\n47 54\n48 53\n49 52\n50 51"
},
{
"input": "4\n82 46 8 44",
"output": "3 1\n4 2"
},
{
"input": "2\n35 50",
"output": "1 2"
},
{
"input": "8\n24 39 49 38 44 64 44 50",
"output": "1 6\n4 8\n2 3\n5 7"
},
{
"input": "100\n23 44 35 88 10 78 8 84 46 19 69 36 81 60 46 12 53 22 83 73 6 18 80 14 54 39 74 42 34 20 91 70 32 11 80 53 70 21 24 12 87 68 35 39 8 84 81 70 8 54 73 2 60 71 4 33 65 48 69 58 55 57 78 61 45 50 55 72 86 37 5 11 12 81 32 19 22 11 22 82 23 56 61 84 47 59 31 38 31 90 57 1 24 38 68 27 80 9 37 14",
"output": "92 31\n52 90\n55 4\n71 41\n21 69\n7 84\n45 46\n49 8\n98 19\n5 80\n34 74\n72 47\n78 13\n16 97\n40 35\n73 23\n24 63\n100 6\n22 27\n10 51\n76 20\n30 68\n38 54\n18 48\n77 37\n79 32\n1 59\n81 11\n39 95\n93 42\n96 57\n87 83\n89 64\n33 53\n75 14\n56 86\n29 60\n3 91\n43 62\n12 82\n70 67\n99 61\n88 50\n94 25\n26 36\n44 17\n28 66\n2 58\n65 85\n9 15"
},
{
"input": "12\n22 83 2 67 55 12 40 93 83 73 12 28",
"output": "3 8\n6 9\n11 2\n1 10\n12 4\n7 5"
},
{
"input": "16\n10 33 36 32 48 25 31 27 45 13 37 26 22 21 15 43",
"output": "1 5\n10 9\n15 16\n14 11\n13 3\n6 2\n12 4\n8 7"
},
{
"input": "20\n18 13 71 60 28 10 20 65 65 12 13 14 64 68 6 50 72 7 66 58",
"output": "15 17\n18 3\n6 14\n10 19\n2 9\n11 8\n12 13\n1 4\n7 20\n5 16"
},
{
"input": "24\n59 39 25 22 46 21 24 70 60 11 46 42 44 37 13 37 41 58 72 23 25 61 58 62",
"output": "10 19\n15 8\n6 24\n4 22\n20 9\n7 1\n3 23\n21 18\n14 11\n16 5\n2 13\n17 12"
},
{
"input": "28\n22 1 51 31 83 35 3 64 59 10 61 25 19 53 55 80 78 8 82 22 67 4 27 64 33 6 85 76",
"output": "2 27\n7 5\n22 19\n26 16\n18 17\n10 28\n13 21\n1 24\n20 8\n12 11\n23 9\n4 15\n25 14\n6 3"
},
{
"input": "32\n41 42 22 68 40 52 66 16 73 25 41 21 36 60 46 30 24 55 35 10 54 52 70 24 20 56 3 34 35 6 51 8",
"output": "27 9\n30 23\n32 4\n20 7\n8 14\n25 26\n12 18\n3 21\n17 22\n24 6\n10 31\n16 15\n28 2\n19 11\n29 1\n13 5"
},
{
"input": "36\n1 10 61 43 27 49 55 33 7 30 45 78 69 34 38 19 36 49 55 11 30 63 46 24 16 68 71 18 11 52 72 24 60 68 8 41",
"output": "1 12\n9 31\n35 27\n2 13\n20 34\n29 26\n25 22\n28 3\n16 33\n24 19\n32 7\n5 30\n10 18\n21 6\n8 23\n14 11\n17 4\n15 36"
},
{
"input": "40\n7 30 13 37 37 56 45 28 61 28 23 33 44 63 58 52 21 2 42 19 10 32 9 7 61 15 58 20 45 4 46 24 35 17 50 4 20 48 41 55",
"output": "18 14\n30 25\n36 9\n1 27\n24 15\n23 6\n21 40\n3 16\n26 35\n34 38\n20 31\n28 29\n37 7\n17 13\n11 19\n32 39\n8 5\n10 4\n2 33\n22 12"
},
{
"input": "44\n7 12 46 78 24 68 86 22 71 79 85 14 58 72 26 46 54 39 35 13 31 45 81 21 15 8 47 64 69 87 57 6 18 80 47 29 36 62 34 67 59 48 75 25",
"output": "32 30\n1 7\n26 11\n2 23\n20 34\n12 10\n25 4\n33 43\n24 14\n8 9\n5 29\n44 6\n15 40\n36 28\n21 38\n39 41\n19 13\n37 31\n18 17\n22 42\n3 35\n16 27"
},
{
"input": "48\n57 38 16 25 34 57 29 38 60 51 72 78 22 39 10 33 20 16 12 3 51 74 9 88 4 70 56 65 86 18 33 12 77 78 52 87 68 85 81 5 61 2 52 39 80 13 74 30",
"output": "42 24\n20 36\n25 29\n40 38\n23 39\n15 45\n19 34\n32 12\n46 33\n3 47\n18 22\n30 11\n17 26\n13 37\n4 28\n7 41\n48 9\n16 6\n31 1\n5 27\n2 43\n8 35\n14 21\n44 10"
},
{
"input": "52\n57 12 13 40 68 31 18 4 31 18 65 3 62 32 6 3 49 48 51 33 53 40 9 32 47 53 58 19 14 23 32 38 39 69 19 20 62 52 68 17 39 22 54 59 3 2 52 9 67 68 24 39",
"output": "46 34\n12 50\n16 39\n45 5\n8 49\n15 11\n23 37\n48 13\n2 44\n3 27\n29 1\n40 43\n7 26\n10 21\n28 47\n35 38\n36 19\n42 17\n30 18\n51 25\n6 22\n9 4\n14 52\n24 41\n31 33\n20 32"
},
{
"input": "56\n53 59 66 68 71 25 48 32 12 61 72 69 30 6 56 55 25 49 60 47 46 46 66 19 31 9 23 15 10 12 71 53 51 32 39 31 66 66 17 52 12 7 7 22 49 12 71 29 63 7 47 29 18 39 27 26",
"output": "14 11\n42 47\n43 31\n50 5\n26 12\n29 4\n9 38\n30 37\n41 23\n46 3\n28 49\n39 10\n53 19\n24 2\n44 15\n27 16\n6 32\n17 1\n56 40\n55 33\n48 45\n52 18\n13 7\n25 51\n36 20\n8 22\n34 21\n35 54"
},
{
"input": "60\n47 63 20 68 46 12 45 44 14 38 28 73 60 5 20 18 70 64 37 47 26 47 37 61 29 61 23 28 30 68 55 22 25 60 38 7 63 12 38 15 14 30 11 5 70 15 53 52 7 57 49 45 55 37 45 28 50 2 31 30",
"output": "58 12\n14 45\n44 17\n36 30\n49 4\n43 18\n6 37\n38 2\n9 26\n41 24\n40 34\n46 13\n16 50\n3 53\n15 31\n32 47\n27 48\n33 57\n21 51\n11 22\n28 20\n56 1\n25 5\n29 55\n42 52\n60 7\n59 8\n19 39\n23 35\n54 10"
},
{
"input": "64\n63 39 19 5 48 56 49 45 29 68 25 59 37 69 62 26 60 44 60 6 67 68 2 40 56 6 19 12 17 70 23 11 59 37 41 55 30 68 72 14 38 34 3 71 2 4 55 15 31 66 15 51 36 72 18 7 6 14 43 33 8 35 57 18",
"output": "23 54\n45 39\n43 44\n46 30\n4 14\n20 38\n26 22\n57 10\n56 21\n61 50\n32 1\n28 15\n40 19\n58 17\n48 33\n51 12\n29 63\n55 25\n64 6\n3 47\n27 36\n31 52\n11 7\n16 5\n9 8\n37 18\n49 59\n60 35\n42 24\n62 2\n53 41\n13 34"
},
{
"input": "68\n58 68 40 55 62 15 10 54 19 18 69 27 15 53 8 18 8 33 15 49 20 9 70 8 18 64 14 59 9 64 3 35 46 11 5 65 58 55 28 58 4 55 64 5 68 24 4 58 23 45 58 50 38 68 5 15 20 9 5 53 20 63 69 68 15 53 65 65",
"output": "31 23\n41 63\n47 11\n35 64\n44 54\n55 45\n59 2\n15 68\n17 67\n24 36\n22 43\n29 30\n58 26\n7 62\n34 5\n27 28\n6 51\n13 48\n19 40\n56 37\n65 1\n10 42\n16 38\n25 4\n9 8\n21 66\n57 60\n61 14\n49 52\n46 20\n12 33\n39 50\n18 3\n32 53"
},
{
"input": "72\n61 13 55 23 24 55 44 33 59 19 14 17 66 40 27 33 29 37 28 74 50 56 59 65 64 17 42 56 73 51 64 23 22 26 38 22 36 47 60 14 52 28 14 12 6 41 73 5 64 67 61 74 54 34 45 34 44 4 34 49 18 72 44 47 31 19 11 31 5 4 45 50",
"output": "58 52\n70 20\n48 47\n69 29\n45 62\n67 50\n44 13\n2 24\n11 49\n40 31\n43 25\n12 51\n26 1\n61 39\n10 23\n66 9\n33 28\n36 22\n4 6\n32 3\n5 53\n34 41\n15 30\n19 72\n42 21\n17 60\n65 64\n68 38\n8 71\n16 55\n54 63\n56 57\n59 7\n37 27\n18 46\n35 14"
},
{
"input": "76\n73 37 73 67 26 45 43 74 47 31 43 81 4 3 39 79 48 81 67 39 67 66 43 67 80 51 34 79 5 58 45 10 39 50 9 78 6 18 75 17 45 17 51 71 34 53 33 11 17 15 11 69 50 41 13 74 10 33 77 41 11 64 36 74 17 32 3 10 27 20 5 73 52 41 7 57",
"output": "14 18\n67 12\n13 25\n29 28\n71 16\n37 36\n75 59\n35 39\n32 64\n57 56\n68 8\n48 72\n51 3\n61 1\n55 44\n50 52\n40 24\n42 21\n49 19\n65 4\n38 22\n70 62\n5 30\n69 76\n10 46\n66 73\n47 43\n58 26\n27 53\n45 34\n63 17\n2 9\n15 41\n20 31\n33 6\n54 23\n60 11\n74 7"
},
{
"input": "80\n18 38 65 1 20 9 57 2 36 26 15 17 33 61 65 27 10 35 49 42 40 32 19 33 12 36 56 31 10 41 8 54 56 60 5 47 61 43 23 19 20 30 7 6 38 60 29 58 35 64 30 51 6 17 30 24 47 1 37 47 34 36 48 28 5 25 47 19 30 39 36 23 31 28 46 46 59 43 19 49",
"output": "4 15\n58 3\n8 50\n35 37\n65 14\n44 46\n53 34\n43 77\n31 48\n6 7\n17 33\n29 27\n25 32\n11 52\n12 80\n54 19\n1 63\n23 67\n40 60\n68 57\n79 36\n5 76\n41 75\n39 78\n72 38\n56 20\n66 30\n10 21\n16 70\n64 45\n74 2\n47 59\n42 71\n51 62\n55 26\n69 9\n28 49\n73 18\n22 61\n13 24"
},
{
"input": "84\n59 41 54 14 42 55 29 28 41 73 40 15 1 1 66 49 76 59 68 60 42 81 19 23 33 12 80 81 42 22 54 54 2 22 22 28 27 60 36 57 17 76 38 20 40 65 23 9 81 50 25 13 46 36 59 53 6 35 47 40 59 19 67 46 63 49 12 33 23 49 33 23 32 62 60 70 44 1 6 63 28 16 70 69",
"output": "13 49\n14 28\n78 22\n33 27\n57 42\n79 17\n48 10\n26 83\n67 76\n52 84\n4 19\n12 63\n82 15\n41 46\n23 80\n62 65\n44 74\n30 75\n34 38\n35 20\n24 61\n47 55\n69 18\n72 1\n51 40\n37 6\n8 32\n36 31\n81 3\n7 56\n73 50\n25 70\n68 66\n71 16\n58 59\n39 64\n54 53\n43 77\n11 29\n45 21\n60 5\n2 9"
},
{
"input": "88\n10 28 71 6 58 66 45 52 13 71 39 1 10 29 30 70 14 17 15 38 4 60 5 46 66 41 40 58 2 57 32 44 21 26 13 40 64 63 56 33 46 8 30 43 67 55 44 28 32 62 14 58 42 67 45 59 32 68 10 31 51 6 42 34 9 12 51 27 20 14 62 42 16 5 1 14 30 62 40 59 58 26 25 15 27 47 21 57",
"output": "12 10\n75 3\n29 16\n21 58\n23 54\n74 45\n4 25\n62 6\n42 37\n65 38\n1 78\n13 71\n59 50\n66 22\n9 80\n35 56\n17 81\n51 52\n70 28\n76 5\n19 88\n84 30\n73 39\n18 46\n69 8\n33 67\n87 61\n83 86\n34 41\n82 24\n68 55\n85 7\n2 47\n48 32\n14 44\n15 72\n43 63\n77 53\n60 26\n31 79\n49 36\n57 27\n40 11\n64 20"
},
{
"input": "92\n17 37 81 15 29 70 73 42 49 23 44 77 27 44 74 11 43 66 15 41 60 36 33 11 2 76 16 51 45 21 46 16 85 29 76 79 16 6 60 13 25 44 62 28 43 35 63 24 76 71 62 15 57 72 45 10 71 59 74 14 53 13 58 72 14 72 73 11 25 1 57 42 86 63 50 30 64 38 10 77 75 24 58 8 54 12 43 30 27 71 52 34",
"output": "70 73\n25 33\n38 3\n84 36\n56 80\n79 12\n16 49\n24 35\n68 26\n86 81\n40 59\n62 15\n60 67\n65 7\n4 66\n19 64\n52 54\n27 90\n32 57\n37 50\n1 6\n30 18\n10 77\n48 74\n82 47\n41 51\n69 43\n13 39\n89 21\n44 58\n5 83\n34 63\n76 71\n88 53\n23 85\n92 61\n46 91\n22 28\n2 75\n78 9\n20 31\n8 55\n72 29\n17 42\n45 14\n87 11"
},
{
"input": "96\n77 7 47 19 73 31 46 13 89 69 52 9 26 77 6 87 55 45 71 2 79 1 80 20 4 82 64 20 75 86 84 24 77 56 16 54 53 35 74 73 40 29 63 20 83 39 58 16 31 41 40 16 11 90 30 48 62 39 55 8 50 3 77 73 75 66 14 90 18 54 38 10 53 22 67 38 27 91 62 37 85 13 92 7 18 83 10 3 86 54 80 59 34 16 39 43",
"output": "22 83\n20 78\n62 68\n88 54\n25 9\n15 16\n2 89\n84 30\n60 81\n12 31\n72 86\n87 45\n53 26\n8 91\n82 23\n67 21\n35 63\n48 33\n52 14\n94 1\n69 65\n85 29\n4 39\n24 64\n28 40\n44 5\n74 19\n32 10\n13 75\n77 66\n42 27\n55 43\n6 79\n49 57\n93 92\n38 47\n80 34\n71 59\n76 17\n46 90\n58 70\n95 36\n41 73\n51 37\n50 11\n96 61\n18 56\n7 3"
},
{
"input": "4\n100 100 1 1",
"output": "3 2\n4 1"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1 100\n2 99\n3 98\n4 97\n5 96\n6 95\n7 94\n8 93\n9 92\n10 91\n11 90\n12 89\n13 88\n14 87\n15 86\n16 85\n17 84\n18 83\n19 82\n20 81\n21 80\n22 79\n23 78\n24 77\n25 76\n26 75\n27 74\n28 73\n29 72\n30 71\n31 70\n32 69\n33 68\n34 67\n35 66\n36 65\n37 64\n38 63\n39 62\n40 61\n41 60\n42 59\n43 58\n44 57\n45 56\n46 55\n47 54\n48 53\n49 52\n50 51"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "1 100\n2 99\n3 98\n4 97\n5 96\n6 95\n7 94\n8 93\n9 92\n10 91\n11 90\n12 89\n13 88\n14 87\n15 86\n16 85\n17 84\n18 83\n19 82\n20 81\n21 80\n22 79\n23 78\n24 77\n25 76\n26 75\n27 74\n28 73\n29 72\n30 71\n31 70\n32 69\n33 68\n34 67\n35 66\n36 65\n37 64\n38 63\n39 62\n40 61\n41 60\n42 59\n43 58\n44 57\n45 56\n46 55\n47 54\n48 53\n49 52\n50 51"
},
{
"input": "4\n3 4 4 5",
"output": "1 4\n2 3"
},
{
"input": "4\n1 1 2 2",
"output": "1 4\n2 3"
},
{
"input": "4\n1 2 3 4",
"output": "1 4\n2 3"
}
] | 1,567,242,075
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 124
| 0
|
def swap(seq,i,j):
temp=seq[i]
seq[i]=seq[j]
seq[j]=temp
def argsort(n,seq):
i=1
indices=[]
while i<=n:
indices.append(i)
i+=1
i=0
while i<n-1:
j=i+1
while j<n:
if(seq[j]<seq[i]):
swap(seq,i,j)
swap(indices,i,j)
j+=1
i+=1
return indices
def Cards(n, seq):
argSorted= argsort(n,seq)
i=1
j=n
while(i<=n/2):
print(str(argSorted[i-1])+" "+str(argSorted[j-1]))
i+=1
j-=1
n = int(input())
seq = [int(x) for x in input().split()]
Cards(n,seq)
|
Title: Cards
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* cards (*n* is even) in the deck. Each card has a positive integer written on it. *n*<=/<=2 people will play new card game. At the beginning of the game each player gets two cards, each card is given to exactly one player.
Find the way to distribute cards such that the sum of values written of the cards will be equal for each player. It is guaranteed that it is always possible.
Input Specification:
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=100) — the number of cards in the deck. It is guaranteed that *n* is even.
The second line contains the sequence of *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100), where *a**i* is equal to the number written on the *i*-th card.
Output Specification:
Print *n*<=/<=2 pairs of integers, the *i*-th pair denote the cards that should be given to the *i*-th player. Each card should be given to exactly one player. Cards are numbered in the order they appear in the input.
It is guaranteed that solution exists. If there are several correct answers, you are allowed to print any of them.
Demo Input:
['6\n1 5 7 4 4 3\n', '4\n10 10 10 10\n']
Demo Output:
['1 3\n6 2\n4 5\n', '1 2\n3 4\n']
Note:
In the first sample, cards are distributed in such a way that each player has the sum of numbers written on his cards equal to 8.
In the second sample, all values *a*<sub class="lower-index">*i*</sub> are equal. Thus, any distribution is acceptable.
|
```python
def swap(seq,i,j):
temp=seq[i]
seq[i]=seq[j]
seq[j]=temp
def argsort(n,seq):
i=1
indices=[]
while i<=n:
indices.append(i)
i+=1
i=0
while i<n-1:
j=i+1
while j<n:
if(seq[j]<seq[i]):
swap(seq,i,j)
swap(indices,i,j)
j+=1
i+=1
return indices
def Cards(n, seq):
argSorted= argsort(n,seq)
i=1
j=n
while(i<=n/2):
print(str(argSorted[i-1])+" "+str(argSorted[j-1]))
i+=1
j-=1
n = int(input())
seq = [int(x) for x in input().split()]
Cards(n,seq)
```
| 3
|
|
415
|
B
|
Mashmokh and Tokens
|
PROGRAMMING
| 1,500
|
[
"binary search",
"greedy",
"implementation",
"math"
] | null | null |
Bimokh is Mashmokh's boss. For the following *n* days he decided to pay to his workers in a new way. At the beginning of each day he will give each worker a certain amount of tokens. Then at the end of each day each worker can give some of his tokens back to get a certain amount of money. The worker can save the rest of tokens but he can't use it in any other day to get more money. If a worker gives back *w* tokens then he'll get dollars.
Mashmokh likes the tokens however he likes money more. That's why he wants to save as many tokens as possible so that the amount of money he gets is maximal possible each day. He has *n* numbers *x*1,<=*x*2,<=...,<=*x**n*. Number *x**i* is the number of tokens given to each worker on the *i*-th day. Help him calculate for each of *n* days the number of tokens he can save.
|
The first line of input contains three space-separated integers *n*,<=*a*,<=*b* (1<=≤<=*n*<=≤<=105; 1<=≤<=*a*,<=*b*<=≤<=109). The second line of input contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109).
|
Output *n* space-separated integers. The *i*-th of them is the number of tokens Mashmokh can save on the *i*-th day.
|
[
"5 1 4\n12 6 11 9 1\n",
"3 1 2\n1 2 3\n",
"1 1 1\n1\n"
] |
[
"0 2 3 1 1 ",
"1 0 1 ",
"0 "
] |
none
| 1,000
|
[
{
"input": "5 1 4\n12 6 11 9 1",
"output": "0 2 3 1 1 "
},
{
"input": "3 1 2\n1 2 3",
"output": "1 0 1 "
},
{
"input": "1 1 1\n1",
"output": "0 "
},
{
"input": "1 1 1000000000\n1000000000",
"output": "0 "
},
{
"input": "1 1 1000000000\n999999999",
"output": "999999999 "
},
{
"input": "10 1 100000000\n999999999 999999999 999999999 999999999 999999999 999999999 999999999 999999999 999999999 999999999",
"output": "99999999 99999999 99999999 99999999 99999999 99999999 99999999 99999999 99999999 99999999 "
}
] | 1,396,799,291
| 491
|
Python 3
|
OK
|
TESTS
| 47
| 186
| 9,830,400
|
"""
Codeforces Round 240 Div 1 Problem B
Author : chaotic_iak
Language: Python 3.3.4
"""
class InputHandlerObject(object):
inputs = []
def getInput(self, n = 0):
res = ""
inputs = self.inputs
if not inputs: inputs.extend(input().split(" "))
if n == 0:
res = inputs[:]
inputs[:] = []
while n > len(inputs):
inputs.extend(input().split(" "))
if n > 0:
res = inputs[:n]
inputs[:n] = []
return res
InputHandler = InputHandlerObject()
g = InputHandler.getInput
############################## SOLUTION ##############################
n,a,b = g()
n,a,b = int(n),int(a),int(b)
c = [int(x) for x in g()]
r = []
for i in c:
r.append(str(((i*a) % b) // a))
print(" ".join(r))
|
Title: Mashmokh and Tokens
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bimokh is Mashmokh's boss. For the following *n* days he decided to pay to his workers in a new way. At the beginning of each day he will give each worker a certain amount of tokens. Then at the end of each day each worker can give some of his tokens back to get a certain amount of money. The worker can save the rest of tokens but he can't use it in any other day to get more money. If a worker gives back *w* tokens then he'll get dollars.
Mashmokh likes the tokens however he likes money more. That's why he wants to save as many tokens as possible so that the amount of money he gets is maximal possible each day. He has *n* numbers *x*1,<=*x*2,<=...,<=*x**n*. Number *x**i* is the number of tokens given to each worker on the *i*-th day. Help him calculate for each of *n* days the number of tokens he can save.
Input Specification:
The first line of input contains three space-separated integers *n*,<=*a*,<=*b* (1<=≤<=*n*<=≤<=105; 1<=≤<=*a*,<=*b*<=≤<=109). The second line of input contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109).
Output Specification:
Output *n* space-separated integers. The *i*-th of them is the number of tokens Mashmokh can save on the *i*-th day.
Demo Input:
['5 1 4\n12 6 11 9 1\n', '3 1 2\n1 2 3\n', '1 1 1\n1\n']
Demo Output:
['0 2 3 1 1 ', '1 0 1 ', '0 ']
Note:
none
|
```python
"""
Codeforces Round 240 Div 1 Problem B
Author : chaotic_iak
Language: Python 3.3.4
"""
class InputHandlerObject(object):
inputs = []
def getInput(self, n = 0):
res = ""
inputs = self.inputs
if not inputs: inputs.extend(input().split(" "))
if n == 0:
res = inputs[:]
inputs[:] = []
while n > len(inputs):
inputs.extend(input().split(" "))
if n > 0:
res = inputs[:n]
inputs[:n] = []
return res
InputHandler = InputHandlerObject()
g = InputHandler.getInput
############################## SOLUTION ##############################
n,a,b = g()
n,a,b = int(n),int(a),int(b)
c = [int(x) for x in g()]
r = []
for i in c:
r.append(str(((i*a) % b) // a))
print(" ".join(r))
```
| 3
|
|
608
|
A
|
Saitama Destroys Hotel
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
Saitama accidentally destroyed a hotel again. To repay the hotel company, Genos has volunteered to operate an elevator in one of its other hotels. The elevator is special — it starts on the top floor, can only move down, and has infinite capacity. Floors are numbered from 0 to *s* and elevator initially starts on floor *s* at time 0.
The elevator takes exactly 1 second to move down exactly 1 floor and negligible time to pick up passengers. Genos is given a list detailing when and on which floor passengers arrive. Please determine how long in seconds it will take Genos to bring all passengers to floor 0.
|
The first line of input contains two integers *n* and *s* (1<=≤<=*n*<=≤<=100, 1<=≤<=*s*<=≤<=1000) — the number of passengers and the number of the top floor respectively.
The next *n* lines each contain two space-separated integers *f**i* and *t**i* (1<=≤<=*f**i*<=≤<=*s*, 1<=≤<=*t**i*<=≤<=1000) — the floor and the time of arrival in seconds for the passenger number *i*.
|
Print a single integer — the minimum amount of time in seconds needed to bring all the passengers to floor 0.
|
[
"3 7\n2 1\n3 8\n5 2\n",
"5 10\n2 77\n3 33\n8 21\n9 12\n10 64\n"
] |
[
"11\n",
"79\n"
] |
In the first sample, it takes at least 11 seconds to bring all passengers to floor 0. Here is how this could be done:
1. Move to floor 5: takes 2 seconds.
2. Pick up passenger 3.
3. Move to floor 3: takes 2 seconds.
4. Wait for passenger 2 to arrive: takes 4 seconds.
5. Pick up passenger 2.
6. Go to floor 2: takes 1 second.
7. Pick up passenger 1.
8. Go to floor 0: takes 2 seconds.
This gives a total of 2 + 2 + 4 + 1 + 2 = 11 seconds.
| 500
|
[
{
"input": "3 7\n2 1\n3 8\n5 2",
"output": "11"
},
{
"input": "5 10\n2 77\n3 33\n8 21\n9 12\n10 64",
"output": "79"
},
{
"input": "1 1000\n1000 1000",
"output": "2000"
},
{
"input": "1 1\n1 1",
"output": "2"
},
{
"input": "1 1000\n1 1",
"output": "1000"
},
{
"input": "1 1000\n1 1000",
"output": "1001"
},
{
"input": "100 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "2"
},
{
"input": "2 7\n6 3\n1 5",
"output": "9"
},
{
"input": "2 100\n99 2\n1 10",
"output": "101"
},
{
"input": "5 5\n1 1\n2 1\n3 1\n4 1\n5 1",
"output": "6"
},
{
"input": "3 7\n1 6\n5 5\n6 1",
"output": "10"
},
{
"input": "2 100\n4 100\n7 99",
"output": "106"
},
{
"input": "2 10\n9 3\n1 4",
"output": "12"
},
{
"input": "2 5\n4 4\n5 4",
"output": "9"
},
{
"input": "2 10\n9 10\n6 11",
"output": "19"
},
{
"input": "2 100\n99 9\n1 10",
"output": "108"
},
{
"input": "2 7\n3 5\n7 4",
"output": "11"
},
{
"input": "4 4\n4 6\n4 8\n1 7\n2 9",
"output": "12"
},
{
"input": "2 1000\n1 2\n1000 1",
"output": "1001"
},
{
"input": "2 20\n1 1\n2 2",
"output": "20"
},
{
"input": "2 20\n10 10\n19 9",
"output": "28"
}
] | 1,517,484,605
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 39
| 62
| 5,632,000
|
n, s = map(int, input().split())
MAXN = 1010
T = [-1]*MAXN
for i in range(n):
f, t = map(int, input().split())
T[f] = max(T[f], t)
now = 0
nowf = s
while nowf > 0:
now = max(now, T[nowf])
nowf-=1
now+=1
print(now)
|
Title: Saitama Destroys Hotel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Saitama accidentally destroyed a hotel again. To repay the hotel company, Genos has volunteered to operate an elevator in one of its other hotels. The elevator is special — it starts on the top floor, can only move down, and has infinite capacity. Floors are numbered from 0 to *s* and elevator initially starts on floor *s* at time 0.
The elevator takes exactly 1 second to move down exactly 1 floor and negligible time to pick up passengers. Genos is given a list detailing when and on which floor passengers arrive. Please determine how long in seconds it will take Genos to bring all passengers to floor 0.
Input Specification:
The first line of input contains two integers *n* and *s* (1<=≤<=*n*<=≤<=100, 1<=≤<=*s*<=≤<=1000) — the number of passengers and the number of the top floor respectively.
The next *n* lines each contain two space-separated integers *f**i* and *t**i* (1<=≤<=*f**i*<=≤<=*s*, 1<=≤<=*t**i*<=≤<=1000) — the floor and the time of arrival in seconds for the passenger number *i*.
Output Specification:
Print a single integer — the minimum amount of time in seconds needed to bring all the passengers to floor 0.
Demo Input:
['3 7\n2 1\n3 8\n5 2\n', '5 10\n2 77\n3 33\n8 21\n9 12\n10 64\n']
Demo Output:
['11\n', '79\n']
Note:
In the first sample, it takes at least 11 seconds to bring all passengers to floor 0. Here is how this could be done:
1. Move to floor 5: takes 2 seconds.
2. Pick up passenger 3.
3. Move to floor 3: takes 2 seconds.
4. Wait for passenger 2 to arrive: takes 4 seconds.
5. Pick up passenger 2.
6. Go to floor 2: takes 1 second.
7. Pick up passenger 1.
8. Go to floor 0: takes 2 seconds.
This gives a total of 2 + 2 + 4 + 1 + 2 = 11 seconds.
|
```python
n, s = map(int, input().split())
MAXN = 1010
T = [-1]*MAXN
for i in range(n):
f, t = map(int, input().split())
T[f] = max(T[f], t)
now = 0
nowf = s
while nowf > 0:
now = max(now, T[nowf])
nowf-=1
now+=1
print(now)
```
| 3
|
|
678
|
A
|
Johny Likes Numbers
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Johny likes numbers *n* and *k* very much. Now Johny wants to find the smallest integer *x* greater than *n*, so it is divisible by the number *k*.
|
The only line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=109).
|
Print the smallest integer *x*<=><=*n*, so it is divisible by the number *k*.
|
[
"5 3\n",
"25 13\n",
"26 13\n"
] |
[
"6\n",
"26\n",
"39\n"
] |
none
| 0
|
[
{
"input": "5 3",
"output": "6"
},
{
"input": "25 13",
"output": "26"
},
{
"input": "26 13",
"output": "39"
},
{
"input": "1 1",
"output": "2"
},
{
"input": "8 8",
"output": "16"
},
{
"input": "14 15",
"output": "15"
},
{
"input": "197 894",
"output": "894"
},
{
"input": "6058 8581",
"output": "8581"
},
{
"input": "97259 41764",
"output": "125292"
},
{
"input": "453145 333625",
"output": "667250"
},
{
"input": "2233224 4394826",
"output": "4394826"
},
{
"input": "76770926 13350712",
"output": "80104272"
},
{
"input": "687355301 142098087",
"output": "710490435"
},
{
"input": "1000000000 999999999",
"output": "1999999998"
},
{
"input": "1000000000 1000000000",
"output": "2000000000"
},
{
"input": "999999999 1000000000",
"output": "1000000000"
},
{
"input": "1000000000 1",
"output": "1000000001"
},
{
"input": "1000000000 2",
"output": "1000000002"
},
{
"input": "999999999 1",
"output": "1000000000"
},
{
"input": "100000000 1",
"output": "100000001"
},
{
"input": "999999999 500000000",
"output": "1000000000"
},
{
"input": "999999990 10",
"output": "1000000000"
},
{
"input": "1000000000 999999997",
"output": "1999999994"
},
{
"input": "999999999 2",
"output": "1000000000"
},
{
"input": "999999984 1",
"output": "999999985"
},
{
"input": "999999983 1",
"output": "999999984"
},
{
"input": "666666666 1",
"output": "666666667"
},
{
"input": "1000000000 990000000",
"output": "1980000000"
},
{
"input": "41 48",
"output": "48"
},
{
"input": "123456 2",
"output": "123458"
},
{
"input": "111 111",
"output": "222"
},
{
"input": "878787 1",
"output": "878788"
},
{
"input": "121 1",
"output": "122"
},
{
"input": "114514 114514",
"output": "229028"
},
{
"input": "500000001 1000000000",
"output": "1000000000"
},
{
"input": "999999997 1",
"output": "999999998"
},
{
"input": "100000000 10",
"output": "100000010"
}
] | 1,545,561,515
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 11
| 500
| 0
|
x=input().split()
a=int(x[0])
b=int(x[1])
if a%b==0:
c=a+b
else:
while a%b!=0:
a+=1
c=a
print(c)
|
Title: Johny Likes Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Johny likes numbers *n* and *k* very much. Now Johny wants to find the smallest integer *x* greater than *n*, so it is divisible by the number *k*.
Input Specification:
The only line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=109).
Output Specification:
Print the smallest integer *x*<=><=*n*, so it is divisible by the number *k*.
Demo Input:
['5 3\n', '25 13\n', '26 13\n']
Demo Output:
['6\n', '26\n', '39\n']
Note:
none
|
```python
x=input().split()
a=int(x[0])
b=int(x[1])
if a%b==0:
c=a+b
else:
while a%b!=0:
a+=1
c=a
print(c)
```
| 0
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,589,893,493
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 186
| 0
|
string = input()
print (string.lower())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
string = input()
print (string.lower())
```
| 0
|
579
|
A
|
Raising Bacteria
|
PROGRAMMING
| 1,000
|
[
"bitmasks"
] | null | null |
You are a lover of bacteria. You want to raise some bacteria in a box.
Initially, the box is empty. Each morning, you can put any number of bacteria into the box. And each night, every bacterium in the box will split into two bacteria. You hope to see exactly *x* bacteria in the box at some moment.
What is the minimum number of bacteria you need to put into the box across those days?
|
The only line containing one integer *x* (1<=≤<=*x*<=≤<=109).
|
The only line containing one integer: the answer.
|
[
"5\n",
"8\n"
] |
[
"2\n",
"1\n"
] |
For the first sample, we can add one bacterium in the box in the first day morning and at the third morning there will be 4 bacteria in the box. Now we put one more resulting 5 in the box. We added 2 bacteria in the process so the answer is 2.
For the second sample, we can put one in the first morning and in the 4-th morning there will be 8 in the box. So the answer is 1.
| 250
|
[
{
"input": "5",
"output": "2"
},
{
"input": "8",
"output": "1"
},
{
"input": "536870911",
"output": "29"
},
{
"input": "1",
"output": "1"
},
{
"input": "343000816",
"output": "14"
},
{
"input": "559980448",
"output": "12"
},
{
"input": "697681824",
"output": "14"
},
{
"input": "41313494",
"output": "14"
},
{
"input": "673935585",
"output": "13"
},
{
"input": "117422204",
"output": "19"
},
{
"input": "954746654",
"output": "15"
},
{
"input": "536838144",
"output": "14"
},
{
"input": "1000000000",
"output": "13"
},
{
"input": "2",
"output": "1"
},
{
"input": "3",
"output": "2"
},
{
"input": "4",
"output": "1"
},
{
"input": "6",
"output": "2"
},
{
"input": "7",
"output": "3"
},
{
"input": "9",
"output": "2"
},
{
"input": "10",
"output": "2"
},
{
"input": "999999999",
"output": "21"
},
{
"input": "999999998",
"output": "20"
},
{
"input": "999999997",
"output": "20"
},
{
"input": "999999996",
"output": "19"
},
{
"input": "999999995",
"output": "20"
},
{
"input": "999999994",
"output": "19"
},
{
"input": "999999993",
"output": "19"
},
{
"input": "999999992",
"output": "18"
},
{
"input": "999999991",
"output": "20"
},
{
"input": "999999990",
"output": "19"
},
{
"input": "536870910",
"output": "28"
},
{
"input": "536870912",
"output": "1"
},
{
"input": "536870913",
"output": "2"
},
{
"input": "536870914",
"output": "2"
},
{
"input": "22",
"output": "3"
},
{
"input": "14",
"output": "3"
}
] | 1,666,891,977
| 2,147,483,647
|
PyPy 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
x = int(input())
c = 0
while x != 0:
c += x % 2
x = x // 2
print(c
|
Title: Raising Bacteria
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are a lover of bacteria. You want to raise some bacteria in a box.
Initially, the box is empty. Each morning, you can put any number of bacteria into the box. And each night, every bacterium in the box will split into two bacteria. You hope to see exactly *x* bacteria in the box at some moment.
What is the minimum number of bacteria you need to put into the box across those days?
Input Specification:
The only line containing one integer *x* (1<=≤<=*x*<=≤<=109).
Output Specification:
The only line containing one integer: the answer.
Demo Input:
['5\n', '8\n']
Demo Output:
['2\n', '1\n']
Note:
For the first sample, we can add one bacterium in the box in the first day morning and at the third morning there will be 4 bacteria in the box. Now we put one more resulting 5 in the box. We added 2 bacteria in the process so the answer is 2.
For the second sample, we can put one in the first morning and in the 4-th morning there will be 8 in the box. So the answer is 1.
|
```python
x = int(input())
c = 0
while x != 0:
c += x % 2
x = x // 2
print(c
```
| -1
|
|
1,008
|
A
|
Romaji
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] | null | null |
Vitya has just started learning Berlanese language. It is known that Berlanese uses the Latin alphabet. Vowel letters are "a", "o", "u", "i", and "e". Other letters are consonant.
In Berlanese, there has to be a vowel after every consonant, but there can be any letter after any vowel. The only exception is a consonant "n"; after this letter, there can be any letter (not only a vowel) or there can be no letter at all. For example, the words "harakiri", "yupie", "man", and "nbo" are Berlanese while the words "horse", "king", "my", and "nz" are not.
Help Vitya find out if a word $s$ is Berlanese.
|
The first line of the input contains the string $s$ consisting of $|s|$ ($1\leq |s|\leq 100$) lowercase Latin letters.
|
Print "YES" (without quotes) if there is a vowel after every consonant except "n", otherwise print "NO".
You can print each letter in any case (upper or lower).
|
[
"sumimasen\n",
"ninja\n",
"codeforces\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
In the first and second samples, a vowel goes after each consonant except "n", so the word is Berlanese.
In the third sample, the consonant "c" goes after the consonant "r", and the consonant "s" stands on the end, so the word is not Berlanese.
| 500
|
[
{
"input": "sumimasen",
"output": "YES"
},
{
"input": "ninja",
"output": "YES"
},
{
"input": "codeforces",
"output": "NO"
},
{
"input": "auuaoonntanonnuewannnnpuuinniwoonennyolonnnvienonpoujinndinunnenannmuveoiuuhikucuziuhunnnmunzancenen",
"output": "YES"
},
{
"input": "n",
"output": "YES"
},
{
"input": "necnei",
"output": "NO"
},
{
"input": "nternn",
"output": "NO"
},
{
"input": "aucunuohja",
"output": "NO"
},
{
"input": "a",
"output": "YES"
},
{
"input": "b",
"output": "NO"
},
{
"input": "nn",
"output": "YES"
},
{
"input": "nnnzaaa",
"output": "YES"
},
{
"input": "zn",
"output": "NO"
},
{
"input": "ab",
"output": "NO"
},
{
"input": "aaaaaaaaaa",
"output": "YES"
},
{
"input": "aaaaaaaaab",
"output": "NO"
},
{
"input": "aaaaaaaaan",
"output": "YES"
},
{
"input": "baaaaaaaaa",
"output": "YES"
},
{
"input": "naaaaaaaaa",
"output": "YES"
},
{
"input": "nbaaaaaaaa",
"output": "YES"
},
{
"input": "bbaaaaaaaa",
"output": "NO"
},
{
"input": "bnaaaaaaaa",
"output": "NO"
},
{
"input": "eonwonojannonnufimiiniewuqaienokacevecinfuqihatenhunliquuyebayiaenifuexuanenuaounnboancaeowonu",
"output": "YES"
},
{
"input": "uixinnepnlinqaingieianndeakuniooudidonnnqeaituioeneiroionxuowudiooonayenfeonuino",
"output": "NO"
},
{
"input": "nnnnnyigaveteononnnnxaalenxuiiwannntoxonyoqonlejuoxuoconnnentoinnul",
"output": "NO"
},
{
"input": "ndonneasoiunhomuunnhuitonnntunntoanerekonoupunanuauenu",
"output": "YES"
},
{
"input": "anujemogawautiedoneobninnibonuunaoennnyoorufonxionntinimiboonununnnnnleenqunminzayoutanlalo",
"output": "NO"
},
{
"input": "y",
"output": "NO"
},
{
"input": "by",
"output": "NO"
},
{
"input": "yy",
"output": "NO"
},
{
"input": "nbn",
"output": "NO"
},
{
"input": "nz",
"output": "NO"
},
{
"input": "king",
"output": "NO"
},
{
"input": "g",
"output": "NO"
},
{
"input": "az",
"output": "NO"
},
{
"input": "x",
"output": "NO"
},
{
"input": "z",
"output": "NO"
},
{
"input": "yn",
"output": "NO"
},
{
"input": "aeo",
"output": "YES"
},
{
"input": "nb",
"output": "NO"
},
{
"input": "npn",
"output": "NO"
},
{
"input": "kini",
"output": "YES"
},
{
"input": "pya",
"output": "NO"
},
{
"input": "m",
"output": "NO"
},
{
"input": "p",
"output": "NO"
},
{
"input": "aaaaaaaak",
"output": "NO"
},
{
"input": "aab",
"output": "NO"
},
{
"input": "d",
"output": "NO"
},
{
"input": "at",
"output": "NO"
},
{
"input": "aaaaaak",
"output": "NO"
},
{
"input": "aaz",
"output": "NO"
},
{
"input": "aaab",
"output": "NO"
},
{
"input": "s",
"output": "NO"
},
{
"input": "nzzen",
"output": "NO"
},
{
"input": "aeionnhhhn",
"output": "NO"
},
{
"input": "h",
"output": "NO"
},
{
"input": "ny",
"output": "NO"
}
] | 1,694,004,957
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 57
| 77
| 0
|
x = input()
vow=['a','e','i','o','u']
n=len(x)
for i in range(n):
if x[i] in vow or x[i]=='n':
continue
else:
if i==n-1:
print('NO')
exit(0)
else:
if x[i+1] not in vow:
print('NO')
exit(0)
print('YES')
|
Title: Romaji
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vitya has just started learning Berlanese language. It is known that Berlanese uses the Latin alphabet. Vowel letters are "a", "o", "u", "i", and "e". Other letters are consonant.
In Berlanese, there has to be a vowel after every consonant, but there can be any letter after any vowel. The only exception is a consonant "n"; after this letter, there can be any letter (not only a vowel) or there can be no letter at all. For example, the words "harakiri", "yupie", "man", and "nbo" are Berlanese while the words "horse", "king", "my", and "nz" are not.
Help Vitya find out if a word $s$ is Berlanese.
Input Specification:
The first line of the input contains the string $s$ consisting of $|s|$ ($1\leq |s|\leq 100$) lowercase Latin letters.
Output Specification:
Print "YES" (without quotes) if there is a vowel after every consonant except "n", otherwise print "NO".
You can print each letter in any case (upper or lower).
Demo Input:
['sumimasen\n', 'ninja\n', 'codeforces\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
In the first and second samples, a vowel goes after each consonant except "n", so the word is Berlanese.
In the third sample, the consonant "c" goes after the consonant "r", and the consonant "s" stands on the end, so the word is not Berlanese.
|
```python
x = input()
vow=['a','e','i','o','u']
n=len(x)
for i in range(n):
if x[i] in vow or x[i]=='n':
continue
else:
if i==n-1:
print('NO')
exit(0)
else:
if x[i+1] not in vow:
print('NO')
exit(0)
print('YES')
```
| 3
|
|
443
|
A
|
Anton and Letters
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
Recently, Anton has found a set. The set consists of small English letters. Anton carefully wrote out all the letters from the set in one line, separated by a comma. He also added an opening curved bracket at the beginning of the line and a closing curved bracket at the end of the line.
Unfortunately, from time to time Anton would forget writing some letter and write it again. He asks you to count the total number of distinct letters in his set.
|
The first and the single line contains the set of letters. The length of the line doesn't exceed 1000. It is guaranteed that the line starts from an opening curved bracket and ends with a closing curved bracket. Between them, small English letters are listed, separated by a comma. Each comma is followed by a space.
|
Print a single number — the number of distinct letters in Anton's set.
|
[
"{a, b, c}\n",
"{b, a, b, a}\n",
"{}\n"
] |
[
"3\n",
"2\n",
"0\n"
] |
none
| 500
|
[
{
"input": "{a, b, c}",
"output": "3"
},
{
"input": "{b, a, b, a}",
"output": "2"
},
{
"input": "{}",
"output": "0"
},
{
"input": "{a, a, c, b, b, b, c, c, c, c}",
"output": "3"
},
{
"input": "{a, c, b, b}",
"output": "3"
},
{
"input": "{a, b}",
"output": "2"
},
{
"input": "{a}",
"output": "1"
},
{
"input": "{b, a, b, a, b, c, c, b, c, b}",
"output": "3"
},
{
"input": "{e, g, c, e}",
"output": "3"
},
{
"input": "{a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a}",
"output": "1"
},
{
"input": "{a, a, b}",
"output": "2"
},
{
"input": "{a, b, b, b, a, b, a, a, a, a, a, a, b, a, b, a, a, a, a, a, b, a, b, a}",
"output": "2"
},
{
"input": "{j, u, a, c, f, w, e, w, x, t, h, p, v, n, i, l, x, n, i, b, u, c, a, a}",
"output": "16"
},
{
"input": "{x, i, w, c, p, e, h, z, k, i}",
"output": "9"
},
{
"input": "{t, k, o, x, r, d, q, j, k, e, z, w, y, r, z, s, s, e, s, b, k, i}",
"output": "15"
},
{
"input": "{y}",
"output": "1"
},
{
"input": "{x}",
"output": "1"
},
{
"input": "{b, z, a, z}",
"output": "3"
},
{
"input": "{z}",
"output": "1"
},
{
"input": "{a, z}",
"output": "2"
},
{
"input": "{a, b, z}",
"output": "3"
},
{
"input": "{s, q, z, r, t, a, b, h, j, i, o, z, r, q}",
"output": "11"
}
] | 1,687,496,221
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 31
| 0
|
letters_set = input()[1:-1]
letters_list = letters_set.split(", ")
distinct_letters = set(letters_list)
count = len(distinct_letters)
print(count)
|
Title: Anton and Letters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, Anton has found a set. The set consists of small English letters. Anton carefully wrote out all the letters from the set in one line, separated by a comma. He also added an opening curved bracket at the beginning of the line and a closing curved bracket at the end of the line.
Unfortunately, from time to time Anton would forget writing some letter and write it again. He asks you to count the total number of distinct letters in his set.
Input Specification:
The first and the single line contains the set of letters. The length of the line doesn't exceed 1000. It is guaranteed that the line starts from an opening curved bracket and ends with a closing curved bracket. Between them, small English letters are listed, separated by a comma. Each comma is followed by a space.
Output Specification:
Print a single number — the number of distinct letters in Anton's set.
Demo Input:
['{a, b, c}\n', '{b, a, b, a}\n', '{}\n']
Demo Output:
['3\n', '2\n', '0\n']
Note:
none
|
```python
letters_set = input()[1:-1]
letters_list = letters_set.split(", ")
distinct_letters = set(letters_list)
count = len(distinct_letters)
print(count)
```
| 0
|
|
496
|
A
|
Minimum Difficulty
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"math"
] | null | null |
Mike is trying rock climbing but he is awful at it.
There are *n* holds on the wall, *i*-th hold is at height *a**i* off the ground. Besides, let the sequence *a**i* increase, that is, *a**i*<=<<=*a**i*<=+<=1 for all *i* from 1 to *n*<=-<=1; we will call such sequence a track. Mike thinks that the track *a*1, ..., *a**n* has difficulty . In other words, difficulty equals the maximum distance between two holds that are adjacent in height.
Today Mike decided to cover the track with holds hanging on heights *a*1, ..., *a**n*. To make the problem harder, Mike decided to remove one hold, that is, remove one element of the sequence (for example, if we take the sequence (1,<=2,<=3,<=4,<=5) and remove the third element from it, we obtain the sequence (1,<=2,<=4,<=5)). However, as Mike is awful at climbing, he wants the final difficulty (i.e. the maximum difference of heights between adjacent holds after removing the hold) to be as small as possible among all possible options of removing a hold. The first and last holds must stay at their positions.
Help Mike determine the minimum difficulty of the track after removing one hold.
|
The first line contains a single integer *n* (3<=≤<=*n*<=≤<=100) — the number of holds.
The next line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=1000), where *a**i* is the height where the hold number *i* hangs. The sequence *a**i* is increasing (i.e. each element except for the first one is strictly larger than the previous one).
|
Print a single number — the minimum difficulty of the track after removing a single hold.
|
[
"3\n1 4 6\n",
"5\n1 2 3 4 5\n",
"5\n1 2 3 7 8\n"
] |
[
"5\n",
"2\n",
"4\n"
] |
In the first sample you can remove only the second hold, then the sequence looks like (1, 6), the maximum difference of the neighboring elements equals 5.
In the second test after removing every hold the difficulty equals 2.
In the third test you can obtain sequences (1, 3, 7, 8), (1, 2, 7, 8), (1, 2, 3, 8), for which the difficulty is 4, 5 and 5, respectively. Thus, after removing the second element we obtain the optimal answer — 4.
| 500
|
[
{
"input": "3\n1 4 6",
"output": "5"
},
{
"input": "5\n1 2 3 4 5",
"output": "2"
},
{
"input": "5\n1 2 3 7 8",
"output": "4"
},
{
"input": "3\n1 500 1000",
"output": "999"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "2"
},
{
"input": "10\n1 4 9 16 25 36 49 64 81 100",
"output": "19"
},
{
"input": "10\n300 315 325 338 350 365 379 391 404 416",
"output": "23"
},
{
"input": "15\n87 89 91 92 93 95 97 99 101 103 105 107 109 111 112",
"output": "2"
},
{
"input": "60\n3 5 7 8 15 16 18 21 24 26 40 41 43 47 48 49 50 51 52 54 55 60 62 71 74 84 85 89 91 96 406 407 409 412 417 420 423 424 428 431 432 433 436 441 445 446 447 455 458 467 469 471 472 475 480 485 492 493 497 500",
"output": "310"
},
{
"input": "3\n159 282 405",
"output": "246"
},
{
"input": "81\n6 7 22 23 27 38 40 56 59 71 72 78 80 83 86 92 95 96 101 122 125 127 130 134 154 169 170 171 172 174 177 182 184 187 195 197 210 211 217 223 241 249 252 253 256 261 265 269 274 277 291 292 297 298 299 300 302 318 338 348 351 353 381 386 387 397 409 410 419 420 428 430 453 460 461 473 478 493 494 500 741",
"output": "241"
},
{
"input": "10\n218 300 388 448 535 629 680 740 836 925",
"output": "111"
},
{
"input": "100\n6 16 26 36 46 56 66 76 86 96 106 116 126 136 146 156 166 176 186 196 206 216 226 236 246 256 266 276 286 296 306 316 326 336 346 356 366 376 386 396 406 416 426 436 446 456 466 476 486 496 506 516 526 536 546 556 566 576 586 596 606 616 626 636 646 656 666 676 686 696 706 716 726 736 746 756 766 776 786 796 806 816 826 836 846 856 866 876 886 896 906 916 926 936 946 956 966 976 986 996",
"output": "20"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000",
"output": "901"
},
{
"input": "100\n1 9 15 17 28 29 30 31 32 46 48 49 52 56 62 77 82 85 90 91 94 101 102 109 111 113 116 118 124 125 131 132 136 138 139 143 145 158 161 162 165 167 171 173 175 177 179 183 189 196 801 802 804 806 817 819 827 830 837 840 842 846 850 855 858 862 863 866 869 870 878 881 883 884 896 898 899 901 904 906 908 909 910 911 912 917 923 924 925 935 939 943 945 956 963 964 965 972 976 978",
"output": "605"
},
{
"input": "100\n2 43 47 49 50 57 59 67 74 98 901 903 904 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 938 939 940 942 943 944 945 946 947 948 949 950 952 953 954 956 957 958 959 960 961 962 963 965 966 967 968 969 970 971 972 973 974 975 976 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 998 999",
"output": "803"
},
{
"input": "72\n178 186 196 209 217 226 236 248 260 273 281 291 300 309 322 331 343 357 366 377 389 399 409 419 429 442 450 459 469 477 491 501 512 524 534 548 557 568 582 593 602 616 630 643 652 660 670 679 693 707 715 728 737 750 759 768 776 789 797 807 815 827 837 849 863 873 881 890 901 910 920 932",
"output": "17"
},
{
"input": "38\n1 28 55 82 109 136 163 190 217 244 271 298 325 352 379 406 433 460 487 514 541 568 595 622 649 676 703 730 757 784 811 838 865 892 919 946 973 1000",
"output": "54"
},
{
"input": "28\n1 38 75 112 149 186 223 260 297 334 371 408 445 482 519 556 593 630 667 704 741 778 815 852 889 926 963 1000",
"output": "74"
}
] | 1,655,464,611
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 19
| 77
| 0
|
n= int(input())
s= [int(x) for x in input().split()]
a=[]
b=[]
for i in range(0,len(s)-2):
a.append(s[i+2]-s[i])
m = a.index((min(a)))
s.pop(m+1)
for i in range(len(s)-1):
b.append(s[i+1]-s[i])
print(max(b))
|
Title: Minimum Difficulty
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mike is trying rock climbing but he is awful at it.
There are *n* holds on the wall, *i*-th hold is at height *a**i* off the ground. Besides, let the sequence *a**i* increase, that is, *a**i*<=<<=*a**i*<=+<=1 for all *i* from 1 to *n*<=-<=1; we will call such sequence a track. Mike thinks that the track *a*1, ..., *a**n* has difficulty . In other words, difficulty equals the maximum distance between two holds that are adjacent in height.
Today Mike decided to cover the track with holds hanging on heights *a*1, ..., *a**n*. To make the problem harder, Mike decided to remove one hold, that is, remove one element of the sequence (for example, if we take the sequence (1,<=2,<=3,<=4,<=5) and remove the third element from it, we obtain the sequence (1,<=2,<=4,<=5)). However, as Mike is awful at climbing, he wants the final difficulty (i.e. the maximum difference of heights between adjacent holds after removing the hold) to be as small as possible among all possible options of removing a hold. The first and last holds must stay at their positions.
Help Mike determine the minimum difficulty of the track after removing one hold.
Input Specification:
The first line contains a single integer *n* (3<=≤<=*n*<=≤<=100) — the number of holds.
The next line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=1000), where *a**i* is the height where the hold number *i* hangs. The sequence *a**i* is increasing (i.e. each element except for the first one is strictly larger than the previous one).
Output Specification:
Print a single number — the minimum difficulty of the track after removing a single hold.
Demo Input:
['3\n1 4 6\n', '5\n1 2 3 4 5\n', '5\n1 2 3 7 8\n']
Demo Output:
['5\n', '2\n', '4\n']
Note:
In the first sample you can remove only the second hold, then the sequence looks like (1, 6), the maximum difference of the neighboring elements equals 5.
In the second test after removing every hold the difficulty equals 2.
In the third test you can obtain sequences (1, 3, 7, 8), (1, 2, 7, 8), (1, 2, 3, 8), for which the difficulty is 4, 5 and 5, respectively. Thus, after removing the second element we obtain the optimal answer — 4.
|
```python
n= int(input())
s= [int(x) for x in input().split()]
a=[]
b=[]
for i in range(0,len(s)-2):
a.append(s[i+2]-s[i])
m = a.index((min(a)))
s.pop(m+1)
for i in range(len(s)-1):
b.append(s[i+1]-s[i])
print(max(b))
```
| 3
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,607,539,180
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 216
| 0
|
M, N = input().split()
M = int(M)
N = int(N)
liczba_pol = M * N
if liczba_pol % 2 == 0:
print(liczba_pol / 2)
else:
print((liczba_pol - 1) / 2)
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
M, N = input().split()
M = int(M)
N = int(N)
liczba_pol = M * N
if liczba_pol % 2 == 0:
print(liczba_pol / 2)
else:
print((liczba_pol - 1) / 2)
```
| 0
|
217
|
A
|
Ice Skating
|
PROGRAMMING
| 1,200
|
[
"brute force",
"dfs and similar",
"dsu",
"graphs"
] | null | null |
Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created.
We assume that Bajtek can only heap up snow drifts at integer coordinates.
|
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift.
Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct.
|
Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one.
|
[
"2\n2 1\n1 2\n",
"2\n2 1\n4 1\n"
] |
[
"1\n",
"0\n"
] |
none
| 500
|
[
{
"input": "2\n2 1\n1 2",
"output": "1"
},
{
"input": "2\n2 1\n4 1",
"output": "0"
},
{
"input": "24\n171 35\n261 20\n4 206\n501 446\n961 912\n581 748\n946 978\n463 514\n841 889\n341 466\n842 967\n54 102\n235 261\n925 889\n682 672\n623 636\n268 94\n635 710\n474 510\n697 794\n586 663\n182 184\n806 663\n468 459",
"output": "21"
},
{
"input": "17\n660 646\n440 442\n689 618\n441 415\n922 865\n950 972\n312 366\n203 229\n873 860\n219 199\n344 308\n169 176\n961 992\n153 84\n201 230\n987 938\n834 815",
"output": "16"
},
{
"input": "11\n798 845\n722 911\n374 270\n629 537\n748 856\n831 885\n486 641\n751 829\n609 492\n98 27\n654 663",
"output": "10"
},
{
"input": "1\n321 88",
"output": "0"
},
{
"input": "9\n811 859\n656 676\n76 141\n945 951\n497 455\n18 55\n335 294\n267 275\n656 689",
"output": "7"
},
{
"input": "7\n948 946\n130 130\n761 758\n941 938\n971 971\n387 385\n509 510",
"output": "6"
},
{
"input": "6\n535 699\n217 337\n508 780\n180 292\n393 112\n732 888",
"output": "5"
},
{
"input": "14\n25 23\n499 406\n193 266\n823 751\n219 227\n101 138\n978 992\n43 74\n997 932\n237 189\n634 538\n774 740\n842 767\n742 802",
"output": "13"
},
{
"input": "12\n548 506\n151 198\n370 380\n655 694\n654 690\n407 370\n518 497\n819 827\n765 751\n802 771\n741 752\n653 662",
"output": "11"
},
{
"input": "40\n685 711\n433 403\n703 710\n491 485\n616 619\n288 282\n884 871\n367 352\n500 511\n977 982\n51 31\n576 564\n508 519\n755 762\n22 20\n368 353\n232 225\n953 955\n452 436\n311 330\n967 988\n369 364\n791 803\n150 149\n651 661\n118 93\n398 387\n748 766\n852 852\n230 228\n555 545\n515 519\n667 678\n867 862\n134 146\n859 863\n96 99\n486 469\n303 296\n780 786",
"output": "38"
},
{
"input": "3\n175 201\n907 909\n388 360",
"output": "2"
},
{
"input": "7\n312 298\n86 78\n73 97\n619 594\n403 451\n538 528\n71 86",
"output": "6"
},
{
"input": "19\n802 820\n368 248\n758 794\n455 378\n876 888\n771 814\n245 177\n586 555\n844 842\n364 360\n820 856\n731 624\n982 975\n825 856\n122 121\n862 896\n42 4\n792 841\n828 820",
"output": "16"
},
{
"input": "32\n643 877\n842 614\n387 176\n99 338\n894 798\n652 728\n611 648\n622 694\n579 781\n243 46\n322 305\n198 438\n708 579\n246 325\n536 459\n874 593\n120 277\n989 907\n223 110\n35 130\n761 692\n690 661\n518 766\n226 93\n678 597\n725 617\n661 574\n775 496\n56 416\n14 189\n358 359\n898 901",
"output": "31"
},
{
"input": "32\n325 327\n20 22\n72 74\n935 933\n664 663\n726 729\n785 784\n170 171\n315 314\n577 580\n984 987\n313 317\n434 435\n962 961\n55 54\n46 44\n743 742\n434 433\n617 612\n332 332\n883 886\n940 936\n793 792\n645 644\n611 607\n418 418\n465 465\n219 218\n167 164\n56 54\n403 405\n210 210",
"output": "29"
},
{
"input": "32\n652 712\n260 241\n27 154\n188 16\n521 351\n518 356\n452 540\n790 827\n339 396\n336 551\n897 930\n828 627\n27 168\n180 113\n134 67\n794 671\n812 711\n100 241\n686 813\n138 289\n384 506\n884 932\n913 959\n470 508\n730 734\n373 478\n788 862\n392 426\n148 68\n113 49\n713 852\n924 894",
"output": "29"
},
{
"input": "14\n685 808\n542 677\n712 747\n832 852\n187 410\n399 338\n626 556\n530 635\n267 145\n215 209\n559 684\n944 949\n753 596\n601 823",
"output": "13"
},
{
"input": "5\n175 158\n16 2\n397 381\n668 686\n957 945",
"output": "4"
},
{
"input": "5\n312 284\n490 509\n730 747\n504 497\n782 793",
"output": "4"
},
{
"input": "2\n802 903\n476 348",
"output": "1"
},
{
"input": "4\n325 343\n425 442\n785 798\n275 270",
"output": "3"
},
{
"input": "28\n462 483\n411 401\n118 94\n111 127\n5 6\n70 52\n893 910\n73 63\n818 818\n182 201\n642 633\n900 886\n893 886\n684 700\n157 173\n953 953\n671 660\n224 225\n832 801\n152 157\n601 585\n115 101\n739 722\n611 606\n659 642\n461 469\n702 689\n649 653",
"output": "25"
},
{
"input": "36\n952 981\n885 900\n803 790\n107 129\n670 654\n143 132\n66 58\n813 819\n849 837\n165 198\n247 228\n15 39\n619 618\n105 138\n868 855\n965 957\n293 298\n613 599\n227 212\n745 754\n723 704\n877 858\n503 487\n678 697\n592 595\n155 135\n962 982\n93 89\n660 673\n225 212\n967 987\n690 680\n804 813\n489 518\n240 221\n111 124",
"output": "34"
},
{
"input": "30\n89 3\n167 156\n784 849\n943 937\n144 95\n24 159\n80 120\n657 683\n585 596\n43 147\n909 964\n131 84\n345 389\n333 321\n91 126\n274 325\n859 723\n866 922\n622 595\n690 752\n902 944\n127 170\n426 383\n905 925\n172 284\n793 810\n414 510\n890 884\n123 24\n267 255",
"output": "29"
},
{
"input": "5\n664 666\n951 941\n739 742\n844 842\n2 2",
"output": "4"
},
{
"input": "3\n939 867\n411 427\n757 708",
"output": "2"
},
{
"input": "36\n429 424\n885 972\n442 386\n512 511\n751 759\n4 115\n461 497\n496 408\n8 23\n542 562\n296 331\n448 492\n412 395\n109 166\n622 640\n379 355\n251 262\n564 586\n66 115\n275 291\n666 611\n629 534\n510 567\n635 666\n738 803\n420 369\n92 17\n101 144\n141 92\n258 258\n184 235\n492 456\n311 210\n394 357\n531 512\n634 636",
"output": "34"
},
{
"input": "29\n462 519\n871 825\n127 335\n156 93\n576 612\n885 830\n634 779\n340 105\n744 795\n716 474\n93 139\n563 805\n137 276\n177 101\n333 14\n391 437\n873 588\n817 518\n460 597\n572 670\n140 303\n392 441\n273 120\n862 578\n670 639\n410 161\n544 577\n193 116\n252 195",
"output": "28"
},
{
"input": "23\n952 907\n345 356\n812 807\n344 328\n242 268\n254 280\n1000 990\n80 78\n424 396\n595 608\n755 813\n383 380\n55 56\n598 633\n203 211\n508 476\n600 593\n206 192\n855 882\n517 462\n967 994\n642 657\n493 488",
"output": "22"
},
{
"input": "10\n579 816\n806 590\n830 787\n120 278\n677 800\n16 67\n188 251\n559 560\n87 67\n104 235",
"output": "8"
},
{
"input": "23\n420 424\n280 303\n515 511\n956 948\n799 803\n441 455\n362 369\n299 289\n823 813\n982 967\n876 878\n185 157\n529 551\n964 989\n655 656\n1 21\n114 112\n45 56\n935 937\n1000 997\n934 942\n360 366\n648 621",
"output": "22"
},
{
"input": "23\n102 84\n562 608\n200 127\n952 999\n465 496\n322 367\n728 690\n143 147\n855 867\n861 866\n26 59\n300 273\n255 351\n192 246\n70 111\n365 277\n32 104\n298 319\n330 354\n241 141\n56 125\n315 298\n412 461",
"output": "22"
},
{
"input": "7\n429 506\n346 307\n99 171\n853 916\n322 263\n115 157\n906 924",
"output": "6"
},
{
"input": "3\n1 1\n2 1\n2 2",
"output": "0"
},
{
"input": "4\n1 1\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "5\n1 1\n1 2\n2 2\n3 1\n3 3",
"output": "0"
},
{
"input": "6\n1 1\n1 2\n2 2\n3 1\n3 2\n3 3",
"output": "0"
},
{
"input": "20\n1 1\n2 2\n3 3\n3 9\n4 4\n5 2\n5 5\n5 7\n5 8\n6 2\n6 6\n6 9\n7 7\n8 8\n9 4\n9 7\n9 9\n10 2\n10 9\n10 10",
"output": "1"
},
{
"input": "21\n1 1\n1 9\n2 1\n2 2\n2 5\n2 6\n2 9\n3 3\n3 8\n4 1\n4 4\n5 5\n5 8\n6 6\n7 7\n8 8\n9 9\n10 4\n10 10\n11 5\n11 11",
"output": "1"
},
{
"input": "22\n1 1\n1 3\n1 4\n1 8\n1 9\n1 11\n2 2\n3 3\n4 4\n4 5\n5 5\n6 6\n6 8\n7 7\n8 3\n8 4\n8 8\n9 9\n10 10\n11 4\n11 9\n11 11",
"output": "3"
},
{
"input": "50\n1 1\n2 2\n2 9\n3 3\n4 4\n4 9\n4 16\n4 24\n5 5\n6 6\n7 7\n8 8\n8 9\n8 20\n9 9\n10 10\n11 11\n12 12\n13 13\n14 7\n14 14\n14 16\n14 25\n15 4\n15 6\n15 15\n15 22\n16 6\n16 16\n17 17\n18 18\n19 6\n19 19\n20 20\n21 21\n22 6\n22 22\n23 23\n24 6\n24 7\n24 8\n24 9\n24 24\n25 1\n25 3\n25 5\n25 7\n25 23\n25 24\n25 25",
"output": "7"
},
{
"input": "55\n1 1\n1 14\n2 2\n2 19\n3 1\n3 3\n3 8\n3 14\n3 23\n4 1\n4 4\n5 5\n5 8\n5 15\n6 2\n6 3\n6 4\n6 6\n7 7\n8 8\n8 21\n9 9\n10 1\n10 10\n11 9\n11 11\n12 12\n13 13\n14 14\n15 15\n15 24\n16 5\n16 16\n17 5\n17 10\n17 17\n17 18\n17 22\n17 27\n18 18\n19 19\n20 20\n21 20\n21 21\n22 22\n23 23\n24 14\n24 24\n25 25\n26 8\n26 11\n26 26\n27 3\n27 27\n28 28",
"output": "5"
},
{
"input": "3\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "6\n4 4\n3 4\n5 4\n4 5\n4 3\n3 1",
"output": "0"
},
{
"input": "4\n1 1\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "3\n1 1\n2 2\n1 2",
"output": "0"
},
{
"input": "8\n1 3\n1 1\n4 1\n2 2\n2 5\n5 9\n5 1\n5 4",
"output": "1"
},
{
"input": "10\n1 1\n1 2\n1 3\n1 4\n5 5\n6 6\n7 7\n8 8\n9 9\n100 100",
"output": "6"
},
{
"input": "7\n1 1\n2 2\n3 3\n4 4\n1 2\n2 3\n3 4",
"output": "0"
},
{
"input": "6\n1 1\n2 1\n2 2\n2 4\n4 3\n2 3",
"output": "0"
},
{
"input": "4\n3 1\n2 1\n2 2\n1 2",
"output": "0"
},
{
"input": "6\n1 1\n2 2\n2 1\n2 4\n4 3\n2 3",
"output": "0"
},
{
"input": "3\n1 2\n1 3\n1 4",
"output": "0"
},
{
"input": "4\n1 1\n2 2\n1 2\n2 1",
"output": "0"
},
{
"input": "4\n1 3\n2 1\n3 2\n3 1",
"output": "1"
},
{
"input": "7\n1 1\n1 2\n2 2\n3 3\n3 4\n4 4\n1 4",
"output": "0"
},
{
"input": "21\n12 12\n13 12\n12 11\n13 13\n10 10\n11 10\n11 11\n501 500\n501 501\n503 502\n500 500\n503 503\n502 501\n502 502\n700 700\n702 702\n703 702\n701 701\n702 701\n703 703\n701 700",
"output": "2"
},
{
"input": "6\n1 11\n6 8\n11 10\n1 10\n11 11\n6 9",
"output": "1"
},
{
"input": "4\n1 1\n2 2\n3 2\n3 1",
"output": "0"
},
{
"input": "3\n1 2\n3 4\n3 2",
"output": "0"
},
{
"input": "3\n1 1\n1 2\n2 2",
"output": "0"
},
{
"input": "4\n5 5\n5 4\n6 3\n6 4",
"output": "0"
},
{
"input": "3\n1 1\n2 2\n2 1",
"output": "0"
}
] | 1,617,212,625
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 35
| 124
| 0
|
def find_best_snow_drifts(snow_drifts, point):
snow_drifts.remove(point)
if len(snow_drifts) > 0:
same_line_snow_drifts = get_points_same_line(snow_drifts, point)
for p in same_line_snow_drifts:
find_best_snow_drifts(snow_drifts, p)
def is_same_line(point1, point2):
return point1[0] == point2[0] or point1[1] == point2[1]
def get_points_same_line(snow_drifts, point):
points = []
for p in snow_drifts:
if (p != point and is_same_line(point, p)):
points.append(p)
return points
if __name__ == "__main__":
n = int(input())
snow_drifts = []
solution = 0
for i in range(n):
coordinates = [int(n) for n in input().split(' ')]
snow_drifts.append(coordinates)
G_SNOW_DRIFTS = snow_drifts.copy()
for point in G_SNOW_DRIFTS:
if point in snow_drifts:
find_best_snow_drifts(snow_drifts, point)
solution += 1
print(solution - 1)
|
Title: Ice Skating
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created.
We assume that Bajtek can only heap up snow drifts at integer coordinates.
Input Specification:
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift.
Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct.
Output Specification:
Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one.
Demo Input:
['2\n2 1\n1 2\n', '2\n2 1\n4 1\n']
Demo Output:
['1\n', '0\n']
Note:
none
|
```python
def find_best_snow_drifts(snow_drifts, point):
snow_drifts.remove(point)
if len(snow_drifts) > 0:
same_line_snow_drifts = get_points_same_line(snow_drifts, point)
for p in same_line_snow_drifts:
find_best_snow_drifts(snow_drifts, p)
def is_same_line(point1, point2):
return point1[0] == point2[0] or point1[1] == point2[1]
def get_points_same_line(snow_drifts, point):
points = []
for p in snow_drifts:
if (p != point and is_same_line(point, p)):
points.append(p)
return points
if __name__ == "__main__":
n = int(input())
snow_drifts = []
solution = 0
for i in range(n):
coordinates = [int(n) for n in input().split(' ')]
snow_drifts.append(coordinates)
G_SNOW_DRIFTS = snow_drifts.copy()
for point in G_SNOW_DRIFTS:
if point in snow_drifts:
find_best_snow_drifts(snow_drifts, point)
solution += 1
print(solution - 1)
```
| -1
|
|
519
|
B
|
A and B and Compilation Errors
|
PROGRAMMING
| 1,100
|
[
"data structures",
"implementation",
"sortings"
] | null | null |
A and B are preparing themselves for programming contests.
B loves to debug his code. But before he runs the solution and starts debugging, he has to first compile the code.
Initially, the compiler displayed *n* compilation errors, each of them is represented as a positive integer. After some effort, B managed to fix some mistake and then another one mistake.
However, despite the fact that B is sure that he corrected the two errors, he can not understand exactly what compilation errors disappeared — the compiler of the language which B uses shows errors in the new order every time! B is sure that unlike many other programming languages, compilation errors for his programming language do not depend on each other, that is, if you correct one error, the set of other error does not change.
Can you help B find out exactly what two errors he corrected?
|
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=105) — the initial number of compilation errors.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the errors the compiler displayed for the first time.
The third line contains *n*<=-<=1 space-separated integers *b*1,<=*b*2,<=...,<=*b**n*<=-<=1 — the errors displayed at the second compilation. It is guaranteed that the sequence in the third line contains all numbers of the second string except for exactly one.
The fourth line contains *n*<=-<=2 space-separated integers *с*1,<=*с*2,<=...,<=*с**n*<=-<=2 — the errors displayed at the third compilation. It is guaranteed that the sequence in the fourth line contains all numbers of the third line except for exactly one.
|
Print two numbers on a single line: the numbers of the compilation errors that disappeared after B made the first and the second correction, respectively.
|
[
"5\n1 5 8 123 7\n123 7 5 1\n5 1 7\n",
"6\n1 4 3 3 5 7\n3 7 5 4 3\n4 3 7 5\n"
] |
[
"8\n123\n",
"1\n3\n"
] |
In the first test sample B first corrects the error number 8, then the error number 123.
In the second test sample B first corrects the error number 1, then the error number 3. Note that if there are multiple errors with the same number, B can correct only one of them in one step.
| 1,000
|
[
{
"input": "5\n1 5 8 123 7\n123 7 5 1\n5 1 7",
"output": "8\n123"
},
{
"input": "6\n1 4 3 3 5 7\n3 7 5 4 3\n4 3 7 5",
"output": "1\n3"
},
{
"input": "3\n1 2 3\n3 2\n2",
"output": "1\n3"
},
{
"input": "10\n460626451 802090732 277246428 661369649 388684428 784303821 376287098 656422756 9301599 25720377\n277246428 388684428 661369649 460626451 656422756 802090732 9301599 784303821 376287098\n376287098 802090732 388684428 9301599 656422756 784303821 460626451 277246428",
"output": "25720377\n661369649"
},
{
"input": "3\n796067435 964699482 819602309\n964699482 796067435\n964699482",
"output": "819602309\n796067435"
},
{
"input": "3\n374054998 726316780 902899520\n902899520 726316780\n726316780",
"output": "374054998\n902899520"
},
{
"input": "3\n168638990 939116221 323703261\n168638990 323703261\n168638990",
"output": "939116221\n323703261"
},
{
"input": "3\n77 77 77\n77 77\n77",
"output": "77\n77"
},
{
"input": "3\n84 30 9\n9 84\n9",
"output": "30\n84"
},
{
"input": "6\n5 4 3 3 5 5\n3 5 5 4 3\n3 5 4 3",
"output": "5\n5"
},
{
"input": "4\n1 5 7 8\n1 5 7\n1 5",
"output": "8\n7"
}
] | 1,693,577,649
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 33
| 155
| 26,521,600
|
from sys import stdin
def input(): return stdin.readline()[:-1]
n=int(input())
a=list(map(int,input().split()))
b=list(map(int,input().split()))
c=list(map(int,input().split()))
l=a+b
ans=l[0]
for i in range(1,2*n-1):
ans^=l[i]
print(ans)
l=b+c
ans=l[0]
for i in range(1,2*n-3):
ans^=l[i]
print(ans)
|
Title: A and B and Compilation Errors
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A and B are preparing themselves for programming contests.
B loves to debug his code. But before he runs the solution and starts debugging, he has to first compile the code.
Initially, the compiler displayed *n* compilation errors, each of them is represented as a positive integer. After some effort, B managed to fix some mistake and then another one mistake.
However, despite the fact that B is sure that he corrected the two errors, he can not understand exactly what compilation errors disappeared — the compiler of the language which B uses shows errors in the new order every time! B is sure that unlike many other programming languages, compilation errors for his programming language do not depend on each other, that is, if you correct one error, the set of other error does not change.
Can you help B find out exactly what two errors he corrected?
Input Specification:
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=105) — the initial number of compilation errors.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the errors the compiler displayed for the first time.
The third line contains *n*<=-<=1 space-separated integers *b*1,<=*b*2,<=...,<=*b**n*<=-<=1 — the errors displayed at the second compilation. It is guaranteed that the sequence in the third line contains all numbers of the second string except for exactly one.
The fourth line contains *n*<=-<=2 space-separated integers *с*1,<=*с*2,<=...,<=*с**n*<=-<=2 — the errors displayed at the third compilation. It is guaranteed that the sequence in the fourth line contains all numbers of the third line except for exactly one.
Output Specification:
Print two numbers on a single line: the numbers of the compilation errors that disappeared after B made the first and the second correction, respectively.
Demo Input:
['5\n1 5 8 123 7\n123 7 5 1\n5 1 7\n', '6\n1 4 3 3 5 7\n3 7 5 4 3\n4 3 7 5\n']
Demo Output:
['8\n123\n', '1\n3\n']
Note:
In the first test sample B first corrects the error number 8, then the error number 123.
In the second test sample B first corrects the error number 1, then the error number 3. Note that if there are multiple errors with the same number, B can correct only one of them in one step.
|
```python
from sys import stdin
def input(): return stdin.readline()[:-1]
n=int(input())
a=list(map(int,input().split()))
b=list(map(int,input().split()))
c=list(map(int,input().split()))
l=a+b
ans=l[0]
for i in range(1,2*n-1):
ans^=l[i]
print(ans)
l=b+c
ans=l[0]
for i in range(1,2*n-3):
ans^=l[i]
print(ans)
```
| 3
|
|
4
|
A
|
Watermelon
|
PROGRAMMING
| 800
|
[
"brute force",
"math"
] |
A. Watermelon
|
1
|
64
|
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
|
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
|
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
|
[
"8\n"
] |
[
"YES\n"
] |
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
| 0
|
[
{
"input": "8",
"output": "YES"
},
{
"input": "5",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "3",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "1",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "10",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "53",
"output": "NO"
},
{
"input": "77",
"output": "NO"
},
{
"input": "32",
"output": "YES"
},
{
"input": "44",
"output": "YES"
},
{
"input": "98",
"output": "YES"
},
{
"input": "99",
"output": "NO"
},
{
"input": "90",
"output": "YES"
},
{
"input": "67",
"output": "NO"
},
{
"input": "100",
"output": "YES"
},
{
"input": "88",
"output": "YES"
}
] | 1,690,186,776
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 30
| 0
|
p=list(map(int,input().split()))
for i in p:
if n%2==0 and n!=2:
print("yes")
else:
print("no")
|
Title: Watermelon
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
Input Specification:
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Output Specification:
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
Demo Input:
['8\n']
Demo Output:
['YES\n']
Note:
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
|
```python
p=list(map(int,input().split()))
for i in p:
if n%2==0 and n!=2:
print("yes")
else:
print("no")
```
| -1
|
899
|
B
|
Months and Years
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
Everybody in Russia uses Gregorian calendar. In this calendar there are 31 days in January, 28 or 29 days in February (depending on whether the year is leap or not), 31 days in March, 30 days in April, 31 days in May, 30 in June, 31 in July, 31 in August, 30 in September, 31 in October, 30 in November, 31 in December.
A year is leap in one of two cases: either its number is divisible by 4, but not divisible by 100, or is divisible by 400. For example, the following years are leap: 2000, 2004, but years 1900 and 2018 are not leap.
In this problem you are given *n* (1<=≤<=*n*<=≤<=24) integers *a*1,<=*a*2,<=...,<=*a**n*, and you have to check if these integers could be durations in days of *n* consecutive months, according to Gregorian calendar. Note that these months could belong to several consecutive years. In other words, check if there is a month in some year, such that its duration is *a*1 days, duration of the next month is *a*2 days, and so on.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=24) — the number of integers.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (28<=≤<=*a**i*<=≤<=31) — the numbers you are to check.
|
If there are several consecutive months that fit the sequence, print "YES" (without quotes). Otherwise, print "NO" (without quotes).
You can print each letter in arbitrary case (small or large).
|
[
"4\n31 31 30 31\n",
"2\n30 30\n",
"5\n29 31 30 31 30\n",
"3\n31 28 30\n",
"3\n31 31 28\n"
] |
[
"Yes\n\n",
"No\n\n",
"Yes\n\n",
"No\n\n",
"Yes\n\n"
] |
In the first example the integers can denote months July, August, September and October.
In the second example the answer is no, because there are no two consecutive months each having 30 days.
In the third example the months are: February (leap year) — March — April – May — June.
In the fourth example the number of days in the second month is 28, so this is February. March follows February and has 31 days, but not 30, so the answer is NO.
In the fifth example the months are: December — January — February (non-leap year).
| 1,000
|
[
{
"input": "4\n31 31 30 31",
"output": "Yes"
},
{
"input": "2\n30 30",
"output": "No"
},
{
"input": "5\n29 31 30 31 30",
"output": "Yes"
},
{
"input": "3\n31 28 30",
"output": "No"
},
{
"input": "3\n31 31 28",
"output": "Yes"
},
{
"input": "24\n29 28 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "4\n31 29 31 30",
"output": "Yes"
},
{
"input": "24\n31 28 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "8\n31 29 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "1\n29",
"output": "Yes"
},
{
"input": "8\n31 29 31 30 31 31 31 31",
"output": "No"
},
{
"input": "1\n31",
"output": "Yes"
},
{
"input": "11\n30 31 30 31 31 30 31 30 31 31 28",
"output": "Yes"
},
{
"input": "21\n30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31",
"output": "Yes"
},
{
"input": "4\n31 28 28 30",
"output": "No"
},
{
"input": "2\n30 31",
"output": "Yes"
},
{
"input": "7\n28 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "4\n28 31 30 31",
"output": "Yes"
},
{
"input": "17\n28 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "9\n31 31 29 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "4\n31 28 31 30",
"output": "Yes"
},
{
"input": "21\n30 31 30 31 31 28 31 30 31 30 31 29 30 31 30 31 31 28 31 30 31",
"output": "No"
},
{
"input": "2\n31 31",
"output": "Yes"
},
{
"input": "17\n31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "4\n30 31 30 31",
"output": "Yes"
},
{
"input": "12\n31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "12\n31 29 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "11\n30 31 30 31 31 30 31 30 31 29 28",
"output": "No"
},
{
"input": "22\n31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "14\n31 30 31 31 28 31 30 31 30 31 31 30 31 30",
"output": "Yes"
},
{
"input": "12\n31 30 31 31 28 31 30 31 30 31 31 30",
"output": "Yes"
},
{
"input": "4\n31 29 29 30",
"output": "No"
},
{
"input": "7\n28 28 30 31 30 31 31",
"output": "No"
},
{
"input": "9\n29 31 29 31 30 31 30 31 31",
"output": "No"
},
{
"input": "17\n31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "2\n31 29",
"output": "Yes"
},
{
"input": "12\n31 28 31 30 31 30 31 31 30 31 28 31",
"output": "No"
},
{
"input": "2\n29 31",
"output": "Yes"
},
{
"input": "12\n31 29 31 30 31 30 31 30 30 31 30 31",
"output": "No"
},
{
"input": "12\n31 28 31 30 31 29 31 31 30 31 30 31",
"output": "No"
},
{
"input": "22\n31 30 31 30 31 31 30 31 30 31 31 28 31 30 28 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "14\n31 30 31 31 28 31 30 31 30 31 31 30 29 30",
"output": "No"
},
{
"input": "19\n31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31",
"output": "Yes"
},
{
"input": "20\n31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "1\n28",
"output": "Yes"
},
{
"input": "1\n29",
"output": "Yes"
},
{
"input": "17\n31 30 31 30 31 31 29 31 30 31 31 31 31 30 31 30 31",
"output": "No"
},
{
"input": "1\n30",
"output": "Yes"
},
{
"input": "1\n31",
"output": "Yes"
},
{
"input": "24\n31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "24\n28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "12\n31 30 31 31 28 28 30 31 30 31 31 30",
"output": "No"
},
{
"input": "24\n29 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "24\n28 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "24\n31 29 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "13\n28 31 30 31 30 31 31 30 31 30 31 31 28",
"output": "Yes"
},
{
"input": "15\n31 31 28 31 30 31 30 31 31 30 31 30 31 31 29",
"output": "Yes"
},
{
"input": "23\n31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31 29 31",
"output": "Yes"
},
{
"input": "24\n31 30 31 30 31 31 30 31 30 31 31 30 31 30 31 30 31 31 30 31 30 31 31 30",
"output": "No"
},
{
"input": "23\n29 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "15\n31 31 29 31 30 31 30 31 31 30 31 30 31 31 28",
"output": "Yes"
},
{
"input": "12\n31 30 31 30 31 30 31 31 30 31 30 31",
"output": "No"
}
] | 1,630,648,203
| 1,683
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 54
| 108
| 20,172,800
|
n = int(input())
l = list(map(int,input().split()))
o = []
for i in range(12):
if i%2 == 0 and i < 7:
o.append(31)
if i%2 == 1 and i < 7:
o.append(30)
if i%2 == 0 and i >= 7:
o.append(30)
if i%2 == 1 and i >= 7:
o.append(31)
o[1] = 28
# print(o)
z = o.copy()
z[1] = 29
e1 = o+o+o
e2 = o+o+z
e3 = o+z+o
e4 = z+o+o
e5 = z+z+z
e6 = z+z+o
e7 = z+o+z
e8 = o+z+z
k = []
k.append(e1)
k.append(e2)
k.append(e3)
k.append(e4)
k.append(e5)
k.append(e6)
k.append(e7)
k.append(e8)
flag = 0
for x in k:
for i in range(len(x)-n):
f = 1
for j in range(n):
if l[j] != x[i+j]:
f = 0
break
if f:
flag = 1
break
if flag:
break
if flag:
print("Yes")
else:
print("No")
|
Title: Months and Years
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Everybody in Russia uses Gregorian calendar. In this calendar there are 31 days in January, 28 or 29 days in February (depending on whether the year is leap or not), 31 days in March, 30 days in April, 31 days in May, 30 in June, 31 in July, 31 in August, 30 in September, 31 in October, 30 in November, 31 in December.
A year is leap in one of two cases: either its number is divisible by 4, but not divisible by 100, or is divisible by 400. For example, the following years are leap: 2000, 2004, but years 1900 and 2018 are not leap.
In this problem you are given *n* (1<=≤<=*n*<=≤<=24) integers *a*1,<=*a*2,<=...,<=*a**n*, and you have to check if these integers could be durations in days of *n* consecutive months, according to Gregorian calendar. Note that these months could belong to several consecutive years. In other words, check if there is a month in some year, such that its duration is *a*1 days, duration of the next month is *a*2 days, and so on.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=24) — the number of integers.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (28<=≤<=*a**i*<=≤<=31) — the numbers you are to check.
Output Specification:
If there are several consecutive months that fit the sequence, print "YES" (without quotes). Otherwise, print "NO" (without quotes).
You can print each letter in arbitrary case (small or large).
Demo Input:
['4\n31 31 30 31\n', '2\n30 30\n', '5\n29 31 30 31 30\n', '3\n31 28 30\n', '3\n31 31 28\n']
Demo Output:
['Yes\n\n', 'No\n\n', 'Yes\n\n', 'No\n\n', 'Yes\n\n']
Note:
In the first example the integers can denote months July, August, September and October.
In the second example the answer is no, because there are no two consecutive months each having 30 days.
In the third example the months are: February (leap year) — March — April – May — June.
In the fourth example the number of days in the second month is 28, so this is February. March follows February and has 31 days, but not 30, so the answer is NO.
In the fifth example the months are: December — January — February (non-leap year).
|
```python
n = int(input())
l = list(map(int,input().split()))
o = []
for i in range(12):
if i%2 == 0 and i < 7:
o.append(31)
if i%2 == 1 and i < 7:
o.append(30)
if i%2 == 0 and i >= 7:
o.append(30)
if i%2 == 1 and i >= 7:
o.append(31)
o[1] = 28
# print(o)
z = o.copy()
z[1] = 29
e1 = o+o+o
e2 = o+o+z
e3 = o+z+o
e4 = z+o+o
e5 = z+z+z
e6 = z+z+o
e7 = z+o+z
e8 = o+z+z
k = []
k.append(e1)
k.append(e2)
k.append(e3)
k.append(e4)
k.append(e5)
k.append(e6)
k.append(e7)
k.append(e8)
flag = 0
for x in k:
for i in range(len(x)-n):
f = 1
for j in range(n):
if l[j] != x[i+j]:
f = 0
break
if f:
flag = 1
break
if flag:
break
if flag:
print("Yes")
else:
print("No")
```
| 0
|
|
239
|
A
|
Two Bags of Potatoes
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation",
"math"
] | null | null |
Valera had two bags of potatoes, the first of these bags contains *x* (*x*<=≥<=1) potatoes, and the second — *y* (*y*<=≥<=1) potatoes. Valera — very scattered boy, so the first bag of potatoes (it contains *x* potatoes) Valera lost. Valera remembers that the total amount of potatoes (*x*<=+<=*y*) in the two bags, firstly, was not gerater than *n*, and, secondly, was divisible by *k*.
Help Valera to determine how many potatoes could be in the first bag. Print all such possible numbers in ascending order.
|
The first line of input contains three integers *y*, *k*, *n* (1<=≤<=*y*,<=*k*,<=*n*<=≤<=109; <=≤<=105).
|
Print the list of whitespace-separated integers — all possible values of *x* in ascending order. You should print each possible value of *x* exactly once.
If there are no such values of *x* print a single integer -1.
|
[
"10 1 10\n",
"10 6 40\n"
] |
[
"-1\n",
"2 8 14 20 26 \n"
] |
none
| 500
|
[
{
"input": "10 1 10",
"output": "-1"
},
{
"input": "10 6 40",
"output": "2 8 14 20 26 "
},
{
"input": "10 1 20",
"output": "1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "1 10000 1000000000",
"output": "9999 19999 29999 39999 49999 59999 69999 79999 89999 99999 109999 119999 129999 139999 149999 159999 169999 179999 189999 199999 209999 219999 229999 239999 249999 259999 269999 279999 289999 299999 309999 319999 329999 339999 349999 359999 369999 379999 389999 399999 409999 419999 429999 439999 449999 459999 469999 479999 489999 499999 509999 519999 529999 539999 549999 559999 569999 579999 589999 599999 609999 619999 629999 639999 649999 659999 669999 679999 689999 699999 709999 719999 729999 739999 7499..."
},
{
"input": "84817 1 33457",
"output": "-1"
},
{
"input": "21 37 99",
"output": "16 53 "
},
{
"input": "78 7 15",
"output": "-1"
},
{
"input": "74 17 27",
"output": "-1"
},
{
"input": "79 23 43",
"output": "-1"
},
{
"input": "32 33 3",
"output": "-1"
},
{
"input": "55 49 44",
"output": "-1"
},
{
"input": "64 59 404",
"output": "54 113 172 231 290 "
},
{
"input": "61 69 820",
"output": "8 77 146 215 284 353 422 491 560 629 698 "
},
{
"input": "17 28 532",
"output": "11 39 67 95 123 151 179 207 235 263 291 319 347 375 403 431 459 487 515 "
},
{
"input": "46592 52 232",
"output": "-1"
},
{
"input": "1541 58 648",
"output": "-1"
},
{
"input": "15946 76 360",
"output": "-1"
},
{
"input": "30351 86 424",
"output": "-1"
},
{
"input": "1 2 37493",
"output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161 163 165 167 169 171 173 175 177 179 181 183 185 187 189 191 193 195 197 199 201 203 205 207 209 211 213 215 217 219 221 223 225 227 229 231 233 235 237 239 241 243 245 247 249 251 253 255 257 259 261 263 265 267 269 271 273 275 277 279 281 28..."
},
{
"input": "1 3 27764",
"output": "2 5 8 11 14 17 20 23 26 29 32 35 38 41 44 47 50 53 56 59 62 65 68 71 74 77 80 83 86 89 92 95 98 101 104 107 110 113 116 119 122 125 128 131 134 137 140 143 146 149 152 155 158 161 164 167 170 173 176 179 182 185 188 191 194 197 200 203 206 209 212 215 218 221 224 227 230 233 236 239 242 245 248 251 254 257 260 263 266 269 272 275 278 281 284 287 290 293 296 299 302 305 308 311 314 317 320 323 326 329 332 335 338 341 344 347 350 353 356 359 362 365 368 371 374 377 380 383 386 389 392 395 398 401 404 407 410..."
},
{
"input": "10 4 9174",
"output": "2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 102 106 110 114 118 122 126 130 134 138 142 146 150 154 158 162 166 170 174 178 182 186 190 194 198 202 206 210 214 218 222 226 230 234 238 242 246 250 254 258 262 266 270 274 278 282 286 290 294 298 302 306 310 314 318 322 326 330 334 338 342 346 350 354 358 362 366 370 374 378 382 386 390 394 398 402 406 410 414 418 422 426 430 434 438 442 446 450 454 458 462 466 470 474 478 482 486 490 494 498 502 506 510 514 518 522 526 530 534 53..."
},
{
"input": "33 7 4971",
"output": "2 9 16 23 30 37 44 51 58 65 72 79 86 93 100 107 114 121 128 135 142 149 156 163 170 177 184 191 198 205 212 219 226 233 240 247 254 261 268 275 282 289 296 303 310 317 324 331 338 345 352 359 366 373 380 387 394 401 408 415 422 429 436 443 450 457 464 471 478 485 492 499 506 513 520 527 534 541 548 555 562 569 576 583 590 597 604 611 618 625 632 639 646 653 660 667 674 681 688 695 702 709 716 723 730 737 744 751 758 765 772 779 786 793 800 807 814 821 828 835 842 849 856 863 870 877 884 891 898 905 912 919..."
},
{
"input": "981 1 3387",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "386 1 2747",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "123 2 50000",
"output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161 163 165 167 169 171 173 175 177 179 181 183 185 187 189 191 193 195 197 199 201 203 205 207 209 211 213 215 217 219 221 223 225 227 229 231 233 235 237 239 241 243 245 247 249 251 253 255 257 259 261 263 265 267 269 271 273 275 277 279 281 28..."
},
{
"input": "3123 100 10000000",
"output": "77 177 277 377 477 577 677 777 877 977 1077 1177 1277 1377 1477 1577 1677 1777 1877 1977 2077 2177 2277 2377 2477 2577 2677 2777 2877 2977 3077 3177 3277 3377 3477 3577 3677 3777 3877 3977 4077 4177 4277 4377 4477 4577 4677 4777 4877 4977 5077 5177 5277 5377 5477 5577 5677 5777 5877 5977 6077 6177 6277 6377 6477 6577 6677 6777 6877 6977 7077 7177 7277 7377 7477 7577 7677 7777 7877 7977 8077 8177 8277 8377 8477 8577 8677 8777 8877 8977 9077 9177 9277 9377 9477 9577 9677 9777 9877 9977 10077 10177 10277 1037..."
},
{
"input": "2 10000 1000000000",
"output": "9998 19998 29998 39998 49998 59998 69998 79998 89998 99998 109998 119998 129998 139998 149998 159998 169998 179998 189998 199998 209998 219998 229998 239998 249998 259998 269998 279998 289998 299998 309998 319998 329998 339998 349998 359998 369998 379998 389998 399998 409998 419998 429998 439998 449998 459998 469998 479998 489998 499998 509998 519998 529998 539998 549998 559998 569998 579998 589998 599998 609998 619998 629998 639998 649998 659998 669998 679998 689998 699998 709998 719998 729998 739998 7499..."
},
{
"input": "3 10000 1000000000",
"output": "9997 19997 29997 39997 49997 59997 69997 79997 89997 99997 109997 119997 129997 139997 149997 159997 169997 179997 189997 199997 209997 219997 229997 239997 249997 259997 269997 279997 289997 299997 309997 319997 329997 339997 349997 359997 369997 379997 389997 399997 409997 419997 429997 439997 449997 459997 469997 479997 489997 499997 509997 519997 529997 539997 549997 559997 569997 579997 589997 599997 609997 619997 629997 639997 649997 659997 669997 679997 689997 699997 709997 719997 729997 739997 7499..."
},
{
"input": "12312223 10000 1000000000",
"output": "7777 17777 27777 37777 47777 57777 67777 77777 87777 97777 107777 117777 127777 137777 147777 157777 167777 177777 187777 197777 207777 217777 227777 237777 247777 257777 267777 277777 287777 297777 307777 317777 327777 337777 347777 357777 367777 377777 387777 397777 407777 417777 427777 437777 447777 457777 467777 477777 487777 497777 507777 517777 527777 537777 547777 557777 567777 577777 587777 597777 607777 617777 627777 637777 647777 657777 667777 677777 687777 697777 707777 717777 727777 737777 7477..."
},
{
"input": "500000000 1000000000 1000000000",
"output": "500000000 "
},
{
"input": "1 1000000000 1000000000",
"output": "999999999 "
},
{
"input": "10 6 11",
"output": "-1"
},
{
"input": "2 100 10",
"output": "-1"
},
{
"input": "1 100000007 1000000000",
"output": "100000006 200000013 300000020 400000027 500000034 600000041 700000048 800000055 900000062 "
},
{
"input": "1 999999999 1000000000",
"output": "999999998 "
},
{
"input": "100000000 1000000000 1000000000",
"output": "900000000 "
},
{
"input": "11 2 12",
"output": "1 "
},
{
"input": "31 10 39",
"output": "-1"
},
{
"input": "48 6 50",
"output": "-1"
},
{
"input": "500000000 500000000 1000000000",
"output": "500000000 "
},
{
"input": "1 1000000000 999999999",
"output": "-1"
},
{
"input": "4 2 10",
"output": "2 4 6 "
},
{
"input": "1000000000 1 1",
"output": "-1"
},
{
"input": "1000000000 1 100000",
"output": "-1"
},
{
"input": "1000000000 1 10",
"output": "-1"
},
{
"input": "10 5 14",
"output": "-1"
},
{
"input": "500000000 499999999 1000000000",
"output": "499999998 "
},
{
"input": "1 999999997 1000000000",
"output": "999999996 "
}
] | 1,638,555,909
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 3
| 1,000
| 0
|
y,k,n=map(int,input().split())
if n<=y:
print(-1)
exit()
potatoes=[]
i=1
while y+i<=n:
if (i+y)%k==0:
potatoes.append(i)
i+=1
print(*potatoes)
|
Title: Two Bags of Potatoes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera had two bags of potatoes, the first of these bags contains *x* (*x*<=≥<=1) potatoes, and the second — *y* (*y*<=≥<=1) potatoes. Valera — very scattered boy, so the first bag of potatoes (it contains *x* potatoes) Valera lost. Valera remembers that the total amount of potatoes (*x*<=+<=*y*) in the two bags, firstly, was not gerater than *n*, and, secondly, was divisible by *k*.
Help Valera to determine how many potatoes could be in the first bag. Print all such possible numbers in ascending order.
Input Specification:
The first line of input contains three integers *y*, *k*, *n* (1<=≤<=*y*,<=*k*,<=*n*<=≤<=109; <=≤<=105).
Output Specification:
Print the list of whitespace-separated integers — all possible values of *x* in ascending order. You should print each possible value of *x* exactly once.
If there are no such values of *x* print a single integer -1.
Demo Input:
['10 1 10\n', '10 6 40\n']
Demo Output:
['-1\n', '2 8 14 20 26 \n']
Note:
none
|
```python
y,k,n=map(int,input().split())
if n<=y:
print(-1)
exit()
potatoes=[]
i=1
while y+i<=n:
if (i+y)%k==0:
potatoes.append(i)
i+=1
print(*potatoes)
```
| 0
|
|
535
|
A
|
Tavas and Nafas
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation"
] | null | null |
Today Tavas got his test result as an integer score and he wants to share it with his girlfriend, Nafas.
His phone operating system is Tavdroid, and its keyboard doesn't have any digits! He wants to share his score with Nafas via text, so he has no choice but to send this number using words.
He ate coffee mix without water again, so right now he's really messed up and can't think.
Your task is to help him by telling him what to type.
|
The first and only line of input contains an integer *s* (0<=≤<=*s*<=≤<=99), Tavas's score.
|
In the first and only line of output, print a single string consisting only from English lowercase letters and hyphens ('-'). Do not use spaces.
|
[
"6\n",
"99\n",
"20\n"
] |
[
"six\n",
"ninety-nine\n",
"twenty\n"
] |
You can find all you need to know about English numerals in [http://en.wikipedia.org/wiki/English_numerals](https://en.wikipedia.org/wiki/English_numerals) .
| 500
|
[
{
"input": "6",
"output": "six"
},
{
"input": "99",
"output": "ninety-nine"
},
{
"input": "20",
"output": "twenty"
},
{
"input": "10",
"output": "ten"
},
{
"input": "15",
"output": "fifteen"
},
{
"input": "27",
"output": "twenty-seven"
},
{
"input": "40",
"output": "forty"
},
{
"input": "63",
"output": "sixty-three"
},
{
"input": "0",
"output": "zero"
},
{
"input": "1",
"output": "one"
},
{
"input": "2",
"output": "two"
},
{
"input": "8",
"output": "eight"
},
{
"input": "9",
"output": "nine"
},
{
"input": "11",
"output": "eleven"
},
{
"input": "12",
"output": "twelve"
},
{
"input": "13",
"output": "thirteen"
},
{
"input": "14",
"output": "fourteen"
},
{
"input": "16",
"output": "sixteen"
},
{
"input": "17",
"output": "seventeen"
},
{
"input": "18",
"output": "eighteen"
},
{
"input": "19",
"output": "nineteen"
},
{
"input": "21",
"output": "twenty-one"
},
{
"input": "29",
"output": "twenty-nine"
},
{
"input": "30",
"output": "thirty"
},
{
"input": "32",
"output": "thirty-two"
},
{
"input": "38",
"output": "thirty-eight"
},
{
"input": "43",
"output": "forty-three"
},
{
"input": "47",
"output": "forty-seven"
},
{
"input": "50",
"output": "fifty"
},
{
"input": "54",
"output": "fifty-four"
},
{
"input": "56",
"output": "fifty-six"
},
{
"input": "60",
"output": "sixty"
},
{
"input": "66",
"output": "sixty-six"
},
{
"input": "70",
"output": "seventy"
},
{
"input": "76",
"output": "seventy-six"
},
{
"input": "80",
"output": "eighty"
},
{
"input": "82",
"output": "eighty-two"
},
{
"input": "90",
"output": "ninety"
},
{
"input": "91",
"output": "ninety-one"
},
{
"input": "95",
"output": "ninety-five"
},
{
"input": "71",
"output": "seventy-one"
},
{
"input": "46",
"output": "forty-six"
},
{
"input": "84",
"output": "eighty-four"
},
{
"input": "22",
"output": "twenty-two"
},
{
"input": "23",
"output": "twenty-three"
},
{
"input": "24",
"output": "twenty-four"
},
{
"input": "25",
"output": "twenty-five"
},
{
"input": "26",
"output": "twenty-six"
},
{
"input": "28",
"output": "twenty-eight"
},
{
"input": "31",
"output": "thirty-one"
},
{
"input": "33",
"output": "thirty-three"
},
{
"input": "34",
"output": "thirty-four"
},
{
"input": "35",
"output": "thirty-five"
},
{
"input": "36",
"output": "thirty-six"
},
{
"input": "37",
"output": "thirty-seven"
},
{
"input": "39",
"output": "thirty-nine"
},
{
"input": "65",
"output": "sixty-five"
},
{
"input": "68",
"output": "sixty-eight"
},
{
"input": "41",
"output": "forty-one"
},
{
"input": "42",
"output": "forty-two"
},
{
"input": "44",
"output": "forty-four"
},
{
"input": "45",
"output": "forty-five"
},
{
"input": "48",
"output": "forty-eight"
},
{
"input": "49",
"output": "forty-nine"
},
{
"input": "51",
"output": "fifty-one"
},
{
"input": "52",
"output": "fifty-two"
},
{
"input": "53",
"output": "fifty-three"
},
{
"input": "55",
"output": "fifty-five"
},
{
"input": "57",
"output": "fifty-seven"
},
{
"input": "58",
"output": "fifty-eight"
},
{
"input": "59",
"output": "fifty-nine"
},
{
"input": "61",
"output": "sixty-one"
},
{
"input": "62",
"output": "sixty-two"
},
{
"input": "64",
"output": "sixty-four"
},
{
"input": "67",
"output": "sixty-seven"
},
{
"input": "69",
"output": "sixty-nine"
},
{
"input": "72",
"output": "seventy-two"
},
{
"input": "73",
"output": "seventy-three"
},
{
"input": "74",
"output": "seventy-four"
},
{
"input": "75",
"output": "seventy-five"
},
{
"input": "77",
"output": "seventy-seven"
},
{
"input": "78",
"output": "seventy-eight"
},
{
"input": "79",
"output": "seventy-nine"
},
{
"input": "81",
"output": "eighty-one"
},
{
"input": "83",
"output": "eighty-three"
},
{
"input": "85",
"output": "eighty-five"
},
{
"input": "86",
"output": "eighty-six"
},
{
"input": "87",
"output": "eighty-seven"
},
{
"input": "88",
"output": "eighty-eight"
},
{
"input": "89",
"output": "eighty-nine"
},
{
"input": "92",
"output": "ninety-two"
},
{
"input": "93",
"output": "ninety-three"
},
{
"input": "94",
"output": "ninety-four"
},
{
"input": "96",
"output": "ninety-six"
},
{
"input": "7",
"output": "seven"
},
{
"input": "97",
"output": "ninety-seven"
},
{
"input": "98",
"output": "ninety-eight"
},
{
"input": "3",
"output": "three"
},
{
"input": "4",
"output": "four"
},
{
"input": "5",
"output": "five"
}
] | 1,587,797,560
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 100
| 124
| 307,200
|
first = ['zero','one','two','three','four','five','six','seven','eight','nine','ten','eleven','twelve','thirteen',
'fourteen','fifteen','sixteen','seventeen','eighteen','nineteen']
second = ['twenty','thirty','forty','fifty','sixty','seventy','eighty','ninety']
n = int(input())
if(n < 20):
print(first[n])
else:
ans=second[n//10-2]
if(n%10 != 0):
ans=ans+'-'+first[n%10]
print(ans)
|
Title: Tavas and Nafas
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today Tavas got his test result as an integer score and he wants to share it with his girlfriend, Nafas.
His phone operating system is Tavdroid, and its keyboard doesn't have any digits! He wants to share his score with Nafas via text, so he has no choice but to send this number using words.
He ate coffee mix without water again, so right now he's really messed up and can't think.
Your task is to help him by telling him what to type.
Input Specification:
The first and only line of input contains an integer *s* (0<=≤<=*s*<=≤<=99), Tavas's score.
Output Specification:
In the first and only line of output, print a single string consisting only from English lowercase letters and hyphens ('-'). Do not use spaces.
Demo Input:
['6\n', '99\n', '20\n']
Demo Output:
['six\n', 'ninety-nine\n', 'twenty\n']
Note:
You can find all you need to know about English numerals in [http://en.wikipedia.org/wiki/English_numerals](https://en.wikipedia.org/wiki/English_numerals) .
|
```python
first = ['zero','one','two','three','four','five','six','seven','eight','nine','ten','eleven','twelve','thirteen',
'fourteen','fifteen','sixteen','seventeen','eighteen','nineteen']
second = ['twenty','thirty','forty','fifty','sixty','seventy','eighty','ninety']
n = int(input())
if(n < 20):
print(first[n])
else:
ans=second[n//10-2]
if(n%10 != 0):
ans=ans+'-'+first[n%10]
print(ans)
```
| 3
|
|
464
|
E
|
The Classic Problem
|
PROGRAMMING
| 3,000
|
[
"data structures",
"graphs",
"shortest paths"
] | null | null |
You are given a weighted undirected graph on *n* vertices and *m* edges. Find the shortest path from vertex *s* to vertex *t* or else state that such path doesn't exist.
|
The first line of the input contains two space-separated integers — *n* and *m* (1<=≤<=*n*<=≤<=105; 0<=≤<=*m*<=≤<=105).
Next *m* lines contain the description of the graph edges. The *i*-th line contains three space-separated integers — *u**i*, *v**i*, *x**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*; 0<=≤<=*x**i*<=≤<=105). That means that vertices with numbers *u**i* and *v**i* are connected by edge of length 2*x**i* (2 to the power of *x**i*).
The last line contains two space-separated integers — the numbers of vertices *s* and *t*.
The vertices are numbered from 1 to *n*. The graph contains no multiple edges and self-loops.
|
In the first line print the remainder after dividing the length of the shortest path by 1000000007 (109<=+<=7) if the path exists, and -1 if the path doesn't exist.
If the path exists print in the second line integer *k* — the number of vertices in the shortest path from vertex *s* to vertex *t*; in the third line print *k* space-separated integers — the vertices of the shortest path in the visiting order. The first vertex should be vertex *s*, the last vertex should be vertex *t*. If there are multiple shortest paths, print any of them.
|
[
"4 4\n1 4 2\n1 2 0\n2 3 0\n3 4 0\n1 4\n",
"4 3\n1 2 4\n2 3 5\n3 4 6\n1 4\n",
"4 2\n1 2 0\n3 4 1\n1 4\n"
] |
[
"3\n4\n1 2 3 4 \n",
"112\n4\n1 2 3 4 \n",
"-1\n"
] |
A path from vertex *s* to vertex *t* is a sequence *v*<sub class="lower-index">0</sub>, ..., *v*<sub class="lower-index">*k*</sub>, such that *v*<sub class="lower-index">0</sub> = *s*, *v*<sub class="lower-index">*k*</sub> = *t*, and for any *i* from 0 to *k* - 1 vertices *v*<sub class="lower-index">*i*</sub> and *v*<sub class="lower-index">*i* + 1</sub> are connected by an edge.
The length of the path is the sum of weights of edges between *v*<sub class="lower-index">*i*</sub> and *v*<sub class="lower-index">*i* + 1</sub> for all *i* from 0 to *k* - 1.
The shortest path from *s* to *t* is the path which length is minimum among all possible paths from *s* to *t*.
| 2,500
|
[] | 1,621,673,941
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 8
| 5,000
| 3,584,000
|
import sys
def solve():
n,m = [int(x) for x in input().split()]
n = n+1
neighbours = [[] for i in range(n)]
for i in range(m):
a,b, dist = [int(x) for x in input().split()]
#dist is the exponent of 2. actual cost would be 2**dist
neighbours[a].append([b,dist])
neighbours[b].append([a,dist])
start, end = [int(x) for x in input().split()]
dist = [sys.maxsize] * n
dist[start] = 0
visited = [False] * n
prev = [None]* n
for step in range(n):
nextNode = 0
minDist = sys.maxsize
#find the next node, being the smallest dist
for i,v in enumerate(visited):
if v:
continue
if dist[i] < minDist:
minDist = dist[i]
nextNode = i
if minDist == sys.maxsize:
break
visited[nextNode] = True
#do the relaxation
for neighbour in neighbours[nextNode]:
node, cost = neighbour
cost = 2 ** cost
tmp = dist[nextNode] + cost
if tmp < dist[node]:
prev[node] = nextNode
dist[node] = dist[nextNode] + cost
#find shortest path
path = [end]
if dist[end] == sys.maxsize:
print(-1)
return
shortestPath = dist[end] % 1000000007
while True:
end = prev[end]
path.append(end)
if end == start:
break
print(shortestPath)
print(len(path))
print(" ".join([ str(x) for x in path[::-1] ]))
solve()
|
Title: The Classic Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a weighted undirected graph on *n* vertices and *m* edges. Find the shortest path from vertex *s* to vertex *t* or else state that such path doesn't exist.
Input Specification:
The first line of the input contains two space-separated integers — *n* and *m* (1<=≤<=*n*<=≤<=105; 0<=≤<=*m*<=≤<=105).
Next *m* lines contain the description of the graph edges. The *i*-th line contains three space-separated integers — *u**i*, *v**i*, *x**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*; 0<=≤<=*x**i*<=≤<=105). That means that vertices with numbers *u**i* and *v**i* are connected by edge of length 2*x**i* (2 to the power of *x**i*).
The last line contains two space-separated integers — the numbers of vertices *s* and *t*.
The vertices are numbered from 1 to *n*. The graph contains no multiple edges and self-loops.
Output Specification:
In the first line print the remainder after dividing the length of the shortest path by 1000000007 (109<=+<=7) if the path exists, and -1 if the path doesn't exist.
If the path exists print in the second line integer *k* — the number of vertices in the shortest path from vertex *s* to vertex *t*; in the third line print *k* space-separated integers — the vertices of the shortest path in the visiting order. The first vertex should be vertex *s*, the last vertex should be vertex *t*. If there are multiple shortest paths, print any of them.
Demo Input:
['4 4\n1 4 2\n1 2 0\n2 3 0\n3 4 0\n1 4\n', '4 3\n1 2 4\n2 3 5\n3 4 6\n1 4\n', '4 2\n1 2 0\n3 4 1\n1 4\n']
Demo Output:
['3\n4\n1 2 3 4 \n', '112\n4\n1 2 3 4 \n', '-1\n']
Note:
A path from vertex *s* to vertex *t* is a sequence *v*<sub class="lower-index">0</sub>, ..., *v*<sub class="lower-index">*k*</sub>, such that *v*<sub class="lower-index">0</sub> = *s*, *v*<sub class="lower-index">*k*</sub> = *t*, and for any *i* from 0 to *k* - 1 vertices *v*<sub class="lower-index">*i*</sub> and *v*<sub class="lower-index">*i* + 1</sub> are connected by an edge.
The length of the path is the sum of weights of edges between *v*<sub class="lower-index">*i*</sub> and *v*<sub class="lower-index">*i* + 1</sub> for all *i* from 0 to *k* - 1.
The shortest path from *s* to *t* is the path which length is minimum among all possible paths from *s* to *t*.
|
```python
import sys
def solve():
n,m = [int(x) for x in input().split()]
n = n+1
neighbours = [[] for i in range(n)]
for i in range(m):
a,b, dist = [int(x) for x in input().split()]
#dist is the exponent of 2. actual cost would be 2**dist
neighbours[a].append([b,dist])
neighbours[b].append([a,dist])
start, end = [int(x) for x in input().split()]
dist = [sys.maxsize] * n
dist[start] = 0
visited = [False] * n
prev = [None]* n
for step in range(n):
nextNode = 0
minDist = sys.maxsize
#find the next node, being the smallest dist
for i,v in enumerate(visited):
if v:
continue
if dist[i] < minDist:
minDist = dist[i]
nextNode = i
if minDist == sys.maxsize:
break
visited[nextNode] = True
#do the relaxation
for neighbour in neighbours[nextNode]:
node, cost = neighbour
cost = 2 ** cost
tmp = dist[nextNode] + cost
if tmp < dist[node]:
prev[node] = nextNode
dist[node] = dist[nextNode] + cost
#find shortest path
path = [end]
if dist[end] == sys.maxsize:
print(-1)
return
shortestPath = dist[end] % 1000000007
while True:
end = prev[end]
path.append(end)
if end == start:
break
print(shortestPath)
print(len(path))
print(" ".join([ str(x) for x in path[::-1] ]))
solve()
```
| 0
|
|
765
|
A
|
Neverending competitions
|
PROGRAMMING
| 900
|
[
"implementation",
"math"
] | null | null |
There are literally dozens of snooker competitions held each year, and team Jinotega tries to attend them all (for some reason they prefer name "snookah")! When a competition takes place somewhere far from their hometown, Ivan, Artsem and Konstantin take a flight to the contest and back.
Jinotega's best friends, team Base have found a list of their itinerary receipts with information about departure and arrival airports. Now they wonder, where is Jinotega now: at home or at some competition far away? They know that:
- this list contains all Jinotega's flights in this year (in arbitrary order), - Jinotega has only flown from his hometown to a snooker contest and back, - after each competition Jinotega flies back home (though they may attend a competition in one place several times), - and finally, at the beginning of the year Jinotega was at home.
Please help them to determine Jinotega's location!
|
In the first line of input there is a single integer *n*: the number of Jinotega's flights (1<=≤<=*n*<=≤<=100). In the second line there is a string of 3 capital Latin letters: the name of Jinotega's home airport. In the next *n* lines there is flight information, one flight per line, in form "XXX->YYY", where "XXX" is the name of departure airport "YYY" is the name of arrival airport. Exactly one of these airports is Jinotega's home airport.
It is guaranteed that flights information is consistent with the knowledge of Jinotega's friends, which is described in the main part of the statement.
|
If Jinotega is now at home, print "home" (without quotes), otherwise print "contest".
|
[
"4\nSVO\nSVO->CDG\nLHR->SVO\nSVO->LHR\nCDG->SVO\n",
"3\nSVO\nSVO->HKT\nHKT->SVO\nSVO->RAP\n"
] |
[
"home\n",
"contest\n"
] |
In the first sample Jinotega might first fly from SVO to CDG and back, and then from SVO to LHR and back, so now they should be at home. In the second sample Jinotega must now be at RAP because a flight from RAP back to SVO is not on the list.
| 500
|
[
{
"input": "4\nSVO\nSVO->CDG\nLHR->SVO\nSVO->LHR\nCDG->SVO",
"output": "home"
},
{
"input": "3\nSVO\nSVO->HKT\nHKT->SVO\nSVO->RAP",
"output": "contest"
},
{
"input": "1\nESJ\nESJ->TSJ",
"output": "contest"
},
{
"input": "2\nXMR\nFAJ->XMR\nXMR->FAJ",
"output": "home"
},
{
"input": "3\nZIZ\nDWJ->ZIZ\nZIZ->DWJ\nZIZ->DWJ",
"output": "contest"
},
{
"input": "10\nPVO\nDMN->PVO\nDMN->PVO\nPVO->DMN\nDMN->PVO\nPVO->DMN\nPVO->DMN\nPVO->DMN\nDMN->PVO\nPVO->DMN\nDMN->PVO",
"output": "home"
},
{
"input": "11\nIAU\nIAU->RUQ\nIAU->RUQ\nRUQ->IAU\nRUQ->IAU\nIAU->RUQ\nRUQ->IAU\nIAU->RUQ\nRUQ->IAU\nIAU->RUQ\nIAU->RUQ\nRUQ->IAU",
"output": "contest"
},
{
"input": "10\nHPN\nDFI->HPN\nHPN->KAB\nHPN->DFI\nVSO->HPN\nHPN->KZX\nHPN->VSO\nKZX->HPN\nLDW->HPN\nKAB->HPN\nHPN->LDW",
"output": "home"
},
{
"input": "11\nFGH\nFGH->BRZ\nUBK->FGH\nQRE->FGH\nFGH->KQK\nFGH->QRE\nKQK->FGH\nFGH->UBK\nBRZ->FGH\nFGH->ALX\nALX->FGH\nFGH->KQK",
"output": "contest"
},
{
"input": "50\nPFH\nJFV->PFH\nBVP->PFH\nPFH->BVP\nPFH->JFV\nPFH->ETQ\nPFH->LQJ\nZTO->PFH\nPFH->BVP\nPFH->RXO\nPFH->ZTO\nHWL->PFH\nPFH->HIV\nPFH->AFP\nPFH->HWL\nOBB->PFH\nHIV->PFH\nPFH->LSR\nAFP->PFH\nLQJ->PFH\nHWL->PFH\nETQ->PFH\nPFH->HWL\nLSR->PFH\nWBR->PFH\nBNZ->PFH\nHQR->PFH\nZTO->PFH\nPFH->WBR\nPFH->BYJ\nRXO->PFH\nFHZ->PFH\nFHZ->PFH\nPFN->PFH\nPFH->GMB\nPFH->JFV\nJFV->PFH\nGNZ->PFH\nPFH->BNZ\nPFH->GNZ\nPFH->HQR\nBYJ->PFH\nGMB->PFH\nPFH->FHZ\nPFH->FHZ\nPFH->ZTO\nPFH->UGD\nBVP->PFH\nUGD->PFH\nPFH->PFN\nPFH->OBB",
"output": "home"
},
{
"input": "1\nAAK\nAAK->ABA",
"output": "contest"
},
{
"input": "1\nXYZ\nXYZ->XYR",
"output": "contest"
}
] | 1,487,086,572
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 23
| 62
| 4,608,000
|
print("contest" if int(input())%2 else "home")
|
Title: Neverending competitions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are literally dozens of snooker competitions held each year, and team Jinotega tries to attend them all (for some reason they prefer name "snookah")! When a competition takes place somewhere far from their hometown, Ivan, Artsem and Konstantin take a flight to the contest and back.
Jinotega's best friends, team Base have found a list of their itinerary receipts with information about departure and arrival airports. Now they wonder, where is Jinotega now: at home or at some competition far away? They know that:
- this list contains all Jinotega's flights in this year (in arbitrary order), - Jinotega has only flown from his hometown to a snooker contest and back, - after each competition Jinotega flies back home (though they may attend a competition in one place several times), - and finally, at the beginning of the year Jinotega was at home.
Please help them to determine Jinotega's location!
Input Specification:
In the first line of input there is a single integer *n*: the number of Jinotega's flights (1<=≤<=*n*<=≤<=100). In the second line there is a string of 3 capital Latin letters: the name of Jinotega's home airport. In the next *n* lines there is flight information, one flight per line, in form "XXX->YYY", where "XXX" is the name of departure airport "YYY" is the name of arrival airport. Exactly one of these airports is Jinotega's home airport.
It is guaranteed that flights information is consistent with the knowledge of Jinotega's friends, which is described in the main part of the statement.
Output Specification:
If Jinotega is now at home, print "home" (without quotes), otherwise print "contest".
Demo Input:
['4\nSVO\nSVO->CDG\nLHR->SVO\nSVO->LHR\nCDG->SVO\n', '3\nSVO\nSVO->HKT\nHKT->SVO\nSVO->RAP\n']
Demo Output:
['home\n', 'contest\n']
Note:
In the first sample Jinotega might first fly from SVO to CDG and back, and then from SVO to LHR and back, so now they should be at home. In the second sample Jinotega must now be at RAP because a flight from RAP back to SVO is not on the list.
|
```python
print("contest" if int(input())%2 else "home")
```
| 3
|
|
552
|
B
|
Vanya and Books
|
PROGRAMMING
| 1,200
|
[
"implementation",
"math"
] | null | null |
Vanya got an important task — he should enumerate books in the library and label each book with its number. Each of the *n* books should be assigned with a number from 1 to *n*. Naturally, distinct books should be assigned distinct numbers.
Vanya wants to know how many digits he will have to write down as he labels the books.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=109) — the number of books in the library.
|
Print the number of digits needed to number all the books.
|
[
"13\n",
"4\n"
] |
[
"17\n",
"4\n"
] |
Note to the first test. The books get numbers 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, which totals to 17 digits.
Note to the second sample. The books get numbers 1, 2, 3, 4, which totals to 4 digits.
| 1,000
|
[
{
"input": "13",
"output": "17"
},
{
"input": "4",
"output": "4"
},
{
"input": "100",
"output": "192"
},
{
"input": "99",
"output": "189"
},
{
"input": "1000000000",
"output": "8888888899"
},
{
"input": "1000000",
"output": "5888896"
},
{
"input": "999",
"output": "2889"
},
{
"input": "55",
"output": "101"
},
{
"input": "222222222",
"output": "1888888896"
},
{
"input": "8",
"output": "8"
},
{
"input": "13",
"output": "17"
},
{
"input": "313",
"output": "831"
},
{
"input": "1342",
"output": "4261"
},
{
"input": "30140",
"output": "139594"
},
{
"input": "290092",
"output": "1629447"
},
{
"input": "2156660",
"output": "13985516"
},
{
"input": "96482216",
"output": "760746625"
},
{
"input": "943006819",
"output": "8375950269"
},
{
"input": "1",
"output": "1"
},
{
"input": "7",
"output": "7"
},
{
"input": "35",
"output": "61"
},
{
"input": "996",
"output": "2880"
},
{
"input": "6120",
"output": "23373"
},
{
"input": "30660",
"output": "142194"
},
{
"input": "349463",
"output": "1985673"
},
{
"input": "8171970",
"output": "56092686"
},
{
"input": "36123011",
"output": "277872985"
},
{
"input": "986747865",
"output": "8769619683"
},
{
"input": "9",
"output": "9"
},
{
"input": "10",
"output": "11"
},
{
"input": "11",
"output": "13"
},
{
"input": "101",
"output": "195"
},
{
"input": "1000",
"output": "2893"
},
{
"input": "1001",
"output": "2897"
},
{
"input": "9999",
"output": "38889"
},
{
"input": "10000",
"output": "38894"
},
{
"input": "10001",
"output": "38899"
},
{
"input": "99999",
"output": "488889"
},
{
"input": "100000",
"output": "488895"
},
{
"input": "100001",
"output": "488901"
},
{
"input": "999999",
"output": "5888889"
},
{
"input": "1000001",
"output": "5888903"
},
{
"input": "9999999",
"output": "68888889"
},
{
"input": "10000000",
"output": "68888897"
},
{
"input": "10000001",
"output": "68888905"
},
{
"input": "99999999",
"output": "788888889"
},
{
"input": "100000000",
"output": "788888898"
},
{
"input": "100000001",
"output": "788888907"
},
{
"input": "999999999",
"output": "8888888889"
},
{
"input": "95",
"output": "181"
},
{
"input": "995",
"output": "2877"
},
{
"input": "9995",
"output": "38873"
},
{
"input": "99995",
"output": "488869"
},
{
"input": "999999995",
"output": "8888888853"
},
{
"input": "999999998",
"output": "8888888880"
}
] | 1,567,432,284
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 4
| 1,000
| 0
|
books = int(input())
digits = 0
for i in range(1, books + 1):
digits += len(str(i))
print(digits)
|
Title: Vanya and Books
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya got an important task — he should enumerate books in the library and label each book with its number. Each of the *n* books should be assigned with a number from 1 to *n*. Naturally, distinct books should be assigned distinct numbers.
Vanya wants to know how many digits he will have to write down as he labels the books.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=109) — the number of books in the library.
Output Specification:
Print the number of digits needed to number all the books.
Demo Input:
['13\n', '4\n']
Demo Output:
['17\n', '4\n']
Note:
Note to the first test. The books get numbers 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, which totals to 17 digits.
Note to the second sample. The books get numbers 1, 2, 3, 4, which totals to 4 digits.
|
```python
books = int(input())
digits = 0
for i in range(1, books + 1):
digits += len(str(i))
print(digits)
```
| 0
|
|
355
|
A
|
Vasya and Digital Root
|
PROGRAMMING
| 1,100
|
[
"constructive algorithms",
"implementation"
] | null | null |
Vasya has recently found out what a digital root of a number is and he decided to share his knowledge with you.
Let's assume that *S*(*n*) is the sum of digits of number *n*, for example, *S*(4098)<==<=4<=+<=0<=+<=9<=+<=8<==<=21. Then the digital root of number *n* equals to:
1. *dr*(*n*)<==<=*S*(*n*), if *S*(*n*)<=<<=10; 1. *dr*(*n*)<==<=*dr*(<=*S*(*n*)<=), if *S*(*n*)<=≥<=10.
For example, *dr*(4098)<=<==<=<=*dr*(21)<=<==<=<=3.
Vasya is afraid of large numbers, so the numbers he works with are at most 101000. For all such numbers, he has proved that *dr*(*n*)<=<==<=<=*S*(<=*S*(<=*S*(<=*S*(*n*)<=)<=)<=) (*n*<=≤<=101000).
Now Vasya wants to quickly find numbers with the given digital root. The problem is, he hasn't learned how to do that and he asked you to help him. You task is, given numbers *k* and *d*, find the number consisting of exactly *k* digits (the leading zeroes are not allowed), with digital root equal to *d*, or else state that such number does not exist.
|
The first line contains two integers *k* and *d* (1<=≤<=*k*<=≤<=1000; 0<=≤<=*d*<=≤<=9).
|
In a single line print either any number that meets the requirements (without the leading zeroes) or "No solution" (without the quotes), if the corresponding number does not exist.
The chosen number must consist of exactly *k* digits. We assume that number 0 doesn't contain any leading zeroes.
|
[
"4 4\n",
"5 1\n",
"1 0\n"
] |
[
"5881\n",
"36172\n",
"0\n"
] |
For the first test sample *dr*(5881) = *dr*(22) = 4.
For the second test sample *dr*(36172) = *dr*(19) = *dr*(10) = 1.
| 500
|
[
{
"input": "4 4",
"output": "5881"
},
{
"input": "5 1",
"output": "36172"
},
{
"input": "1 0",
"output": "0"
},
{
"input": "8 7",
"output": "49722154"
},
{
"input": "487 0",
"output": "No solution"
},
{
"input": "1000 5",
"output": "8541939554067890866522280268745476436249986028349767396372181155840878549622667946850256234534972693110974918858266403731194206972478044933297639886527448596769215803533001453375065914421371731616055420973164037664278812596299678416020519508892847037891229851414508562230407367486468987019052183250172396304562086008837592345867873765321840214188417303688776985319268802181355472294386101622570417737061113209187893810568585166094583478900129912239498334853726870963804475563182775380744565964067602555515611220..."
},
{
"input": "22 9",
"output": "1583569962049529809017"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 9",
"output": "9"
},
{
"input": "13 5",
"output": "1381199538344"
},
{
"input": "100 4",
"output": "6334594910586850938286642284598905674550356974741186703111536643493065423553455569335256292313330478"
},
{
"input": "123 6",
"output": "928024873067884441426263446866614165147002631091527531801777528825238463822318502518751375671158771476735217071878592158343"
},
{
"input": "1000 1",
"output": "8286301124628812353504240076754144327937426329149605334362213339655339076564408659154706137278060590992944494591503606137350736487608756923833530346502466262820452589925067370165968733865814927433418675056573256434073937686361155637721866942352171450747045834987797118866710087297111065178077368748085213082452303815796793489599773148508108295035303578345492871662297456131736137780231762177312635688688714815857818196180724774924848693916003108422682889382923194020205691379066085156078824413573001257245677878..."
},
{
"input": "2 0",
"output": "No solution"
},
{
"input": "734 9",
"output": "5509849803670339733829077693143634799621955270111335907079347964026719040571586127009915057683769302171314977999063915868539391500563742827163274052101515706840652002966522709635011152141196057419086708927225560622675363856445980167733179728663010064912099615416068178748694469047950713834326493597331720572208847439692450327661109751421257198843242305082523510866664350537162158359215265173356615680034808012842300294492281197211603826994471586252822908597603049772690875861970190564793056757768783375525854981..."
},
{
"input": "678 8",
"output": "3301967993506605598118564082793505826927835671912383741219911930496842130418974223636865915672261642456247377827650506657877850580145623499927271391838907804651235401527392426584047219626357010023552497909436550723659221336486898100975437974320483591226280567200180225706948265372905918038750624429412331582504280650041845010449084641487447573160867860208332424835101416924485616494780952529083292227777966546236453553361466209621076748915774965082618181512654546592160909206650552581723190500273752213154329310..."
},
{
"input": "955 7",
"output": "4875434946733568640983465009954221247849488705968833681097920555785434899849497268074436910608289709905212840964404347113134616236366794383005890642796609027376389191650656756216171636192669456464756898600086886269167613161503734300581107122411830728903919402846291350458047685924037685489537178939190129043010338580479169957795695942333133962326316127076129681213167918954090336000635320714955444899171270809399782177230616239894234246885245402806465700760528496316658100834632585364274381823984214942419830421..."
},
{
"input": "893 3",
"output": "3154491812688062338683413382839715419754844054478504300541293341098785797116419835470049101334759365561276155814822131363018164033585874216523127145546903121862283071300185033613164338905028463571111541628115658108609505120357131336651371062955497690723492519748325195227665653129911625684144804656937323976632567108677478936761775342496303735237936919652618323430255701996987753367609559178855599470625167628439986055634187527493497208780060336400261449926469512996188738133678473883670714775784527941804249702..."
},
{
"input": "998 2",
"output": "8948712698877635315965401396781625629035528026219922557326466734622505808493494219669540192792500692387387200924494124219975316993592377253517258369463882172533672158172302951620486954085880606055358057621166471042557383036617719864238933843342304818076672889894622975857106353903546493307325157763617269195570831067239463586554245706859061059010215520785892192165179414199200952765077228454366556358805840526959104496983177402562569401945586771345953166346316987259989961516385311376707950154520512125143059966..."
},
{
"input": "960 6",
"output": "7291446744949293530598651243840704118065364362420848463900543089429494124955982767375712583398715647208330285855809398453361266463042342917037983463277320070057956978767965467358862479678812136400444143489366786562672928727263605336304125661306952421127807059398289873947797478996261161224877129724944902005212399176751167053423457968483336961277157597291131065544350665072172392437597673561840137077580044817979332136630042866681837917711758227272499659805765131669208911408670581308412686469802437930679571593..."
}
] | 1,644,186,366
| 2,147,483,647
|
PyPy 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
n = int(input())
m = int(input())
print(9*(10**(n-1)+m)
|
Title: Vasya and Digital Root
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has recently found out what a digital root of a number is and he decided to share his knowledge with you.
Let's assume that *S*(*n*) is the sum of digits of number *n*, for example, *S*(4098)<==<=4<=+<=0<=+<=9<=+<=8<==<=21. Then the digital root of number *n* equals to:
1. *dr*(*n*)<==<=*S*(*n*), if *S*(*n*)<=<<=10; 1. *dr*(*n*)<==<=*dr*(<=*S*(*n*)<=), if *S*(*n*)<=≥<=10.
For example, *dr*(4098)<=<==<=<=*dr*(21)<=<==<=<=3.
Vasya is afraid of large numbers, so the numbers he works with are at most 101000. For all such numbers, he has proved that *dr*(*n*)<=<==<=<=*S*(<=*S*(<=*S*(<=*S*(*n*)<=)<=)<=) (*n*<=≤<=101000).
Now Vasya wants to quickly find numbers with the given digital root. The problem is, he hasn't learned how to do that and he asked you to help him. You task is, given numbers *k* and *d*, find the number consisting of exactly *k* digits (the leading zeroes are not allowed), with digital root equal to *d*, or else state that such number does not exist.
Input Specification:
The first line contains two integers *k* and *d* (1<=≤<=*k*<=≤<=1000; 0<=≤<=*d*<=≤<=9).
Output Specification:
In a single line print either any number that meets the requirements (without the leading zeroes) or "No solution" (without the quotes), if the corresponding number does not exist.
The chosen number must consist of exactly *k* digits. We assume that number 0 doesn't contain any leading zeroes.
Demo Input:
['4 4\n', '5 1\n', '1 0\n']
Demo Output:
['5881\n', '36172\n', '0\n']
Note:
For the first test sample *dr*(5881) = *dr*(22) = 4.
For the second test sample *dr*(36172) = *dr*(19) = *dr*(10) = 1.
|
```python
n = int(input())
m = int(input())
print(9*(10**(n-1)+m)
```
| -1
|
|
870
|
A
|
Search for Pretty Integers
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation"
] | null | null |
You are given two lists of non-zero digits.
Let's call an integer pretty if its (base 10) representation has at least one digit from the first list and at least one digit from the second list. What is the smallest positive pretty integer?
|
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=9) — the lengths of the first and the second lists, respectively.
The second line contains *n* distinct digits *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=9) — the elements of the first list.
The third line contains *m* distinct digits *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=9) — the elements of the second list.
|
Print the smallest pretty integer.
|
[
"2 3\n4 2\n5 7 6\n",
"8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1\n"
] |
[
"25\n",
"1\n"
] |
In the first example 25, 46, 24567 are pretty, as well as many other integers. The smallest among them is 25. 42 and 24 are not pretty because they don't have digits from the second list.
In the second example all integers that have at least one digit different from 9 are pretty. It's obvious that the smallest among them is 1, because it's the smallest positive integer.
| 500
|
[
{
"input": "2 3\n4 2\n5 7 6",
"output": "25"
},
{
"input": "8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1",
"output": "1"
},
{
"input": "1 1\n9\n1",
"output": "19"
},
{
"input": "9 1\n5 4 2 3 6 1 7 9 8\n9",
"output": "9"
},
{
"input": "5 3\n7 2 5 8 6\n3 1 9",
"output": "12"
},
{
"input": "4 5\n5 2 6 4\n8 9 1 3 7",
"output": "12"
},
{
"input": "5 9\n4 2 1 6 7\n2 3 4 5 6 7 8 9 1",
"output": "1"
},
{
"input": "9 9\n5 4 3 2 1 6 7 8 9\n3 2 1 5 4 7 8 9 6",
"output": "1"
},
{
"input": "9 5\n2 3 4 5 6 7 8 9 1\n4 2 1 6 7",
"output": "1"
},
{
"input": "9 9\n1 2 3 4 5 6 7 8 9\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "9 9\n1 2 3 4 5 6 7 8 9\n9 8 7 6 5 4 3 2 1",
"output": "1"
},
{
"input": "9 9\n9 8 7 6 5 4 3 2 1\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "9 9\n9 8 7 6 5 4 3 2 1\n9 8 7 6 5 4 3 2 1",
"output": "1"
},
{
"input": "1 1\n8\n9",
"output": "89"
},
{
"input": "1 1\n9\n8",
"output": "89"
},
{
"input": "1 1\n1\n2",
"output": "12"
},
{
"input": "1 1\n2\n1",
"output": "12"
},
{
"input": "1 1\n9\n9",
"output": "9"
},
{
"input": "1 1\n1\n1",
"output": "1"
},
{
"input": "4 5\n3 2 4 5\n1 6 5 9 8",
"output": "5"
},
{
"input": "3 2\n4 5 6\n1 5",
"output": "5"
},
{
"input": "5 4\n1 3 5 6 7\n2 4 3 9",
"output": "3"
},
{
"input": "5 5\n1 3 5 7 9\n2 4 6 8 9",
"output": "9"
},
{
"input": "2 2\n1 8\n2 8",
"output": "8"
},
{
"input": "5 5\n5 6 7 8 9\n1 2 3 4 5",
"output": "5"
},
{
"input": "5 5\n1 2 3 4 5\n1 2 3 4 5",
"output": "1"
},
{
"input": "5 5\n1 2 3 4 5\n2 3 4 5 6",
"output": "2"
},
{
"input": "2 2\n1 5\n2 5",
"output": "5"
},
{
"input": "4 4\n1 3 5 8\n2 4 6 8",
"output": "8"
},
{
"input": "3 3\n1 5 3\n2 5 7",
"output": "5"
},
{
"input": "3 3\n3 6 8\n2 6 9",
"output": "6"
},
{
"input": "2 2\n1 4\n2 4",
"output": "4"
},
{
"input": "5 3\n3 4 5 6 7\n1 5 9",
"output": "5"
},
{
"input": "4 4\n1 2 3 4\n2 5 6 7",
"output": "2"
},
{
"input": "5 5\n1 2 3 4 5\n9 2 1 7 5",
"output": "1"
},
{
"input": "2 2\n1 3\n2 3",
"output": "3"
},
{
"input": "3 3\n3 2 1\n3 2 1",
"output": "1"
},
{
"input": "3 3\n1 3 5\n2 3 6",
"output": "3"
},
{
"input": "3 3\n5 6 7\n5 6 7",
"output": "5"
},
{
"input": "1 2\n5\n2 5",
"output": "5"
},
{
"input": "3 3\n2 4 9\n7 8 9",
"output": "9"
},
{
"input": "3 3\n1 2 4\n3 4 5",
"output": "4"
},
{
"input": "3 2\n1 4 9\n2 4",
"output": "4"
},
{
"input": "3 3\n3 5 6\n1 5 9",
"output": "5"
},
{
"input": "3 2\n1 2 4\n3 4",
"output": "4"
},
{
"input": "2 4\n8 9\n1 2 3 9",
"output": "9"
},
{
"input": "1 2\n9\n8 9",
"output": "9"
},
{
"input": "3 2\n1 2 4\n4 2",
"output": "2"
},
{
"input": "2 3\n4 5\n1 3 5",
"output": "5"
},
{
"input": "3 2\n1 2 3\n2 3",
"output": "2"
},
{
"input": "4 3\n1 3 5 9\n2 8 9",
"output": "9"
},
{
"input": "2 2\n1 9\n9 2",
"output": "9"
}
] | 1,611,924,070
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 124
| 2,048,000
|
n,m=map(int,input().split())
a=list(map(int,input().split()))
b=list(map(int,input().split()))
a.sort()
b.sort()
#print(a)
#print(b)
list1=[]
m=1000
for i in range(n):
#print("1st")
if(a[i] in b):
m=a[i]
list1.append(a[i])
break
for i in range(m):
#print("2nd")
if(b[i]>m):
break
if(b[i] in a):
list1.append(b[i])
break
list1.append(int(str(a[0]) + str(b[0])))
print(min(list1))
|
Title: Search for Pretty Integers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two lists of non-zero digits.
Let's call an integer pretty if its (base 10) representation has at least one digit from the first list and at least one digit from the second list. What is the smallest positive pretty integer?
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=9) — the lengths of the first and the second lists, respectively.
The second line contains *n* distinct digits *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=9) — the elements of the first list.
The third line contains *m* distinct digits *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=9) — the elements of the second list.
Output Specification:
Print the smallest pretty integer.
Demo Input:
['2 3\n4 2\n5 7 6\n', '8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1\n']
Demo Output:
['25\n', '1\n']
Note:
In the first example 25, 46, 24567 are pretty, as well as many other integers. The smallest among them is 25. 42 and 24 are not pretty because they don't have digits from the second list.
In the second example all integers that have at least one digit different from 9 are pretty. It's obvious that the smallest among them is 1, because it's the smallest positive integer.
|
```python
n,m=map(int,input().split())
a=list(map(int,input().split()))
b=list(map(int,input().split()))
a.sort()
b.sort()
#print(a)
#print(b)
list1=[]
m=1000
for i in range(n):
#print("1st")
if(a[i] in b):
m=a[i]
list1.append(a[i])
break
for i in range(m):
#print("2nd")
if(b[i]>m):
break
if(b[i] in a):
list1.append(b[i])
break
list1.append(int(str(a[0]) + str(b[0])))
print(min(list1))
```
| -1
|
|
686
|
B
|
Little Robber Girl's Zoo
|
PROGRAMMING
| 1,100
|
[
"constructive algorithms",
"implementation",
"sortings"
] | null | null |
Little Robber Girl likes to scare animals in her zoo for fun. She decided to arrange the animals in a row in the order of non-decreasing height. However, the animals were so scared that they couldn't stay in the right places.
The robber girl was angry at first, but then she decided to arrange the animals herself. She repeatedly names numbers *l* and *r* such that *r*<=-<=*l*<=+<=1 is even. After that animals that occupy positions between *l* and *r* inclusively are rearranged as follows: the animal at position *l* swaps places with the animal at position *l*<=+<=1, the animal *l*<=+<=2 swaps with the animal *l*<=+<=3, ..., finally, the animal at position *r*<=-<=1 swaps with the animal *r*.
Help the robber girl to arrange the animals in the order of non-decreasing height. You should name at most 20<=000 segments, since otherwise the robber girl will become bored and will start scaring the animals again.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — number of animals in the robber girl's zoo.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109), where *a**i* is the height of the animal occupying the *i*-th place.
|
Print the sequence of operations that will rearrange the animals by non-decreasing height.
The output should contain several lines, *i*-th of the lines should contain two space-separated integers *l**i* and *r**i* (1<=≤<=*l**i*<=<<=*r**i*<=≤<=*n*) — descriptions of segments the robber girl should name. The segments should be described in the order the operations are performed.
The number of operations should not exceed 20<=000.
If the animals are arranged correctly from the start, you are allowed to output nothing.
|
[
"4\n2 1 4 3\n",
"7\n36 28 57 39 66 69 68\n",
"5\n1 2 1 2 1\n"
] |
[
"1 4\n",
"1 4\n6 7\n",
"2 5\n3 4\n1 4\n1 4\n"
] |
Note that you don't have to minimize the number of operations. Any solution that performs at most 20 000 operations is allowed.
| 1,000
|
[
{
"input": "4\n2 1 4 3",
"output": "1 2\n3 4"
},
{
"input": "7\n36 28 57 39 66 69 68",
"output": "1 2\n3 4\n6 7"
},
{
"input": "5\n1 2 1 2 1",
"output": "2 3\n4 5\n3 4"
},
{
"input": "78\n7 3 8 8 9 8 10 9 12 11 16 14 17 17 18 18 20 20 25 22 27 26 29 27 35 35 36 36 37 37 38 38 40 39 42 42 48 46 49 49 58 50 60 58 65 61 68 66 69 69 69 69 70 69 71 71 77 73 78 77 80 79 85 83 86 86 86 86 88 87 91 90 96 91 98 97 99 98",
"output": "1 2\n5 6\n7 8\n9 10\n11 12\n19 20\n21 22\n23 24\n33 34\n37 38\n41 42\n43 44\n45 46\n47 48\n53 54\n57 58\n59 60\n61 62\n63 64\n69 70\n71 72\n73 74\n75 76\n77 78"
},
{
"input": "99\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 4 4 4 4 4 4 4 4 4 4 4 4 4 4 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53\n53 54\n54 55\n55 56\n56 57\n57 58\n58 59\n59 60\n60 61\n61 62\n62 63\n63 64\n64 65\n65 66\n66 67\n67 68\n68 69\n69 70\n70 71\n71 72\n72 73\n73 74\n74 75\n75 76\n76 77\n77 78\n78 79\n79 80\n80 81\n81 82\n82 83\n83 84\n84 85\n85 86\n86 87\n87 88\n88 89\n89 90\n90 91\n91 92\n92 93\n..."
},
{
"input": "99\n4577 4577 4576 4576 4576 4576 4576 4576 4576 4576 4576 4576 4576 4575 4575 4575 4575 4575 4575 4574 4574 4574 4574 4574 4574 4574 4574 4574 4574 4573 4573 4573 4573 4573 4573 4573 4573 4573 4573 4573 4573 4572 4572 4572 4572 4572 4572 4572 4572 4572 4572 4572 4571 4571 4571 4571 4571 4571 4571 4571 4571 4570 4570 4570 4570 4570 4570 4570 4569 4569 4569 4569 4569 4569 4569 4569 4569 4569 4569 4568 4568 4568 4568 4568 4568 4568 4568 4568 4568 4568 4567 4567 4567 4567 4567 4567 4567 4567 4567",
"output": "2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53\n53 54\n54 55\n55 56\n56 57\n57 58\n58 59\n59 60\n60 61\n61 62\n62 63\n63 64\n64 65\n65 66\n66 67\n67 68\n68 69\n69 70\n70 71\n71 72\n72 73\n73 74\n74 75\n75 76\n76 77\n7..."
},
{
"input": "10\n44 23 65 17 48 29 49 88 91 85",
"output": "1 2\n3 4\n4 5\n5 6\n6 7\n9 10\n2 3\n4 5\n8 9\n1 2\n3 4"
},
{
"input": "13\n605297997 425887240 859639341 200428931 888317166 983420497 81642057 628988722 389959969 358920886 646428392 324912711 401437250",
"output": "1 2\n3 4\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n2 3\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n1 2\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n3 4\n5 6\n6 7\n8 9\n9 10\n2 3\n4 5\n5 6\n7 8\n8 9\n1 2\n3 4\n4 5\n6 7\n7 8\n3 4\n5 6\n6 7\n4 5\n3 4"
},
{
"input": "43\n644870843 160471908 227474511 47341477 175939701 563067024 749818136 707986934 201095131 736488829 346428456 342944986 316696712 101551423 672610101 897020945 708299245 587795677 408207112 985104524 278945228 192250326 157154304 301319412 270702270 954096281 649990285 37649442 300182190 382249227 605285302 392816037 419998044 84624133 332174228 996770879 816912092 283973844 498255316 374935144 294452244 529912248 553039417",
"output": "1 2\n2 3\n3 4\n4 5\n5 6\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n16 17\n17 18\n18 19\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n2 3\n3 4\n7 8\n9 10\n10 11\n11 12\n12 13\n13 14\n15 16\n16 17\n17 18\n19 20\n20 21\n21 22\n22 23\n23 24\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n1 2\n6 7\n8 9\n9 10\n10 11\n11 12\n12 13\n1..."
},
{
"input": "97\n1 1 1 2 1 1 1 2 1 1 1 1 1 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 1 1 2 1 1 1 1 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 1 1 1 2 2 1 1 2 1 1 1 1 2 2 1 2 1 2 1 1 2 2 2 1 2 2 1 1 2 2 2 1 1 2 1 2 1 1 2",
"output": "4 5\n5 6\n6 7\n8 9\n9 10\n10 11\n11 12\n12 13\n20 21\n22 23\n26 27\n28 29\n34 35\n35 36\n37 38\n38 39\n39 40\n40 41\n42 43\n44 45\n48 49\n58 59\n59 60\n60 61\n63 64\n64 65\n66 67\n67 68\n68 69\n69 70\n72 73\n74 75\n76 77\n77 78\n81 82\n84 85\n85 86\n89 90\n90 91\n92 93\n94 95\n95 96\n7 8\n8 9\n9 10\n10 11\n11 12\n19 20\n21 22\n25 26\n27 28\n33 34\n34 35\n36 37\n37 38\n38 39\n39 40\n41 42\n43 44\n47 48\n57 58\n58 59\n59 60\n62 63\n63 64\n65 66\n66 67\n67 68\n68 69\n71 72\n73 74\n75 76\n76 77\n80 81\n83 84\n..."
},
{
"input": "87\n2 2 1 2 3 1 3 2 3 2 3 3 1 3 3 3 2 2 1 1 2 3 2 1 2 2 3 3 1 1 1 3 2 3 1 2 1 3 3 3 3 3 3 2 3 2 3 3 2 1 1 3 1 1 3 3 2 3 1 1 3 3 3 2 3 1 3 2 2 2 1 3 3 3 1 1 2 3 2 3 2 1 3 3 3 1 3",
"output": "2 3\n5 6\n7 8\n9 10\n12 13\n16 17\n17 18\n18 19\n19 20\n20 21\n22 23\n23 24\n24 25\n25 26\n28 29\n29 30\n30 31\n32 33\n34 35\n35 36\n36 37\n43 44\n45 46\n48 49\n49 50\n50 51\n52 53\n53 54\n56 57\n58 59\n59 60\n63 64\n65 66\n67 68\n68 69\n69 70\n70 71\n74 75\n75 76\n76 77\n78 79\n80 81\n81 82\n85 86\n1 2\n4 5\n6 7\n8 9\n11 12\n15 16\n16 17\n17 18\n18 19\n19 20\n21 22\n22 23\n23 24\n24 25\n27 28\n28 29\n29 30\n31 32\n33 34\n34 35\n35 36\n42 43\n44 45\n47 48\n48 49\n49 50\n51 52\n52 53\n55 56\n57 58\n58 59\n6..."
},
{
"input": "100\n3 2 5 4 3 3 3 3 4 3 1 2 3 2 3 1 4 1 5 2 5 3 3 5 2 3 5 4 3 4 1 5 5 2 2 1 3 5 1 3 5 2 2 1 4 3 1 3 5 1 1 3 5 5 5 4 5 5 1 5 3 5 4 3 5 4 1 1 2 1 2 5 1 2 2 2 3 5 5 5 4 2 3 2 1 2 3 5 2 2 2 2 5 3 5 4 2 5 3 4",
"output": "1 2\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n19 20\n21 22\n22 23\n24 25\n25 26\n27 28\n28 29\n29 30\n30 31\n33 34\n34 35\n35 36\n36 37\n38 39\n39 40\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n49 50\n50 51\n51 52\n55 56\n58 59\n60 61\n62 63\n63 64\n65 66\n66 67\n67 68\n68 69\n69 70\n70 71\n72 73\n73 74\n74 75\n75 76\n76 77\n80 81\n81 82\n82 83\n83 84\n84 85\n85 86\n86 87\n88 89\n89 90\n90 91\n91 92\n93 94\n95 96\n96 97\n98 99\n99 100\n3 4\n4 5\n5 6\n..."
},
{
"input": "100\n245 230 240 248 247 235 240 228 247 243 244 240 246 234 244 247 247 232 247 233 241 247 236 247 230 228 243 237 246 231 246 231 233 235 229 244 247 248 245 248 231 230 238 247 235 248 240 239 233 232 230 229 229 244 247 246 248 247 247 234 243 242 247 228 238 238 236 243 236 228 229 245 232 246 241 243 248 235 242 237 244 239 238 245 231 235 234 237 238 237 234 232 231 236 233 238 228 243 242 246",
"output": "1 2\n2 3\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n38 39\n40 41\n41 42\n42 43\n43 44\n44 45\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53\n53 54\n54 55\n55 56\n57 58\n58 59\n59 60\n60 61\n61 62\n62 63\n63 64\n64 65\n65 66\n66 67\n67 68\n68 69\n69 70\n70 71\n71 72\n72 73\n73 74\n74 75\n75 76\n77 78\n78 79\n79 80\n80 81\n81 82\n8..."
},
{
"input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53\n53 54\n54 55\n55 56\n56 57\n57 58\n58 59\n59 60\n60 61\n61 62\n62 63\n63 64\n64 65\n65 66\n66 67\n67 68\n68 69\n69 70\n70 71\n71 72\n72 73\n73 74\n74 75\n75 76\n76 77\n77 78\n78 79\n79 80\n80 81\n81 82\n82 83\n83 84\n84 85\n85 86\n86 87\n87 88\n88 89\n89 90\n90 91\n91 92\n92 93\n93 94\n94 95\n95 96\n96 97\n97 98\n98 99\n99 100\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53\n53 54\n54 55\n55 56\n56 57\n57 58\n..."
},
{
"input": "98\n5 5 5 5 5 5 5 6 6 6 6 7 6 7 7 7 7 7 7 8 8 8 8 8 8 9 8 9 9 9 9 10 9 10 9 11 10 11 11 11 11 12 12 12 12 12 12 12 12 13 13 13 13 13 13 14 14 14 14 14 14 14 15 15 15 15 15 15 15 16 16 16 16 17 17 17 17 17 17 18 17 18 18 18 19 19 19 19 19 20 19 20 20 20 20 20 20 20",
"output": "12 13\n26 27\n32 33\n34 35\n36 37\n80 81\n90 91\n33 34"
},
{
"input": "20\n2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 2 2 2 2",
"output": "6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11"
}
] | 1,623,561,914
| 1,514
|
PyPy 3
|
OK
|
TESTS
| 37
| 140
| 4,300,800
|
n= int(input())
a = list(map(int,input().split()))
QQQ = 0
while True:
B = list(a)
for i in range(n-1):
if a[i] > a[i+1]:
print(i+1,i+2)
a[i],a[i+1] = a[i+1],a[i]
#print(a)
if a == B:
break
|
Title: Little Robber Girl's Zoo
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Robber Girl likes to scare animals in her zoo for fun. She decided to arrange the animals in a row in the order of non-decreasing height. However, the animals were so scared that they couldn't stay in the right places.
The robber girl was angry at first, but then she decided to arrange the animals herself. She repeatedly names numbers *l* and *r* such that *r*<=-<=*l*<=+<=1 is even. After that animals that occupy positions between *l* and *r* inclusively are rearranged as follows: the animal at position *l* swaps places with the animal at position *l*<=+<=1, the animal *l*<=+<=2 swaps with the animal *l*<=+<=3, ..., finally, the animal at position *r*<=-<=1 swaps with the animal *r*.
Help the robber girl to arrange the animals in the order of non-decreasing height. You should name at most 20<=000 segments, since otherwise the robber girl will become bored and will start scaring the animals again.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — number of animals in the robber girl's zoo.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109), where *a**i* is the height of the animal occupying the *i*-th place.
Output Specification:
Print the sequence of operations that will rearrange the animals by non-decreasing height.
The output should contain several lines, *i*-th of the lines should contain two space-separated integers *l**i* and *r**i* (1<=≤<=*l**i*<=<<=*r**i*<=≤<=*n*) — descriptions of segments the robber girl should name. The segments should be described in the order the operations are performed.
The number of operations should not exceed 20<=000.
If the animals are arranged correctly from the start, you are allowed to output nothing.
Demo Input:
['4\n2 1 4 3\n', '7\n36 28 57 39 66 69 68\n', '5\n1 2 1 2 1\n']
Demo Output:
['1 4\n', '1 4\n6 7\n', '2 5\n3 4\n1 4\n1 4\n']
Note:
Note that you don't have to minimize the number of operations. Any solution that performs at most 20 000 operations is allowed.
|
```python
n= int(input())
a = list(map(int,input().split()))
QQQ = 0
while True:
B = list(a)
for i in range(n-1):
if a[i] > a[i+1]:
print(i+1,i+2)
a[i],a[i+1] = a[i+1],a[i]
#print(a)
if a == B:
break
```
| 3
|
|
330
|
A
|
Cakeminator
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat.
|
The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
|
Output the maximum number of cake cells that the cakeminator can eat.
|
[
"3 4\nS...\n....\n..S.\n"
] |
[
"8\n"
] |
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats).
| 500
|
[
{
"input": "3 4\nS...\n....\n..S.",
"output": "8"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "2 2\nSS\nSS",
"output": "0"
},
{
"input": "7 3\nS..\nS..\nS..\nS..\nS..\nS..\nS..",
"output": "14"
},
{
"input": "3 5\n..S..\nSSSSS\n..S..",
"output": "0"
},
{
"input": "10 10\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS",
"output": "0"
},
{
"input": "10 10\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS",
"output": "30"
},
{
"input": "10 10\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..",
"output": "80"
},
{
"input": "9 5\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS",
"output": "0"
},
{
"input": "9 9\n...S.....\nS.S.....S\n.S....S..\n.S.....SS\n.........\n..S.S..S.\n.SS......\n....S....\n..S...S..",
"output": "17"
},
{
"input": "5 6\nSSSSSS\nSSSSSS\nSSSSSS\nSS.S..\nS.S.SS",
"output": "0"
},
{
"input": "9 8\n........\n.......S\n........\nS.......\n........\n........\nS.......\n........\n.......S",
"output": "64"
},
{
"input": "9 7\n......S\n......S\nS.S.S..\n.......\n.......\n.S.....\n.S....S\n..S....\n.S....S",
"output": "28"
},
{
"input": "10 10\n.....S....\n....SS..S.\n.S...S....\n........SS\n.S.......S\nSS..S.....\n.SS.....SS\nS..S......\n.......SSS\nSSSSS....S",
"output": "10"
},
{
"input": "6 7\n..S.SS.\n......S\n....S.S\nSS..S..\nS..SS.S\n.....S.",
"output": "0"
},
{
"input": "10 6\n.SSSSS\nSSS.SS\nSSSSSS\nS.SSSS\nSSSSS.\nS.SSSS\nSS.SSS\n.SSS.S\n.SSS..\nSS..SS",
"output": "0"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "4 3\n.S.\nS.S\n.S.\nS.S",
"output": "0"
},
{
"input": "2 3\n...\nSSS",
"output": "3"
},
{
"input": "2 4\nS.SS\nS.SS",
"output": "2"
},
{
"input": "2 2\n..\n.S",
"output": "3"
},
{
"input": "3 2\n.S\n.S\nSS",
"output": "0"
},
{
"input": "2 4\nSS.S\n..S.",
"output": "0"
},
{
"input": "2 3\n...\nS..",
"output": "5"
}
] | 1,633,362,798
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 122
| 20,172,800
|
r, c = map(int, input().split())
ar = list()
line = 0
row = 0
for i in range(r):
s = input()
if 'S' in s:
line += 1
for j in range(len(s)):
if j not in ar:
row +=1
ar.append(j)
print(r * c - line * row)
|
Title: Cakeminator
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat.
Input Specification:
The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
Output Specification:
Output the maximum number of cake cells that the cakeminator can eat.
Demo Input:
['3 4\nS...\n....\n..S.\n']
Demo Output:
['8\n']
Note:
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats).
|
```python
r, c = map(int, input().split())
ar = list()
line = 0
row = 0
for i in range(r):
s = input()
if 'S' in s:
line += 1
for j in range(len(s)):
if j not in ar:
row +=1
ar.append(j)
print(r * c - line * row)
```
| 0
|
|
339
|
A
|
Helpful Maths
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings",
"strings"
] | null | null |
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
|
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
|
Print the new sum that Xenia can count.
|
[
"3+2+1\n",
"1+1+3+1+3\n",
"2\n"
] |
[
"1+2+3\n",
"1+1+1+3+3\n",
"2\n"
] |
none
| 500
|
[
{
"input": "3+2+1",
"output": "1+2+3"
},
{
"input": "1+1+3+1+3",
"output": "1+1+1+3+3"
},
{
"input": "2",
"output": "2"
},
{
"input": "2+2+1+1+3",
"output": "1+1+2+2+3"
},
{
"input": "2+1+2+2+2+3+1+3+1+2",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "1+2+1+2+2+2+2+1+3+3",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "2+3+3+1+2+2+2+1+1+2+1+3+2+2+3+3+2+2+3+3+3+1+1+1+3+3+3+2+1+3+2+3+2+1+1+3+3+3+1+2+2+1+2+2+1+2+1+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "1",
"output": "1"
},
{
"input": "2+1+2+2+1+3+2+3+1+1+2+1+2+2+3+1+1+3+3+3+2+2+3+2+2+2+1+2+1+2+3+2+2+2+1+3+1+3+3+3+1+2+1+2+2+2+2+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "2+2+1+1+1+3+1+1+3+3+2+3+1+3+1+1+3+1+1+2+2+2+2+1+2+1+2+1+1+1+3+1+3+2+3+2+3+3+1+1+1+2+3+2+1+3+1+3+2+2",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3+2+3+3+2+2+1+2+1+2+3+1+2+3+2+3+2+1+2+2+1+1+2+2+3+2+1+3+1+1+3+2+2+2+2+3+3+2+2+3+3+1+1+2+3+3+2+3+3+3",
"output": "1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3",
"output": "3"
},
{
"input": "1+1",
"output": "1+1"
},
{
"input": "1+2",
"output": "1+2"
},
{
"input": "1+3",
"output": "1+3"
},
{
"input": "2+1",
"output": "1+2"
},
{
"input": "2+2",
"output": "2+2"
},
{
"input": "2+3",
"output": "2+3"
},
{
"input": "3+1",
"output": "1+3"
},
{
"input": "3+2",
"output": "2+3"
},
{
"input": "3+3",
"output": "3+3"
}
] | 1,696,017,211
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 30
| 0
|
L=input().split('+')
LL=sorted([int(i)for i in L])
s=''
for i in LL:
s=s+str(i)
print(s-'+')
|
Title: Helpful Maths
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
Input Specification:
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
Output Specification:
Print the new sum that Xenia can count.
Demo Input:
['3+2+1\n', '1+1+3+1+3\n', '2\n']
Demo Output:
['1+2+3\n', '1+1+1+3+3\n', '2\n']
Note:
none
|
```python
L=input().split('+')
LL=sorted([int(i)for i in L])
s=''
for i in LL:
s=s+str(i)
print(s-'+')
```
| -1
|
|
522
|
B
|
Photo to Remember
|
PROGRAMMING
| 1,100
|
[
"*special",
"data structures",
"dp",
"implementation"
] | null | null |
One day *n* friends met at a party, they hadn't seen each other for a long time and so they decided to make a group photo together.
Simply speaking, the process of taking photos can be described as follows. On the photo, each photographed friend occupies a rectangle of pixels: the *i*-th of them occupies the rectangle of width *w**i* pixels and height *h**i* pixels. On the group photo everybody stands in a line, thus the minimum pixel size of the photo including all the photographed friends, is *W*<=×<=*H*, where *W* is the total sum of all widths and *H* is the maximum height of all the photographed friends.
As is usually the case, the friends made *n* photos — the *j*-th (1<=≤<=*j*<=≤<=*n*) photo had everybody except for the *j*-th friend as he was the photographer.
Print the minimum size of each made photo in pixels.
|
The first line contains integer *n* (2<=≤<=*n*<=≤<=200<=000) — the number of friends.
Then *n* lines follow: the *i*-th line contains information about the *i*-th friend. The line contains a pair of integers *w**i*,<=*h**i* (1<=≤<=*w**i*<=≤<=10,<=1<=≤<=*h**i*<=≤<=1000) — the width and height in pixels of the corresponding rectangle.
|
Print *n* space-separated numbers *b*1,<=*b*2,<=...,<=*b**n*, where *b**i* — the total number of pixels on the minimum photo containing all friends expect for the *i*-th one.
|
[
"3\n1 10\n5 5\n10 1\n",
"3\n2 1\n1 2\n2 1\n"
] |
[
"75 110 60 ",
"6 4 6 "
] |
none
| 1,000
|
[
{
"input": "3\n1 10\n5 5\n10 1",
"output": "75 110 60 "
},
{
"input": "3\n2 1\n1 2\n2 1",
"output": "6 4 6 "
},
{
"input": "2\n1 5\n2 3",
"output": "6 5 "
},
{
"input": "2\n2 3\n1 1",
"output": "1 6 "
},
{
"input": "3\n1 10\n2 10\n3 10",
"output": "50 40 30 "
},
{
"input": "3\n2 10\n1 9\n3 7",
"output": "36 50 30 "
},
{
"input": "3\n1 1\n3 2\n2 3",
"output": "15 9 8 "
},
{
"input": "3\n3 123\n1 456\n2 789",
"output": "2367 3945 1824 "
},
{
"input": "3\n2 987\n3 654\n1 321",
"output": "2616 2961 4935 "
},
{
"input": "3\n3 143\n2 543\n1 893",
"output": "2679 3572 2715 "
},
{
"input": "2\n1 1\n1 2",
"output": "2 1 "
},
{
"input": "3\n2 22\n1 11\n2 22",
"output": "66 88 66 "
},
{
"input": "3\n1 11\n1 12\n1 13",
"output": "26 26 24 "
},
{
"input": "3\n1 11\n1 12\n2 10",
"output": "36 33 24 "
},
{
"input": "10\n6 20\n1 175\n1 758\n1 169\n2 490\n2 600\n4 463\n7 377\n9 40\n4 961",
"output": "29791 34596 34596 34596 33635 33635 31713 28830 26908 25014 "
},
{
"input": "10\n8 158\n1 709\n6 766\n4 335\n5 356\n2 972\n1 108\n4 235\n3 631\n1 414",
"output": "26244 33048 28188 30132 29160 25278 33048 30132 31104 33048 "
},
{
"input": "10\n7 549\n9 115\n8 141\n3 650\n5 730\n3 841\n7 18\n9 170\n2 217\n1 155",
"output": "39527 37845 38686 42891 41209 37230 39527 37845 43732 44573 "
},
{
"input": "10\n6 386\n9 816\n9 268\n9 481\n8 284\n10 715\n9 351\n7 580\n4 327\n7 392",
"output": "58752 49335 56304 56304 57120 55488 56304 57936 60384 57936 "
},
{
"input": "10\n9 292\n4 6\n6 638\n8 461\n10 970\n10 488\n9 769\n10 644\n8 280\n5 334",
"output": "67900 72750 70810 68870 53061 66930 67900 66930 68870 71780 "
},
{
"input": "10\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000",
"output": "90000 90000 90000 90000 90000 90000 90000 90000 90000 90000 "
}
] | 1,425,832,108
| 1,888
|
Python 3
|
OK
|
TESTS
| 44
| 1,404
| 6,656,000
|
st=int(input())
summa=0
q=[]
w=[]
ish=[]
for i in range(st):
z,x=map(int,input().split())
q.append(z)
w.append(x)
ish.append(x)
summa=sum(q)
w.sort()
for i in range(st):
qw=w[st-1]
if ish[i]==qw:
qw=w[st-2]
print((summa-q[i])*qw,end=' ')
|
Title: Photo to Remember
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day *n* friends met at a party, they hadn't seen each other for a long time and so they decided to make a group photo together.
Simply speaking, the process of taking photos can be described as follows. On the photo, each photographed friend occupies a rectangle of pixels: the *i*-th of them occupies the rectangle of width *w**i* pixels and height *h**i* pixels. On the group photo everybody stands in a line, thus the minimum pixel size of the photo including all the photographed friends, is *W*<=×<=*H*, where *W* is the total sum of all widths and *H* is the maximum height of all the photographed friends.
As is usually the case, the friends made *n* photos — the *j*-th (1<=≤<=*j*<=≤<=*n*) photo had everybody except for the *j*-th friend as he was the photographer.
Print the minimum size of each made photo in pixels.
Input Specification:
The first line contains integer *n* (2<=≤<=*n*<=≤<=200<=000) — the number of friends.
Then *n* lines follow: the *i*-th line contains information about the *i*-th friend. The line contains a pair of integers *w**i*,<=*h**i* (1<=≤<=*w**i*<=≤<=10,<=1<=≤<=*h**i*<=≤<=1000) — the width and height in pixels of the corresponding rectangle.
Output Specification:
Print *n* space-separated numbers *b*1,<=*b*2,<=...,<=*b**n*, where *b**i* — the total number of pixels on the minimum photo containing all friends expect for the *i*-th one.
Demo Input:
['3\n1 10\n5 5\n10 1\n', '3\n2 1\n1 2\n2 1\n']
Demo Output:
['75 110 60 ', '6 4 6 ']
Note:
none
|
```python
st=int(input())
summa=0
q=[]
w=[]
ish=[]
for i in range(st):
z,x=map(int,input().split())
q.append(z)
w.append(x)
ish.append(x)
summa=sum(q)
w.sort()
for i in range(st):
qw=w[st-1]
if ish[i]==qw:
qw=w[st-2]
print((summa-q[i])*qw,end=' ')
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Santa Claus is the first who came to the Christmas Olympiad, and he is going to be the first to take his place at a desk! In the classroom there are *n* lanes of *m* desks each, and there are two working places at each of the desks. The lanes are numbered from 1 to *n* from the left to the right, the desks in a lane are numbered from 1 to *m* starting from the blackboard. Note that the lanes go perpendicularly to the blackboard, not along it (see picture).
The organizers numbered all the working places from 1 to 2*nm*. The places are numbered by lanes (i. e. all the places of the first lane go first, then all the places of the second lane, and so on), in a lane the places are numbered starting from the nearest to the blackboard (i. e. from the first desk in the lane), at each desk, the place on the left is numbered before the place on the right.
Santa Clause knows that his place has number *k*. Help him to determine at which lane at which desk he should sit, and whether his place is on the left or on the right!
|
The only line contains three integers *n*, *m* and *k* (1<=≤<=*n*,<=*m*<=≤<=10<=000, 1<=≤<=*k*<=≤<=2*nm*) — the number of lanes, the number of desks in each lane and the number of Santa Claus' place.
|
Print two integers: the number of lane *r*, the number of desk *d*, and a character *s*, which stands for the side of the desk Santa Claus. The character *s* should be "L", if Santa Clause should sit on the left, and "R" if his place is on the right.
|
[
"4 3 9\n",
"4 3 24\n",
"2 4 4\n"
] |
[
"2 2 L\n",
"4 3 R\n",
"1 2 R\n"
] |
The first and the second samples are shown on the picture. The green place corresponds to Santa Claus' place in the first example, the blue place corresponds to Santa Claus' place in the second example.
In the third sample there are two lanes with four desks in each, and Santa Claus has the fourth place. Thus, his place is in the first lane at the second desk on the right.
| 0
|
[
{
"input": "4 3 9",
"output": "2 2 L"
},
{
"input": "4 3 24",
"output": "4 3 R"
},
{
"input": "2 4 4",
"output": "1 2 R"
},
{
"input": "3 10 24",
"output": "2 2 R"
},
{
"input": "10 3 59",
"output": "10 3 L"
},
{
"input": "10000 10000 160845880",
"output": "8043 2940 R"
},
{
"input": "1 1 1",
"output": "1 1 L"
},
{
"input": "1 1 2",
"output": "1 1 R"
},
{
"input": "1 10000 1",
"output": "1 1 L"
},
{
"input": "1 10000 20000",
"output": "1 10000 R"
},
{
"input": "10000 1 1",
"output": "1 1 L"
},
{
"input": "10000 1 10000",
"output": "5000 1 R"
},
{
"input": "10000 1 20000",
"output": "10000 1 R"
},
{
"input": "3 2 1",
"output": "1 1 L"
},
{
"input": "3 2 2",
"output": "1 1 R"
},
{
"input": "3 2 3",
"output": "1 2 L"
},
{
"input": "3 2 4",
"output": "1 2 R"
},
{
"input": "3 2 5",
"output": "2 1 L"
},
{
"input": "3 2 6",
"output": "2 1 R"
},
{
"input": "3 2 7",
"output": "2 2 L"
},
{
"input": "3 2 8",
"output": "2 2 R"
},
{
"input": "3 2 9",
"output": "3 1 L"
},
{
"input": "3 2 10",
"output": "3 1 R"
},
{
"input": "3 2 11",
"output": "3 2 L"
},
{
"input": "3 2 12",
"output": "3 2 R"
},
{
"input": "300 2000 1068628",
"output": "268 314 R"
},
{
"input": "300 2000 584756",
"output": "147 378 R"
},
{
"input": "300 2000 268181",
"output": "68 91 L"
},
{
"input": "10000 9999 186450844",
"output": "9324 4745 R"
},
{
"input": "10000 9999 197114268",
"output": "9857 6990 R"
},
{
"input": "10000 9999 112390396",
"output": "5621 818 R"
},
{
"input": "10000 10000 1",
"output": "1 1 L"
},
{
"input": "10000 10000 2",
"output": "1 1 R"
},
{
"input": "10000 10000 100000001",
"output": "5001 1 L"
},
{
"input": "10000 10000 199999999",
"output": "10000 10000 L"
},
{
"input": "10000 10000 200000000",
"output": "10000 10000 R"
},
{
"input": "1 2 1",
"output": "1 1 L"
},
{
"input": "1 2 2",
"output": "1 1 R"
},
{
"input": "1 2 3",
"output": "1 2 L"
},
{
"input": "1 2 4",
"output": "1 2 R"
},
{
"input": "2 1 1",
"output": "1 1 L"
},
{
"input": "2 1 2",
"output": "1 1 R"
},
{
"input": "2 1 3",
"output": "2 1 L"
},
{
"input": "2 1 4",
"output": "2 1 R"
},
{
"input": "4 3 7",
"output": "2 1 L"
},
{
"input": "1 1 1",
"output": "1 1 L"
}
] | 1,482,658,725
| 2,025
|
Python 3
|
OK
|
TESTS
| 46
| 93
| 4,608,000
|
"""task a."""
import math
str = input()
number_strings = str.split(" ")
[n, m, k] = [int(n) for n in number_strings]
s = "L" if k % 2 == 1 else "R"
d = math.ceil((k / 2)) % m
d = m if d == 0 else d
r = math.ceil(k / (m * 2))
print(" ", r, d, s)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Santa Claus is the first who came to the Christmas Olympiad, and he is going to be the first to take his place at a desk! In the classroom there are *n* lanes of *m* desks each, and there are two working places at each of the desks. The lanes are numbered from 1 to *n* from the left to the right, the desks in a lane are numbered from 1 to *m* starting from the blackboard. Note that the lanes go perpendicularly to the blackboard, not along it (see picture).
The organizers numbered all the working places from 1 to 2*nm*. The places are numbered by lanes (i. e. all the places of the first lane go first, then all the places of the second lane, and so on), in a lane the places are numbered starting from the nearest to the blackboard (i. e. from the first desk in the lane), at each desk, the place on the left is numbered before the place on the right.
Santa Clause knows that his place has number *k*. Help him to determine at which lane at which desk he should sit, and whether his place is on the left or on the right!
Input Specification:
The only line contains three integers *n*, *m* and *k* (1<=≤<=*n*,<=*m*<=≤<=10<=000, 1<=≤<=*k*<=≤<=2*nm*) — the number of lanes, the number of desks in each lane and the number of Santa Claus' place.
Output Specification:
Print two integers: the number of lane *r*, the number of desk *d*, and a character *s*, which stands for the side of the desk Santa Claus. The character *s* should be "L", if Santa Clause should sit on the left, and "R" if his place is on the right.
Demo Input:
['4 3 9\n', '4 3 24\n', '2 4 4\n']
Demo Output:
['2 2 L\n', '4 3 R\n', '1 2 R\n']
Note:
The first and the second samples are shown on the picture. The green place corresponds to Santa Claus' place in the first example, the blue place corresponds to Santa Claus' place in the second example.
In the third sample there are two lanes with four desks in each, and Santa Claus has the fourth place. Thus, his place is in the first lane at the second desk on the right.
|
```python
"""task a."""
import math
str = input()
number_strings = str.split(" ")
[n, m, k] = [int(n) for n in number_strings]
s = "L" if k % 2 == 1 else "R"
d = math.ceil((k / 2)) % m
d = m if d == 0 else d
r = math.ceil(k / (m * 2))
print(" ", r, d, s)
```
| 3
|
|
8
|
A
|
Train and Peter
|
PROGRAMMING
| 1,200
|
[
"strings"
] |
A. Train and Peter
|
1
|
64
|
Peter likes to travel by train. He likes it so much that on the train he falls asleep.
Once in summer Peter was going by train from city A to city B, and as usual, was sleeping. Then he woke up, started to look through the window and noticed that every railway station has a flag of a particular colour.
The boy started to memorize the order of the flags' colours that he had seen. But soon he fell asleep again. Unfortunately, he didn't sleep long, he woke up and went on memorizing the colours. Then he fell asleep again, and that time he slept till the end of the journey.
At the station he told his parents about what he was doing, and wrote two sequences of the colours that he had seen before and after his sleep, respectively.
Peter's parents know that their son likes to fantasize. They give you the list of the flags' colours at the stations that the train passes sequentially on the way from A to B, and ask you to find out if Peter could see those sequences on the way from A to B, or from B to A. Remember, please, that Peter had two periods of wakefulness.
Peter's parents put lowercase Latin letters for colours. The same letter stands for the same colour, different letters — for different colours.
|
The input data contains three lines. The first line contains a non-empty string, whose length does not exceed 105, the string consists of lowercase Latin letters — the flags' colours at the stations on the way from A to B. On the way from B to A the train passes the same stations, but in reverse order.
The second line contains the sequence, written by Peter during the first period of wakefulness. The third line contains the sequence, written during the second period of wakefulness. Both sequences are non-empty, consist of lowercase Latin letters, and the length of each does not exceed 100 letters. Each of the sequences is written in chronological order.
|
Output one of the four words without inverted commas:
- «forward» — if Peter could see such sequences only on the way from A to B; - «backward» — if Peter could see such sequences on the way from B to A; - «both» — if Peter could see such sequences both on the way from A to B, and on the way from B to A; - «fantasy» — if Peter could not see such sequences.
|
[
"atob\na\nb\n",
"aaacaaa\naca\naa\n"
] |
[
"forward\n",
"both\n"
] |
It is assumed that the train moves all the time, so one flag cannot be seen twice. There are no flags at stations A and B.
| 0
|
[
{
"input": "atob\na\nb",
"output": "forward"
},
{
"input": "aaacaaa\naca\naa",
"output": "both"
},
{
"input": "aaa\naa\naa",
"output": "fantasy"
},
{
"input": "astalavista\nastla\nlavista",
"output": "fantasy"
},
{
"input": "abacabadabacaba\nabacaba\nabacaba",
"output": "both"
},
{
"input": "a\na\na",
"output": "fantasy"
},
{
"input": "ab\nb\na",
"output": "backward"
},
{
"input": "aaa\naaaa\naaaa",
"output": "fantasy"
},
{
"input": "bbabbbbababbaabaabaa\nabb\nbaab",
"output": "forward"
},
{
"input": "bbbbbbbbbbbbbbbbbbbbbbbbb\nbbbb\nbbbbb",
"output": "both"
},
{
"input": "babaabababaaaababaabababaabababababababbababbbabbaabababaababbaabbababaababaaabababaabbaababaaababaa\nabaabababaa\nabaabbaa",
"output": "forward"
},
{
"input": "bbbbbbbbbbbbbbbbbbbbbbbbb\nbbbb\nbbbbb",
"output": "both"
},
{
"input": "aababaaababaabbaabababaaababaabababbaabbabaabababaabbabbbababbababababababaabababaababaaaabababaabab\nabaabababaa\nabaabbaa",
"output": "backward"
},
{
"input": "aaaa\naaa\naa",
"output": "fantasy"
},
{
"input": "zzzz\nzz\nzzz",
"output": "fantasy"
},
{
"input": "zzzz\nzzzz\nzzzz",
"output": "fantasy"
},
{
"input": "zzzz\nzz\nzz",
"output": "both"
},
{
"input": "aabaa\naab\nbaa",
"output": "fantasy"
},
{
"input": "aabaab\naba\nab",
"output": "forward"
},
{
"input": "aab\nb\naa",
"output": "backward"
},
{
"input": "abacaba\naca\nba",
"output": "both"
}
] | 1,450,078,366
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 218
| 819,200
|
import string
s = input()
x = input()
y = input()
a = False
b = False
if x in s:
if y in s[s.find(x) + len(x):]:
a = True
s = s[::-1]
if x in s:
if y in s[s.find(x) + len(x):]:
b = True
if a and b:
print("both")
elif a:
print("forward")
elif b:
print("backward")
else:
print("fantasy")
|
Title: Train and Peter
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Peter likes to travel by train. He likes it so much that on the train he falls asleep.
Once in summer Peter was going by train from city A to city B, and as usual, was sleeping. Then he woke up, started to look through the window and noticed that every railway station has a flag of a particular colour.
The boy started to memorize the order of the flags' colours that he had seen. But soon he fell asleep again. Unfortunately, he didn't sleep long, he woke up and went on memorizing the colours. Then he fell asleep again, and that time he slept till the end of the journey.
At the station he told his parents about what he was doing, and wrote two sequences of the colours that he had seen before and after his sleep, respectively.
Peter's parents know that their son likes to fantasize. They give you the list of the flags' colours at the stations that the train passes sequentially on the way from A to B, and ask you to find out if Peter could see those sequences on the way from A to B, or from B to A. Remember, please, that Peter had two periods of wakefulness.
Peter's parents put lowercase Latin letters for colours. The same letter stands for the same colour, different letters — for different colours.
Input Specification:
The input data contains three lines. The first line contains a non-empty string, whose length does not exceed 105, the string consists of lowercase Latin letters — the flags' colours at the stations on the way from A to B. On the way from B to A the train passes the same stations, but in reverse order.
The second line contains the sequence, written by Peter during the first period of wakefulness. The third line contains the sequence, written during the second period of wakefulness. Both sequences are non-empty, consist of lowercase Latin letters, and the length of each does not exceed 100 letters. Each of the sequences is written in chronological order.
Output Specification:
Output one of the four words without inverted commas:
- «forward» — if Peter could see such sequences only on the way from A to B; - «backward» — if Peter could see such sequences on the way from B to A; - «both» — if Peter could see such sequences both on the way from A to B, and on the way from B to A; - «fantasy» — if Peter could not see such sequences.
Demo Input:
['atob\na\nb\n', 'aaacaaa\naca\naa\n']
Demo Output:
['forward\n', 'both\n']
Note:
It is assumed that the train moves all the time, so one flag cannot be seen twice. There are no flags at stations A and B.
|
```python
import string
s = input()
x = input()
y = input()
a = False
b = False
if x in s:
if y in s[s.find(x) + len(x):]:
a = True
s = s[::-1]
if x in s:
if y in s[s.find(x) + len(x):]:
b = True
if a and b:
print("both")
elif a:
print("forward")
elif b:
print("backward")
else:
print("fantasy")
```
| 3.884896
|
490
|
A
|
Team Olympiad
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
The School №0 of the capital of Berland has *n* children studying in it. All the children in this school are gifted: some of them are good at programming, some are good at maths, others are good at PE (Physical Education). Hence, for each child we know value *t**i*:
- *t**i*<==<=1, if the *i*-th child is good at programming, - *t**i*<==<=2, if the *i*-th child is good at maths, - *t**i*<==<=3, if the *i*-th child is good at PE
Each child happens to be good at exactly one of these three subjects.
The Team Scientific Decathlon Olympias requires teams of three students. The school teachers decided that the teams will be composed of three children that are good at different subjects. That is, each team must have one mathematician, one programmer and one sportsman. Of course, each child can be a member of no more than one team.
What is the maximum number of teams that the school will be able to present at the Olympiad? How should the teams be formed for that?
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=5000) — the number of children in the school. The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=3), where *t**i* describes the skill of the *i*-th child.
|
In the first line output integer *w* — the largest possible number of teams.
Then print *w* lines, containing three numbers in each line. Each triple represents the indexes of the children forming the team. You can print both the teams, and the numbers in the triplets in any order. The children are numbered from 1 to *n* in the order of their appearance in the input. Each child must participate in no more than one team. If there are several solutions, print any of them.
If no teams can be compiled, print the only line with value *w* equal to 0.
|
[
"7\n1 3 1 3 2 1 2\n",
"4\n2 1 1 2\n"
] |
[
"2\n3 5 2\n6 7 4\n",
"0\n"
] |
none
| 500
|
[
{
"input": "7\n1 3 1 3 2 1 2",
"output": "2\n3 5 2\n6 7 4"
},
{
"input": "4\n2 1 1 2",
"output": "0"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "2\n3 1",
"output": "0"
},
{
"input": "3\n2 1 2",
"output": "0"
},
{
"input": "3\n1 2 3",
"output": "1\n1 2 3"
},
{
"input": "12\n3 3 3 3 3 3 3 3 1 3 3 2",
"output": "1\n9 12 2"
},
{
"input": "60\n3 3 1 2 2 1 3 1 1 1 3 2 2 2 3 3 1 3 2 3 2 2 1 3 3 2 3 1 2 2 2 1 3 2 1 1 3 3 1 1 1 3 1 2 1 1 3 3 3 2 3 2 3 2 2 2 1 1 1 2",
"output": "20\n6 60 1\n17 44 20\n3 5 33\n36 21 42\n59 14 2\n58 26 49\n9 29 48\n23 19 24\n10 30 37\n41 54 15\n45 31 27\n57 55 38\n39 12 25\n35 34 11\n32 52 7\n8 50 18\n43 4 53\n46 56 51\n40 22 16\n28 13 47"
},
{
"input": "12\n3 1 1 1 1 1 1 2 1 1 1 1",
"output": "1\n3 8 1"
},
{
"input": "22\n2 2 2 2 2 2 2 2 2 2 3 2 2 2 2 2 2 1 2 2 2 2",
"output": "1\n18 2 11"
},
{
"input": "138\n2 3 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 3 2 2 2 1 2 3 2 2 2 3 1 3 2 3 2 3 2 2 2 2 3 2 2 2 2 2 1 2 2 3 2 2 3 2 1 2 2 2 2 2 3 1 2 2 2 2 2 3 2 2 3 2 2 2 2 2 1 1 2 3 2 2 2 2 3 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 3 2 3 2 2 2 1 2 2 2 1 2 2 2 2 1 2 2 2 2 1 3",
"output": "18\n13 91 84\n34 90 48\n11 39 77\n78 129 50\n137 68 119\n132 122 138\n19 12 96\n40 7 2\n22 88 69\n107 73 46\n115 15 52\n127 106 87\n93 92 66\n71 112 117\n63 124 42\n17 70 101\n109 121 57\n123 25 36"
},
{
"input": "203\n2 2 1 2 1 2 2 2 1 2 2 1 1 3 1 2 1 2 1 1 2 3 1 1 2 3 3 2 2 2 1 2 1 1 1 1 1 3 1 1 2 1 1 2 2 2 1 2 2 2 1 2 3 2 1 1 2 2 1 2 1 2 2 1 1 2 2 2 1 1 2 2 1 2 1 2 2 3 2 1 2 1 1 1 1 1 1 1 1 1 1 2 2 1 1 2 2 2 2 1 1 1 1 1 1 1 2 2 2 2 2 1 1 1 2 2 2 1 2 2 1 3 2 1 1 1 2 1 1 2 1 1 2 2 2 1 1 2 2 2 1 2 1 3 2 1 2 2 2 1 1 1 2 2 2 1 2 1 1 2 2 2 2 2 1 1 2 1 2 2 1 1 1 1 1 1 2 2 3 1 1 2 3 1 1 1 1 1 1 2 2 1 1 1 2 2 3 2 1 3 1 1 1",
"output": "13\n188 72 14\n137 4 197\n158 76 122\n152 142 26\n104 119 179\n40 63 38\n12 1 78\n17 30 27\n189 60 53\n166 190 144\n129 7 183\n83 41 22\n121 81 200"
},
{
"input": "220\n1 1 3 1 3 1 1 3 1 3 3 3 3 1 3 3 1 3 3 3 3 3 1 1 1 3 1 1 1 3 2 3 3 3 1 1 3 3 1 1 3 3 3 3 1 3 3 1 1 1 2 3 1 1 1 2 3 3 3 2 3 1 1 3 1 1 1 3 2 1 3 2 3 1 1 3 3 3 1 3 1 1 1 3 3 2 1 3 2 1 1 3 3 1 1 1 2 1 1 3 2 1 2 1 1 1 3 1 3 3 1 2 3 3 3 3 1 3 1 1 1 1 2 3 1 1 1 1 1 1 3 2 3 1 3 1 3 1 1 3 1 3 1 3 1 3 1 3 3 2 3 1 3 3 1 3 3 3 3 1 1 3 3 3 3 1 1 3 3 3 2 1 1 1 3 3 1 3 3 3 1 1 1 3 1 3 3 1 1 1 2 3 1 1 3 1 1 1 1 2 3 1 1 2 3 3 1 3 1 3 3 3 3 1 3 2 3 1 1 3",
"output": "20\n198 89 20\n141 56 131\n166 204 19\n160 132 142\n111 112 195\n45 216 92\n6 31 109\n14 150 170\n199 60 18\n173 123 140\n134 69 156\n82 191 85\n126 200 80\n24 97 46\n62 86 149\n214 101 26\n79 171 78\n125 72 118\n172 103 162\n219 51 64"
},
{
"input": "61\n2 3 1 3 2 2 2 3 1 3 2 3 1 2 1 1 2 2 2 2 3 2 3 1 2 1 3 1 3 2 1 1 3 2 1 3 3 3 1 3 3 1 1 3 1 3 2 2 1 2 2 2 1 3 2 3 1 3 3 1 1",
"output": "20\n9 55 2\n24 34 27\n3 5 37\n35 17 41\n61 11 4\n60 19 54\n15 20 59\n26 14 29\n16 22 38\n43 50 12\n49 25 36\n57 51 40\n39 6 33\n32 30 10\n31 48 8\n13 47 23\n45 1 58\n53 52 56\n42 18 21\n28 7 44"
},
{
"input": "5\n1 2 2 3 3",
"output": "1\n1 3 4"
}
] | 1,660,304,936
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 41
| 46
| 0
|
n=int(input())
s=[int(x) for x in input().split()]
a=s.count(1)
b=s.count(2)
c=s.count(3)
ans=min(a,b,c)
print(min(a,b,c))
p1=[]
p2=[]
p3=[]
for i in range(0,n):
if s[i]==1:
p1.append(i+1)
elif s[i]==2:
p2.append(i+1)
else:
p3.append(i+1)
for k in range(0,ans):
print(p1[k],p2[k],p3[k])
|
Title: Team Olympiad
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The School №0 of the capital of Berland has *n* children studying in it. All the children in this school are gifted: some of them are good at programming, some are good at maths, others are good at PE (Physical Education). Hence, for each child we know value *t**i*:
- *t**i*<==<=1, if the *i*-th child is good at programming, - *t**i*<==<=2, if the *i*-th child is good at maths, - *t**i*<==<=3, if the *i*-th child is good at PE
Each child happens to be good at exactly one of these three subjects.
The Team Scientific Decathlon Olympias requires teams of three students. The school teachers decided that the teams will be composed of three children that are good at different subjects. That is, each team must have one mathematician, one programmer and one sportsman. Of course, each child can be a member of no more than one team.
What is the maximum number of teams that the school will be able to present at the Olympiad? How should the teams be formed for that?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=5000) — the number of children in the school. The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=3), where *t**i* describes the skill of the *i*-th child.
Output Specification:
In the first line output integer *w* — the largest possible number of teams.
Then print *w* lines, containing three numbers in each line. Each triple represents the indexes of the children forming the team. You can print both the teams, and the numbers in the triplets in any order. The children are numbered from 1 to *n* in the order of their appearance in the input. Each child must participate in no more than one team. If there are several solutions, print any of them.
If no teams can be compiled, print the only line with value *w* equal to 0.
Demo Input:
['7\n1 3 1 3 2 1 2\n', '4\n2 1 1 2\n']
Demo Output:
['2\n3 5 2\n6 7 4\n', '0\n']
Note:
none
|
```python
n=int(input())
s=[int(x) for x in input().split()]
a=s.count(1)
b=s.count(2)
c=s.count(3)
ans=min(a,b,c)
print(min(a,b,c))
p1=[]
p2=[]
p3=[]
for i in range(0,n):
if s[i]==1:
p1.append(i+1)
elif s[i]==2:
p2.append(i+1)
else:
p3.append(i+1)
for k in range(0,ans):
print(p1[k],p2[k],p3[k])
```
| 3
|
|
576
|
A
|
Vasya and Petya's Game
|
PROGRAMMING
| 1,500
|
[
"math",
"number theory"
] | null | null |
Vasya and Petya are playing a simple game. Vasya thought of number *x* between 1 and *n*, and Petya tries to guess the number.
Petya can ask questions like: "Is the unknown number divisible by number *y*?".
The game is played by the following rules: first Petya asks all the questions that interest him (also, he can ask no questions), and then Vasya responds to each question with a 'yes' or a 'no'. After receiving all the answers Petya should determine the number that Vasya thought of.
Unfortunately, Petya is not familiar with the number theory. Help him find the minimum number of questions he should ask to make a guaranteed guess of Vasya's number, and the numbers *y**i*, he should ask the questions about.
|
A single line contains number *n* (1<=≤<=*n*<=≤<=103).
|
Print the length of the sequence of questions *k* (0<=≤<=*k*<=≤<=*n*), followed by *k* numbers — the questions *y**i* (1<=≤<=*y**i*<=≤<=*n*).
If there are several correct sequences of questions of the minimum length, you are allowed to print any of them.
|
[
"4\n",
"6\n"
] |
[
"3\n2 4 3 \n",
"4\n2 4 3 5 \n"
] |
The sequence from the answer to the first sample test is actually correct.
If the unknown number is not divisible by one of the sequence numbers, it is equal to 1.
If the unknown number is divisible by 4, it is 4.
If the unknown number is divisible by 3, then the unknown number is 3.
Otherwise, it is equal to 2. Therefore, the sequence of questions allows you to guess the unknown number. It can be shown that there is no correct sequence of questions of length 2 or shorter.
| 500
|
[
{
"input": "4",
"output": "3\n2 4 3 "
},
{
"input": "6",
"output": "4\n2 4 3 5 "
},
{
"input": "1",
"output": "0"
},
{
"input": "15",
"output": "9\n2 4 8 3 9 5 7 11 13 "
},
{
"input": "19",
"output": "12\n2 4 8 16 3 9 5 7 11 13 17 19 "
},
{
"input": "20",
"output": "12\n2 4 8 16 3 9 5 7 11 13 17 19 "
},
{
"input": "37",
"output": "19\n2 4 8 16 32 3 9 27 5 25 7 11 13 17 19 23 29 31 37 "
},
{
"input": "211",
"output": "61\n2 4 8 16 32 64 128 3 9 27 81 5 25 125 7 49 11 121 13 169 17 19 23 29 31 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 "
},
{
"input": "557",
"output": "123\n2 4 8 16 32 64 128 256 512 3 9 27 81 243 5 25 125 7 49 343 11 121 13 169 17 289 19 361 23 529 29 31 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 293 307 311 313 317 331 337 347 349 353 359 367 373 379 383 389 397 401 409 419 421 431 433 439 443 449 457 461 463 467 479 487 491 499 503 509 521 523 541 547 557 "
},
{
"input": "907",
"output": "179\n2 4 8 16 32 64 128 256 512 3 9 27 81 243 729 5 25 125 625 7 49 343 11 121 13 169 17 289 19 361 23 529 29 841 31 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 293 307 311 313 317 331 337 347 349 353 359 367 373 379 383 389 397 401 409 419 421 431 433 439 443 449 457 461 463 467 479 487 491 499 503 509 521 523 541 547 557 563 569 571 577 587 593 599 601 607 613 617 ..."
},
{
"input": "953",
"output": "186\n2 4 8 16 32 64 128 256 512 3 9 27 81 243 729 5 25 125 625 7 49 343 11 121 13 169 17 289 19 361 23 529 29 841 31 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 293 307 311 313 317 331 337 347 349 353 359 367 373 379 383 389 397 401 409 419 421 431 433 439 443 449 457 461 463 467 479 487 491 499 503 509 521 523 541 547 557 563 569 571 577 587 593 599 601 607 613 617 ..."
},
{
"input": "289",
"output": "78\n2 4 8 16 32 64 128 256 3 9 27 81 243 5 25 125 7 49 11 121 13 169 17 289 19 23 29 31 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 "
},
{
"input": "400",
"output": "97\n2 4 8 16 32 64 128 256 3 9 27 81 243 5 25 125 7 49 343 11 121 13 169 17 289 19 361 23 29 31 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 293 307 311 313 317 331 337 347 349 353 359 367 373 379 383 389 397 "
},
{
"input": "900",
"output": "178\n2 4 8 16 32 64 128 256 512 3 9 27 81 243 729 5 25 125 625 7 49 343 11 121 13 169 17 289 19 361 23 529 29 841 31 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 293 307 311 313 317 331 337 347 349 353 359 367 373 379 383 389 397 401 409 419 421 431 433 439 443 449 457 461 463 467 479 487 491 499 503 509 521 523 541 547 557 563 569 571 577 587 593 599 601 607 613 617 ..."
},
{
"input": "625",
"output": "136\n2 4 8 16 32 64 128 256 512 3 9 27 81 243 5 25 125 625 7 49 343 11 121 13 169 17 289 19 361 23 529 29 31 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 293 307 311 313 317 331 337 347 349 353 359 367 373 379 383 389 397 401 409 419 421 431 433 439 443 449 457 461 463 467 479 487 491 499 503 509 521 523 541 547 557 563 569 571 577 587 593 599 601 607 613 617 619 "
},
{
"input": "729",
"output": "152\n2 4 8 16 32 64 128 256 512 3 9 27 81 243 729 5 25 125 625 7 49 343 11 121 13 169 17 289 19 361 23 529 29 31 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 293 307 311 313 317 331 337 347 349 353 359 367 373 379 383 389 397 401 409 419 421 431 433 439 443 449 457 461 463 467 479 487 491 499 503 509 521 523 541 547 557 563 569 571 577 587 593 599 601 607 613 617 619 ..."
},
{
"input": "784",
"output": "160\n2 4 8 16 32 64 128 256 512 3 9 27 81 243 729 5 25 125 625 7 49 343 11 121 13 169 17 289 19 361 23 529 29 31 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 293 307 311 313 317 331 337 347 349 353 359 367 373 379 383 389 397 401 409 419 421 431 433 439 443 449 457 461 463 467 479 487 491 499 503 509 521 523 541 547 557 563 569 571 577 587 593 599 601 607 613 617 619 ..."
},
{
"input": "31",
"output": "17\n2 4 8 16 3 9 27 5 25 7 11 13 17 19 23 29 31 "
},
{
"input": "44",
"output": "21\n2 4 8 16 32 3 9 27 5 25 7 11 13 17 19 23 29 31 37 41 43 "
},
{
"input": "160",
"output": "50\n2 4 8 16 32 64 128 3 9 27 81 5 25 125 7 49 11 121 13 17 19 23 29 31 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 "
},
{
"input": "322",
"output": "83\n2 4 8 16 32 64 128 256 3 9 27 81 243 5 25 125 7 49 11 121 13 169 17 289 19 23 29 31 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 293 307 311 313 317 "
},
{
"input": "894",
"output": "178\n2 4 8 16 32 64 128 256 512 3 9 27 81 243 729 5 25 125 625 7 49 343 11 121 13 169 17 289 19 361 23 529 29 841 31 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 293 307 311 313 317 331 337 347 349 353 359 367 373 379 383 389 397 401 409 419 421 431 433 439 443 449 457 461 463 467 479 487 491 499 503 509 521 523 541 547 557 563 569 571 577 587 593 599 601 607 613 617 ..."
},
{
"input": "998",
"output": "193\n2 4 8 16 32 64 128 256 512 3 9 27 81 243 729 5 25 125 625 7 49 343 11 121 13 169 17 289 19 361 23 529 29 841 31 961 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 293 307 311 313 317 331 337 347 349 353 359 367 373 379 383 389 397 401 409 419 421 431 433 439 443 449 457 461 463 467 479 487 491 499 503 509 521 523 541 547 557 563 569 571 577 587 593 599 601 607 613 ..."
},
{
"input": "1000",
"output": "193\n2 4 8 16 32 64 128 256 512 3 9 27 81 243 729 5 25 125 625 7 49 343 11 121 13 169 17 289 19 361 23 529 29 841 31 961 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 293 307 311 313 317 331 337 347 349 353 359 367 373 379 383 389 397 401 409 419 421 431 433 439 443 449 457 461 463 467 479 487 491 499 503 509 521 523 541 547 557 563 569 571 577 587 593 599 601 607 613 ..."
},
{
"input": "1000",
"output": "193\n2 4 8 16 32 64 128 256 512 3 9 27 81 243 729 5 25 125 625 7 49 343 11 121 13 169 17 289 19 361 23 529 29 841 31 961 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 293 307 311 313 317 331 337 347 349 353 359 367 373 379 383 389 397 401 409 419 421 431 433 439 443 449 457 461 463 467 479 487 491 499 503 509 521 523 541 547 557 563 569 571 577 587 593 599 601 607 613 ..."
},
{
"input": "30",
"output": "16\n2 4 8 16 3 9 27 5 25 7 11 13 17 19 23 29 "
}
] | 1,564,472,574
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 124
| 0
|
n = int(input())
h = []
for i in range(2, n):
g = 0
for j in range(2, int(i ** 0.5) + 1):
if i % j == 0:
g += 1
if g == 0:
h.append(i)
g = 0
while g < len(h):
x = h[g]
if x ** 2 <= n:
h.append(x ** 2)
g += 1
print(*h)
|
Title: Vasya and Petya's Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya and Petya are playing a simple game. Vasya thought of number *x* between 1 and *n*, and Petya tries to guess the number.
Petya can ask questions like: "Is the unknown number divisible by number *y*?".
The game is played by the following rules: first Petya asks all the questions that interest him (also, he can ask no questions), and then Vasya responds to each question with a 'yes' or a 'no'. After receiving all the answers Petya should determine the number that Vasya thought of.
Unfortunately, Petya is not familiar with the number theory. Help him find the minimum number of questions he should ask to make a guaranteed guess of Vasya's number, and the numbers *y**i*, he should ask the questions about.
Input Specification:
A single line contains number *n* (1<=≤<=*n*<=≤<=103).
Output Specification:
Print the length of the sequence of questions *k* (0<=≤<=*k*<=≤<=*n*), followed by *k* numbers — the questions *y**i* (1<=≤<=*y**i*<=≤<=*n*).
If there are several correct sequences of questions of the minimum length, you are allowed to print any of them.
Demo Input:
['4\n', '6\n']
Demo Output:
['3\n2 4 3 \n', '4\n2 4 3 5 \n']
Note:
The sequence from the answer to the first sample test is actually correct.
If the unknown number is not divisible by one of the sequence numbers, it is equal to 1.
If the unknown number is divisible by 4, it is 4.
If the unknown number is divisible by 3, then the unknown number is 3.
Otherwise, it is equal to 2. Therefore, the sequence of questions allows you to guess the unknown number. It can be shown that there is no correct sequence of questions of length 2 or shorter.
|
```python
n = int(input())
h = []
for i in range(2, n):
g = 0
for j in range(2, int(i ** 0.5) + 1):
if i % j == 0:
g += 1
if g == 0:
h.append(i)
g = 0
while g < len(h):
x = h[g]
if x ** 2 <= n:
h.append(x ** 2)
g += 1
print(*h)
```
| 0
|
|
761
|
B
|
Dasha and friends
|
PROGRAMMING
| 1,300
|
[
"brute force",
"implementation",
"math"
] | null | null |
Running with barriers on the circle track is very popular in the country where Dasha lives, so no wonder that on her way to classes she saw the following situation:
The track is the circle with length *L*, in distinct points of which there are *n* barriers. Athlete always run the track in counterclockwise direction if you look on him from above. All barriers are located at integer distance from each other along the track.
Her friends the parrot Kefa and the leopard Sasha participated in competitions and each of them ran one lap. Each of the friends started from some integral point on the track. Both friends wrote the distance from their start along the track to each of the *n* barriers. Thus, each of them wrote *n* integers in the ascending order, each of them was between 0 and *L*<=-<=1, inclusively.
There are several tracks in the country, all of them have same length and same number of barriers, but the positions of the barriers can differ among different tracks. Now Dasha is interested if it is possible that Kefa and Sasha ran the same track or they participated on different tracks.
Write the program which will check that Kefa's and Sasha's tracks coincide (it means that one can be obtained from the other by changing the start position). Note that they always run the track in one direction — counterclockwise, if you look on a track from above.
|
The first line contains two integers *n* and *L* (1<=≤<=*n*<=≤<=50, *n*<=≤<=*L*<=≤<=100) — the number of barriers on a track and its length.
The second line contains *n* distinct integers in the ascending order — the distance from Kefa's start to each barrier in the order of its appearance. All integers are in the range from 0 to *L*<=-<=1 inclusively.
The second line contains *n* distinct integers in the ascending order — the distance from Sasha's start to each barrier in the order of its overcoming. All integers are in the range from 0 to *L*<=-<=1 inclusively.
|
Print "YES" (without quotes), if Kefa and Sasha ran the coinciding tracks (it means that the position of all barriers coincides, if they start running from the same points on the track). Otherwise print "NO" (without quotes).
|
[
"3 8\n2 4 6\n1 5 7\n",
"4 9\n2 3 5 8\n0 1 3 6\n",
"2 4\n1 3\n1 2\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
The first test is analyzed in the statement.
| 1,000
|
[
{
"input": "3 8\n2 4 6\n1 5 7",
"output": "YES"
},
{
"input": "4 9\n2 3 5 8\n0 1 3 6",
"output": "YES"
},
{
"input": "2 4\n1 3\n1 2",
"output": "NO"
},
{
"input": "5 9\n0 2 5 6 7\n1 3 6 7 8",
"output": "YES"
},
{
"input": "5 60\n7 26 27 40 59\n14 22 41 42 55",
"output": "YES"
},
{
"input": "20 29\n0 1 2 4 5 8 9 12 14 15 17 19 20 21 22 23 25 26 27 28\n0 2 4 5 6 7 8 10 11 12 13 14 15 16 18 19 22 23 26 28",
"output": "YES"
},
{
"input": "35 41\n0 1 2 3 4 5 6 7 9 10 11 12 13 14 18 19 20 21 22 23 24 25 26 28 30 31 32 33 34 35 36 37 38 39 40\n0 1 2 3 4 5 7 8 9 10 11 12 16 17 18 19 20 21 22 23 24 26 28 29 30 31 32 33 34 35 36 37 38 39 40",
"output": "YES"
},
{
"input": "40 63\n0 2 3 4 5 6 9 10 12 15 17 19 23 25 26 27 28 29 30 31 33 34 36 37 38 39 40 43 45 49 50 52 53 54 55 57 58 60 61 62\n1 2 3 4 5 8 10 14 15 17 18 19 20 22 23 25 26 27 28 30 31 32 33 34 37 38 40 43 46 47 51 53 54 55 56 57 58 59 61 62",
"output": "NO"
},
{
"input": "50 97\n1 2 3 4 6 9 10 11 12 13 14 21 22 23 24 25 28 29 30 31 32 33 34 36 37 40 41 45 53 56 59 64 65 69 70 71 72 73 74 77 81 84 85 86 87 89 91 92 95 96\n0 1 2 3 6 10 13 14 15 16 18 20 21 24 25 27 28 29 30 33 35 36 37 38 39 40 47 48 49 50 51 54 55 56 57 58 59 60 62 63 66 67 71 79 82 85 90 91 95 96",
"output": "NO"
},
{
"input": "50 100\n0 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 52 54 56 58 60 62 64 66 68 70 72 74 76 78 80 82 84 86 88 90 92 94 96 98\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99",
"output": "YES"
},
{
"input": "1 2\n0\n0",
"output": "YES"
},
{
"input": "1 2\n0\n1",
"output": "YES"
},
{
"input": "1 2\n1\n0",
"output": "YES"
},
{
"input": "1 2\n1\n1",
"output": "YES"
},
{
"input": "1 1\n0\n0",
"output": "YES"
},
{
"input": "5 12\n2 3 4 8 10\n2 3 4 8 10",
"output": "YES"
},
{
"input": "1 18\n3\n10",
"output": "YES"
},
{
"input": "1 75\n65\n8",
"output": "YES"
},
{
"input": "2 16\n4 13\n2 11",
"output": "YES"
},
{
"input": "2 95\n45 59\n3 84",
"output": "YES"
},
{
"input": "3 53\n29 43 50\n29 43 50",
"output": "YES"
},
{
"input": "3 60\n39 46 51\n43 50 55",
"output": "YES"
},
{
"input": "4 4\n0 1 2 3\n0 1 2 3",
"output": "YES"
},
{
"input": "4 93\n45 48 50 90\n20 68 71 73",
"output": "YES"
},
{
"input": "6 18\n0 3 8 11 15 16\n2 7 10 14 15 17",
"output": "YES"
},
{
"input": "6 87\n0 1 21 31 34 66\n11 12 32 42 45 77",
"output": "YES"
},
{
"input": "7 26\n0 3 9 13 14 19 20\n4 7 13 17 18 23 24",
"output": "YES"
},
{
"input": "7 81\n0 12 19 24 25 35 59\n1 8 13 14 24 48 70",
"output": "YES"
},
{
"input": "8 20\n0 1 2 3 5 6 14 15\n1 2 10 11 16 17 18 19",
"output": "YES"
},
{
"input": "8 94\n0 8 11 27 38 54 57 89\n1 33 38 46 49 65 76 92",
"output": "YES"
},
{
"input": "9 18\n1 3 6 8 11 12 13 16 17\n0 2 5 6 7 10 11 13 15",
"output": "YES"
},
{
"input": "9 90\n10 11 27 33 34 55 63 84 87\n9 12 25 26 42 48 49 70 78",
"output": "YES"
},
{
"input": "10 42\n4 9 10 14 15 16 19 33 36 40\n0 14 17 21 27 32 33 37 38 39",
"output": "YES"
},
{
"input": "10 73\n4 5 15 19 20 25 28 42 57 58\n3 4 9 12 26 41 42 61 62 72",
"output": "YES"
},
{
"input": "11 11\n0 1 2 3 4 5 6 7 8 9 10\n0 1 2 3 4 5 6 7 8 9 10",
"output": "YES"
},
{
"input": "11 57\n1 4 27 30 31 35 37 41 50 52 56\n22 25 26 30 32 36 45 47 51 53 56",
"output": "YES"
},
{
"input": "12 73\n5 9 11 20 25 36 40 41 44 48 56 60\n12 16 18 27 32 43 47 48 51 55 63 67",
"output": "YES"
},
{
"input": "12 95\n1 37 42 46 56 58 59 62 64 71 76 80\n2 18 54 59 63 73 75 76 79 81 88 93",
"output": "YES"
},
{
"input": "13 29\n2 5 6 9 12 17 18 19 20 21 22 24 27\n0 3 6 11 12 13 14 15 16 18 21 25 28",
"output": "YES"
},
{
"input": "13 90\n9 18 23 30 31 36 39 44 58 59 74 82 87\n1 6 18 27 32 39 40 45 48 53 67 68 83",
"output": "YES"
},
{
"input": "14 29\n1 2 3 4 5 7 9 12 13 20 21 22 23 24\n0 3 4 11 12 13 14 15 21 22 23 24 25 27",
"output": "YES"
},
{
"input": "14 94\n7 8 9 21 34 35 36 37 38 43 46 52 84 93\n2 3 4 16 29 30 31 32 33 38 41 47 79 88",
"output": "YES"
},
{
"input": "15 19\n1 2 3 4 5 6 7 8 9 10 11 13 14 16 17\n0 1 2 3 4 5 6 7 8 9 10 12 13 15 16",
"output": "YES"
},
{
"input": "15 27\n2 3 4 5 6 7 8 9 10 11 12 14 17 24 26\n2 3 4 5 6 7 8 9 10 11 12 14 17 24 26",
"output": "YES"
},
{
"input": "16 28\n3 5 6 7 9 10 11 12 13 14 17 19 20 25 26 27\n0 5 6 7 11 13 14 15 17 18 19 20 21 22 25 27",
"output": "YES"
},
{
"input": "16 93\n5 6 10 11 13 14 41 43 46 61 63 70 74 79 83 92\n0 9 15 16 20 21 23 24 51 53 56 71 73 80 84 89",
"output": "YES"
},
{
"input": "17 49\n2 5 11 12 16 18 19 21 22 24 36 37 38 39 40 44 47\n1 7 8 12 14 15 17 18 20 32 33 34 35 36 40 43 47",
"output": "YES"
},
{
"input": "17 86\n16 17 25 33 39 41 50 51 54 56 66 70 72 73 77 80 85\n3 9 11 20 21 24 26 36 40 42 43 47 50 55 72 73 81",
"output": "YES"
},
{
"input": "18 20\n0 1 2 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19\n0 1 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19",
"output": "YES"
},
{
"input": "18 82\n0 5 10 13 14 16 21 28 29 30 44 46 61 64 69 71 77 78\n0 5 8 9 11 16 23 24 25 39 41 56 59 64 66 72 73 77",
"output": "YES"
},
{
"input": "19 25\n0 1 2 3 5 7 9 10 12 13 16 17 18 19 20 21 22 23 24\n0 3 4 5 6 7 8 9 10 11 12 13 14 15 17 19 21 22 24",
"output": "YES"
},
{
"input": "19 91\n5 17 18 20 22 25 26 31 32 33 43 47 54 61 62 64 77 80 87\n4 5 6 16 20 27 34 35 37 50 53 60 69 81 82 84 86 89 90",
"output": "YES"
},
{
"input": "20 53\n2 6 8 9 16 17 20 21 22 23 25 26 35 36 38 39 44 46 47 50\n4 5 8 9 10 11 13 14 23 24 26 27 32 34 35 38 43 47 49 50",
"output": "YES"
},
{
"input": "21 44\n0 1 3 4 6 7 8 9 10 11 12 15 17 18 21 22 27 29 34 36 42\n1 7 9 10 12 13 15 16 17 18 19 20 21 24 26 27 30 31 36 38 43",
"output": "YES"
},
{
"input": "21 94\n3 5 6 8 9 15 16 20 28 31 35 39 49 50 53 61 71 82 85 89 90\n6 17 20 24 25 32 34 35 37 38 44 45 49 57 60 64 68 78 79 82 90",
"output": "YES"
},
{
"input": "22 24\n0 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 22 23\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 21 22 23",
"output": "YES"
},
{
"input": "22 85\n3 5 7 14 18 21 25 32 38 41 53 58 61 62 66 70 71 73 75 76 79 83\n3 6 18 23 26 27 31 35 36 38 40 41 44 48 53 55 57 64 68 71 75 82",
"output": "YES"
},
{
"input": "23 38\n0 2 4 5 7 8 12 13 14 16 17 18 21 22 24 27 28 30 31 32 35 36 37\n0 1 2 3 5 7 8 10 11 15 16 17 19 20 21 24 25 27 30 31 33 34 35",
"output": "YES"
},
{
"input": "23 93\n1 3 5 10 19 22 26 27 30 35 39 53 55 60 66 67 75 76 77 80 82 89 90\n9 11 16 22 23 31 32 33 36 38 45 46 50 52 54 59 68 71 75 76 79 84 88",
"output": "YES"
},
{
"input": "24 37\n1 4 5 6 8 11 12 13 15 16 17 19 20 21 23 26 27 28 30 31 33 34 35 36\n0 3 4 5 7 8 10 11 12 13 15 18 19 20 22 25 26 27 29 30 31 33 34 35",
"output": "YES"
},
{
"input": "24 94\n9 10 13 14 16 18 19 22 24 29 32 35 48 55 57 63 64 69 72 77 78 85 90 92\n1 7 8 13 16 21 22 29 34 36 47 48 51 52 54 56 57 60 62 67 70 73 86 93",
"output": "YES"
},
{
"input": "25 45\n0 1 2 4 6 7 8 9 13 14 17 19 21 22 23 25 28 29 30 31 34 36 38 39 42\n1 3 4 5 7 10 11 12 13 16 18 20 21 24 27 28 29 31 33 34 35 36 40 41 44",
"output": "YES"
},
{
"input": "25 72\n1 2 6 8 9 11 15 18 19 20 26 29 31 33 34 40 41 43 45 48 58 60 68 69 71\n0 6 9 11 13 14 20 21 23 25 28 38 40 48 49 51 53 54 58 60 61 63 67 70 71",
"output": "YES"
},
{
"input": "26 47\n0 2 5 7 8 9 10 12 13 14 20 22 23 25 27 29 31 32 33 35 36 37 38 42 44 45\n0 2 4 6 8 9 10 12 13 14 15 19 21 22 24 26 29 31 32 33 34 36 37 38 44 46",
"output": "YES"
},
{
"input": "26 99\n0 1 13 20 21 22 25 26 27 28 32 39 44 47 56 58 60 62 71 81 83 87 89 93 94 98\n6 8 12 14 18 19 23 24 25 37 44 45 46 49 50 51 52 56 63 68 71 80 82 84 86 95",
"output": "YES"
},
{
"input": "27 35\n0 2 3 4 5 6 7 8 10 11 12 13 14 15 16 17 19 20 21 23 26 27 29 30 31 32 33\n0 1 2 3 5 7 8 9 10 11 12 13 15 16 17 18 19 20 21 22 24 25 26 28 31 32 34",
"output": "YES"
},
{
"input": "27 51\n1 2 4 7 8 11 13 17 20 21 23 24 25 28 29 30 34 35 37 38 40 43 45 46 47 48 50\n0 1 2 4 6 7 9 12 13 16 18 22 25 26 28 29 30 33 34 35 39 40 42 43 45 48 50",
"output": "YES"
},
{
"input": "28 38\n1 4 5 7 8 9 10 11 12 14 15 16 18 19 20 21 22 23 24 25 28 29 30 32 33 35 36 37\n0 1 2 3 4 5 6 9 10 11 13 14 16 17 18 20 23 24 26 27 28 29 30 31 33 34 35 37",
"output": "YES"
},
{
"input": "28 67\n0 1 2 3 6 9 10 15 18 22 24 25 30 35 36 38 39 47 48 49 51 53 55 56 58 62 63 64\n4 7 11 13 14 19 24 25 27 28 36 37 38 40 42 44 45 47 51 52 53 56 57 58 59 62 65 66",
"output": "YES"
},
{
"input": "29 29\n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28\n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28",
"output": "YES"
},
{
"input": "29 93\n1 2 11 13 18 21 27 28 30 38 41 42 46 54 55 56 60 61 63 64 66 69 71 72 77 81 83 89 90\n2 10 11 12 16 17 19 20 22 25 27 28 33 37 39 45 46 50 51 60 62 67 70 76 77 79 87 90 91",
"output": "YES"
},
{
"input": "30 63\n0 2 3 5 6 7 8 10 13 18 19 21 22 23 26 32 35 37 38 39 40 41 43 44 49 51 53 54 58 61\n0 2 3 5 6 7 8 10 13 18 19 21 22 23 26 32 35 37 38 39 40 41 43 44 49 51 53 54 58 61",
"output": "YES"
},
{
"input": "30 91\n1 2 3 7 8 9 13 16 17 19 27 29 38 45 47 52 53 55 61 62 66 77 78 79 80 81 82 84 88 89\n3 4 5 9 12 13 15 23 25 34 41 43 48 49 51 57 58 62 73 74 75 76 77 78 80 84 85 88 89 90",
"output": "YES"
},
{
"input": "31 39\n0 1 2 3 4 5 6 7 8 10 11 13 14 17 18 20 21 23 24 25 27 28 29 30 31 33 34 35 36 37 38\n0 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 18 19 21 22 25 26 28 29 31 32 33 35 36 37 38",
"output": "YES"
},
{
"input": "31 95\n9 12 14 15 21 23 26 28 30 36 37 42 47 51 54 56 59 62 64 65 66 70 72 74 75 79 82 85 87 91 93\n0 2 3 7 10 13 15 19 21 32 35 37 38 44 46 49 51 53 59 60 65 70 74 77 79 82 85 87 88 89 93",
"output": "YES"
},
{
"input": "32 61\n0 2 3 5 7 10 13 14 15 18 19 20 21 22 23 24 26 32 33 34 36 38 43 46 47 51 54 55 56 57 58 59\n1 2 4 6 9 12 13 14 17 18 19 20 21 22 23 25 31 32 33 35 37 42 45 46 50 53 54 55 56 57 58 60",
"output": "YES"
},
{
"input": "32 86\n5 7 9 10 13 17 18 19 25 26 28 32 33 37 38 43 45 47 50 53 57 58 60 69 73 74 75 77 80 82 83 85\n7 11 12 13 15 18 20 21 23 29 31 33 34 37 41 42 43 49 50 52 56 57 61 62 67 69 71 74 77 81 82 84",
"output": "YES"
},
{
"input": "33 44\n0 1 2 3 5 9 10 11 12 13 14 15 17 18 20 21 22 23 24 25 26 27 28 30 31 32 35 36 38 39 41 42 43\n0 2 3 4 7 8 10 11 13 14 15 16 17 18 19 21 25 26 27 28 29 30 31 33 34 36 37 38 39 40 41 42 43",
"output": "YES"
},
{
"input": "33 73\n3 6 7 8 9 10 11 13 14 15 17 19 22 23 26 27 28 31 33 34 35 37 42 44 48 52 54 57 62 63 64 67 68\n2 3 4 7 8 16 19 20 21 22 23 24 26 27 28 30 32 35 36 39 40 41 44 46 47 48 50 55 57 61 65 67 70",
"output": "YES"
},
{
"input": "34 52\n1 2 3 4 5 6 8 9 10 12 13 14 15 16 17 19 21 24 26 27 28 29 31 33 35 36 37 39 40 45 46 49 50 51\n0 1 2 3 4 6 7 8 10 11 12 13 14 15 17 19 22 24 25 26 27 29 31 33 34 35 37 38 43 44 47 48 49 51",
"output": "YES"
},
{
"input": "34 68\n0 7 9 10 11 14 15 16 20 21 22 24 26 32 34 35 37 38 40 41 42 43 44 45 47 50 53 55 57 58 59 62 64 65\n0 1 2 3 5 8 11 13 15 16 17 20 22 23 26 33 35 36 37 40 41 42 46 47 48 50 52 58 60 61 63 64 66 67",
"output": "YES"
},
{
"input": "35 90\n4 5 7 8 10 11 12 13 14 22 27 29 31 33 34 38 46 49 52 53 54 55 56 57 60 61 64 69 77 81 83 86 87 88 89\n4 7 10 11 12 13 14 15 18 19 22 27 35 39 41 44 45 46 47 52 53 55 56 58 59 60 61 62 70 75 77 79 81 82 86",
"output": "YES"
},
{
"input": "36 43\n1 2 3 4 6 7 8 9 10 11 14 16 17 18 19 20 21 22 23 24 25 26 27 29 30 31 32 33 34 35 36 37 38 39 40 42\n0 1 2 3 4 5 6 8 9 10 11 12 13 14 15 16 17 18 19 21 23 24 25 26 28 29 30 31 32 33 36 38 39 40 41 42",
"output": "YES"
},
{
"input": "36 84\n1 3 6 13 15 16 17 18 19 21 23 26 29 33 38 40 42 45 49 50 53 54 57 58 60 61 64 65 67 70 73 76 78 79 81 83\n0 2 5 8 12 17 19 21 24 28 29 32 33 36 37 39 40 43 44 46 49 52 55 57 58 60 62 64 66 69 76 78 79 80 81 82",
"output": "YES"
},
{
"input": "37 46\n0 1 3 6 7 8 9 10 12 13 14 16 17 19 20 21 22 23 24 25 26 27 28 29 30 31 33 34 35 36 37 39 40 41 42 43 44\n0 3 4 5 6 7 9 10 11 13 14 16 17 18 19 20 21 22 23 24 25 26 27 28 30 31 32 33 34 36 37 38 39 40 41 43 44",
"output": "YES"
},
{
"input": "37 97\n0 5 10 11 12 15 16 18 19 25 28 29 34 35 36 37 38 40 46 47 48 49 55 58 60 61 62 64 65 70 76 77 80 82 88 94 96\n1 7 13 15 16 21 26 27 28 31 32 34 35 41 44 45 50 51 52 53 54 56 62 63 64 65 71 74 76 77 78 80 81 86 92 93 96",
"output": "YES"
},
{
"input": "38 58\n1 2 3 4 5 8 9 11 12 13 15 16 17 22 23 24 25 26 27 29 30 31 32 33 34 36 37 40 41 43 46 47 48 52 53 55 56 57\n1 2 3 5 6 7 8 9 12 13 15 16 17 19 20 21 26 27 28 29 30 31 33 34 35 36 37 38 40 41 44 45 47 50 51 52 56 57",
"output": "YES"
},
{
"input": "38 92\n1 2 3 5 6 7 12 14 15 16 17 18 20 22 29 31 33 34 38 41 43 49 54 55 57 58 61 63 66 67 69 73 75 76 82 85 88 90\n1 3 4 10 13 16 18 21 22 23 25 26 27 32 34 35 36 37 38 40 42 49 51 53 54 58 61 63 69 74 75 77 78 81 83 86 87 89",
"output": "YES"
},
{
"input": "39 59\n0 1 2 3 5 6 7 8 9 10 11 12 13 15 16 17 19 24 25 28 29 31 32 33 35 37 38 40 41 42 43 45 46 47 49 50 53 55 56\n0 1 3 4 5 6 8 9 10 12 13 16 18 19 22 23 24 25 27 28 29 30 31 32 33 34 35 37 38 39 41 46 47 50 51 53 54 55 57",
"output": "YES"
},
{
"input": "39 67\n1 3 5 7 8 16 18 20 21 23 24 25 27 28 29 31 32 34 36 38 40 43 44 46 47 48 49 50 52 53 54 55 58 59 61 62 63 64 66\n0 1 2 4 6 8 10 12 13 21 23 25 26 28 29 30 32 33 34 36 37 39 41 43 45 48 49 51 52 53 54 55 57 58 59 60 63 64 66",
"output": "YES"
},
{
"input": "40 63\n0 2 3 4 5 6 9 10 12 15 18 19 23 25 26 27 28 29 30 31 33 34 36 37 38 39 40 43 45 49 50 52 53 54 55 57 58 60 61 62\n1 2 3 4 5 8 10 14 15 17 18 19 20 22 23 25 26 27 28 30 31 32 33 34 37 38 40 43 46 47 51 53 54 55 56 57 58 59 61 62",
"output": "YES"
},
{
"input": "40 96\n5 11 12 13 14 16 17 18 19 24 30 31 32 33 37 42 46 50 53 54 55 58 60 61 64 67 68 69 70 72 75 76 77 81 84 85 89 91 92 93\n2 7 11 15 18 19 20 23 25 26 29 32 33 34 35 37 40 41 42 46 49 50 54 56 57 58 66 72 73 74 75 77 78 79 80 85 91 92 93 94",
"output": "YES"
},
{
"input": "41 67\n0 2 3 5 8 10 11 12 13 14 15 19 20 21 22 26 29 30 31 32 34 35 37 38 40 41 44 45 46 47 49 51 52 53 54 56 57 58 59 63 66\n2 3 4 5 9 12 13 14 15 17 18 20 21 23 24 27 28 29 30 32 34 35 36 37 39 40 41 42 46 49 50 52 53 55 58 60 61 62 63 64 65",
"output": "YES"
},
{
"input": "41 72\n0 3 4 6 7 8 9 12 13 14 16 21 23 24 25 26 27 29 31 32 33 34 35 38 40 41 45 47 49 50 51 52 56 57 58 59 61 62 65 66 69\n0 1 4 5 6 8 13 15 16 17 18 19 21 23 24 25 26 27 30 32 33 37 39 41 42 43 44 48 49 50 51 53 54 57 58 61 64 67 68 70 71",
"output": "YES"
},
{
"input": "42 48\n0 1 2 3 4 7 8 9 10 11 12 13 15 16 17 18 19 20 21 22 23 24 26 27 28 29 30 32 33 34 35 36 37 38 40 41 42 43 44 45 46 47\n0 1 2 3 4 5 6 8 9 10 11 12 14 15 16 17 18 19 20 22 23 24 25 26 27 28 29 30 31 32 33 34 37 38 39 40 41 42 43 45 46 47",
"output": "YES"
},
{
"input": "42 81\n0 1 3 6 7 8 11 13 17 18 19 21 22 24 29 30 31 32 34 35 38 44 46 48 49 50 51 52 53 55 59 61 62 63 65 66 67 69 70 72 77 80\n0 1 3 4 6 11 12 13 14 16 17 20 26 28 30 31 32 33 34 35 37 41 43 44 45 47 48 49 51 52 54 59 62 63 64 66 69 70 71 74 76 80",
"output": "YES"
},
{
"input": "43 55\n0 1 2 3 4 5 6 7 8 12 14 15 17 18 19 20 21 22 23 26 27 28 29 31 32 33 35 36 37 38 40 42 43 44 45 46 47 48 49 50 51 53 54\n1 2 4 5 6 7 8 9 10 13 14 15 16 18 19 20 22 23 24 25 27 29 30 31 32 33 34 35 36 37 38 40 41 42 43 44 45 46 47 48 49 50 54",
"output": "YES"
},
{
"input": "43 81\n2 3 4 5 6 7 9 10 12 13 18 19 20 21 23 26 27 29 30 32 34 38 39 43 46 47 48 50 51 52 54 55 58 62 64 67 69 70 71 72 73 75 80\n0 3 5 6 7 8 9 11 16 19 20 21 22 23 24 26 27 29 30 35 36 37 38 40 43 44 46 47 49 51 55 56 60 63 64 65 67 68 69 71 72 75 79",
"output": "YES"
},
{
"input": "44 54\n0 1 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 21 22 23 24 25 26 27 28 29 31 33 34 35 36 37 39 40 41 43 44 47 49 50 52 53\n0 1 2 3 4 5 6 7 8 10 12 13 14 15 16 18 19 20 22 23 26 28 29 31 32 33 34 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52",
"output": "YES"
},
{
"input": "44 93\n1 5 6 7 8 10 14 17 19 21 25 26 27 30 33 34 35 36 38 41 45 48 49 51 53 55 57 60 66 67 69 70 73 76 78 79 80 81 82 83 85 87 88 90\n0 2 4 8 9 10 13 16 17 18 19 21 24 28 31 32 34 36 38 40 43 49 50 52 53 56 59 61 62 63 64 65 66 68 70 71 73 77 81 82 83 84 86 90",
"output": "YES"
},
{
"input": "45 47\n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 43 44 45 46\n0 1 2 3 4 5 6 7 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 33 34 35 36 37 38 39 40 41 42 43 44 45 46",
"output": "YES"
},
{
"input": "45 71\n0 2 3 7 8 11 12 13 14 15 16 17 20 21 22 23 24 26 28 30 32 37 39 41 42 43 44 45 47 48 50 52 54 55 56 57 58 59 60 61 62 64 66 68 70\n0 1 2 3 4 7 8 9 10 11 13 15 17 19 24 26 28 29 30 31 32 34 35 37 39 41 42 43 44 45 46 47 48 49 51 53 55 57 58 60 61 65 66 69 70",
"output": "YES"
},
{
"input": "46 46\n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45\n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45",
"output": "YES"
},
{
"input": "46 93\n0 1 2 6 13 16 17 18 19 21 27 29 32 34 37 38 39 40 41 44 45 49 50 52 54 56 57 61 64 65 66 67 69 71 73 75 77 78 79 83 85 87 88 90 91 92\n0 2 4 5 7 8 9 10 11 12 16 23 26 27 28 29 31 37 39 42 44 47 48 49 50 51 54 55 59 60 62 64 66 67 71 74 75 76 77 79 81 83 85 87 88 89",
"output": "YES"
},
{
"input": "47 49\n0 1 2 3 4 5 6 7 9 10 11 12 13 14 15 16 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48\n0 1 2 3 4 5 6 7 8 9 10 11 13 14 15 16 17 18 19 20 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48",
"output": "YES"
},
{
"input": "47 94\n0 1 3 4 5 7 8 9 14 18 19 26 30 33 34 35 37 40 42 45 46 49 50 51 52 53 55 56 60 61 62 63 64 65 66 69 71 73 75 79 84 86 87 88 90 92 93\n1 2 3 4 6 7 8 10 11 12 17 21 22 29 33 36 37 38 40 43 45 48 49 52 53 54 55 56 58 59 63 64 65 66 67 68 69 72 74 76 78 82 87 89 90 91 93",
"output": "YES"
},
{
"input": "48 65\n0 1 2 4 5 6 7 8 9 10 11 12 15 16 17 20 22 24 25 26 27 28 30 32 33 34 35 37 38 39 44 45 46 47 48 50 51 52 53 54 55 56 57 58 59 61 62 63\n0 1 4 6 8 9 10 11 12 14 16 17 18 19 21 22 23 28 29 30 31 32 34 35 36 37 38 39 40 41 42 43 45 46 47 49 50 51 53 54 55 56 57 58 59 60 61 64",
"output": "YES"
},
{
"input": "48 90\n1 3 4 5 8 9 11 13 14 15 16 18 20 21 24 26 29 30 31 33 34 36 37 38 39 40 42 43 44 46 47 48 51 52 55 58 59 61 62 63 65 66 68 78 79 81 82 89\n0 3 4 6 8 9 10 11 13 15 16 19 21 24 25 26 28 29 31 32 33 34 35 37 38 39 41 42 43 46 47 50 53 54 56 57 58 60 61 63 73 74 76 77 84 86 88 89",
"output": "YES"
},
{
"input": "49 60\n0 1 2 5 7 8 9 10 11 12 13 14 15 16 17 19 20 21 23 25 26 27 28 29 30 31 32 33 34 36 38 39 40 41 42 43 44 46 47 48 49 50 51 52 53 54 55 58 59\n0 1 2 3 4 5 6 7 8 10 11 12 14 16 17 18 19 20 21 22 23 24 25 27 29 30 31 32 33 34 35 37 38 39 40 41 42 43 44 45 46 49 50 51 52 53 56 58 59",
"output": "YES"
},
{
"input": "49 97\n0 1 2 3 6 8 11 14 19 23 26 29 32 34 35 37 39 41 43 44 45 46 51 53 63 64 65 66 67 70 71 72 73 76 77 78 79 81 83 84 86 87 90 91 92 93 94 95 96\n0 3 4 5 6 7 8 9 10 11 12 13 16 18 21 24 29 33 36 39 42 44 45 47 49 51 53 54 55 56 61 63 73 74 75 76 77 80 81 82 83 86 87 88 89 91 93 94 96",
"output": "YES"
},
{
"input": "50 58\n0 1 2 3 5 6 7 8 10 11 12 13 14 15 16 17 18 19 21 22 23 24 25 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 49 50 54 55 56 57\n0 1 3 4 5 6 7 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 31 32 36 37 38 39 40 41 42 43 45 46 47 48 50 51 52 53 54 55 56 57",
"output": "YES"
},
{
"input": "50 97\n1 2 3 4 7 9 10 11 12 13 14 21 22 23 24 25 28 29 30 31 32 33 34 36 37 40 41 45 53 56 59 64 65 69 70 71 72 73 74 77 81 84 85 86 87 89 91 92 95 96\n0 1 2 3 6 10 13 14 15 16 18 20 21 24 25 27 28 29 30 33 35 36 37 38 39 40 47 48 49 50 51 54 55 56 57 58 59 60 62 63 66 67 71 79 82 85 90 91 95 96",
"output": "YES"
},
{
"input": "40 96\n5 11 12 13 14 16 17 18 19 24 30 31 32 33 37 42 46 50 53 54 55 58 60 61 64 67 68 69 70 72 75 76 77 81 84 85 88 91 92 93\n2 7 11 15 18 19 20 23 25 26 29 32 33 34 35 37 40 41 42 46 49 50 54 56 57 58 66 72 73 74 75 77 78 79 80 85 91 92 93 94",
"output": "NO"
},
{
"input": "41 67\n0 2 3 5 8 10 11 12 13 14 15 19 20 21 22 25 29 30 31 32 34 35 37 38 40 41 44 45 46 47 49 51 52 53 54 56 57 58 59 63 66\n2 3 4 5 9 12 13 14 15 17 18 20 21 23 24 27 28 29 30 32 34 35 36 37 39 40 41 42 46 49 50 52 53 55 58 60 61 62 63 64 65",
"output": "NO"
},
{
"input": "41 72\n0 3 4 6 7 8 9 12 13 14 16 21 23 24 25 26 27 28 31 32 33 34 35 38 40 41 45 47 49 50 51 52 56 57 58 59 61 62 65 66 69\n0 1 4 5 6 8 13 15 16 17 18 19 21 23 24 25 26 27 30 32 33 37 39 41 42 43 44 48 49 50 51 53 54 57 58 61 64 67 68 70 71",
"output": "NO"
},
{
"input": "42 48\n0 1 2 3 4 7 8 9 10 11 12 13 15 16 17 18 19 20 21 22 23 24 25 27 28 29 30 32 33 34 35 36 37 38 40 41 42 43 44 45 46 47\n0 1 2 3 4 5 6 8 9 10 11 12 14 15 16 17 18 19 20 22 23 24 25 26 27 28 29 30 31 32 33 34 37 38 39 40 41 42 43 45 46 47",
"output": "NO"
},
{
"input": "42 81\n0 1 3 6 7 8 11 13 17 18 19 20 22 24 29 30 31 32 34 35 38 44 46 48 49 50 51 52 53 55 59 61 62 63 65 66 67 69 70 72 77 80\n0 1 3 4 6 11 12 13 14 16 17 20 26 28 30 31 32 33 34 35 37 41 43 44 45 47 48 49 51 52 54 59 62 63 64 66 69 70 71 74 76 80",
"output": "NO"
},
{
"input": "43 55\n0 1 2 3 4 5 6 7 8 12 14 15 17 18 19 20 21 22 23 26 27 28 29 31 32 33 34 36 37 38 40 42 43 44 45 46 47 48 49 50 51 53 54\n1 2 4 5 6 7 8 9 10 13 14 15 16 18 19 20 22 23 24 25 27 29 30 31 32 33 34 35 36 37 38 40 41 42 43 44 45 46 47 48 49 50 54",
"output": "NO"
},
{
"input": "43 81\n2 3 4 5 6 7 9 10 12 13 17 19 20 21 23 26 27 29 30 32 34 38 39 43 46 47 48 50 51 52 54 55 58 62 64 67 69 70 71 72 73 75 80\n0 3 5 6 7 8 9 11 16 19 20 21 22 23 24 26 27 29 30 35 36 37 38 40 43 44 46 47 49 51 55 56 60 63 64 65 67 68 69 71 72 75 79",
"output": "NO"
},
{
"input": "44 54\n0 1 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 21 22 23 24 25 26 27 28 29 31 33 34 35 36 37 38 40 41 43 44 47 49 50 52 53\n0 1 2 3 4 5 6 7 8 10 12 13 14 15 16 18 19 20 22 23 26 28 29 31 32 33 34 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52",
"output": "NO"
},
{
"input": "44 93\n1 5 6 7 8 10 14 17 19 21 25 26 27 30 33 34 35 36 38 41 45 48 49 51 53 55 57 60 66 67 69 70 73 76 78 79 80 81 82 83 84 87 88 90\n0 2 4 8 9 10 13 16 17 18 19 21 24 28 31 32 34 36 38 40 43 49 50 52 53 56 59 61 62 63 64 65 66 68 70 71 73 77 81 82 83 84 86 90",
"output": "NO"
},
{
"input": "45 47\n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 44 45 46\n0 1 2 3 4 5 6 7 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 33 34 35 36 37 38 39 40 41 42 43 44 45 46",
"output": "YES"
},
{
"input": "45 71\n0 2 3 7 8 11 12 13 14 15 16 17 20 21 22 23 24 26 28 30 32 37 39 40 42 43 44 45 47 48 50 52 54 55 56 57 58 59 60 61 62 64 66 68 70\n0 1 2 3 4 7 8 9 10 11 13 15 17 19 24 26 28 29 30 31 32 34 35 37 39 41 42 43 44 45 46 47 48 49 51 53 55 57 58 60 61 65 66 69 70",
"output": "NO"
},
{
"input": "46 46\n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45\n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45",
"output": "YES"
},
{
"input": "46 93\n0 1 2 6 13 16 17 18 19 21 27 29 32 34 37 38 39 40 41 44 45 49 50 52 54 56 57 61 64 65 66 67 69 71 73 75 77 78 79 83 85 86 88 90 91 92\n0 2 4 5 7 8 9 10 11 12 16 23 26 27 28 29 31 37 39 42 44 47 48 49 50 51 54 55 59 60 62 64 66 67 71 74 75 76 77 79 81 83 85 87 88 89",
"output": "NO"
},
{
"input": "47 49\n0 1 2 3 4 5 6 7 9 10 11 12 13 14 15 16 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48\n0 1 2 3 4 5 6 7 8 9 10 11 13 14 15 16 17 18 19 20 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48",
"output": "YES"
},
{
"input": "47 94\n0 1 3 4 5 7 8 9 14 18 19 26 30 33 34 35 37 40 42 44 46 49 50 51 52 53 55 56 60 61 62 63 64 65 66 69 71 73 75 79 84 86 87 88 90 92 93\n1 2 3 4 6 7 8 10 11 12 17 21 22 29 33 36 37 38 40 43 45 48 49 52 53 54 55 56 58 59 63 64 65 66 67 68 69 72 74 76 78 82 87 89 90 91 93",
"output": "NO"
},
{
"input": "48 65\n0 1 2 4 5 6 7 8 9 10 11 12 15 16 17 20 21 24 25 26 27 28 30 32 33 34 35 37 38 39 44 45 46 47 48 50 51 52 53 54 55 56 57 58 59 61 62 63\n0 1 4 6 8 9 10 11 12 14 16 17 18 19 21 22 23 28 29 30 31 32 34 35 36 37 38 39 40 41 42 43 45 46 47 49 50 51 53 54 55 56 57 58 59 60 61 64",
"output": "NO"
},
{
"input": "48 90\n1 3 4 5 8 9 11 13 14 15 16 17 20 21 24 26 29 30 31 33 34 36 37 38 39 40 42 43 44 46 47 48 51 52 55 58 59 61 62 63 65 66 68 78 79 81 82 89\n0 3 4 6 8 9 10 11 13 15 16 19 21 24 25 26 28 29 31 32 33 34 35 37 38 39 41 42 43 46 47 50 53 54 56 57 58 60 61 63 73 74 76 77 84 86 88 89",
"output": "NO"
},
{
"input": "49 60\n0 1 2 5 7 8 9 10 11 12 13 14 15 16 17 18 20 21 23 25 26 27 28 29 30 31 32 33 34 36 38 39 40 41 42 43 44 46 47 48 49 50 51 52 53 54 55 58 59\n0 1 2 3 4 5 6 7 8 10 11 12 14 16 17 18 19 20 21 22 23 24 25 27 29 30 31 32 33 34 35 37 38 39 40 41 42 43 44 45 46 49 50 51 52 53 56 58 59",
"output": "NO"
},
{
"input": "49 97\n0 1 2 3 5 8 11 14 19 23 26 29 32 34 35 37 39 41 43 44 45 46 51 53 63 64 65 66 67 70 71 72 73 76 77 78 79 81 83 84 86 87 90 91 92 93 94 95 96\n0 3 4 5 6 7 8 9 10 11 12 13 16 18 21 24 29 33 36 39 42 44 45 47 49 51 53 54 55 56 61 63 73 74 75 76 77 80 81 82 83 86 87 88 89 91 93 94 96",
"output": "NO"
},
{
"input": "50 58\n0 1 2 3 5 6 7 8 10 11 12 13 14 15 16 17 18 19 21 22 23 24 25 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 50 54 55 56 57\n0 1 3 4 5 6 7 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 31 32 36 37 38 39 40 41 42 43 45 46 47 48 50 51 52 53 54 55 56 57",
"output": "NO"
},
{
"input": "5 10\n0 1 3 5 7\n0 1 2 4 7",
"output": "NO"
},
{
"input": "5 8\n0 2 4 6 7\n0 2 3 5 7",
"output": "NO"
}
] | 1,485,976,205
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 46
| 4,608,000
|
n,l=map(int,input().split())
lis1=list(map(int,input().split()))
lis2=list(map(int,input().split()))
ans="YES"
dif=lis1[0]-lis2[0]
for i in range(1,n):
if(lis1[i]-lis2[i]==dif):
ans="NO"
break
print (ans)
|
Title: Dasha and friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Running with barriers on the circle track is very popular in the country where Dasha lives, so no wonder that on her way to classes she saw the following situation:
The track is the circle with length *L*, in distinct points of which there are *n* barriers. Athlete always run the track in counterclockwise direction if you look on him from above. All barriers are located at integer distance from each other along the track.
Her friends the parrot Kefa and the leopard Sasha participated in competitions and each of them ran one lap. Each of the friends started from some integral point on the track. Both friends wrote the distance from their start along the track to each of the *n* barriers. Thus, each of them wrote *n* integers in the ascending order, each of them was between 0 and *L*<=-<=1, inclusively.
There are several tracks in the country, all of them have same length and same number of barriers, but the positions of the barriers can differ among different tracks. Now Dasha is interested if it is possible that Kefa and Sasha ran the same track or they participated on different tracks.
Write the program which will check that Kefa's and Sasha's tracks coincide (it means that one can be obtained from the other by changing the start position). Note that they always run the track in one direction — counterclockwise, if you look on a track from above.
Input Specification:
The first line contains two integers *n* and *L* (1<=≤<=*n*<=≤<=50, *n*<=≤<=*L*<=≤<=100) — the number of barriers on a track and its length.
The second line contains *n* distinct integers in the ascending order — the distance from Kefa's start to each barrier in the order of its appearance. All integers are in the range from 0 to *L*<=-<=1 inclusively.
The second line contains *n* distinct integers in the ascending order — the distance from Sasha's start to each barrier in the order of its overcoming. All integers are in the range from 0 to *L*<=-<=1 inclusively.
Output Specification:
Print "YES" (without quotes), if Kefa and Sasha ran the coinciding tracks (it means that the position of all barriers coincides, if they start running from the same points on the track). Otherwise print "NO" (without quotes).
Demo Input:
['3 8\n2 4 6\n1 5 7\n', '4 9\n2 3 5 8\n0 1 3 6\n', '2 4\n1 3\n1 2\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
The first test is analyzed in the statement.
|
```python
n,l=map(int,input().split())
lis1=list(map(int,input().split()))
lis2=list(map(int,input().split()))
ans="YES"
dif=lis1[0]-lis2[0]
for i in range(1,n):
if(lis1[i]-lis2[i]==dif):
ans="NO"
break
print (ans)
```
| 0
|
|
253
|
C
|
Text Editor
|
PROGRAMMING
| 1,600
|
[
"data structures",
"dfs and similar",
"graphs",
"greedy",
"shortest paths"
] | null | null |
Vasya is pressing the keys on the keyboard reluctantly, squeezing out his ideas on the classical epos depicted in Homer's Odysseus... How can he explain to his literature teacher that he isn't going to become a writer? In fact, he is going to become a programmer. So, he would take great pleasure in writing a program, but none — in writing a composition.
As Vasya was fishing for a sentence in the dark pond of his imagination, he suddenly wondered: what is the least number of times he should push a key to shift the cursor from one position to another one?
Let's describe his question more formally: to type a text, Vasya is using the text editor. He has already written *n* lines, the *i*-th line contains *a**i* characters (including spaces). If some line contains *k* characters, then this line overall contains (*k*<=+<=1) positions where the cursor can stand: before some character or after all characters (at the end of the line). Thus, the cursor's position is determined by a pair of integers (*r*,<=*c*), where *r* is the number of the line and *c* is the cursor's position in the line (the positions are indexed starting from one from the beginning of the line).
Vasya doesn't use the mouse to move the cursor. He uses keys "Up", "Down", "Right" and "Left". When he pushes each of these keys, the cursor shifts in the needed direction. Let's assume that before the corresponding key is pressed, the cursor was located in the position (*r*,<=*c*), then Vasya pushed key:
- "Up": if the cursor was located in the first line (*r*<==<=1), then it does not move. Otherwise, it moves to the previous line (with number *r*<=-<=1), to the same position. At that, if the previous line was short, that is, the cursor couldn't occupy position *c* there, the cursor moves to the last position of the line with number *r*<=-<=1;- "Down": if the cursor was located in the last line (*r*<==<=*n*), then it does not move. Otherwise, it moves to the next line (with number *r*<=+<=1), to the same position. At that, if the next line was short, that is, the cursor couldn't occupy position *c* there, the cursor moves to the last position of the line with number *r*<=+<=1;- "Right": if the cursor can move to the right in this line (*c*<=<<=*a**r*<=+<=1), then it moves to the right (to position *c*<=+<=1). Otherwise, it is located at the end of the line and doesn't move anywhere when Vasya presses the "Right" key;- "Left": if the cursor can move to the left in this line (*c*<=><=1), then it moves to the left (to position *c*<=-<=1). Otherwise, it is located at the beginning of the line and doesn't move anywhere when Vasya presses the "Left" key.
You've got the number of lines in the text file and the number of characters, written in each line of this file. Find the least number of times Vasya should push the keys, described above, to shift the cursor from position (*r*1,<=*c*1) to position (*r*2,<=*c*2).
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the file. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=105), separated by single spaces. The third line contains four integers *r*1,<=*c*1,<=*r*2,<=*c*2 (1<=≤<=*r*1,<=*r*2<=≤<=*n*,<=1<=≤<=*c*1<=≤<=*a**r*1<=+<=1,<=1<=≤<=*c*2<=≤<=*a**r*2<=+<=1).
|
Print a single integer — the minimum number of times Vasya should push a key to move the cursor from position (*r*1,<=*c*1) to position (*r*2,<=*c*2).
|
[
"4\n2 1 6 4\n3 4 4 2\n",
"4\n10 5 6 4\n1 11 4 2\n",
"3\n10 1 10\n1 10 1 1\n"
] |
[
"3\n",
"6\n",
"3\n"
] |
In the first sample the editor contains four lines. Let's represent the cursor's possible positions in the line as numbers. Letter *s* represents the cursor's initial position, letter *t* represents the last one. Then all possible positions of the cursor in the text editor are described by the following table.
123
12
123s567
1t345
One of the possible answers in the given sample is: "Left", "Down", "Left".
| 1,500
|
[
{
"input": "4\n2 1 6 4\n3 4 4 2",
"output": "3"
},
{
"input": "4\n10 5 6 4\n1 11 4 2",
"output": "6"
},
{
"input": "3\n10 1 10\n1 10 1 1",
"output": "3"
},
{
"input": "4\n2 1 6 4\n4 2 3 5",
"output": "4"
},
{
"input": "3\n20 3 20\n1 20 1 1",
"output": "5"
},
{
"input": "2\n10 1\n1 3 2 1",
"output": "2"
},
{
"input": "20\n3 1 9 9 6 1 3 4 5 6 7 3 1 9 9 1 9 1 5 7\n17 7 19 5",
"output": "5"
},
{
"input": "20\n81 90 11 68 23 18 78 75 45 86 58 37 21 15 98 40 53 100 10 70\n11 55 8 19",
"output": "7"
},
{
"input": "25\n55 47 5 63 55 11 8 32 0 62 41 7 17 70 33 6 41 68 37 82 33 64 28 33 12\n6 11 14 12",
"output": "19"
},
{
"input": "30\n77 38 82 87 88 1 90 3 79 69 64 36 85 12 1 19 80 89 75 56 49 28 10 31 37 65 27 84 10 72\n26 65 19 3",
"output": "15"
},
{
"input": "100\n119 384 220 357 394 123 371 57 6 221 219 79 305 292 71 113 428 326 166 235 120 404 77 223 2 171 81 1 119 307 200 323 89 294 178 421 125 197 89 154 335 46 210 311 216 182 246 262 195 99 175 153 310 302 417 167 222 349 63 325 175 345 6 78 9 147 126 308 229 295 175 368 230 116 95 254 443 15 299 265 322 171 179 184 435 115 384 324 213 359 414 159 322 49 209 296 376 173 369 302\n8 47 23 65",
"output": "73"
},
{
"input": "100\n120 336 161 474 285 126 321 63 82 303 421 110 143 279 505 231 40 413 20 421 271 30 465 186 495 156 225 445 530 156 516 305 360 261 123 5 50 377 124 8 115 529 395 408 271 166 121 240 336 348 352 359 487 471 171 379 381 182 109 425 252 434 131 430 461 386 33 189 481 461 163 89 374 505 525 526 132 468 80 88 90 538 280 281 552 415 194 41 333 296 297 205 40 79 22 219 108 213 158 410\n58 119 82 196",
"output": "186"
},
{
"input": "100\n9 8 5 2 10 6 10 10 1 9 8 5 0 9 1 6 6 2 3 9 9 3 2 7 2 7 8 10 6 6 2 8 5 0 0 8 7 3 0 4 7 5 9 0 3 6 9 6 5 0 4 9 4 7 7 1 5 8 2 4 10 3 9 8 10 6 10 7 4 9 0 1 3 6 6 2 1 1 5 7 0 9 6 0 4 6 8 4 7 6 1 9 4 3 10 9 7 0 0 7\n72 2 87 2",
"output": "16"
},
{
"input": "100\n9 72 46 37 26 94 80 1 43 85 26 53 58 18 24 19 67 2 100 52 61 81 48 15 73 41 97 93 45 1 73 54 75 51 28 79 0 14 41 42 24 50 70 18 96 100 67 1 68 48 44 39 63 77 78 18 10 51 32 53 26 60 1 13 66 39 55 27 23 71 75 0 27 88 73 31 16 95 87 84 86 71 37 40 66 70 65 83 19 4 81 99 26 51 67 63 80 54 23 44\n6 76 89 15",
"output": "97"
},
{
"input": "100\n176 194 157 24 27 153 31 159 196 85 127 114 142 39 133 4 44 36 141 96 80 40 120 16 88 29 157 136 158 98 145 152 19 40 106 116 19 195 184 70 72 95 78 146 199 1 103 3 120 71 52 77 160 148 24 156 108 64 86 124 103 97 108 66 107 126 29 172 23 106 29 69 64 90 9 171 59 85 1 63 79 50 136 21 115 164 30 115 86 26 25 6 128 48 122 14 198 88 182 117\n71 4 85 80",
"output": "92"
},
{
"input": "100\n1622 320 1261 282 1604 57 1427 1382 904 911 1719 1682 984 1727 1301 1799 1110 1057 248 764 1642 1325 1172 1677 182 32 665 397 1146 73 412 554 973 874 774 1948 1676 1959 518 280 1467 568 613 760 594 252 224 1359 876 253 760 1566 929 1614 940 1079 288 245 1432 1647 1534 1768 1947 733 225 495 1239 644 124 522 1859 1856 1464 485 1962 131 1693 1622 242 1119 1290 538 998 1342 791 711 809 1407 1369 414 124 758 1104 1142 355 324 665 1155 551 1611\n36 1383 51 21",
"output": "47"
},
{
"input": "50\n966 151 777 841 507 884 487 813 29 230 966 819 390 482 137 365 391 693 56 756 327 500 895 22 361 619 8 516 21 770 572 53 497 682 162 32 308 309 110 470 699 318 947 658 720 679 435 645 481 42\n45 510 25 48",
"output": "59"
},
{
"input": "50\n4143 2907 2028 539 3037 1198 6597 3658 972 9809 854 4931 642 3170 9777 2992 7121 8094 6634 684 5580 4684 3397 7909 3908 3822 2137 8299 8146 2105 7578 4338 7363 8237 530 301 4566 1153 4795 5342 3257 6953 4401 8311 9977 9260 7019 7705 5416 6754\n21 3413 23 218",
"output": "112"
},
{
"input": "50\n8974 13208 81051 72024 84908 49874 22875 64935 27340 38682 28512 43441 78752 83458 63344 5723 83425 54009 61980 7824 59956 43184 49274 3896 44079 67313 68565 9138 55087 68458 43009 3685 22879 85032 84273 93643 64957 73428 57016 33405 85961 47708 90325 1352 1551 20935 76821 75406 59309 40757\n14 45232 2 6810",
"output": "1102"
},
{
"input": "100\n34 80 42 99 7 49 109 61 20 7 92 2 62 96 65 77 70 5 16 83 99 39 88 66 106 1 80 68 71 74 28 75 19 97 38 100 30 1 55 86 3 13 61 82 72 50 68 18 77 89 96 27 26 35 46 13 83 77 40 31 85 108 15 5 40 80 1 108 44 18 66 26 46 7 36 80 34 76 17 9 23 57 109 90 88 1 54 66 71 94 6 89 50 22 93 82 32 74 41 74\n91 7 56 3",
"output": "36"
},
{
"input": "100\n156 150 75 72 205 133 139 99 212 82 58 104 133 88 46 157 49 179 32 72 159 188 42 47 36 58 127 215 125 115 209 118 109 11 62 159 110 151 92 202 203 25 44 209 153 8 199 168 126 34 21 106 31 40 48 212 106 0 131 166 2 126 13 126 103 44 2 66 33 25 194 41 37 198 199 6 22 1 161 16 95 11 198 198 166 145 214 159 143 2 181 130 159 118 176 165 192 178 42 168\n49 12 66 23",
"output": "39"
},
{
"input": "100\n289 16 321 129 0 121 61 86 93 5 63 276 259 144 275 236 309 257 244 138 107 18 158 14 295 162 7 113 58 101 142 196 181 329 115 109 62 237 110 87 19 205 68 257 252 0 166 45 310 244 140 251 262 315 213 206 290 128 287 230 198 83 135 40 8 273 319 295 288 274 34 260 288 252 172 129 201 110 294 111 95 180 34 98 16 188 170 40 274 153 11 159 245 51 328 290 112 11 105 182\n99 53 21 77",
"output": "154"
},
{
"input": "10\n11284 10942 14160 10062 1858 6457 1336 13842 5498 4236\n1 7123 5 664",
"output": "681"
},
{
"input": "53\n29496 9630 10781 25744 28508 15670 8252 14284 25995 20215 24251 14240 1370 15724 28268 30377 4839 16791 33515 23776 24252 1045 15245 12839 17531 28591 13091 27339 23361 10997 30438 26977 26789 18402 32938 2106 26599 10733 29549 9760 31507 33572 16934 7273 26477 15040 23704 19905 1941 3861 5950 1265 34\n11 6571 1 3145",
"output": "1788"
},
{
"input": "31\n14324 29226 58374 19956 61695 71586 13261 11436 58443 34879 12689 62786 68194 34303 99201 67616 51364 67539 56799 60130 22021 64546 28331 75746 45036 43950 2150 61718 33030 37781 34319\n24 57393 7 6152",
"output": "4024"
},
{
"input": "23\n5397 13279 11741 20182 18311 20961 16720 11864 2486 14081 15637 16216 3736 437 16346 12449 20205 10949 14237 2213 15281 15271 19138\n5 11479 13 68",
"output": "380"
},
{
"input": "40\n41997 20736 34699 73866 45509 41964 36050 16673 10454 21166 28306 69335 6172 65943 78569 16794 10439 68061 40392 52510 78248 63851 45294 49929 22580 5574 40993 18334 73897 59148 47727 76645 4280 23651 58772 64500 13704 60366 37099 20336\n14 29991 16 11904",
"output": "1468"
},
{
"input": "16\n922 7593 4748 4103 7672 6001 1573 3973 8524 8265 4747 3202 4796 2637 889 9359\n12 2165 12 1654",
"output": "90"
},
{
"input": "18\n22746 9084 3942 1120 25391 25307 7409 1189 23473 26175 10964 13584 5541 500 24338 12272 15824 27656\n3 1395 12 90",
"output": "424"
},
{
"input": "45\n2286 4425 14666 34959 10792 3723 30132 34266 18100 22813 28627 23310 33911 27285 1211 993 15526 4751 13611 21400 25712 24437 27435 34808 33950 18373 33685 23487 5444 10249 21415 16368 35398 7889 30918 19940 1552 12164 34292 13922 10011 31377 24102 34539 11992\n20 21252 28 2058",
"output": "531"
},
{
"input": "29\n56328 80183 27682 79083 60680 12286 34299 8015 51808 50756 82133 45930 43695 65863 25178 70825 2288 15111 39667 39637 11453 62821 81484 84216 54524 53749 8396 67712 76146\n13 10739 9 3622",
"output": "1345"
},
{
"input": "46\n67864 68218 3593 30646 66413 65542 65322 26801 28984 61330 15247 16522 39142 14013 49272 41585 56739 6881 44227 7101 57657 21121 51857 39351 13500 71528 8488 66118 14756 43923 21284 20018 49049 60198 6181 62460 44141 55828 42636 14623 59758 68321 12192 29978 24745 16467\n27 5545 4 3766",
"output": "197"
},
{
"input": "70\n53691 15034 17444 13375 23285 29211 24567 21643 45514 10290 70111 24541 25072 5365 12162 34564 27535 48253 39581 13468 33718 35105 30468 50214 53365 74800 16749 33935 36346 54230 73796 26826 27866 41887 67566 40813 32267 58821 56828 26439 23708 32335 69515 33825 6092 20510 50174 11129 4592 74116 21498 77951 48056 28554 43904 21885 5967 40253 4990 70029 34374 41201 25399 6101 10354 61833 43646 20534 371 11111\n21 3911 45 1755",
"output": "1455"
},
{
"input": "10\n8121 10681 10179 10221 9410 5214 19040 17893 7862 4611\n7 7780 7 3369",
"output": "1249"
},
{
"input": "2\n1 2\n1 1 1 1",
"output": "0"
},
{
"input": "3\n1 10 20\n2 10 3 1",
"output": "4"
}
] | 1,641,469,190
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 7
| 186
| 409,600
|
from collections import *
import sys
#sys.setrecursionlimit((10**5))
import heapq
import sys
def inpu(): return int(input())
def sep(): return map(int,input().split())
def lis(): return list(sep())
"""
def main():
f = open('input.txt','r')
o = open('output.txt','w')
b,g = map(int,f.readline().split())
ans=""
if b>=g:
i,j,k=0,0,0
while(True):
if i<b and j<g:
ans+="BG"
i+=1
j+=1
elif i<b and j>=g:
ans+="B"
i+=1
else:
break
elif g>=b:
i,j,k=0,0,0
while(True):
if i<b and j<g:
ans+="GB"
i+=1
j+=1
elif i>=b and j<g:
ans+="G"
j+=1
else:
break
o.write(ans)
o.close()
if __name__ == '__main__':
main()
"""
"""
import sys
def main():
sys.stdin = open("input.txt")
sys.stdout = open("output.txt", 'w')
b, g = map(int, input().split())
ans = ""
if b >= g:
i, j, k = 0, 0, 0
while (True):
if i < b and j < g:
ans += "BG"
i += 1
j += 1
elif i < b and j >= g:
ans += "B"
i += 1
else:
break
elif g >= b:
i, j, k = 0, 0, 0
while (True):
if i < b and j < g:
ans += "GB"
i += 1
j += 1
elif i >= b and j < g:
ans += "G"
j += 1
else:
break
print(ans)
if __name__ == '__main__':
main()
"""
def main():
sys.stdin = open("input.txt")
sys.stdout = open("output.txt", 'w')
t = 1
#t = int(input())
for _ in range(t):
n=inpu()
arr=lis()
arr=[arr[i]+1 for i in range(n)]
r1,c1,r2,c2=sep()
ans=0
if r1<r2:
ans = 0
while (r1<r2):
#print(c1,ans)
if c1>arr[r1]:
ans+=1
c1=arr[r1]
else:
ans+=1
r1+=1
elif r2<r1:
ans = 0
while(r1>r2):
if c1-1>arr[r1-2]:
ans+=1
c1 = arr[r1-2]
else:
ans+=1
r1-=1
if c1>c2:
c1,c2 = c2,c1
p,q = c1,c2
rem = abs(p-q)
stair = 0
while(r1>1):
#print(str(rem)+"---------------------")
stair+=1
prev = min(arr[r1-1],c2)
rem = min(rem,abs(prev-c1)+stair*2)
c2=prev
r1-=1
stair=0
c1,c2=p,q
while(r2<n):
#print(c2)
#print(str(rem)+"------")
stair+=1
nex = min(arr[r2],c2)
rem = min(rem,abs(nex-c1)+stair*2)
c2=nex
r2+=1
#print(rem)
print(ans+rem)
if __name__ == '__main__':
main()
|
Title: Text Editor
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya is pressing the keys on the keyboard reluctantly, squeezing out his ideas on the classical epos depicted in Homer's Odysseus... How can he explain to his literature teacher that he isn't going to become a writer? In fact, he is going to become a programmer. So, he would take great pleasure in writing a program, but none — in writing a composition.
As Vasya was fishing for a sentence in the dark pond of his imagination, he suddenly wondered: what is the least number of times he should push a key to shift the cursor from one position to another one?
Let's describe his question more formally: to type a text, Vasya is using the text editor. He has already written *n* lines, the *i*-th line contains *a**i* characters (including spaces). If some line contains *k* characters, then this line overall contains (*k*<=+<=1) positions where the cursor can stand: before some character or after all characters (at the end of the line). Thus, the cursor's position is determined by a pair of integers (*r*,<=*c*), where *r* is the number of the line and *c* is the cursor's position in the line (the positions are indexed starting from one from the beginning of the line).
Vasya doesn't use the mouse to move the cursor. He uses keys "Up", "Down", "Right" and "Left". When he pushes each of these keys, the cursor shifts in the needed direction. Let's assume that before the corresponding key is pressed, the cursor was located in the position (*r*,<=*c*), then Vasya pushed key:
- "Up": if the cursor was located in the first line (*r*<==<=1), then it does not move. Otherwise, it moves to the previous line (with number *r*<=-<=1), to the same position. At that, if the previous line was short, that is, the cursor couldn't occupy position *c* there, the cursor moves to the last position of the line with number *r*<=-<=1;- "Down": if the cursor was located in the last line (*r*<==<=*n*), then it does not move. Otherwise, it moves to the next line (with number *r*<=+<=1), to the same position. At that, if the next line was short, that is, the cursor couldn't occupy position *c* there, the cursor moves to the last position of the line with number *r*<=+<=1;- "Right": if the cursor can move to the right in this line (*c*<=<<=*a**r*<=+<=1), then it moves to the right (to position *c*<=+<=1). Otherwise, it is located at the end of the line and doesn't move anywhere when Vasya presses the "Right" key;- "Left": if the cursor can move to the left in this line (*c*<=><=1), then it moves to the left (to position *c*<=-<=1). Otherwise, it is located at the beginning of the line and doesn't move anywhere when Vasya presses the "Left" key.
You've got the number of lines in the text file and the number of characters, written in each line of this file. Find the least number of times Vasya should push the keys, described above, to shift the cursor from position (*r*1,<=*c*1) to position (*r*2,<=*c*2).
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the file. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=105), separated by single spaces. The third line contains four integers *r*1,<=*c*1,<=*r*2,<=*c*2 (1<=≤<=*r*1,<=*r*2<=≤<=*n*,<=1<=≤<=*c*1<=≤<=*a**r*1<=+<=1,<=1<=≤<=*c*2<=≤<=*a**r*2<=+<=1).
Output Specification:
Print a single integer — the minimum number of times Vasya should push a key to move the cursor from position (*r*1,<=*c*1) to position (*r*2,<=*c*2).
Demo Input:
['4\n2 1 6 4\n3 4 4 2\n', '4\n10 5 6 4\n1 11 4 2\n', '3\n10 1 10\n1 10 1 1\n']
Demo Output:
['3\n', '6\n', '3\n']
Note:
In the first sample the editor contains four lines. Let's represent the cursor's possible positions in the line as numbers. Letter *s* represents the cursor's initial position, letter *t* represents the last one. Then all possible positions of the cursor in the text editor are described by the following table.
123
12
123s567
1t345
One of the possible answers in the given sample is: "Left", "Down", "Left".
|
```python
from collections import *
import sys
#sys.setrecursionlimit((10**5))
import heapq
import sys
def inpu(): return int(input())
def sep(): return map(int,input().split())
def lis(): return list(sep())
"""
def main():
f = open('input.txt','r')
o = open('output.txt','w')
b,g = map(int,f.readline().split())
ans=""
if b>=g:
i,j,k=0,0,0
while(True):
if i<b and j<g:
ans+="BG"
i+=1
j+=1
elif i<b and j>=g:
ans+="B"
i+=1
else:
break
elif g>=b:
i,j,k=0,0,0
while(True):
if i<b and j<g:
ans+="GB"
i+=1
j+=1
elif i>=b and j<g:
ans+="G"
j+=1
else:
break
o.write(ans)
o.close()
if __name__ == '__main__':
main()
"""
"""
import sys
def main():
sys.stdin = open("input.txt")
sys.stdout = open("output.txt", 'w')
b, g = map(int, input().split())
ans = ""
if b >= g:
i, j, k = 0, 0, 0
while (True):
if i < b and j < g:
ans += "BG"
i += 1
j += 1
elif i < b and j >= g:
ans += "B"
i += 1
else:
break
elif g >= b:
i, j, k = 0, 0, 0
while (True):
if i < b and j < g:
ans += "GB"
i += 1
j += 1
elif i >= b and j < g:
ans += "G"
j += 1
else:
break
print(ans)
if __name__ == '__main__':
main()
"""
def main():
sys.stdin = open("input.txt")
sys.stdout = open("output.txt", 'w')
t = 1
#t = int(input())
for _ in range(t):
n=inpu()
arr=lis()
arr=[arr[i]+1 for i in range(n)]
r1,c1,r2,c2=sep()
ans=0
if r1<r2:
ans = 0
while (r1<r2):
#print(c1,ans)
if c1>arr[r1]:
ans+=1
c1=arr[r1]
else:
ans+=1
r1+=1
elif r2<r1:
ans = 0
while(r1>r2):
if c1-1>arr[r1-2]:
ans+=1
c1 = arr[r1-2]
else:
ans+=1
r1-=1
if c1>c2:
c1,c2 = c2,c1
p,q = c1,c2
rem = abs(p-q)
stair = 0
while(r1>1):
#print(str(rem)+"---------------------")
stair+=1
prev = min(arr[r1-1],c2)
rem = min(rem,abs(prev-c1)+stair*2)
c2=prev
r1-=1
stair=0
c1,c2=p,q
while(r2<n):
#print(c2)
#print(str(rem)+"------")
stair+=1
nex = min(arr[r2],c2)
rem = min(rem,abs(nex-c1)+stair*2)
c2=nex
r2+=1
#print(rem)
print(ans+rem)
if __name__ == '__main__':
main()
```
| 0
|
|
509
|
A
|
Maximum in Table
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
|
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
|
Print a single line containing a positive integer *m* — the maximum value in the table.
|
[
"1\n",
"5\n"
] |
[
"1",
"70"
] |
In the second test the rows of the table look as follows:
| 0
|
[
{
"input": "1",
"output": "1"
},
{
"input": "5",
"output": "70"
},
{
"input": "2",
"output": "2"
},
{
"input": "3",
"output": "6"
},
{
"input": "4",
"output": "20"
},
{
"input": "6",
"output": "252"
},
{
"input": "7",
"output": "924"
},
{
"input": "9",
"output": "12870"
},
{
"input": "10",
"output": "48620"
},
{
"input": "8",
"output": "3432"
}
] | 1,637,241,600
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 10
| 46
| 0
|
n =int(input())
main_arr =[]
arr = [1]*n
arr2 =[1]
for i in range(n-1):
for j in range(n-1):
value = arr[j+1]+arr2[j]
arr2.append(value)
arr = arr2
arr2 = [1]
print(max(arr))
|
Title: Maximum in Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
Input Specification:
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
Output Specification:
Print a single line containing a positive integer *m* — the maximum value in the table.
Demo Input:
['1\n', '5\n']
Demo Output:
['1', '70']
Note:
In the second test the rows of the table look as follows:
|
```python
n =int(input())
main_arr =[]
arr = [1]*n
arr2 =[1]
for i in range(n-1):
for j in range(n-1):
value = arr[j+1]+arr2[j]
arr2.append(value)
arr = arr2
arr2 = [1]
print(max(arr))
```
| 3
|
|
127
|
B
|
Canvas Frames
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Nicholas, a painter is going to paint several new canvases. Nicholas is sure that the canvases will turn out so great that each one will need framing and being hung on the wall. Frames are what Nicholas decided to begin with.
Nicholas has *n* sticks whose lengths equal *a*1,<=*a*2,<=... *a**n*. Nicholas does not want to break the sticks or glue them together. To make a *h*<=×<=*w*-sized frame, he needs two sticks whose lengths equal *h* and two sticks whose lengths equal *w*. Specifically, to make a square frame (when *h*<==<=*w*), he needs four sticks of the same length.
Now Nicholas wants to make from the sticks that he has as many frames as possible; to be able to paint as many canvases as possible to fill the frames. Help him in this uneasy task. Note that it is not necessary to use all the sticks Nicholas has.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of sticks. The second line contains *n* space-separated integers. The *i*-th integer equals the length of the *i*-th stick *a**i* (1<=≤<=*a**i*<=≤<=100).
|
Print the single number — the maximum number of frames Nicholas can make for his future canvases.
|
[
"5\n2 4 3 2 3\n",
"13\n2 2 4 4 4 4 6 6 6 7 7 9 9\n",
"4\n3 3 3 5\n"
] |
[
"1",
"3",
"0"
] |
none
| 1,000
|
[
{
"input": "5\n2 4 3 2 3",
"output": "1"
},
{
"input": "13\n2 2 4 4 4 4 6 6 6 7 7 9 9",
"output": "3"
},
{
"input": "4\n3 3 3 5",
"output": "0"
},
{
"input": "2\n3 5",
"output": "0"
},
{
"input": "9\n1 2 3 4 5 6 7 8 9",
"output": "0"
},
{
"input": "14\n2 4 2 6 2 3 4 1 4 5 4 3 4 1",
"output": "2"
},
{
"input": "33\n1 2 2 6 10 10 33 11 17 32 25 6 7 29 11 32 33 8 13 17 17 6 11 11 11 8 10 26 29 26 32 33 36",
"output": "5"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n10",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "3\n1 1 1",
"output": "0"
},
{
"input": "3\n1 2 2",
"output": "0"
},
{
"input": "3\n3 2 1",
"output": "0"
},
{
"input": "4\n1 1 1 1",
"output": "1"
},
{
"input": "4\n1 2 1 2",
"output": "1"
},
{
"input": "4\n1 100 1 100",
"output": "1"
},
{
"input": "4\n10 100 100 10",
"output": "1"
},
{
"input": "4\n1 2 3 3",
"output": "0"
},
{
"input": "4\n8 5 9 13",
"output": "0"
},
{
"input": "4\n100 100 100 100",
"output": "1"
},
{
"input": "5\n1 1 1 1 1",
"output": "1"
},
{
"input": "5\n1 4 4 1 1",
"output": "1"
},
{
"input": "5\n1 100 1 1 100",
"output": "1"
},
{
"input": "5\n100 100 1 1 100",
"output": "1"
},
{
"input": "5\n100 1 100 100 100",
"output": "1"
},
{
"input": "5\n100 100 100 100 100",
"output": "1"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "1"
},
{
"input": "6\n1 1 5 1 1 5",
"output": "1"
},
{
"input": "6\n1 100 100 1 1 1",
"output": "1"
},
{
"input": "6\n100 1 1 100 1 100",
"output": "1"
},
{
"input": "6\n1 2 3 2 3 1",
"output": "1"
},
{
"input": "6\n1 50 1 100 50 100",
"output": "1"
},
{
"input": "6\n10 10 10 12 13 14",
"output": "0"
},
{
"input": "7\n1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "7\n1 2 1 1 1 1 1",
"output": "1"
},
{
"input": "7\n1 2 2 1 2 1 2",
"output": "1"
},
{
"input": "7\n1 1 2 2 1 2 3",
"output": "1"
},
{
"input": "7\n1 3 2 2 3 1 4",
"output": "1"
},
{
"input": "7\n1 3 4 3 5 4 6",
"output": "1"
},
{
"input": "7\n7 6 5 4 3 2 1",
"output": "0"
},
{
"input": "8\n1 2 1 2 2 2 2 2",
"output": "2"
},
{
"input": "8\n1 2 2 1 1 2 2 2",
"output": "1"
},
{
"input": "8\n1 2 2 2 3 1 1 3",
"output": "1"
},
{
"input": "8\n1 2 3 4 1 2 3 4",
"output": "2"
},
{
"input": "8\n1 1 1 1 2 3 2 3",
"output": "2"
},
{
"input": "8\n1 2 3 4 5 5 5 5",
"output": "1"
},
{
"input": "8\n1 2 1 3 4 1 5 6",
"output": "0"
},
{
"input": "8\n1 2 3 4 5 6 1 7",
"output": "0"
},
{
"input": "8\n8 6 3 4 5 2 1 7",
"output": "0"
},
{
"input": "8\n100 100 100 100 100 100 100 100",
"output": "2"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "2"
},
{
"input": "10\n19 9 14 14 19 5 5 18 10 17",
"output": "1"
},
{
"input": "10\n72 86 73 25 84 29 33 34 20 29",
"output": "0"
},
{
"input": "10\n93 93 99 98 91 96 92 98 94 98",
"output": "1"
},
{
"input": "13\n35 6 21 30 67 55 70 39 75 72 11 13 69",
"output": "0"
},
{
"input": "17\n90 97 12 56 94 11 49 96 22 7 15 48 71 71 94 72 100",
"output": "1"
},
{
"input": "18\n39 72 67 28 69 41 43 51 66 99 4 57 68 93 28 27 37 27",
"output": "1"
},
{
"input": "23\n88 82 2 67 4 6 67 83 77 58 48 64 86 37 96 83 35 46 13 79 72 18 35",
"output": "1"
},
{
"input": "30\n43 34 38 50 47 24 26 20 7 5 26 29 98 87 90 46 10 53 88 61 90 39 78 81 65 13 72 95 53 27",
"output": "1"
},
{
"input": "33\n1 3 34 55 38 58 64 26 66 44 50 63 46 62 62 99 73 87 35 20 30 38 39 85 49 24 93 68 8 25 86 30 51",
"output": "1"
},
{
"input": "38\n65 69 80 93 28 36 40 81 53 75 55 50 82 95 8 51 66 65 50 4 40 92 18 70 38 68 42 100 34 57 98 79 95 84 82 35 100 89",
"output": "3"
},
{
"input": "40\n4 2 62 38 76 68 19 71 44 91 76 31 3 63 56 62 93 98 10 61 52 59 81 46 23 27 36 26 24 38 37 66 15 16 78 41 95 82 73 90",
"output": "1"
},
{
"input": "43\n62 31 14 43 67 2 60 77 64 70 91 9 3 43 76 7 56 84 5 20 88 50 47 42 7 39 8 56 71 24 49 59 70 61 81 17 76 44 80 61 77 5 96",
"output": "4"
},
{
"input": "49\n75 64 7 2 1 66 31 84 78 53 34 5 40 90 7 62 86 54 99 77 8 92 30 3 18 18 61 38 38 11 79 88 84 89 50 94 72 8 54 85 100 1 19 4 97 91 13 39 91",
"output": "4"
},
{
"input": "57\n83 94 42 57 19 9 40 25 56 92 9 38 58 66 43 19 50 10 100 3 49 96 77 36 20 3 48 15 38 19 99 100 66 14 52 13 16 73 65 99 29 85 75 18 97 64 57 82 70 19 16 25 40 11 9 22 89",
"output": "6"
},
{
"input": "67\n36 22 22 86 52 53 36 68 46 82 99 37 15 43 57 35 33 99 22 96 7 8 80 93 70 70 55 51 61 74 6 28 85 72 84 42 29 1 4 71 7 40 61 95 93 36 42 61 16 40 10 85 31 86 93 19 44 20 52 66 10 22 40 53 25 29 23",
"output": "8"
},
{
"input": "74\n90 26 58 69 87 23 44 9 32 25 33 13 79 84 52 90 4 7 93 77 29 85 22 1 96 69 98 16 76 87 57 16 44 41 57 28 18 70 77 83 37 17 59 87 27 19 89 63 14 84 77 40 46 77 82 73 86 73 30 58 6 30 70 36 31 12 43 50 93 3 3 57 38 91",
"output": "7"
},
{
"input": "87\n10 19 83 58 15 48 26 58 89 46 50 34 81 40 25 51 62 85 9 80 71 44 100 22 30 48 74 69 54 40 38 81 66 42 40 90 60 20 75 24 74 98 28 62 79 65 65 6 14 23 3 59 29 24 64 13 8 38 29 85 75 81 36 42 3 63 99 24 72 92 35 8 71 19 77 77 66 3 79 65 15 18 15 69 60 77 91",
"output": "11"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "25"
},
{
"input": "100\n1 9 3 5 10 10 9 8 10 1 7 6 5 6 7 9 1 5 8 3 2 3 3 10 2 3 10 7 10 3 6 3 2 10 1 10 2 3 4 3 3 1 7 5 10 2 3 8 9 2 5 4 7 2 5 9 2 1 7 9 9 8 4 4 6 1 6 6 4 7 2 3 1 1 1 6 9 1 2 9 3 7 6 10 3 6 2 5 2 5 3 9 10 6 4 2 9 9 4 5",
"output": "23"
},
{
"input": "100\n70 70 75 70 74 70 70 73 72 73 74 75 70 74 73 70 70 74 72 72 75 70 73 72 70 75 73 70 74 70 73 75 71 74 70 71 75 74 75 71 74 70 73 73 70 75 71 73 73 74 73 74 71 73 73 71 72 71 70 75 74 74 72 72 71 72 75 75 70 73 71 73 72 71 70 75 71 75 73 75 73 72 75 71 73 71 72 74 75 70 70 74 75 73 70 73 73 75 71 74",
"output": "24"
},
{
"input": "100\n99 98 98 99 98 98 98 100 98 99 99 98 99 98 98 98 99 99 98 99 99 100 98 100 98 98 98 99 98 100 100 98 100 99 100 98 99 99 99 98 100 98 100 99 99 99 98 100 98 98 98 100 100 99 98 98 100 100 100 99 98 99 99 99 100 99 99 98 99 98 99 100 100 98 98 100 100 99 99 99 98 98 98 100 99 99 100 99 100 99 98 100 98 100 98 98 99 98 99 98",
"output": "24"
},
{
"input": "100\n94 87 92 91 94 89 93 94 87 93 93 94 89 91 87 87 92 91 87 94 90 89 92 92 87 88 90 90 90 89 90 92 91 91 89 88 93 89 88 94 91 89 88 87 92 89 91 87 88 90 88 92 90 87 93 94 94 92 92 87 90 88 88 91 94 93 87 94 93 93 87 90 92 92 90 88 88 90 92 91 90 88 89 91 91 88 90 93 90 94 94 93 90 91 91 93 94 94 92 93",
"output": "24"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "25"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "2"
},
{
"input": "7\n13 13 13 13 6 2 3",
"output": "1"
},
{
"input": "8\n1 1 1 1 1 1 1 1",
"output": "2"
},
{
"input": "5\n100 100 99 99 5",
"output": "1"
},
{
"input": "8\n2 2 2 2 2 2 2 2",
"output": "2"
},
{
"input": "8\n1 2 3 4 5 6 7 7",
"output": "0"
},
{
"input": "8\n4 4 4 4 4 4 4 4",
"output": "2"
},
{
"input": "10\n1 1 1 1 1 1 1 1 2 2",
"output": "2"
},
{
"input": "4\n100 100 100 99",
"output": "0"
},
{
"input": "4\n2 2 2 2",
"output": "1"
},
{
"input": "5\n100 100 99 99 2",
"output": "1"
},
{
"input": "9\n1 1 1 1 1 1 1 1 1",
"output": "2"
},
{
"input": "5\n2 2 3 4 4",
"output": "1"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "25"
},
{
"input": "13\n1 2 3 4 5 6 7 8 9 10 11 12 13",
"output": "0"
},
{
"input": "20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "5"
},
{
"input": "4\n4 4 4 4",
"output": "1"
},
{
"input": "5\n1 1 2 3 3",
"output": "1"
},
{
"input": "5\n30 30 30 1 1",
"output": "1"
}
] | 1,613,065,781
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 93
| 109
| 0
|
n=(int)(input())
d={}
a=list(map(int,input().split()))
for i in a:
if i in d:
d[i]+=1
else:
d[i]=1
res=0
for i in d:
res+=(int)(d[i]/2)
print((int)(res/2))
|
Title: Canvas Frames
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nicholas, a painter is going to paint several new canvases. Nicholas is sure that the canvases will turn out so great that each one will need framing and being hung on the wall. Frames are what Nicholas decided to begin with.
Nicholas has *n* sticks whose lengths equal *a*1,<=*a*2,<=... *a**n*. Nicholas does not want to break the sticks or glue them together. To make a *h*<=×<=*w*-sized frame, he needs two sticks whose lengths equal *h* and two sticks whose lengths equal *w*. Specifically, to make a square frame (when *h*<==<=*w*), he needs four sticks of the same length.
Now Nicholas wants to make from the sticks that he has as many frames as possible; to be able to paint as many canvases as possible to fill the frames. Help him in this uneasy task. Note that it is not necessary to use all the sticks Nicholas has.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of sticks. The second line contains *n* space-separated integers. The *i*-th integer equals the length of the *i*-th stick *a**i* (1<=≤<=*a**i*<=≤<=100).
Output Specification:
Print the single number — the maximum number of frames Nicholas can make for his future canvases.
Demo Input:
['5\n2 4 3 2 3\n', '13\n2 2 4 4 4 4 6 6 6 7 7 9 9\n', '4\n3 3 3 5\n']
Demo Output:
['1', '3', '0']
Note:
none
|
```python
n=(int)(input())
d={}
a=list(map(int,input().split()))
for i in a:
if i in d:
d[i]+=1
else:
d[i]=1
res=0
for i in d:
res+=(int)(d[i]/2)
print((int)(res/2))
```
| 3
|
|
960
|
B
|
Minimize the error
|
PROGRAMMING
| 1,500
|
[
"data structures",
"greedy",
"sortings"
] | null | null |
You are given two arrays *A* and *B*, each of size *n*. The error, *E*, between these two arrays is defined . You have to perform exactly *k*1 operations on array *A* and exactly *k*2 operations on array *B*. In one operation, you have to choose one element of the array and increase or decrease it by 1.
Output the minimum possible value of error after *k*1 operations on array *A* and *k*2 operations on array *B* have been performed.
|
The first line contains three space-separated integers *n* (1<=≤<=*n*<=≤<=103), *k*1 and *k*2 (0<=≤<=*k*1<=+<=*k*2<=≤<=103, *k*1 and *k*2 are non-negative) — size of arrays and number of operations to perform on *A* and *B* respectively.
Second line contains *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=106<=≤<=*a**i*<=≤<=106) — array *A*.
Third line contains *n* space separated integers *b*1,<=*b*2,<=...,<=*b**n* (<=-<=106<=≤<=*b**i*<=≤<=106)— array *B*.
|
Output a single integer — the minimum possible value of after doing exactly *k*1 operations on array *A* and exactly *k*2 operations on array *B*.
|
[
"2 0 0\n1 2\n2 3\n",
"2 1 0\n1 2\n2 2\n",
"2 5 7\n3 4\n14 4\n"
] |
[
"2",
"0",
"1"
] |
In the first sample case, we cannot perform any operations on *A* or *B*. Therefore the minimum possible error *E* = (1 - 2)<sup class="upper-index">2</sup> + (2 - 3)<sup class="upper-index">2</sup> = 2.
In the second sample case, we are required to perform exactly one operation on *A*. In order to minimize error, we increment the first element of *A* by 1. Now, *A* = [2, 2]. The error is now *E* = (2 - 2)<sup class="upper-index">2</sup> + (2 - 2)<sup class="upper-index">2</sup> = 0. This is the minimum possible error obtainable.
In the third sample case, we can increase the first element of *A* to 8, using the all of the 5 moves available to us. Also, the first element of *B* can be reduced to 8 using the 6 of the 7 available moves. Now *A* = [8, 4] and *B* = [8, 4]. The error is now *E* = (8 - 8)<sup class="upper-index">2</sup> + (4 - 4)<sup class="upper-index">2</sup> = 0, but we are still left with 1 move for array *B*. Increasing the second element of *B* to 5 using the left move, we get *B* = [8, 5] and *E* = (8 - 8)<sup class="upper-index">2</sup> + (4 - 5)<sup class="upper-index">2</sup> = 1.
| 1,000
|
[
{
"input": "2 0 0\n1 2\n2 3",
"output": "2"
},
{
"input": "2 1 0\n1 2\n2 2",
"output": "0"
},
{
"input": "2 5 7\n3 4\n14 4",
"output": "1"
},
{
"input": "2 0 1\n1 2\n2 2",
"output": "0"
},
{
"input": "2 1 1\n0 0\n1 1",
"output": "0"
},
{
"input": "5 5 5\n0 0 0 0 0\n0 0 0 0 0",
"output": "0"
},
{
"input": "3 4 5\n1 2 3\n3 2 1",
"output": "1"
},
{
"input": "3 1000 0\n1 2 3\n-1000 -1000 -1000",
"output": "1341346"
},
{
"input": "10 300 517\n-6 -2 6 5 -3 8 9 -10 8 6\n5 -9 -2 6 1 4 6 -2 5 -3",
"output": "1"
},
{
"input": "10 819 133\n87 22 30 89 82 -97 -52 25 76 -22\n-20 95 21 25 2 -3 45 -7 -98 -56",
"output": "0"
},
{
"input": "10 10 580\n302 -553 -281 -299 -270 -890 -989 -749 -418 486\n735 330 6 725 -984 209 -855 -786 -502 967",
"output": "2983082"
},
{
"input": "10 403 187\n9691 -3200 3016 3540 -9475 8840 -4705 7940 6293 -2631\n-2288 9129 4067 696 -6754 9869 -5747 701 3344 -3426",
"output": "361744892"
},
{
"input": "10 561 439\n76639 67839 10670 -23 -18393 65114 46538 67596 86615 90480\n50690 620 -33631 -75857 75634 91321 -81662 -93668 -98557 -43621",
"output": "116776723778"
},
{
"input": "10 765 62\n-929885 -995154 254071 -370672 -435272 584846 -301610 -234118 -82557 743536\n-36327 439149 -977780 -821019 -585558 953598 -151943 140715 -311253 -383103",
"output": "6216649853365"
},
{
"input": "22 334 246\n-462653 -618002 4973 -348485 366658 192390 274752 200590 138367 779540 -661269 642587 113645 -110388 -604418 -491231 -933401 -219332 -603140 836439 167007 210226\n357638 -646669 -558432 -434313 -285851 -119233 323088 -512237 -729293 215256 39316 -984201 -209814 715016 -271932 796550 988227 -89577 67202 462973 -942079 -823339",
"output": "15389604923763"
},
{
"input": "1 1000 0\n1000000\n-1000000",
"output": "3996001000000"
},
{
"input": "1 1000 0\n1000000\n1000000",
"output": "0"
},
{
"input": "1 0 1000\n-1000000\n1000000",
"output": "3996001000000"
},
{
"input": "1 0 1000\n1000000\n1000000",
"output": "0"
},
{
"input": "1 5 7\n1\n2",
"output": "1"
},
{
"input": "2 1 3\n2 2\n2 2",
"output": "0"
},
{
"input": "3 3 0\n1 1 1\n1 1 1",
"output": "1"
},
{
"input": "1 0 6\n0\n0",
"output": "0"
},
{
"input": "2 1 1\n2 2\n0 0",
"output": "2"
},
{
"input": "3 1 4\n0 0 0\n1 5 6",
"output": "19"
},
{
"input": "1 1 2\n0\n8",
"output": "25"
},
{
"input": "2 2 0\n3 3\n3 3",
"output": "0"
}
] | 1,614,200,349
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include <iostream>
#include <vector>
#include <algorithm>
using namespace std;
int main()
{
int n,k1,k2;
scanf("%d %d %d",&n,&k1,&k2);
int k=k1+k2;
vector <int> a(n),b(n), c;
for (int i=0;i<n;i++) {
scanf("%d", &a[i]);
}
for (int i=0;i<n;i++) {
scanf("%d", &b[i]);
}
for (int i=0;i<n;i++) {
c.push_back(abs(a[i]-b[i]));
//printf("%d ", c[i]);
}
//printf("!!!!!!!!!!%d\n", k);
sort(c.begin(),c.end());
int l=c[0];
for (int i=n-1;i>-1;i--) {
//printf("%d ", c[i]);
if (k>0) {
int h=c[i]-l;
if (h<=k) {
c[i]-=(h);
k-=h;
}
else {
c[i]-=k;
k=0;
}
}
else {
break;
}
//printf("%d\n", c[i]);
}
while (k>0) {
for (int i=n-1;i>-1;i--) {
if (k>0) {
c[i]-=1;
k-=1;
}
else {
break;
}
}
}
int s=0;
for (int i=0;i<n;i++) {
s+=c[i]*c[i];
//printf("%d ", c[i]);
}
printf("\n%d", s);
return 0;
}
|
Title: Minimize the error
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two arrays *A* and *B*, each of size *n*. The error, *E*, between these two arrays is defined . You have to perform exactly *k*1 operations on array *A* and exactly *k*2 operations on array *B*. In one operation, you have to choose one element of the array and increase or decrease it by 1.
Output the minimum possible value of error after *k*1 operations on array *A* and *k*2 operations on array *B* have been performed.
Input Specification:
The first line contains three space-separated integers *n* (1<=≤<=*n*<=≤<=103), *k*1 and *k*2 (0<=≤<=*k*1<=+<=*k*2<=≤<=103, *k*1 and *k*2 are non-negative) — size of arrays and number of operations to perform on *A* and *B* respectively.
Second line contains *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=106<=≤<=*a**i*<=≤<=106) — array *A*.
Third line contains *n* space separated integers *b*1,<=*b*2,<=...,<=*b**n* (<=-<=106<=≤<=*b**i*<=≤<=106)— array *B*.
Output Specification:
Output a single integer — the minimum possible value of after doing exactly *k*1 operations on array *A* and exactly *k*2 operations on array *B*.
Demo Input:
['2 0 0\n1 2\n2 3\n', '2 1 0\n1 2\n2 2\n', '2 5 7\n3 4\n14 4\n']
Demo Output:
['2', '0', '1']
Note:
In the first sample case, we cannot perform any operations on *A* or *B*. Therefore the minimum possible error *E* = (1 - 2)<sup class="upper-index">2</sup> + (2 - 3)<sup class="upper-index">2</sup> = 2.
In the second sample case, we are required to perform exactly one operation on *A*. In order to minimize error, we increment the first element of *A* by 1. Now, *A* = [2, 2]. The error is now *E* = (2 - 2)<sup class="upper-index">2</sup> + (2 - 2)<sup class="upper-index">2</sup> = 0. This is the minimum possible error obtainable.
In the third sample case, we can increase the first element of *A* to 8, using the all of the 5 moves available to us. Also, the first element of *B* can be reduced to 8 using the 6 of the 7 available moves. Now *A* = [8, 4] and *B* = [8, 4]. The error is now *E* = (8 - 8)<sup class="upper-index">2</sup> + (4 - 4)<sup class="upper-index">2</sup> = 0, but we are still left with 1 move for array *B*. Increasing the second element of *B* to 5 using the left move, we get *B* = [8, 5] and *E* = (8 - 8)<sup class="upper-index">2</sup> + (4 - 5)<sup class="upper-index">2</sup> = 1.
|
```python
#include <iostream>
#include <vector>
#include <algorithm>
using namespace std;
int main()
{
int n,k1,k2;
scanf("%d %d %d",&n,&k1,&k2);
int k=k1+k2;
vector <int> a(n),b(n), c;
for (int i=0;i<n;i++) {
scanf("%d", &a[i]);
}
for (int i=0;i<n;i++) {
scanf("%d", &b[i]);
}
for (int i=0;i<n;i++) {
c.push_back(abs(a[i]-b[i]));
//printf("%d ", c[i]);
}
//printf("!!!!!!!!!!%d\n", k);
sort(c.begin(),c.end());
int l=c[0];
for (int i=n-1;i>-1;i--) {
//printf("%d ", c[i]);
if (k>0) {
int h=c[i]-l;
if (h<=k) {
c[i]-=(h);
k-=h;
}
else {
c[i]-=k;
k=0;
}
}
else {
break;
}
//printf("%d\n", c[i]);
}
while (k>0) {
for (int i=n-1;i>-1;i--) {
if (k>0) {
c[i]-=1;
k-=1;
}
else {
break;
}
}
}
int s=0;
for (int i=0;i<n;i++) {
s+=c[i]*c[i];
//printf("%d ", c[i]);
}
printf("\n%d", s);
return 0;
}
```
| -1
|
|
234
|
A
|
Lefthanders and Righthanders
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
One fine October day a mathematics teacher Vasily Petrov went to a class and saw there *n* pupils who sat at the desks, two people at each desk. Vasily quickly realized that number *n* is even. Like all true mathematicians, Vasily has all students numbered from 1 to *n*.
But Vasily Petrov did not like the way the children were seated at the desks. According to him, the students whose numbers differ by 1, can not sit together, as they talk to each other all the time, distract others and misbehave.
On the other hand, if a righthanded student sits at the left end of the desk and a lefthanded student sits at the right end of the desk, they hit elbows all the time and distract each other. In other cases, the students who sit at the same desk, do not interfere with each other.
Vasily knows very well which students are lefthanders and which ones are righthanders, and he asks you to come up with any order that meets these two uncomplicated conditions (students do not talk to each other and do not bump their elbows). It is guaranteed that the input is such that at least one way to seat the students always exists.
|
The first input line contains a single even integer *n* (4<=≤<=*n*<=≤<=100) — the number of students in the class. The second line contains exactly *n* capital English letters "L" and "R". If the *i*-th letter at the second line equals "L", then the student number *i* is a lefthander, otherwise he is a righthander.
|
Print integer pairs, one pair per line. In the *i*-th line print the numbers of students that will sit at the *i*-th desk. The first number in the pair stands for the student who is sitting to the left, and the second number stands for the student who is sitting to the right. Separate the numbers in the pairs by spaces. If there are multiple solutions, print any of them.
|
[
"6\nLLRLLL\n",
"4\nRRLL\n"
] |
[
"1 4\n2 5\n6 3\n",
"3 1\n4 2\n"
] |
none
| 0
|
[
{
"input": "6\nLLRLLL",
"output": "1 4\n2 5\n6 3"
},
{
"input": "4\nRRLL",
"output": "3 1\n4 2"
},
{
"input": "4\nLLRR",
"output": "1 3\n2 4"
},
{
"input": "6\nRLLRRL",
"output": "1 4\n2 5\n3 6"
},
{
"input": "8\nLRLRLLLR",
"output": "1 5\n6 2\n3 7\n4 8"
},
{
"input": "10\nRLLRLRRRLL",
"output": "1 6\n2 7\n3 8\n9 4\n5 10"
},
{
"input": "12\nLRRRRRLRRRRL",
"output": "1 7\n2 8\n3 9\n4 10\n5 11\n12 6"
},
{
"input": "14\nRLLRLLLLRLLLRL",
"output": "8 1\n2 9\n3 10\n11 4\n5 12\n6 13\n7 14"
},
{
"input": "16\nLLLRRRLRRLLRRLLL",
"output": "1 9\n2 10\n3 11\n4 12\n5 13\n14 6\n7 15\n16 8"
},
{
"input": "18\nRRRLLLLRRRLRLRLLRL",
"output": "1 10\n11 2\n3 12\n4 13\n5 14\n6 15\n7 16\n8 17\n18 9"
},
{
"input": "20\nRLRLLRLRRLLRRRRRRLRL",
"output": "11 1\n2 12\n3 13\n4 14\n5 15\n6 16\n7 17\n18 8\n9 19\n10 20"
},
{
"input": "22\nRLLLRLLLRRLRRRLRLLLLLL",
"output": "1 12\n2 13\n3 14\n4 15\n5 16\n6 17\n7 18\n8 19\n20 9\n21 10\n11 22"
},
{
"input": "24\nLRRRLRLLRLRRRRLLLLRRLRLR",
"output": "1 13\n2 14\n15 3\n16 4\n5 17\n18 6\n7 19\n8 20\n21 9\n10 22\n23 11\n12 24"
},
{
"input": "26\nRLRRLLRRLLRLRRLLRLLRRLRLRR",
"output": "1 14\n2 15\n16 3\n4 17\n5 18\n6 19\n7 20\n8 21\n9 22\n10 23\n24 11\n12 25\n13 26"
},
{
"input": "28\nLLLRRRRRLRRLRRRLRLRLRRLRLRRL",
"output": "1 15\n2 16\n3 17\n18 4\n5 19\n20 6\n7 21\n8 22\n9 23\n10 24\n25 11\n12 26\n13 27\n28 14"
},
{
"input": "30\nLRLLRLRRLLRLRLLRRRRRLRLRLRLLLL",
"output": "1 16\n2 17\n3 18\n4 19\n5 20\n6 21\n7 22\n23 8\n9 24\n10 25\n11 26\n12 27\n28 13\n14 29\n15 30"
},
{
"input": "32\nRLRLLRRLLRRLRLLRLRLRLLRLRRRLLRRR",
"output": "17 1\n2 18\n19 3\n4 20\n5 21\n22 6\n7 23\n8 24\n9 25\n10 26\n11 27\n12 28\n29 13\n14 30\n15 31\n16 32"
},
{
"input": "34\nLRRLRLRLLRRRRLLRLRRLRRLRLRRLRRRLLR",
"output": "1 18\n2 19\n20 3\n4 21\n5 22\n6 23\n7 24\n8 25\n9 26\n10 27\n28 11\n12 29\n13 30\n14 31\n15 32\n33 16\n17 34"
},
{
"input": "36\nRRLLLRRRLLLRRLLLRRLLRLLRLRLLRLRLRLLL",
"output": "19 1\n20 2\n3 21\n4 22\n5 23\n6 24\n25 7\n8 26\n9 27\n10 28\n11 29\n30 12\n13 31\n14 32\n15 33\n16 34\n35 17\n36 18"
},
{
"input": "38\nLLRRRLLRRRLRRLRLRRLRRLRLRLLRRRRLLLLRLL",
"output": "1 20\n2 21\n22 3\n4 23\n24 5\n6 25\n7 26\n27 8\n9 28\n10 29\n11 30\n12 31\n32 13\n14 33\n34 15\n16 35\n17 36\n37 18\n19 38"
},
{
"input": "40\nLRRRRRLRLLRRRLLRRLRLLRLRRLRRLLLRRLRRRLLL",
"output": "1 21\n2 22\n23 3\n4 24\n5 25\n26 6\n7 27\n8 28\n9 29\n10 30\n31 11\n12 32\n13 33\n14 34\n15 35\n16 36\n17 37\n18 38\n39 19\n20 40"
},
{
"input": "42\nRLRRLLLLLLLRRRLRLLLRRRLRLLLRLRLRLLLRLRLRRR",
"output": "1 22\n2 23\n3 24\n25 4\n5 26\n6 27\n7 28\n8 29\n9 30\n10 31\n11 32\n33 12\n34 13\n35 14\n15 36\n37 16\n17 38\n18 39\n19 40\n20 41\n21 42"
},
{
"input": "44\nLLLLRRLLRRLLRRLRLLRRRLRLRLLRLRLRRLLRLRRLLLRR",
"output": "1 23\n2 24\n3 25\n4 26\n27 5\n6 28\n7 29\n8 30\n31 9\n10 32\n11 33\n12 34\n35 13\n14 36\n15 37\n16 38\n17 39\n18 40\n41 19\n42 20\n21 43\n22 44"
},
{
"input": "46\nRRRLLLLRRLRLRRRRRLRLLRLRRLRLLLLLLLLRRLRLRLRLLL",
"output": "1 24\n2 25\n26 3\n4 27\n5 28\n6 29\n7 30\n31 8\n32 9\n10 33\n34 11\n12 35\n13 36\n14 37\n38 15\n16 39\n40 17\n18 41\n42 19\n20 43\n21 44\n45 22\n23 46"
},
{
"input": "48\nLLLLRRLRRRRLRRRLRLLLLLRRLLRLLRLLRRLRRLLRLRLRRRRL",
"output": "1 25\n2 26\n3 27\n4 28\n29 5\n6 30\n7 31\n32 8\n9 33\n10 34\n35 11\n12 36\n13 37\n38 14\n39 15\n16 40\n41 17\n18 42\n19 43\n20 44\n21 45\n22 46\n23 47\n48 24"
},
{
"input": "50\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "1 26\n2 27\n3 28\n4 29\n5 30\n6 31\n7 32\n8 33\n9 34\n10 35\n11 36\n12 37\n13 38\n14 39\n15 40\n16 41\n17 42\n18 43\n19 44\n20 45\n21 46\n22 47\n23 48\n24 49\n25 50"
},
{
"input": "52\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL",
"output": "1 27\n2 28\n3 29\n4 30\n5 31\n6 32\n7 33\n8 34\n9 35\n10 36\n11 37\n12 38\n13 39\n14 40\n15 41\n16 42\n17 43\n18 44\n19 45\n20 46\n21 47\n22 48\n23 49\n24 50\n25 51\n26 52"
},
{
"input": "54\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "1 28\n2 29\n3 30\n4 31\n5 32\n6 33\n7 34\n8 35\n9 36\n10 37\n11 38\n12 39\n13 40\n14 41\n15 42\n16 43\n17 44\n18 45\n19 46\n20 47\n21 48\n22 49\n23 50\n24 51\n25 52\n26 53\n27 54"
},
{
"input": "56\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL",
"output": "1 29\n2 30\n3 31\n4 32\n5 33\n6 34\n7 35\n8 36\n9 37\n10 38\n11 39\n12 40\n13 41\n14 42\n15 43\n16 44\n17 45\n18 46\n19 47\n20 48\n21 49\n22 50\n23 51\n24 52\n25 53\n26 54\n27 55\n28 56"
},
{
"input": "58\nRRRLLLRLLLLRRLRRRLLRLLRLRLLRLRRRRLLLLLLRLRRLRLRRRLRLRRLRRL",
"output": "1 30\n2 31\n3 32\n4 33\n5 34\n6 35\n36 7\n8 37\n9 38\n10 39\n11 40\n41 12\n13 42\n14 43\n44 15\n16 45\n46 17\n18 47\n19 48\n20 49\n21 50\n22 51\n52 23\n24 53\n25 54\n26 55\n27 56\n28 57\n29 58"
},
{
"input": "60\nRLLLLRRLLRRRLLLLRRRRRLRRRLRRRLLLRLLLRLRRRLRLLLRLLRRLLRRRRRLL",
"output": "31 1\n2 32\n3 33\n4 34\n5 35\n36 6\n7 37\n8 38\n9 39\n10 40\n11 41\n42 12\n13 43\n14 44\n15 45\n16 46\n17 47\n48 18\n49 19\n20 50\n21 51\n22 52\n53 23\n24 54\n25 55\n26 56\n27 57\n28 58\n59 29\n30 60"
},
{
"input": "62\nLRRLRLRLLLLRRLLLLRRRLRLLLLRRRLLLLLLRRRLLLLRRLRRLRLLLLLLLLRRLRR",
"output": "1 32\n33 2\n34 3\n4 35\n5 36\n6 37\n7 38\n8 39\n9 40\n10 41\n11 42\n12 43\n13 44\n14 45\n15 46\n16 47\n17 48\n18 49\n50 19\n51 20\n21 52\n53 22\n23 54\n24 55\n25 56\n26 57\n27 58\n28 59\n60 29\n30 61\n31 62"
},
{
"input": "64\nRLLLLRRRLRLLRRRRLRLLLRRRLLLRRRLLRLLRLRLRRRLLRRRRLRLRRRLLLLRRLLLL",
"output": "1 33\n2 34\n3 35\n4 36\n5 37\n6 38\n39 7\n8 40\n9 41\n10 42\n11 43\n12 44\n13 45\n14 46\n15 47\n16 48\n17 49\n18 50\n19 51\n20 52\n21 53\n22 54\n55 23\n56 24\n25 57\n26 58\n27 59\n28 60\n61 29\n62 30\n31 63\n32 64"
},
{
"input": "66\nLLRRRLLRLRLLRRRRRRRLLLLRRLLLLLLRLLLRLLLLLLRRRLRRLLRRRRRLRLLRLLLLRR",
"output": "1 34\n2 35\n3 36\n37 4\n38 5\n6 39\n7 40\n41 8\n9 42\n10 43\n11 44\n12 45\n46 13\n14 47\n15 48\n49 16\n50 17\n18 51\n19 52\n20 53\n21 54\n22 55\n23 56\n24 57\n58 25\n26 59\n27 60\n28 61\n29 62\n30 63\n31 64\n32 65\n33 66"
},
{
"input": "68\nRRLRLRLLRLRLRRRRRRLRRRLLLLRLLRLRLRLRRRRLRLRLLRRRRLRRLLRLRRLLRLRRLRRL",
"output": "35 1\n2 36\n3 37\n4 38\n5 39\n40 6\n7 41\n8 42\n9 43\n10 44\n45 11\n12 46\n13 47\n14 48\n15 49\n50 16\n17 51\n18 52\n19 53\n54 20\n21 55\n56 22\n23 57\n24 58\n25 59\n26 60\n27 61\n28 62\n29 63\n30 64\n31 65\n32 66\n33 67\n68 34"
},
{
"input": "70\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "1 36\n2 37\n3 38\n4 39\n5 40\n6 41\n7 42\n8 43\n9 44\n10 45\n11 46\n12 47\n13 48\n14 49\n15 50\n16 51\n17 52\n18 53\n19 54\n20 55\n21 56\n22 57\n23 58\n24 59\n25 60\n26 61\n27 62\n28 63\n29 64\n30 65\n31 66\n32 67\n33 68\n34 69\n35 70"
},
{
"input": "72\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "1 37\n2 38\n3 39\n4 40\n5 41\n6 42\n7 43\n8 44\n9 45\n10 46\n11 47\n12 48\n13 49\n14 50\n15 51\n16 52\n17 53\n18 54\n19 55\n20 56\n21 57\n22 58\n23 59\n24 60\n25 61\n26 62\n27 63\n28 64\n29 65\n30 66\n31 67\n32 68\n33 69\n34 70\n35 71\n36 72"
},
{
"input": "74\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "1 38\n2 39\n3 40\n4 41\n5 42\n6 43\n7 44\n8 45\n9 46\n10 47\n11 48\n12 49\n13 50\n14 51\n15 52\n16 53\n17 54\n18 55\n19 56\n20 57\n21 58\n22 59\n23 60\n24 61\n25 62\n26 63\n27 64\n28 65\n29 66\n30 67\n31 68\n32 69\n33 70\n34 71\n35 72\n36 73\n37 74"
},
{
"input": "76\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "1 39\n2 40\n3 41\n4 42\n5 43\n6 44\n7 45\n8 46\n9 47\n10 48\n11 49\n12 50\n13 51\n14 52\n15 53\n16 54\n17 55\n18 56\n19 57\n20 58\n21 59\n22 60\n23 61\n24 62\n25 63\n26 64\n27 65\n28 66\n29 67\n30 68\n31 69\n32 70\n33 71\n34 72\n35 73\n36 74\n37 75\n38 76"
},
{
"input": "78\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "1 40\n2 41\n3 42\n4 43\n5 44\n6 45\n7 46\n8 47\n9 48\n10 49\n11 50\n12 51\n13 52\n14 53\n15 54\n16 55\n17 56\n18 57\n19 58\n20 59\n21 60\n22 61\n23 62\n24 63\n25 64\n26 65\n27 66\n28 67\n29 68\n30 69\n31 70\n32 71\n33 72\n34 73\n35 74\n36 75\n37 76\n38 77\n39 78"
},
{
"input": "80\nLRLRRRRLRRRRLLLLRLLRLRLLRRLRLLLRRLLLLRLLLRLRLLRRRLRRRLRLRRRRRLRLLRLLRRLLLRLRRRLL",
"output": "1 41\n2 42\n3 43\n4 44\n45 5\n46 6\n7 47\n8 48\n9 49\n50 10\n11 51\n12 52\n13 53\n14 54\n15 55\n16 56\n17 57\n18 58\n19 59\n20 60\n21 61\n62 22\n23 63\n24 64\n65 25\n26 66\n27 67\n68 28\n29 69\n30 70\n31 71\n72 32\n73 33\n34 74\n35 75\n36 76\n37 77\n38 78\n39 79\n40 80"
},
{
"input": "82\nRLRRLLRLRLRLLLRLLLRRLLRRLRRRRLLRLLLLRRRRRLLLRRRLLLLRLRRLRRRLRLLLLRRRLRLRLLLRLLLLLR",
"output": "42 1\n2 43\n44 3\n4 45\n5 46\n6 47\n48 7\n8 49\n50 9\n10 51\n11 52\n12 53\n13 54\n14 55\n56 15\n16 57\n17 58\n18 59\n60 19\n20 61\n21 62\n22 63\n64 23\n65 24\n25 66\n26 67\n27 68\n69 28\n29 70\n30 71\n31 72\n73 32\n33 74\n34 75\n35 76\n36 77\n78 37\n79 38\n80 39\n81 40\n41 82"
},
{
"input": "84\nLRLRRRRRRLLLRLRLLLLLRRLRLRLRRRLLRLLLRLRLLLRRRLRLRRLRLRLLLLLLLLRRRRRRLLLRRLRLRLLLRLRR",
"output": "1 43\n2 44\n3 45\n46 4\n5 47\n48 6\n7 49\n8 50\n51 9\n10 52\n11 53\n12 54\n55 13\n14 56\n57 15\n16 58\n17 59\n18 60\n19 61\n20 62\n21 63\n22 64\n23 65\n24 66\n25 67\n26 68\n27 69\n70 28\n71 29\n30 72\n31 73\n32 74\n33 75\n34 76\n35 77\n36 78\n79 37\n38 80\n39 81\n40 82\n41 83\n42 84"
},
{
"input": "86\nRRRLLLRLLRLLRLRLRLLLRLRLRRLLRLLLRLLLLLLRRRLRLLRLLLRRRLRLLLLRLLRLRRLLRLLLRRRLLRLRLLRLLR",
"output": "1 44\n45 2\n46 3\n4 47\n5 48\n6 49\n50 7\n8 51\n9 52\n10 53\n11 54\n12 55\n56 13\n14 57\n58 15\n16 59\n17 60\n18 61\n19 62\n20 63\n64 21\n22 65\n23 66\n24 67\n68 25\n26 69\n27 70\n28 71\n72 29\n30 73\n31 74\n32 75\n76 33\n34 77\n35 78\n36 79\n37 80\n38 81\n39 82\n40 83\n84 41\n85 42\n43 86"
},
{
"input": "88\nLLRLRLRLLLLRRRRRRLRRLLLLLRRLRRLLLLLRLRLRLLLLLRLRLRRLRLRRLRLLRRLRLLLRLLLLRRLLRRLRLRLRRLRR",
"output": "1 45\n2 46\n47 3\n4 48\n49 5\n6 50\n7 51\n8 52\n9 53\n10 54\n11 55\n12 56\n57 13\n14 58\n59 15\n60 16\n17 61\n18 62\n63 19\n20 64\n21 65\n22 66\n23 67\n24 68\n25 69\n70 26\n71 27\n28 72\n29 73\n30 74\n31 75\n32 76\n33 77\n34 78\n35 79\n36 80\n37 81\n38 82\n39 83\n40 84\n41 85\n42 86\n43 87\n44 88"
},
{
"input": "90\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL",
"output": "1 46\n2 47\n3 48\n4 49\n5 50\n6 51\n7 52\n8 53\n9 54\n10 55\n11 56\n12 57\n13 58\n14 59\n15 60\n16 61\n17 62\n18 63\n19 64\n20 65\n21 66\n22 67\n23 68\n24 69\n25 70\n26 71\n27 72\n28 73\n29 74\n30 75\n31 76\n32 77\n33 78\n34 79\n35 80\n36 81\n37 82\n38 83\n39 84\n40 85\n41 86\n42 87\n43 88\n44 89\n45 90"
},
{
"input": "92\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL",
"output": "1 47\n2 48\n3 49\n4 50\n5 51\n6 52\n7 53\n8 54\n9 55\n10 56\n11 57\n12 58\n13 59\n14 60\n15 61\n16 62\n17 63\n18 64\n19 65\n20 66\n21 67\n22 68\n23 69\n24 70\n25 71\n26 72\n27 73\n28 74\n29 75\n30 76\n31 77\n32 78\n33 79\n34 80\n35 81\n36 82\n37 83\n38 84\n39 85\n40 86\n41 87\n42 88\n43 89\n44 90\n45 91\n46 92"
},
{
"input": "94\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL",
"output": "1 48\n2 49\n3 50\n4 51\n5 52\n6 53\n7 54\n8 55\n9 56\n10 57\n11 58\n12 59\n13 60\n14 61\n15 62\n16 63\n17 64\n18 65\n19 66\n20 67\n21 68\n22 69\n23 70\n24 71\n25 72\n26 73\n27 74\n28 75\n29 76\n30 77\n31 78\n32 79\n33 80\n34 81\n35 82\n36 83\n37 84\n38 85\n39 86\n40 87\n41 88\n42 89\n43 90\n44 91\n45 92\n46 93\n47 94"
},
{
"input": "96\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL",
"output": "1 49\n2 50\n3 51\n4 52\n5 53\n6 54\n7 55\n8 56\n9 57\n10 58\n11 59\n12 60\n13 61\n14 62\n15 63\n16 64\n17 65\n18 66\n19 67\n20 68\n21 69\n22 70\n23 71\n24 72\n25 73\n26 74\n27 75\n28 76\n29 77\n30 78\n31 79\n32 80\n33 81\n34 82\n35 83\n36 84\n37 85\n38 86\n39 87\n40 88\n41 89\n42 90\n43 91\n44 92\n45 93\n46 94\n47 95\n48 96"
},
{
"input": "98\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL",
"output": "1 50\n2 51\n3 52\n4 53\n5 54\n6 55\n7 56\n8 57\n9 58\n10 59\n11 60\n12 61\n13 62\n14 63\n15 64\n16 65\n17 66\n18 67\n19 68\n20 69\n21 70\n22 71\n23 72\n24 73\n25 74\n26 75\n27 76\n28 77\n29 78\n30 79\n31 80\n32 81\n33 82\n34 83\n35 84\n36 85\n37 86\n38 87\n39 88\n40 89\n41 90\n42 91\n43 92\n44 93\n45 94\n46 95\n47 96\n48 97\n49 98"
},
{
"input": "100\nRLRRRRLLLLRRRRLRRRRRRRRLRLRRLLRRRRRRRRLRRRRLLLLRRRRLRRLRLRRRLLRRLRRLLLRLRRLLLLLLRLRLRLRRLRLRLRRRLLLR",
"output": "1 51\n2 52\n3 53\n4 54\n55 5\n6 56\n7 57\n8 58\n9 59\n10 60\n61 11\n62 12\n13 63\n14 64\n15 65\n16 66\n17 67\n68 18\n69 19\n70 20\n21 71\n72 22\n23 73\n24 74\n75 25\n26 76\n77 27\n78 28\n29 79\n30 80\n31 81\n82 32\n33 83\n84 34\n35 85\n86 36\n37 87\n38 88\n39 89\n40 90\n91 41\n42 92\n93 43\n44 94\n45 95\n46 96\n47 97\n98 48\n99 49\n50 100"
},
{
"input": "100\nLRLLLLRLLLLRRRRRLRRRRLRRLRRLRLLRRLRRRRLLRRRLLLRLLLRRRRLLRLRLRRLRLLRRLLRRLRRLRRRRRLRRLRLRLRLLLLLLLLRL",
"output": "1 51\n2 52\n3 53\n4 54\n5 55\n6 56\n7 57\n8 58\n9 59\n10 60\n11 61\n12 62\n63 13\n14 64\n65 15\n66 16\n17 67\n18 68\n69 19\n70 20\n21 71\n22 72\n73 23\n24 74\n25 75\n76 26\n27 77\n28 78\n29 79\n30 80\n31 81\n82 32\n33 83\n34 84\n85 35\n36 86\n87 37\n38 88\n39 89\n40 90\n91 41\n92 42\n93 43\n44 94\n45 95\n46 96\n97 47\n48 98\n49 99\n50 100"
},
{
"input": "100\nLLLRRLLRLRLLLRLLLRLRLLRRRLRRLLLRLRLRRLLRLRRRLLLRRLLRLLRRLLRRRRRLRLRRLRLRRLRLRRLLRLRLLRLLLRLLRLLLLRLL",
"output": "1 51\n2 52\n3 53\n54 4\n5 55\n6 56\n7 57\n58 8\n9 59\n10 60\n11 61\n12 62\n13 63\n64 14\n15 65\n16 66\n17 67\n18 68\n19 69\n20 70\n21 71\n22 72\n23 73\n74 24\n25 75\n26 76\n27 77\n28 78\n29 79\n30 80\n31 81\n82 32\n33 83\n84 34\n35 85\n36 86\n87 37\n38 88\n39 89\n40 90\n41 91\n92 42\n43 93\n94 44\n45 95\n46 96\n47 97\n48 98\n99 49\n50 100"
},
{
"input": "100\nRLLLLRRLLLLRRRRLLRLRRRLLLRLLRLLLLLRRLLLLLLRRLRRRRRLRLLRLRRRLLLRLRLRLLLRRRLLLLLRRRRRLRRLLLLRLLLRRLLLL",
"output": "51 1\n2 52\n3 53\n4 54\n5 55\n56 6\n7 57\n8 58\n9 59\n10 60\n11 61\n62 12\n13 63\n64 14\n15 65\n16 66\n17 67\n68 18\n19 69\n70 20\n21 71\n22 72\n23 73\n24 74\n25 75\n76 26\n27 77\n28 78\n29 79\n30 80\n31 81\n32 82\n33 83\n34 84\n35 85\n36 86\n37 87\n38 88\n39 89\n40 90\n41 91\n42 92\n93 43\n94 44\n45 95\n46 96\n97 47\n98 48\n99 49\n100 50"
},
{
"input": "100\nRLRRLRLRRLRLLRLLRRRLRRLLLLLRLRLRRRRRRRLLRRRLLRLRLLLRRRLLRRRLLRLRLLLLRRLRLLRLLRLLLLRRLRLRRLRLLLLRLRRR",
"output": "51 1\n2 52\n3 53\n4 54\n5 55\n56 6\n7 57\n8 58\n9 59\n10 60\n61 11\n12 62\n13 63\n14 64\n15 65\n16 66\n67 17\n68 18\n19 69\n20 70\n71 21\n22 72\n23 73\n24 74\n25 75\n26 76\n27 77\n28 78\n29 79\n80 30\n31 81\n82 32\n33 83\n34 84\n85 35\n36 86\n87 37\n38 88\n39 89\n40 90\n41 91\n92 42\n93 43\n44 94\n45 95\n46 96\n47 97\n48 98\n49 99\n50 100"
},
{
"input": "100\nLRRLRLRRRRRRLRRLRRLLLLLLRRLLRRLLRLLLLLLRRRLLRLRRRLLRLLRRLRRRLLRLRLLRRLRRRLLLRRRRLLRRRLLLRRRRRLLLLLLR",
"output": "1 51\n2 52\n53 3\n4 54\n5 55\n6 56\n57 7\n8 58\n9 59\n10 60\n61 11\n62 12\n13 63\n64 14\n15 65\n16 66\n67 17\n18 68\n19 69\n20 70\n21 71\n22 72\n23 73\n24 74\n75 25\n76 26\n27 77\n28 78\n29 79\n30 80\n31 81\n32 82\n33 83\n34 84\n35 85\n36 86\n37 87\n38 88\n39 89\n40 90\n41 91\n42 92\n43 93\n44 94\n95 45\n46 96\n97 47\n98 48\n99 49\n50 100"
},
{
"input": "100\nRRLRRLRLRLRRRRLLRRLLRLRRLLRRRLLRLRRLRLRRLLLRRLLRRRRRRLLLRRRLLRRLLLLLLRLLLLLLRLLLRRRLRLLRRRRRLLRLLRRR",
"output": "1 51\n2 52\n3 53\n54 4\n55 5\n6 56\n7 57\n8 58\n9 59\n10 60\n61 11\n12 62\n13 63\n64 14\n15 65\n16 66\n67 17\n68 18\n19 69\n20 70\n71 21\n22 72\n73 23\n74 24\n25 75\n26 76\n27 77\n78 28\n79 29\n30 80\n31 81\n32 82\n33 83\n84 34\n35 85\n36 86\n87 37\n38 88\n39 89\n40 90\n41 91\n42 92\n43 93\n94 44\n45 95\n46 96\n47 97\n48 98\n49 99\n50 100"
},
{
"input": "100\nRRLLLRLRRLRLLRRLRRRLLRRRLRRLLLLLLLLLRRRLLRLRRLRRLRRLRRLRLLLLRLLRRRLLLLRLRRRLLRRRRLRRLLRRRRLRRRLRLLLR",
"output": "1 51\n52 2\n3 53\n4 54\n5 55\n6 56\n7 57\n58 8\n59 9\n10 60\n11 61\n12 62\n13 63\n14 64\n15 65\n16 66\n67 17\n68 18\n69 19\n20 70\n21 71\n72 22\n23 73\n24 74\n25 75\n76 26\n77 27\n28 78\n29 79\n30 80\n31 81\n32 82\n33 83\n34 84\n35 85\n36 86\n37 87\n38 88\n39 89\n40 90\n41 91\n42 92\n43 93\n44 94\n95 45\n46 96\n97 47\n98 48\n49 99\n50 100"
},
{
"input": "100\nLLLLLRRLRRRRRRRLLRRRRRLRRLRLRLLRLRRLLLRRRRLLRRLRLLRLLLRLRLLRRRRRRRRRLRLLLRLRLLLLLRLRRRRLRLLRLRLRLRRL",
"output": "1 51\n2 52\n3 53\n4 54\n5 55\n56 6\n7 57\n8 58\n59 9\n10 60\n11 61\n12 62\n13 63\n14 64\n15 65\n16 66\n17 67\n18 68\n69 19\n20 70\n71 21\n72 22\n23 73\n24 74\n75 25\n26 76\n77 27\n28 78\n79 29\n30 80\n31 81\n32 82\n33 83\n34 84\n35 85\n36 86\n37 87\n38 88\n39 89\n90 40\n91 41\n42 92\n43 93\n44 94\n95 45\n46 96\n47 97\n48 98\n49 99\n50 100"
},
{
"input": "100\nLLRRRLLLRLLLLRLRLRLRRRLLLRRRLRLLRLLLRRRRRLRRLRRLRRRLRRLRRLLLRLRLLRRRRLRLRRRRRLRRLRLLRRRRLLLRRRRRLLLL",
"output": "1 51\n2 52\n3 53\n4 54\n55 5\n6 56\n7 57\n8 58\n59 9\n10 60\n11 61\n12 62\n13 63\n64 14\n15 65\n16 66\n17 67\n18 68\n19 69\n70 20\n21 71\n72 22\n23 73\n24 74\n25 75\n26 76\n27 77\n78 28\n29 79\n30 80\n31 81\n32 82\n83 33\n34 84\n35 85\n36 86\n37 87\n38 88\n89 39\n90 40\n91 41\n42 92\n43 93\n44 94\n45 95\n46 96\n97 47\n48 98\n99 49\n100 50"
}
] | 1,620,675,945
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 46
| 6,656,000
|
with open("input.txt","r") as file:
with open("output.txt","w") as file2:
N = file.readline()
N = int(N)
n = int(N/2)
S = file.readline()
S = str(S)
for i in range(0,n):
if S[i] == "R" and S[i+n] =="L":
file2.write(i+n+1,i+1)
else:
file2.write(i+1,i+n+1)
|
Title: Lefthanders and Righthanders
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One fine October day a mathematics teacher Vasily Petrov went to a class and saw there *n* pupils who sat at the desks, two people at each desk. Vasily quickly realized that number *n* is even. Like all true mathematicians, Vasily has all students numbered from 1 to *n*.
But Vasily Petrov did not like the way the children were seated at the desks. According to him, the students whose numbers differ by 1, can not sit together, as they talk to each other all the time, distract others and misbehave.
On the other hand, if a righthanded student sits at the left end of the desk and a lefthanded student sits at the right end of the desk, they hit elbows all the time and distract each other. In other cases, the students who sit at the same desk, do not interfere with each other.
Vasily knows very well which students are lefthanders and which ones are righthanders, and he asks you to come up with any order that meets these two uncomplicated conditions (students do not talk to each other and do not bump their elbows). It is guaranteed that the input is such that at least one way to seat the students always exists.
Input Specification:
The first input line contains a single even integer *n* (4<=≤<=*n*<=≤<=100) — the number of students in the class. The second line contains exactly *n* capital English letters "L" and "R". If the *i*-th letter at the second line equals "L", then the student number *i* is a lefthander, otherwise he is a righthander.
Output Specification:
Print integer pairs, one pair per line. In the *i*-th line print the numbers of students that will sit at the *i*-th desk. The first number in the pair stands for the student who is sitting to the left, and the second number stands for the student who is sitting to the right. Separate the numbers in the pairs by spaces. If there are multiple solutions, print any of them.
Demo Input:
['6\nLLRLLL\n', '4\nRRLL\n']
Demo Output:
['1 4\n2 5\n6 3\n', '3 1\n4 2\n']
Note:
none
|
```python
with open("input.txt","r") as file:
with open("output.txt","w") as file2:
N = file.readline()
N = int(N)
n = int(N/2)
S = file.readline()
S = str(S)
for i in range(0,n):
if S[i] == "R" and S[i+n] =="L":
file2.write(i+n+1,i+1)
else:
file2.write(i+1,i+n+1)
```
| -1
|
|
382
|
A
|
Ksenia and Pan Scales
|
PROGRAMMING
| 1,100
|
[
"greedy",
"implementation"
] | null | null |
Ksenia has ordinary pan scales and several weights of an equal mass. Ksenia has already put some weights on the scales, while other weights are untouched. Ksenia is now wondering whether it is possible to put all the remaining weights on the scales so that the scales were in equilibrium.
The scales is in equilibrium if the total sum of weights on the left pan is equal to the total sum of weights on the right pan.
|
The first line has a non-empty sequence of characters describing the scales. In this sequence, an uppercase English letter indicates a weight, and the symbol "|" indicates the delimiter (the character occurs in the sequence exactly once). All weights that are recorded in the sequence before the delimiter are initially on the left pan of the scale. All weights that are recorded in the sequence after the delimiter are initially on the right pan of the scale.
The second line contains a non-empty sequence containing uppercase English letters. Each letter indicates a weight which is not used yet.
It is guaranteed that all the English letters in the input data are different. It is guaranteed that the input does not contain any extra characters.
|
If you cannot put all the weights on the scales so that the scales were in equilibrium, print string "Impossible". Otherwise, print the description of the resulting scales, copy the format of the input.
If there are multiple answers, print any of them.
|
[
"AC|T\nL\n",
"|ABC\nXYZ\n",
"W|T\nF\n",
"ABC|\nD\n"
] |
[
"AC|TL\n",
"XYZ|ABC\n",
"Impossible\n",
"Impossible\n"
] |
none
| 500
|
[
{
"input": "AC|T\nL",
"output": "AC|TL"
},
{
"input": "|ABC\nXYZ",
"output": "XYZ|ABC"
},
{
"input": "W|T\nF",
"output": "Impossible"
},
{
"input": "ABC|\nD",
"output": "Impossible"
},
{
"input": "A|BC\nDEF",
"output": "ADF|BCE"
},
{
"input": "|\nABC",
"output": "Impossible"
},
{
"input": "|\nZXCVBANMIO",
"output": "XVAMO|ZCBNI"
},
{
"input": "|C\nA",
"output": "A|C"
},
{
"input": "|\nAB",
"output": "B|A"
},
{
"input": "A|XYZ\nUIOPL",
"output": "Impossible"
},
{
"input": "K|B\nY",
"output": "Impossible"
},
{
"input": "EQJWDOHKZRBISPLXUYVCMNFGT|\nA",
"output": "Impossible"
},
{
"input": "|MACKERIGZPVHNDYXJBUFLWSO\nQT",
"output": "Impossible"
},
{
"input": "ERACGIZOVPT|WXUYMDLJNQS\nKB",
"output": "ERACGIZOVPTB|WXUYMDLJNQSK"
},
{
"input": "CKQHRUZMISGE|FBVWPXDLTJYN\nOA",
"output": "CKQHRUZMISGEA|FBVWPXDLTJYNO"
},
{
"input": "V|CMOEUTAXBFWSK\nDLRZJGIYNQHP",
"output": "VDLRZJGIYNQHP|CMOEUTAXBFWSK"
},
{
"input": "QWHNMALDGKTJ|\nPBRYVXZUESCOIF",
"output": "QWHNMALDGKTJF|PBRYVXZUESCOI"
},
{
"input": "|\nFXCVMUEWZAHNDOSITPRLKQJYBG",
"output": "XVUWANOIPLQYG|FCMEZHDSTRKJB"
},
{
"input": "IB|PCGHZ\nFXWTJQNEKAUM",
"output": "Impossible"
},
{
"input": "EC|IWAXQ\nJUHSRKGZTOMYN",
"output": "ECJUHRGTMN|IWAXQSKZOY"
},
{
"input": "VDINYMA|UQKWBCLRHZJ\nXEGOF",
"output": "Impossible"
},
{
"input": "ZLTPSIQUBAR|XFDEMYC\nHNOJWG",
"output": "ZLTPSIQUBARG|XFDEMYCHNOJW"
},
{
"input": "R|FLZOTJNU\nGIYHKVX",
"output": "RGIYHKVX|FLZOTJNU"
},
{
"input": "W|TL\nQROFSADYPKHEJNMXBZVUCIG",
"output": "WQOSDPHJMBVCG|TLRFAYKENXZUI"
},
{
"input": "NRDFQSEKLAYMOT|ZH\nGUXIBJCVPW",
"output": "Impossible"
},
{
"input": "FGRT|\nAC",
"output": "Impossible"
},
{
"input": "|FGRT\nAC",
"output": "Impossible"
},
{
"input": "A|\nB",
"output": "A|B"
},
{
"input": "|A\nB",
"output": "B|A"
},
{
"input": "|\nA",
"output": "Impossible"
},
{
"input": "|\nQWERTYUIOPASDFGHJKLZXCVBNM",
"output": "WRYIPSFHKZCBM|QETUOADGJLXVN"
},
{
"input": "QWERTYUIOPASDFGHJKLZXCVBN|\nM",
"output": "Impossible"
},
{
"input": "QWERTY|VBN\nUIOPASDFGHJKLZXC",
"output": "Impossible"
},
{
"input": "ABC|D\nKSL",
"output": "Impossible"
},
{
"input": "A|BCDEF\nGH",
"output": "Impossible"
},
{
"input": "|ABC\nD",
"output": "Impossible"
},
{
"input": "A|BC\nDE",
"output": "Impossible"
},
{
"input": "|ASD\nX",
"output": "Impossible"
},
{
"input": "AB|CDEF\nXYZRT",
"output": "Impossible"
}
] | 1,569,907,982
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 93
| 0
|
x = input()
y = input()
left, right = x.split('|')
for i in y:
if(len(left) < len(right)):
left+=i
else:
right+=i
if(len(left)==len(right)):
print("{}|{}".format(left, right))
else:
print("Immpossible")
|
Title: Ksenia and Pan Scales
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ksenia has ordinary pan scales and several weights of an equal mass. Ksenia has already put some weights on the scales, while other weights are untouched. Ksenia is now wondering whether it is possible to put all the remaining weights on the scales so that the scales were in equilibrium.
The scales is in equilibrium if the total sum of weights on the left pan is equal to the total sum of weights on the right pan.
Input Specification:
The first line has a non-empty sequence of characters describing the scales. In this sequence, an uppercase English letter indicates a weight, and the symbol "|" indicates the delimiter (the character occurs in the sequence exactly once). All weights that are recorded in the sequence before the delimiter are initially on the left pan of the scale. All weights that are recorded in the sequence after the delimiter are initially on the right pan of the scale.
The second line contains a non-empty sequence containing uppercase English letters. Each letter indicates a weight which is not used yet.
It is guaranteed that all the English letters in the input data are different. It is guaranteed that the input does not contain any extra characters.
Output Specification:
If you cannot put all the weights on the scales so that the scales were in equilibrium, print string "Impossible". Otherwise, print the description of the resulting scales, copy the format of the input.
If there are multiple answers, print any of them.
Demo Input:
['AC|T\nL\n', '|ABC\nXYZ\n', 'W|T\nF\n', 'ABC|\nD\n']
Demo Output:
['AC|TL\n', 'XYZ|ABC\n', 'Impossible\n', 'Impossible\n']
Note:
none
|
```python
x = input()
y = input()
left, right = x.split('|')
for i in y:
if(len(left) < len(right)):
left+=i
else:
right+=i
if(len(left)==len(right)):
print("{}|{}".format(left, right))
else:
print("Immpossible")
```
| 0
|
|
676
|
C
|
Vasya and String
|
PROGRAMMING
| 1,500
|
[
"binary search",
"dp",
"strings",
"two pointers"
] | null | null |
High school student Vasya got a string of length *n* as a birthday present. This string consists of letters 'a' and 'b' only. Vasya denotes beauty of the string as the maximum length of a substring (consecutive subsequence) consisting of equal letters.
Vasya can change no more than *k* characters of the original string. What is the maximum beauty of the string he can achieve?
|
The first line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100<=000,<=0<=≤<=*k*<=≤<=*n*) — the length of the string and the maximum number of characters to change.
The second line contains the string, consisting of letters 'a' and 'b' only.
|
Print the only integer — the maximum beauty of the string Vasya can achieve by changing no more than *k* characters.
|
[
"4 2\nabba\n",
"8 1\naabaabaa\n"
] |
[
"4\n",
"5\n"
] |
In the first sample, Vasya can obtain both strings "aaaa" and "bbbb".
In the second sample, the optimal answer is obtained with the string "aaaaabaa" or with the string "aabaaaaa".
| 1,500
|
[
{
"input": "4 2\nabba",
"output": "4"
},
{
"input": "8 1\naabaabaa",
"output": "5"
},
{
"input": "1 0\na",
"output": "1"
},
{
"input": "1 1\nb",
"output": "1"
},
{
"input": "1 0\nb",
"output": "1"
},
{
"input": "1 1\na",
"output": "1"
},
{
"input": "10 10\nbbbbbbbbbb",
"output": "10"
},
{
"input": "10 2\nbbbbbbbbbb",
"output": "10"
},
{
"input": "10 1\nbbabbabbba",
"output": "6"
},
{
"input": "10 10\nbbabbbaabb",
"output": "10"
},
{
"input": "10 9\nbabababbba",
"output": "10"
},
{
"input": "10 4\nbababbaaab",
"output": "9"
},
{
"input": "10 10\naabaaabaaa",
"output": "10"
},
{
"input": "10 10\naaaabbbaaa",
"output": "10"
},
{
"input": "10 1\nbaaaaaaaab",
"output": "9"
},
{
"input": "10 5\naaaaabaaaa",
"output": "10"
},
{
"input": "10 4\naaaaaaaaaa",
"output": "10"
},
{
"input": "100 10\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "100"
},
{
"input": "100 7\nbbbbabbbbbaabbbabbbbbbbbbbbabbbbbbbbbbbbbbbbbbbbbbbbbabbbbbbbbbbbabbabbbbbbbbbbbbbbbbbbbbbbbbbbbbbab",
"output": "93"
},
{
"input": "100 30\nbbaabaaabbbbbbbbbbaababababbbbbbaabaabbbbbbbbabbbbbabbbbabbbbbbbbaabbbbbbbbbabbbbbabbbbbbbbbaaaaabba",
"output": "100"
},
{
"input": "100 6\nbaababbbaabbabbaaabbabbaabbbbbbbbaabbbabbbbaabbabbbbbabababbbbabbbbbbabbbbbbbbbaaaabbabbbbaabbabaabb",
"output": "34"
},
{
"input": "100 45\naabababbabbbaaabbbbbbaabbbabbaabbbbbabbbbbbbbabbbbbbabbaababbaabbababbbbbbababbbbbaabbbbbbbaaaababab",
"output": "100"
},
{
"input": "100 2\nababaabababaaababbaaaabbaabbbababbbaaabbbbabababbbabababaababaaabaabbbbaaabbbabbbbbabbbbbbbaabbabbba",
"output": "17"
},
{
"input": "100 25\nbabbbaaababaaabbbaabaabaabbbabbabbbbaaaaaaabaaabaaaaaaaaaabaaaabaaabbbaaabaaababaaabaabbbbaaaaaaaaaa",
"output": "80"
},
{
"input": "100 14\naabaaaaabababbabbabaaaabbaaaabaaabbbaaabaaaaaaaabaaaaabbaaaaaaaaabaaaaaaabbaababaaaababbbbbabaaaabaa",
"output": "61"
},
{
"input": "100 8\naaaaabaaaabaabaaaaaaaabaaaabaaaaaaaaaaaaaabaaaaabaaaaaaaaaaaaaaaaabaaaababaabaaaaaaaaaaaaabbabaaaaaa",
"output": "76"
},
{
"input": "100 12\naaaaaaaaaaaaaaaabaaabaaaaaaaaaabbaaaabbabaaaaaaaaaaaaaaaaaaaaabbaaabaaaaaaaaaaaabaaaaaaaabaaaaaaaaaa",
"output": "100"
},
{
"input": "100 65\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "100"
},
{
"input": "10 0\nbbbbbbbbbb",
"output": "10"
},
{
"input": "10 0\nbbbbabbbbb",
"output": "5"
},
{
"input": "10 0\nbbabbbabba",
"output": "3"
},
{
"input": "10 0\nbaabbbbaba",
"output": "4"
},
{
"input": "10 0\naababbbbaa",
"output": "4"
},
{
"input": "10 2\nabbbbbaaba",
"output": "8"
},
{
"input": "10 0\nabbaaabaaa",
"output": "3"
},
{
"input": "10 0\naabbaaabaa",
"output": "3"
},
{
"input": "10 1\naaaaaababa",
"output": "8"
},
{
"input": "10 0\nbaaaaaaaaa",
"output": "9"
},
{
"input": "10 0\naaaaaaaaaa",
"output": "10"
},
{
"input": "100 0\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "100"
},
{
"input": "100 0\nbbbbbbbbbbabbbbaaabbbbbbbbbbbabbbabbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbabbbbbbbbbabbbbbbbbbbbbbab",
"output": "40"
},
{
"input": "100 11\nbaabbbbbababbbbabbbbbbbabbbbbbbbbbbbbbabbbbbbababbbbababbbbaaabbbbabbbbbabbbbbbbbabababbbabbbbbbbabb",
"output": "65"
},
{
"input": "100 8\nbbababbbbbaabbbaaababbbbababababbbbababbabbbabbbbbaabbbabbbababbabbbbabbbabbbbaabbbbabbbaabbbbaaaabb",
"output": "33"
},
{
"input": "100 21\nabbaaaabbbababaabbbababbbbbbbbabbaababababbbabbbaaabbaaabbbbabbabbbabbbabaababbbabbbbbabbbbbbabbbbab",
"output": "65"
},
{
"input": "100 9\nabbbaabaabaaaaaaabbabbbababbaaabbbaaabbaabaaaaabbbbbabbaabaabbbbbaaaaababbaaabbabaabaaabababbaababbb",
"output": "26"
},
{
"input": "100 5\naababababbaaaaaaaabbbabaaaabbabaaaabbaabaaaaabababbabaabaaabaaaaaaaabaababbabbaaabaabbabbaaaaabbabba",
"output": "22"
},
{
"input": "100 9\naababaabaaaaaaaaabbbaabaaaaaaabaaaaaaaaaaaaabaaabaabaabbbbabbaababbabbaaaabbababaabaababaabaaaaaaaaa",
"output": "49"
},
{
"input": "100 6\naaaaabbaaaaaaaaaaabaaaabaaaaaaaaabaaabaaaaaabaaaaaaaaaaabaabaaaabaaaaaaaaaaaaaaabaabbaaaaaaaaaaaaaaa",
"output": "56"
},
{
"input": "100 7\nabaaabaabaabaaaaaabaaaaaaaaaaaaaaaaaaaaaaaaaaaaabaaabaaaaaaabbabaaaaaaaaaaaaaaaaabaaaaaaaaaaaaaaaaba",
"output": "86"
},
{
"input": "100 0\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "100"
}
] | 1,696,234,342
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 8
| 62
| 2,867,200
|
import sys
def solve(ch, subsequences):
if len(subsequences[ch]) == 0:
return 0
start_i, end_i = subsequences[ch][0][0], subsequences[ch][0][1]
max_len = end_i - start_i + k
current_len = end_i - start_i
used_k = 0
k_list = []
ends = [end_i]
for i in range(1, len(subsequences[ch])):
next_start_i, next_end_i = subsequences[ch][i][0], subsequences[ch][i][1]
distance = next_start_i - end_i
used_k += distance
k_list.append(used_k)
if used_k > k:
while used_k > k:
used_k -= k_list.pop(0)
start_i += ends.pop(0) + distance
end_i = next_end_i
current_len = end_i - start_i + (k - used_k)
max_len = max(max_len , current_len)
return max_len
in_f = sys.stdin.read(-1).replace("\r\n", "\r")
in_f = in_f.split()
n, k = int(in_f[0]), int(in_f[1])
s = in_f[2]
last_ch = s[0]
current_subsequence = [0, 0]
subsequences = {"a": [], "b": []}
if n == 1:
subsequences[s[0]].append([0, n])
else:
for i in range(1, len(s)):
current_ch = s[i]
if current_ch != last_ch:
current_subsequence[1] = i
subsequences[last_ch].append(current_subsequence)
last_ch = current_ch
current_subsequence = [i, 0]
if i == len(s) - 1:
current_subsequence[1] = len(s)
subsequences[current_ch].append(current_subsequence)
print(min(max(solve("a", subsequences), solve("b", subsequences)), n))
|
Title: Vasya and String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
High school student Vasya got a string of length *n* as a birthday present. This string consists of letters 'a' and 'b' only. Vasya denotes beauty of the string as the maximum length of a substring (consecutive subsequence) consisting of equal letters.
Vasya can change no more than *k* characters of the original string. What is the maximum beauty of the string he can achieve?
Input Specification:
The first line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100<=000,<=0<=≤<=*k*<=≤<=*n*) — the length of the string and the maximum number of characters to change.
The second line contains the string, consisting of letters 'a' and 'b' only.
Output Specification:
Print the only integer — the maximum beauty of the string Vasya can achieve by changing no more than *k* characters.
Demo Input:
['4 2\nabba\n', '8 1\naabaabaa\n']
Demo Output:
['4\n', '5\n']
Note:
In the first sample, Vasya can obtain both strings "aaaa" and "bbbb".
In the second sample, the optimal answer is obtained with the string "aaaaabaa" or with the string "aabaaaaa".
|
```python
import sys
def solve(ch, subsequences):
if len(subsequences[ch]) == 0:
return 0
start_i, end_i = subsequences[ch][0][0], subsequences[ch][0][1]
max_len = end_i - start_i + k
current_len = end_i - start_i
used_k = 0
k_list = []
ends = [end_i]
for i in range(1, len(subsequences[ch])):
next_start_i, next_end_i = subsequences[ch][i][0], subsequences[ch][i][1]
distance = next_start_i - end_i
used_k += distance
k_list.append(used_k)
if used_k > k:
while used_k > k:
used_k -= k_list.pop(0)
start_i += ends.pop(0) + distance
end_i = next_end_i
current_len = end_i - start_i + (k - used_k)
max_len = max(max_len , current_len)
return max_len
in_f = sys.stdin.read(-1).replace("\r\n", "\r")
in_f = in_f.split()
n, k = int(in_f[0]), int(in_f[1])
s = in_f[2]
last_ch = s[0]
current_subsequence = [0, 0]
subsequences = {"a": [], "b": []}
if n == 1:
subsequences[s[0]].append([0, n])
else:
for i in range(1, len(s)):
current_ch = s[i]
if current_ch != last_ch:
current_subsequence[1] = i
subsequences[last_ch].append(current_subsequence)
last_ch = current_ch
current_subsequence = [i, 0]
if i == len(s) - 1:
current_subsequence[1] = len(s)
subsequences[current_ch].append(current_subsequence)
print(min(max(solve("a", subsequences), solve("b", subsequences)), n))
```
| -1
|
|
515
|
C
|
Drazil and Factorial
|
PROGRAMMING
| 1,400
|
[
"greedy",
"math",
"sortings"
] | null | null |
Drazil is playing a math game with Varda.
Let's define for positive integer *x* as a product of factorials of its digits. For example, .
First, they choose a decimal number *a* consisting of *n* digits that contains at least one digit larger than 1. This number may possibly start with leading zeroes. Then they should find maximum positive number *x* satisfying following two conditions:
1. *x* doesn't contain neither digit 0 nor digit 1.
2. = .
Help friends find such number.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=15) — the number of digits in *a*.
The second line contains *n* digits of *a*. There is at least one digit in *a* that is larger than 1. Number *a* may possibly contain leading zeroes.
|
Output a maximum possible integer satisfying the conditions above. There should be no zeroes and ones in this number decimal representation.
|
[
"4\n1234\n",
"3\n555\n"
] |
[
"33222\n",
"555\n"
] |
In the first case, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f5a4207f23215fddce977ab5ea9e9d2e7578fb52.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "4\n1234",
"output": "33222"
},
{
"input": "3\n555",
"output": "555"
},
{
"input": "15\n012345781234578",
"output": "7777553333222222222222"
},
{
"input": "1\n8",
"output": "7222"
},
{
"input": "10\n1413472614",
"output": "75333332222222"
},
{
"input": "8\n68931246",
"output": "77553333332222222"
},
{
"input": "7\n4424368",
"output": "75333332222222222"
},
{
"input": "6\n576825",
"output": "7755532222"
},
{
"input": "5\n97715",
"output": "7775332"
},
{
"input": "3\n915",
"output": "75332"
},
{
"input": "2\n26",
"output": "532"
},
{
"input": "1\n4",
"output": "322"
},
{
"input": "15\n028745260720699",
"output": "7777755533333332222222222"
},
{
"input": "13\n5761790121605",
"output": "7775555333322"
},
{
"input": "10\n3312667105",
"output": "755533332"
},
{
"input": "1\n7",
"output": "7"
},
{
"input": "15\n989898989898989",
"output": "777777777777777333333333333333322222222222222222222222222222"
},
{
"input": "15\n000000000000007",
"output": "7"
},
{
"input": "15\n999999999999990",
"output": "77777777777777333333333333333333333333333322222222222222"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "1\n3",
"output": "3"
},
{
"input": "1\n4",
"output": "322"
},
{
"input": "1\n5",
"output": "5"
},
{
"input": "1\n6",
"output": "53"
},
{
"input": "1\n7",
"output": "7"
},
{
"input": "1\n9",
"output": "7332"
},
{
"input": "2\n09",
"output": "7332"
},
{
"input": "13\n1337251172966",
"output": "777555333333222"
},
{
"input": "15\n987654329876543",
"output": "777777555533333333332222222222222"
},
{
"input": "9\n234567899",
"output": "777755333333322222222"
},
{
"input": "2\n99",
"output": "77333322"
},
{
"input": "2\n66",
"output": "5533"
},
{
"input": "3\n999",
"output": "777333333222"
},
{
"input": "5\n99999",
"output": "77777333333333322222"
},
{
"input": "9\n123456789",
"output": "77755333332222222"
},
{
"input": "9\n987654321",
"output": "77755333332222222"
},
{
"input": "3\n666",
"output": "555333"
},
{
"input": "2\n26",
"output": "532"
},
{
"input": "6\n555777",
"output": "777555"
},
{
"input": "10\n1234567899",
"output": "777755333333322222222"
},
{
"input": "4\n6666",
"output": "55553333"
},
{
"input": "4\n9754",
"output": "775333222"
},
{
"input": "2\n95",
"output": "75332"
},
{
"input": "14\n11122233344455",
"output": "55333333222222222"
},
{
"input": "12\n836544897832",
"output": "77777553333333222222222222222"
}
] | 1,660,538,005
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 46
| 0
|
x = int(input())
n = input()
factorial = {
2:[2],
3:[3],
4:[3,2,2],
5:[5],
6:[3,5],
7:[7],
8:[7,2,2,2],
9:[7,3,3,2]
}
res = []
for i in n:
num = int(i)
if num != 1 and num != 0:
res += factorial[num]
res = sorted(res,reverse = True)
s = ""
for i in res:
s+=str(i)
print(int(s))
|
Title: Drazil and Factorial
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Drazil is playing a math game with Varda.
Let's define for positive integer *x* as a product of factorials of its digits. For example, .
First, they choose a decimal number *a* consisting of *n* digits that contains at least one digit larger than 1. This number may possibly start with leading zeroes. Then they should find maximum positive number *x* satisfying following two conditions:
1. *x* doesn't contain neither digit 0 nor digit 1.
2. = .
Help friends find such number.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=15) — the number of digits in *a*.
The second line contains *n* digits of *a*. There is at least one digit in *a* that is larger than 1. Number *a* may possibly contain leading zeroes.
Output Specification:
Output a maximum possible integer satisfying the conditions above. There should be no zeroes and ones in this number decimal representation.
Demo Input:
['4\n1234\n', '3\n555\n']
Demo Output:
['33222\n', '555\n']
Note:
In the first case, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f5a4207f23215fddce977ab5ea9e9d2e7578fb52.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
x = int(input())
n = input()
factorial = {
2:[2],
3:[3],
4:[3,2,2],
5:[5],
6:[3,5],
7:[7],
8:[7,2,2,2],
9:[7,3,3,2]
}
res = []
for i in n:
num = int(i)
if num != 1 and num != 0:
res += factorial[num]
res = sorted(res,reverse = True)
s = ""
for i in res:
s+=str(i)
print(int(s))
```
| 3
|
|
557
|
C
|
Arthur and Table
|
PROGRAMMING
| 1,900
|
[
"brute force",
"data structures",
"dp",
"greedy",
"math",
"sortings"
] | null | null |
Arthur has bought a beautiful big table into his new flat. When he came home, Arthur noticed that the new table is unstable.
In total the table Arthur bought has *n* legs, the length of the *i*-th leg is *l**i*.
Arthur decided to make the table stable and remove some legs. For each of them Arthur determined number *d**i* — the amount of energy that he spends to remove the *i*-th leg.
A table with *k* legs is assumed to be stable if there are more than half legs of the maximum length. For example, to make a table with 5 legs stable, you need to make sure it has at least three (out of these five) legs of the maximum length. Also, a table with one leg is always stable and a table with two legs is stable if and only if they have the same lengths.
Your task is to help Arthur and count the minimum number of energy units Arthur should spend on making the table stable.
|
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=105) — the initial number of legs in the table Arthur bought.
The second line of the input contains a sequence of *n* integers *l**i* (1<=≤<=*l**i*<=≤<=105), where *l**i* is equal to the length of the *i*-th leg of the table.
The third line of the input contains a sequence of *n* integers *d**i* (1<=≤<=*d**i*<=≤<=200), where *d**i* is the number of energy units that Arthur spends on removing the *i*-th leg off the table.
|
Print a single integer — the minimum number of energy units that Arthur needs to spend in order to make the table stable.
|
[
"2\n1 5\n3 2\n",
"3\n2 4 4\n1 1 1\n",
"6\n2 2 1 1 3 3\n4 3 5 5 2 1\n"
] |
[
"2\n",
"0\n",
"8\n"
] |
none
| 1,500
|
[
{
"input": "2\n1 5\n3 2",
"output": "2"
},
{
"input": "3\n2 4 4\n1 1 1",
"output": "0"
},
{
"input": "6\n2 2 1 1 3 3\n4 3 5 5 2 1",
"output": "8"
},
{
"input": "10\n20 1 15 17 11 2 15 3 16 3\n129 114 183 94 169 16 18 104 49 146",
"output": "652"
},
{
"input": "10\n15 16 19 5 14 19 6 17 7 19\n140 183 186 195 67 25 70 56 54 132",
"output": "387"
},
{
"input": "20\n24 15 7 18 6 18 11 22 18 20 28 8 23 17 22 22 23 23 30 23\n24 137 173 189 43 164 2 11 142 153 16 200 53 58 150 199 169 172 38 78",
"output": "1111"
},
{
"input": "30\n20 27 26 17 29 9 25 13 6 21 15 1 14 22 26 2 15 18 20 23 27 9 15 29 11 2 19 23 14 12\n133 199 22 151 9 134 196 119 197 189 117 84 156 6 61 195 98 197 145 75 142 85 187 24 159 3 60 138 156 161",
"output": "2804"
},
{
"input": "5\n1 1 2 2 3\n2 2 2 2 3",
"output": "5"
},
{
"input": "5\n1 1 2 2 3\n2 2 2 2 7",
"output": "8"
},
{
"input": "10\n1 1 3 4 5 6 7 8 9 10\n10 10 4 2 3 4 2 2 2 2",
"output": "21"
},
{
"input": "1\n5\n4",
"output": "0"
},
{
"input": "2\n3 3\n4 5",
"output": "0"
},
{
"input": "2\n4 5\n3 3",
"output": "3"
},
{
"input": "3\n3 3 3\n1 2 3",
"output": "0"
},
{
"input": "3\n1 2 3\n3 3 3",
"output": "6"
}
] | 1,629,640,310
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 20,172,800
|
# https://codeforces.com/problemset/problem/713/A
t = int(input())
inp_arr = []
for _ in range(t):
inp_arr.append(input().split(' '))
multiset = {}
pattern_set = {}
odd = set(['1','3','5','7','9'])
even = set(['2','4','6','8','0'])
def add_value_to_multiset(val):
num = str(val)
curr = ''
for i in num:
curr += '1' if i in odd else '0'
curr = '0'*(18-len(curr)) + curr
if curr in multiset:
if val in multiset[curr]:
multiset[curr][val] += 1
else:
multiset[curr][val] = 1
else:
multiset[curr] = {val:1}
def remove_value_from_multiset(val):
num = str(val)
curr = ''
for i in num:
curr += '1' if i in odd else '0'
curr = '0'*(18-len(curr)) + curr
multiset[curr][val] -= 1
def count_value_from_multiset(pattern):
count = 0
pattern = '0'*(18-len(pattern)) + pattern
# print(pattern, "()()())()")
if pattern in multiset:
for val in multiset[pattern]:
count += multiset[pattern][val]
return count
for inp in inp_arr:
# print(multiset)
if inp[0] == '+':
add_value_to_multiset(int(inp[1]))
elif inp[0] == '-':
remove_value_from_multiset(int(inp[1]))
else:
print(count_value_from_multiset(inp[1]))
|
Title: Arthur and Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Arthur has bought a beautiful big table into his new flat. When he came home, Arthur noticed that the new table is unstable.
In total the table Arthur bought has *n* legs, the length of the *i*-th leg is *l**i*.
Arthur decided to make the table stable and remove some legs. For each of them Arthur determined number *d**i* — the amount of energy that he spends to remove the *i*-th leg.
A table with *k* legs is assumed to be stable if there are more than half legs of the maximum length. For example, to make a table with 5 legs stable, you need to make sure it has at least three (out of these five) legs of the maximum length. Also, a table with one leg is always stable and a table with two legs is stable if and only if they have the same lengths.
Your task is to help Arthur and count the minimum number of energy units Arthur should spend on making the table stable.
Input Specification:
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=105) — the initial number of legs in the table Arthur bought.
The second line of the input contains a sequence of *n* integers *l**i* (1<=≤<=*l**i*<=≤<=105), where *l**i* is equal to the length of the *i*-th leg of the table.
The third line of the input contains a sequence of *n* integers *d**i* (1<=≤<=*d**i*<=≤<=200), where *d**i* is the number of energy units that Arthur spends on removing the *i*-th leg off the table.
Output Specification:
Print a single integer — the minimum number of energy units that Arthur needs to spend in order to make the table stable.
Demo Input:
['2\n1 5\n3 2\n', '3\n2 4 4\n1 1 1\n', '6\n2 2 1 1 3 3\n4 3 5 5 2 1\n']
Demo Output:
['2\n', '0\n', '8\n']
Note:
none
|
```python
# https://codeforces.com/problemset/problem/713/A
t = int(input())
inp_arr = []
for _ in range(t):
inp_arr.append(input().split(' '))
multiset = {}
pattern_set = {}
odd = set(['1','3','5','7','9'])
even = set(['2','4','6','8','0'])
def add_value_to_multiset(val):
num = str(val)
curr = ''
for i in num:
curr += '1' if i in odd else '0'
curr = '0'*(18-len(curr)) + curr
if curr in multiset:
if val in multiset[curr]:
multiset[curr][val] += 1
else:
multiset[curr][val] = 1
else:
multiset[curr] = {val:1}
def remove_value_from_multiset(val):
num = str(val)
curr = ''
for i in num:
curr += '1' if i in odd else '0'
curr = '0'*(18-len(curr)) + curr
multiset[curr][val] -= 1
def count_value_from_multiset(pattern):
count = 0
pattern = '0'*(18-len(pattern)) + pattern
# print(pattern, "()()())()")
if pattern in multiset:
for val in multiset[pattern]:
count += multiset[pattern][val]
return count
for inp in inp_arr:
# print(multiset)
if inp[0] == '+':
add_value_to_multiset(int(inp[1]))
elif inp[0] == '-':
remove_value_from_multiset(int(inp[1]))
else:
print(count_value_from_multiset(inp[1]))
```
| 0
|
|
26
|
B
|
Regular Bracket Sequence
|
PROGRAMMING
| 1,400
|
[
"greedy"
] |
B. Regular Bracket Sequence
|
5
|
256
|
A bracket sequence is called regular if it is possible to obtain correct arithmetic expression by inserting characters «+» and «1» into this sequence. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not.
One day Johnny got bracket sequence. He decided to remove some of the brackets from it in order to obtain a regular bracket sequence. What is the maximum length of a regular bracket sequence which can be obtained?
|
Input consists of a single line with non-empty string of «(» and «)» characters. Its length does not exceed 106.
|
Output the maximum possible length of a regular bracket sequence.
|
[
"(()))(\n",
"((()())\n"
] |
[
"4\n",
"6\n"
] |
none
| 1,000
|
[
{
"input": "(()))(",
"output": "4"
},
{
"input": "((()())",
"output": "6"
},
{
"input": "(",
"output": "0"
},
{
"input": ")",
"output": "0"
},
{
"input": ")(()(",
"output": "2"
},
{
"input": "))))))(",
"output": "0"
},
{
"input": "()()(()(((",
"output": "6"
},
{
"input": "()))(()((((()(())",
"output": "10"
},
{
"input": "())))((()())())))))())",
"output": "14"
},
{
"input": ")))((((())(()((()((((()()())((",
"output": "16"
},
{
"input": "))()()((()()))())()(((((((())((((((((())()()((())(",
"output": "32"
},
{
"input": "))())))))))())))))()()))()()))))())))))()))))))))))))(()))())(()))))(()))))())))((((()()))))()))()))",
"output": "48"
}
] | 1,699,069,476
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 13
| 92
| 0
|
# LUOGU_RID: 133246561
a=[0 for i in range(1000)]
top=-1
sum=0
s=input()
for i in s:
if i=="(":
top+=1
a[top]="("
else:
if top!=-1:
top-=1
sum+=2
print(sum)
|
Title: Regular Bracket Sequence
Time Limit: 5 seconds
Memory Limit: 256 megabytes
Problem Description:
A bracket sequence is called regular if it is possible to obtain correct arithmetic expression by inserting characters «+» and «1» into this sequence. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not.
One day Johnny got bracket sequence. He decided to remove some of the brackets from it in order to obtain a regular bracket sequence. What is the maximum length of a regular bracket sequence which can be obtained?
Input Specification:
Input consists of a single line with non-empty string of «(» and «)» characters. Its length does not exceed 106.
Output Specification:
Output the maximum possible length of a regular bracket sequence.
Demo Input:
['(()))(\n', '((()())\n']
Demo Output:
['4\n', '6\n']
Note:
none
|
```python
# LUOGU_RID: 133246561
a=[0 for i in range(1000)]
top=-1
sum=0
s=input()
for i in s:
if i=="(":
top+=1
a[top]="("
else:
if top!=-1:
top-=1
sum+=2
print(sum)
```
| -1
|
208
|
A
|
Dubstep
|
PROGRAMMING
| 900
|
[
"strings"
] | null | null |
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
|
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
|
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
|
[
"WUBWUBABCWUB\n",
"WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n"
] |
[
"ABC ",
"WE ARE THE CHAMPIONS MY FRIEND "
] |
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
| 500
|
[
{
"input": "WUBWUBABCWUB",
"output": "ABC "
},
{
"input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB",
"output": "WE ARE THE CHAMPIONS MY FRIEND "
},
{
"input": "WUBWUBWUBSR",
"output": "SR "
},
{
"input": "RWUBWUBWUBLWUB",
"output": "R L "
},
{
"input": "ZJWUBWUBWUBJWUBWUBWUBL",
"output": "ZJ J L "
},
{
"input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB",
"output": "C B E Q "
},
{
"input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB",
"output": "JKD WBIRAQKF YE WV "
},
{
"input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB",
"output": "KSDHEMIXUJ R S H "
},
{
"input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB",
"output": "OG X I KO "
},
{
"input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH",
"output": "Q QQ I WW JOPJPBRH "
},
{
"input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB",
"output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C "
},
{
"input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV",
"output": "E IQMJNIQ GZZBQZAUHYP PMR DCV "
},
{
"input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB",
"output": "FV BPS RXNETCJ JDMBH B V B "
},
{
"input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL",
"output": "FBQ IDFSY CTWDM SXO QI L "
},
{
"input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL",
"output": "I QLHD YIIKZDFQ CX U K NL "
},
{
"input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE",
"output": "K UPDYXGOKU AGOAH IZD IY V P E "
},
{
"input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB",
"output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ "
},
{
"input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB",
"output": "PAMJGY XGPQM TKGSXUY E N H E "
},
{
"input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB",
"output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB "
},
{
"input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM",
"output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M "
},
{
"input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW",
"output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W "
},
{
"input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG",
"output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G "
},
{
"input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN",
"output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N "
},
{
"input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG",
"output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG "
},
{
"input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB",
"output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L "
},
{
"input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB",
"output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U "
},
{
"input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB",
"output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ "
},
{
"input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB",
"output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J "
},
{
"input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO",
"output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O "
},
{
"input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR",
"output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R "
},
{
"input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB",
"output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM "
},
{
"input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB",
"output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H "
},
{
"input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB",
"output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S "
},
{
"input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB",
"output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J "
},
{
"input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF",
"output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F "
},
{
"input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY",
"output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y "
},
{
"input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB",
"output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO "
},
{
"input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW",
"output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W "
},
{
"input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD",
"output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D "
},
{
"input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB",
"output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A "
},
{
"input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB",
"output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y "
},
{
"input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB",
"output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R "
},
{
"input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY",
"output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y "
},
{
"input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE",
"output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E "
},
{
"input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS",
"output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S "
},
{
"input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP",
"output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP "
},
{
"input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB",
"output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y "
},
{
"input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL",
"output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL "
},
{
"input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO",
"output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O "
},
{
"input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU",
"output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU "
},
{
"input": "A",
"output": "A "
},
{
"input": "WUBA",
"output": "A "
},
{
"input": "WUBWUBA",
"output": "A "
},
{
"input": "AWUBWUBWUB",
"output": "A "
},
{
"input": "AWUBBWUBCWUBD",
"output": "A B C D "
},
{
"input": "WUBWWUBWUBWUBUWUBWUBBWUB",
"output": "W U B "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "WUWUBBWWUBUB",
"output": "WU BW UB "
},
{
"input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB",
"output": "WUAB "
},
{
"input": "ZWUB",
"output": "Z "
},
{
"input": "WU",
"output": "WU "
},
{
"input": "UB",
"output": "UB "
},
{
"input": "U",
"output": "U "
},
{
"input": "WUBW",
"output": "W "
},
{
"input": "WUBWU",
"output": "WU "
},
{
"input": "WUWUB",
"output": "WU "
},
{
"input": "UBWUB",
"output": "UB "
},
{
"input": "WUWUBUBWUBUWUB",
"output": "WU UB U "
},
{
"input": "WUBWWUBAWUB",
"output": "W A "
},
{
"input": "WUUUUU",
"output": "WUUUUU "
}
] | 1,693,408,707
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 71
| 92
| 0
|
n = str(input())
x = n.replace("WUB", " ")
x = x.lstrip()
print(x)
|
Title: Dubstep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
Input Specification:
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
Output Specification:
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
Demo Input:
['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n']
Demo Output:
['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND ']
Note:
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
|
```python
n = str(input())
x = n.replace("WUB", " ")
x = x.lstrip()
print(x)
```
| 3
|
|
368
|
B
|
Sereja and Suffixes
|
PROGRAMMING
| 1,100
|
[
"data structures",
"dp"
] | null | null |
Sereja has an array *a*, consisting of *n* integers *a*1, *a*2, ..., *a**n*. The boy cannot sit and do nothing, he decided to study an array. Sereja took a piece of paper and wrote out *m* integers *l*1,<=*l*2,<=...,<=*l**m* (1<=≤<=*l**i*<=≤<=*n*). For each number *l**i* he wants to know how many distinct numbers are staying on the positions *l**i*, *l**i*<=+<=1, ..., *n*. Formally, he want to find the number of distinct numbers among *a**l**i*,<=*a**l**i*<=+<=1,<=...,<=*a**n*.?
Sereja wrote out the necessary array elements but the array was so large and the boy was so pressed for time. Help him, find the answer for the described question for each *l**i*.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105). The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105) — the array elements.
Next *m* lines contain integers *l*1,<=*l*2,<=...,<=*l**m*. The *i*-th line contains integer *l**i* (1<=≤<=*l**i*<=≤<=*n*).
|
Print *m* lines — on the *i*-th line print the answer to the number *l**i*.
|
[
"10 10\n1 2 3 4 1 2 3 4 100000 99999\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10\n"
] |
[
"6\n6\n6\n6\n6\n5\n4\n3\n2\n1\n"
] |
none
| 1,000
|
[
{
"input": "10 10\n1 2 3 4 1 2 3 4 100000 99999\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10",
"output": "6\n6\n6\n6\n6\n5\n4\n3\n2\n1"
},
{
"input": "8 3\n8 6 4 3 4 2 4 8\n6\n4\n2",
"output": "3\n4\n5"
},
{
"input": "7 10\n1 3 8 6 2 2 7\n4\n2\n6\n3\n4\n4\n6\n2\n7\n4",
"output": "3\n5\n2\n4\n3\n3\n2\n5\n1\n3"
},
{
"input": "10 2\n2 6 5 7 2 2 3 2 4 8\n1\n2",
"output": "7\n7"
},
{
"input": "7 1\n68346 10956 76708 23018 84063 34833 80407\n1",
"output": "7"
},
{
"input": "2 2\n8 4\n1\n1",
"output": "2\n2"
},
{
"input": "1 5\n5\n1\n1\n1\n1\n1",
"output": "1\n1\n1\n1\n1"
},
{
"input": "4 7\n3 1 4 2\n4\n1\n2\n3\n2\n4\n4",
"output": "1\n4\n3\n2\n3\n1\n1"
},
{
"input": "4 3\n9 1 7 1\n1\n4\n2",
"output": "3\n1\n2"
},
{
"input": "8 3\n9280 6676 2720 6172 8329 10413 3975 1394\n5\n6\n7",
"output": "4\n3\n2"
},
{
"input": "1 1\n1\n1",
"output": "1"
}
] | 1,670,399,278
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 265
| 12,390,400
|
# -*- coding: utf-8 -*-
"""
Created on Wed Dec 7 14:01:59 2022
@author: 86138
"""
n,m=map(int,input().split())
li=list(map(int,input().split()))
s=set();dp=[0]*n;p=0
for i in range(n-1,-1,-1):
if li[i] not in s:
p+=1
s.add(li[i]);dp[i]=p
li_1=[]
for j in range(m):
a=int(input());li_1.append(dp[a-1])
print('\n'.join(map(str,li_1)))
|
Title: Sereja and Suffixes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja has an array *a*, consisting of *n* integers *a*1, *a*2, ..., *a**n*. The boy cannot sit and do nothing, he decided to study an array. Sereja took a piece of paper and wrote out *m* integers *l*1,<=*l*2,<=...,<=*l**m* (1<=≤<=*l**i*<=≤<=*n*). For each number *l**i* he wants to know how many distinct numbers are staying on the positions *l**i*, *l**i*<=+<=1, ..., *n*. Formally, he want to find the number of distinct numbers among *a**l**i*,<=*a**l**i*<=+<=1,<=...,<=*a**n*.?
Sereja wrote out the necessary array elements but the array was so large and the boy was so pressed for time. Help him, find the answer for the described question for each *l**i*.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105). The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105) — the array elements.
Next *m* lines contain integers *l*1,<=*l*2,<=...,<=*l**m*. The *i*-th line contains integer *l**i* (1<=≤<=*l**i*<=≤<=*n*).
Output Specification:
Print *m* lines — on the *i*-th line print the answer to the number *l**i*.
Demo Input:
['10 10\n1 2 3 4 1 2 3 4 100000 99999\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10\n']
Demo Output:
['6\n6\n6\n6\n6\n5\n4\n3\n2\n1\n']
Note:
none
|
```python
# -*- coding: utf-8 -*-
"""
Created on Wed Dec 7 14:01:59 2022
@author: 86138
"""
n,m=map(int,input().split())
li=list(map(int,input().split()))
s=set();dp=[0]*n;p=0
for i in range(n-1,-1,-1):
if li[i] not in s:
p+=1
s.add(li[i]);dp[i]=p
li_1=[]
for j in range(m):
a=int(input());li_1.append(dp[a-1])
print('\n'.join(map(str,li_1)))
```
| 3
|
|
929
|
A
|
Прокат велосипедов
|
PROGRAMMING
| 1,400
|
[
"*special",
"greedy",
"implementation"
] | null | null |
Как известно, в теплую погоду многие жители крупных городов пользуются сервисами городского велопроката. Вот и Аркадий сегодня будет добираться от школы до дома, используя городские велосипеды.
Школа и дом находятся на одной прямой улице, кроме того, на той же улице есть *n* точек, где можно взять велосипед в прокат или сдать его. Первый велопрокат находится в точке *x*1 километров вдоль улицы, второй — в точке *x*2 и так далее, *n*-й велопрокат находится в точке *x**n*. Школа Аркадия находится в точке *x*1 (то есть там же, где и первый велопрокат), а дом — в точке *x**n* (то есть там же, где и *n*-й велопрокат). Известно, что *x**i*<=<<=*x**i*<=+<=1 для всех 1<=≤<=*i*<=<<=*n*.
Согласно правилам пользования велопроката, Аркадий может брать велосипед в прокат только на ограниченное время, после этого он должен обязательно вернуть его в одной из точек велопроката, однако, он тут же может взять новый велосипед, и отсчет времени пойдет заново. Аркадий может брать не более одного велосипеда в прокат одновременно. Если Аркадий решает взять велосипед в какой-то точке проката, то он сдаёт тот велосипед, на котором он до него доехал, берёт ровно один новый велосипед и продолжает на нём своё движение.
За отведенное время, независимо от выбранного велосипеда, Аркадий успевает проехать не больше *k* километров вдоль улицы.
Определите, сможет ли Аркадий доехать на велосипедах от школы до дома, и если да, то какое минимальное число раз ему необходимо будет взять велосипед в прокат, включая первый велосипед? Учтите, что Аркадий не намерен сегодня ходить пешком.
|
В первой строке следуют два целых числа *n* и *k* (2<=≤<=*n*<=≤<=1<=000, 1<=≤<=*k*<=≤<=100<=000) — количество велопрокатов и максимальное расстояние, которое Аркадий может проехать на одном велосипеде.
В следующей строке следует последовательность целых чисел *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x*1<=<<=*x*2<=<<=...<=<<=*x**n*<=≤<=100<=000) — координаты точек, в которых находятся велопрокаты. Гарантируется, что координаты велопрокатов заданы в порядке возрастания.
|
Если Аркадий не сможет добраться от школы до дома только на велосипедах, выведите -1. В противном случае, выведите минимальное количество велосипедов, которые Аркадию нужно взять в точках проката.
|
[
"4 4\n3 6 8 10\n",
"2 9\n10 20\n",
"12 3\n4 6 7 9 10 11 13 15 17 18 20 21\n"
] |
[
"2\n",
"-1\n",
"6\n"
] |
В первом примере Аркадий должен взять первый велосипед в первом велопрокате и доехать на нём до второго велопроката. Во втором велопрокате он должен взять новый велосипед, на котором он сможет добраться до четвертого велопроката, рядом с которым и находится его дом. Поэтому Аркадию нужно всего два велосипеда, чтобы добраться от школы до дома.
Во втором примере всего два велопроката, расстояние между которыми 10. Но максимальное расстояние, которое можно проехать на одном велосипеде, равно 9. Поэтому Аркадий не сможет добраться от школы до дома только на велосипедах.
| 500
|
[
{
"input": "4 4\n3 6 8 10",
"output": "2"
},
{
"input": "2 9\n10 20",
"output": "-1"
},
{
"input": "12 3\n4 6 7 9 10 11 13 15 17 18 20 21",
"output": "6"
},
{
"input": "2 1\n11164 11165",
"output": "1"
},
{
"input": "3 7\n45823 45825 45829",
"output": "1"
},
{
"input": "2 100000\n0 100000",
"output": "1"
},
{
"input": "50 15001\n1269 1580 5431 5916 6642 14145 15760 19922 20589 22062 24138 33454 33505 35916 37012 42577 43140 49457 54720 55188 56205 56639 56870 57997 58379 59088 59297 61805 61861 63005 64013 68848 71182 71497 72715 73008 75616 76042 76614 80690 83089 85033 86408 92392 92763 93833 95085 95815 97152 99379",
"output": "8"
},
{
"input": "5 7\n6219 6222 6229 6231 6236",
"output": "3"
},
{
"input": "10 448\n78449 78573 78599 78742 78748 78759 78853 79091 79298 79324",
"output": "3"
},
{
"input": "20 19191\n11272 12386 14108 24663 24932 26547 29656 44677 45436 45654 48562 62367 71049 71238 78182 84042 88736 92026 96836 99343",
"output": "6"
},
{
"input": "2 100000\n1 100000",
"output": "1"
},
{
"input": "2 99999\n0 100000",
"output": "-1"
},
{
"input": "2 2\n1 3",
"output": "1"
},
{
"input": "2 2\n1 2",
"output": "1"
},
{
"input": "2 2\n1 4",
"output": "-1"
},
{
"input": "10 1\n1 2 3 4 5 6 7 8 9 10",
"output": "9"
}
] | 1,520,082,007
| 77,107
|
Python 3
|
OK
|
TESTS
| 52
| 77
| 5,632,000
|
import bisect
n,k = map(int, input().split(' '))
x = list(map(int, input().split(' ')))
bord = 0
bikes = 0
while bord < n - 1:
path = x[bord] + k
cur = bisect.bisect_right(x, path)
if cur - 1 != bord:
bord = cur - 1
bikes += 1
else:
bikes = -1
break
print(bikes)
|
Title: Прокат велосипедов
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Как известно, в теплую погоду многие жители крупных городов пользуются сервисами городского велопроката. Вот и Аркадий сегодня будет добираться от школы до дома, используя городские велосипеды.
Школа и дом находятся на одной прямой улице, кроме того, на той же улице есть *n* точек, где можно взять велосипед в прокат или сдать его. Первый велопрокат находится в точке *x*1 километров вдоль улицы, второй — в точке *x*2 и так далее, *n*-й велопрокат находится в точке *x**n*. Школа Аркадия находится в точке *x*1 (то есть там же, где и первый велопрокат), а дом — в точке *x**n* (то есть там же, где и *n*-й велопрокат). Известно, что *x**i*<=<<=*x**i*<=+<=1 для всех 1<=≤<=*i*<=<<=*n*.
Согласно правилам пользования велопроката, Аркадий может брать велосипед в прокат только на ограниченное время, после этого он должен обязательно вернуть его в одной из точек велопроката, однако, он тут же может взять новый велосипед, и отсчет времени пойдет заново. Аркадий может брать не более одного велосипеда в прокат одновременно. Если Аркадий решает взять велосипед в какой-то точке проката, то он сдаёт тот велосипед, на котором он до него доехал, берёт ровно один новый велосипед и продолжает на нём своё движение.
За отведенное время, независимо от выбранного велосипеда, Аркадий успевает проехать не больше *k* километров вдоль улицы.
Определите, сможет ли Аркадий доехать на велосипедах от школы до дома, и если да, то какое минимальное число раз ему необходимо будет взять велосипед в прокат, включая первый велосипед? Учтите, что Аркадий не намерен сегодня ходить пешком.
Input Specification:
В первой строке следуют два целых числа *n* и *k* (2<=≤<=*n*<=≤<=1<=000, 1<=≤<=*k*<=≤<=100<=000) — количество велопрокатов и максимальное расстояние, которое Аркадий может проехать на одном велосипеде.
В следующей строке следует последовательность целых чисел *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x*1<=<<=*x*2<=<<=...<=<<=*x**n*<=≤<=100<=000) — координаты точек, в которых находятся велопрокаты. Гарантируется, что координаты велопрокатов заданы в порядке возрастания.
Output Specification:
Если Аркадий не сможет добраться от школы до дома только на велосипедах, выведите -1. В противном случае, выведите минимальное количество велосипедов, которые Аркадию нужно взять в точках проката.
Demo Input:
['4 4\n3 6 8 10\n', '2 9\n10 20\n', '12 3\n4 6 7 9 10 11 13 15 17 18 20 21\n']
Demo Output:
['2\n', '-1\n', '6\n']
Note:
В первом примере Аркадий должен взять первый велосипед в первом велопрокате и доехать на нём до второго велопроката. Во втором велопрокате он должен взять новый велосипед, на котором он сможет добраться до четвертого велопроката, рядом с которым и находится его дом. Поэтому Аркадию нужно всего два велосипеда, чтобы добраться от школы до дома.
Во втором примере всего два велопроката, расстояние между которыми 10. Но максимальное расстояние, которое можно проехать на одном велосипеде, равно 9. Поэтому Аркадий не сможет добраться от школы до дома только на велосипедах.
|
```python
import bisect
n,k = map(int, input().split(' '))
x = list(map(int, input().split(' ')))
bord = 0
bikes = 0
while bord < n - 1:
path = x[bord] + k
cur = bisect.bisect_right(x, path)
if cur - 1 != bord:
bord = cur - 1
bikes += 1
else:
bikes = -1
break
print(bikes)
```
| 3
|
|
673
|
A
|
Bear and Game
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Bear Limak likes watching sports on TV. He is going to watch a game today. The game lasts 90 minutes and there are no breaks.
Each minute can be either interesting or boring. If 15 consecutive minutes are boring then Limak immediately turns TV off.
You know that there will be *n* interesting minutes *t*1,<=*t*2,<=...,<=*t**n*. Your task is to calculate for how many minutes Limak will watch the game.
|
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=90) — the number of interesting minutes.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=... *t**n*<=≤<=90), given in the increasing order.
|
Print the number of minutes Limak will watch the game.
|
[
"3\n7 20 88\n",
"9\n16 20 30 40 50 60 70 80 90\n",
"9\n15 20 30 40 50 60 70 80 90\n"
] |
[
"35\n",
"15\n",
"90\n"
] |
In the first sample, minutes 21, 22, ..., 35 are all boring and thus Limak will turn TV off immediately after the 35-th minute. So, he would watch the game for 35 minutes.
In the second sample, the first 15 minutes are boring.
In the third sample, there are no consecutive 15 boring minutes. So, Limak will watch the whole game.
| 500
|
[
{
"input": "3\n7 20 88",
"output": "35"
},
{
"input": "9\n16 20 30 40 50 60 70 80 90",
"output": "15"
},
{
"input": "9\n15 20 30 40 50 60 70 80 90",
"output": "90"
},
{
"input": "30\n6 11 12 15 22 24 30 31 32 33 34 35 40 42 44 45 47 50 53 54 57 58 63 67 75 77 79 81 83 88",
"output": "90"
},
{
"input": "60\n1 2 4 5 6 7 11 14 16 18 20 21 22 23 24 25 26 33 34 35 36 37 38 39 41 42 43 44 46 47 48 49 52 55 56 57 58 59 60 61 63 64 65 67 68 70 71 72 73 74 75 77 78 80 82 83 84 85 86 88",
"output": "90"
},
{
"input": "90\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90",
"output": "90"
},
{
"input": "1\n1",
"output": "16"
},
{
"input": "5\n15 30 45 60 75",
"output": "90"
},
{
"input": "6\n14 29 43 59 70 74",
"output": "58"
},
{
"input": "1\n15",
"output": "30"
},
{
"input": "1\n16",
"output": "15"
},
{
"input": "14\n14 22 27 31 35 44 46 61 62 69 74 79 88 89",
"output": "90"
},
{
"input": "76\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90",
"output": "90"
},
{
"input": "1\n90",
"output": "15"
},
{
"input": "6\n13 17 32 47 60 66",
"output": "81"
},
{
"input": "84\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84",
"output": "90"
},
{
"input": "9\n6 20 27 28 40 53 59 70 85",
"output": "90"
},
{
"input": "12\n14 22 27 31 35 44 62 69 74 79 88 89",
"output": "59"
},
{
"input": "5\n15 30 45 60 74",
"output": "89"
},
{
"input": "72\n3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89",
"output": "54"
},
{
"input": "8\n1 16 30 31 32 33 34 50",
"output": "49"
},
{
"input": "12\n1 3 6 10 15 21 28 36 45 55 66 78",
"output": "90"
},
{
"input": "25\n1 2 3 4 5 6 7 8 9 10 11 23 36 50 65 81 82 83 84 85 86 87 88 89 90",
"output": "80"
},
{
"input": "8\n5 17 20 35 42 53 67 76",
"output": "90"
},
{
"input": "9\n15 28 39 48 55 60 63 64 74",
"output": "89"
},
{
"input": "10\n15 28 39 48 55 60 63 64 74 82",
"output": "90"
},
{
"input": "2\n1 18",
"output": "16"
},
{
"input": "9\n10 20 30 40 50 60 70 80 84",
"output": "90"
},
{
"input": "2\n16 50",
"output": "15"
},
{
"input": "6\n15 30 45 60 75 84",
"output": "90"
},
{
"input": "8\n15 20 30 40 50 60 73 83",
"output": "90"
},
{
"input": "8\n10 20 30 40 50 60 70 80",
"output": "90"
},
{
"input": "3\n1 20 90",
"output": "16"
},
{
"input": "6\n15 30 45 60 74 89",
"output": "90"
}
] | 1,659,071,078
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 6
| 46
| 0
|
n = int(input())
t =[*map(int,input().split())]
m = 0; cnt = 1
for i in range(0,n):
if((t[i]-m)<=15):m = t[i]
else: m += 15;cnt = 0; break
if(cnt): m = 90
print(m)
|
Title: Bear and Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bear Limak likes watching sports on TV. He is going to watch a game today. The game lasts 90 minutes and there are no breaks.
Each minute can be either interesting or boring. If 15 consecutive minutes are boring then Limak immediately turns TV off.
You know that there will be *n* interesting minutes *t*1,<=*t*2,<=...,<=*t**n*. Your task is to calculate for how many minutes Limak will watch the game.
Input Specification:
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=90) — the number of interesting minutes.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=... *t**n*<=≤<=90), given in the increasing order.
Output Specification:
Print the number of minutes Limak will watch the game.
Demo Input:
['3\n7 20 88\n', '9\n16 20 30 40 50 60 70 80 90\n', '9\n15 20 30 40 50 60 70 80 90\n']
Demo Output:
['35\n', '15\n', '90\n']
Note:
In the first sample, minutes 21, 22, ..., 35 are all boring and thus Limak will turn TV off immediately after the 35-th minute. So, he would watch the game for 35 minutes.
In the second sample, the first 15 minutes are boring.
In the third sample, there are no consecutive 15 boring minutes. So, Limak will watch the whole game.
|
```python
n = int(input())
t =[*map(int,input().split())]
m = 0; cnt = 1
for i in range(0,n):
if((t[i]-m)<=15):m = t[i]
else: m += 15;cnt = 0; break
if(cnt): m = 90
print(m)
```
| 0
|
|
652
|
A
|
Gabriel and Caterpillar
|
PROGRAMMING
| 1,400
|
[
"implementation",
"math"
] | null | null |
The 9-th grade student Gabriel noticed a caterpillar on a tree when walking around in a forest after the classes. The caterpillar was on the height *h*1 cm from the ground. On the height *h*2 cm (*h*2<=><=*h*1) on the same tree hung an apple and the caterpillar was crawling to the apple.
Gabriel is interested when the caterpillar gets the apple. He noted that the caterpillar goes up by *a* cm per hour by day and slips down by *b* cm per hour by night.
In how many days Gabriel should return to the forest to see the caterpillar get the apple. You can consider that the day starts at 10 am and finishes at 10 pm. Gabriel's classes finish at 2 pm. You can consider that Gabriel noticed the caterpillar just after the classes at 2 pm.
Note that the forest is magic so the caterpillar can slip down under the ground and then lift to the apple.
|
The first line contains two integers *h*1,<=*h*2 (1<=≤<=*h*1<=<<=*h*2<=≤<=105) — the heights of the position of the caterpillar and the apple in centimeters.
The second line contains two integers *a*,<=*b* (1<=≤<=*a*,<=*b*<=≤<=105) — the distance the caterpillar goes up by day and slips down by night, in centimeters per hour.
|
Print the only integer *k* — the number of days Gabriel should wait to return to the forest and see the caterpillar getting the apple.
If the caterpillar can't get the apple print the only integer <=-<=1.
|
[
"10 30\n2 1\n",
"10 13\n1 1\n",
"10 19\n1 2\n",
"1 50\n5 4\n"
] |
[
"1\n",
"0\n",
"-1\n",
"1\n"
] |
In the first example at 10 pm of the first day the caterpillar gets the height 26. At 10 am of the next day it slips down to the height 14. And finally at 6 pm of the same day the caterpillar gets the apple.
Note that in the last example the caterpillar was slipping down under the ground and getting the apple on the next day.
| 0
|
[
{
"input": "10 30\n2 1",
"output": "1"
},
{
"input": "10 13\n1 1",
"output": "0"
},
{
"input": "10 19\n1 2",
"output": "-1"
},
{
"input": "1 50\n5 4",
"output": "1"
},
{
"input": "1 1000\n2 1",
"output": "82"
},
{
"input": "999 1000\n1 1",
"output": "0"
},
{
"input": "999 1000\n1 1000",
"output": "0"
},
{
"input": "1 1000\n999 1",
"output": "0"
},
{
"input": "1 1000\n100 99",
"output": "17"
},
{
"input": "500 509\n1 1",
"output": "-1"
},
{
"input": "500 555\n6 1",
"output": "1"
},
{
"input": "1 100000\n2 1",
"output": "8332"
},
{
"input": "99990 100000\n1 1",
"output": "-1"
},
{
"input": "90000 100000\n2 1",
"output": "832"
},
{
"input": "10 100000\n1 100000",
"output": "-1"
},
{
"input": "1 41\n5 6",
"output": "0"
},
{
"input": "1 100000\n1 100000",
"output": "-1"
},
{
"input": "1 9\n1 1",
"output": "0"
},
{
"input": "8 16\n1 12",
"output": "0"
},
{
"input": "14 30\n2 1",
"output": "0"
},
{
"input": "7245 77828\n6224 92468",
"output": "-1"
},
{
"input": "43951 66098\n1604 35654",
"output": "-1"
},
{
"input": "1 2\n4 3",
"output": "0"
},
{
"input": "90493 94279\n468 49",
"output": "1"
},
{
"input": "1 50\n3 1",
"output": "2"
},
{
"input": "26300 88310\n7130 351",
"output": "1"
},
{
"input": "1 17\n2 2",
"output": "0"
},
{
"input": "10718 75025\n7083 6958",
"output": "6"
},
{
"input": "1 10\n1 100000",
"output": "-1"
},
{
"input": "1 190\n10 1",
"output": "2"
},
{
"input": "24951 85591\n3090 8945",
"output": "-1"
},
{
"input": "1 25\n3 2",
"output": "0"
},
{
"input": "27043 88418\n7273 7",
"output": "1"
},
{
"input": "35413 75637\n4087 30166",
"output": "-1"
},
{
"input": "1 18\n2 3",
"output": "-1"
},
{
"input": "1 16\n2 2",
"output": "0"
},
{
"input": "1 18\n2 1",
"output": "1"
},
{
"input": "1 10\n2 2",
"output": "0"
},
{
"input": "1 30\n2 1",
"output": "2"
},
{
"input": "1 100000\n10000 100000",
"output": "-1"
},
{
"input": "4444 33425\n2758 44",
"output": "1"
},
{
"input": "1 100000\n10 99910",
"output": "-1"
},
{
"input": "12 100\n6 11",
"output": "-1"
},
{
"input": "100 100000\n10 11",
"output": "-1"
},
{
"input": "28473 80380\n2568 95212",
"output": "-1"
},
{
"input": "10 105\n10 1",
"output": "1"
},
{
"input": "4642 39297\n3760 451",
"output": "1"
},
{
"input": "1 90\n10 1",
"output": "1"
},
{
"input": "2 100\n1 100000",
"output": "-1"
},
{
"input": "1 100000\n1000 100000",
"output": "-1"
},
{
"input": "1 45\n1 100000",
"output": "-1"
},
{
"input": "12 1000\n100 1",
"output": "1"
},
{
"input": "64635 76564\n100 34238",
"output": "-1"
},
{
"input": "10 90\n10 12",
"output": "0"
},
{
"input": "49238 81395\n3512 251",
"output": "1"
},
{
"input": "6497 62133\n309 50077",
"output": "-1"
},
{
"input": "1 100\n1 100000",
"output": "-1"
},
{
"input": "1 10000\n1 10000",
"output": "-1"
},
{
"input": "55674 93249\n846 1",
"output": "4"
},
{
"input": "10 90\n9 10",
"output": "-1"
},
{
"input": "23110 69794\n171 808",
"output": "-1"
},
{
"input": "1 100000\n1 10000",
"output": "-1"
},
{
"input": "1 9\n1 2",
"output": "0"
},
{
"input": "58750 81357\n2 98022",
"output": "-1"
},
{
"input": "82125 89348\n894 91369",
"output": "-1"
},
{
"input": "25401 53663\n957 30449",
"output": "-1"
},
{
"input": "2 12\n1 2",
"output": "-1"
},
{
"input": "1 10000\n1 100000",
"output": "-1"
},
{
"input": "1 100000\n1 99999",
"output": "-1"
},
{
"input": "1 149\n8 2",
"output": "2"
},
{
"input": "3 100\n1 1",
"output": "-1"
},
{
"input": "1 18\n2 2",
"output": "-1"
},
{
"input": "1 77\n9 1",
"output": "1"
},
{
"input": "7330 94486\n968 141",
"output": "9"
},
{
"input": "89778 98176\n863 61",
"output": "1"
},
{
"input": "1 70\n6 5",
"output": "2"
}
] | 1,646,755,794
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 76
| 62
| 0
|
def solve(h1, h2, a, b):
d = max(h2 - a * 8 - h1, 0)
if d and a <= b:
return -1
x = max(1, (a - b) * 12)
return (d + x - 1) // x
h1, h2 = map(int, input().split())
a, b = map(int, input().split())
print(solve(h1, h2, a, b))
|
Title: Gabriel and Caterpillar
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The 9-th grade student Gabriel noticed a caterpillar on a tree when walking around in a forest after the classes. The caterpillar was on the height *h*1 cm from the ground. On the height *h*2 cm (*h*2<=><=*h*1) on the same tree hung an apple and the caterpillar was crawling to the apple.
Gabriel is interested when the caterpillar gets the apple. He noted that the caterpillar goes up by *a* cm per hour by day and slips down by *b* cm per hour by night.
In how many days Gabriel should return to the forest to see the caterpillar get the apple. You can consider that the day starts at 10 am and finishes at 10 pm. Gabriel's classes finish at 2 pm. You can consider that Gabriel noticed the caterpillar just after the classes at 2 pm.
Note that the forest is magic so the caterpillar can slip down under the ground and then lift to the apple.
Input Specification:
The first line contains two integers *h*1,<=*h*2 (1<=≤<=*h*1<=<<=*h*2<=≤<=105) — the heights of the position of the caterpillar and the apple in centimeters.
The second line contains two integers *a*,<=*b* (1<=≤<=*a*,<=*b*<=≤<=105) — the distance the caterpillar goes up by day and slips down by night, in centimeters per hour.
Output Specification:
Print the only integer *k* — the number of days Gabriel should wait to return to the forest and see the caterpillar getting the apple.
If the caterpillar can't get the apple print the only integer <=-<=1.
Demo Input:
['10 30\n2 1\n', '10 13\n1 1\n', '10 19\n1 2\n', '1 50\n5 4\n']
Demo Output:
['1\n', '0\n', '-1\n', '1\n']
Note:
In the first example at 10 pm of the first day the caterpillar gets the height 26. At 10 am of the next day it slips down to the height 14. And finally at 6 pm of the same day the caterpillar gets the apple.
Note that in the last example the caterpillar was slipping down under the ground and getting the apple on the next day.
|
```python
def solve(h1, h2, a, b):
d = max(h2 - a * 8 - h1, 0)
if d and a <= b:
return -1
x = max(1, (a - b) * 12)
return (d + x - 1) // x
h1, h2 = map(int, input().split())
a, b = map(int, input().split())
print(solve(h1, h2, a, b))
```
| 3
|
|
980
|
C
|
Posterized
|
PROGRAMMING
| 1,700
|
[
"games",
"greedy"
] | null | null |
Professor Ibrahim has prepared the final homework for his algorithm’s class. He asked his students to implement the Posterization Image Filter.
Their algorithm will be tested on an array of integers, where the $i$-th integer represents the color of the $i$-th pixel in the image. The image is in black and white, therefore the color of each pixel will be an integer between 0 and 255 (inclusive).
To implement the filter, students are required to divide the black and white color range [0, 255] into groups of consecutive colors, and select one color in each group to be the group’s key. In order to preserve image details, the size of a group must not be greater than $k$, and each color should belong to exactly one group.
Finally, the students will replace the color of each pixel in the array with that color’s assigned group key.
To better understand the effect, here is an image of a basking turtle where the Posterization Filter was applied with increasing $k$ to the right.
To make the process of checking the final answer easier, Professor Ibrahim wants students to divide the groups and assign the keys in a way that produces the lexicographically smallest possible array.
|
The first line of input contains two integers $n$ and $k$ ($1 \leq n \leq 10^5$, $1 \leq k \leq 256$), the number of pixels in the image, and the maximum size of a group, respectively.
The second line contains $n$ integers $p_1, p_2, \dots, p_n$ ($0 \leq p_i \leq 255$), where $p_i$ is the color of the $i$-th pixel.
|
Print $n$ space-separated integers; the lexicographically smallest possible array that represents the image after applying the Posterization filter.
|
[
"4 3\n2 14 3 4\n",
"5 2\n0 2 1 255 254\n"
] |
[
"0 12 3 3\n",
"0 1 1 254 254\n"
] |
One possible way to group colors and assign keys for the first sample:
Color $2$ belongs to the group $[0,2]$, with group key $0$.
Color $14$ belongs to the group $[12,14]$, with group key $12$.
Colors $3$ and $4$ belong to group $[3, 5]$, with group key $3$.
Other groups won't affect the result so they are not listed here.
| 1,500
|
[
{
"input": "4 3\n2 14 3 4",
"output": "0 12 3 3"
},
{
"input": "5 2\n0 2 1 255 254",
"output": "0 1 1 254 254"
},
{
"input": "10 3\n112 184 161 156 118 231 191 128 91 229",
"output": "110 182 159 154 116 229 189 126 89 229"
},
{
"input": "9 3\n174 149 118 124 166 146 219 233 107",
"output": "172 147 116 122 164 144 217 231 105"
},
{
"input": "8 4\n180 195 13 195 61 24 132 160",
"output": "177 192 10 192 58 21 129 157"
},
{
"input": "1 4\n51",
"output": "48"
},
{
"input": "2 4\n218 213",
"output": "215 210"
},
{
"input": "3 3\n212 167 3",
"output": "210 165 1"
},
{
"input": "100 7\n39 242 238 155 95 30 129 132 72 59 22 61 133 113 99 81 253 204 160 109 92 187 11 227 145 148 100 42 78 14 113 91 140 197 123 182 4 185 208 27 182 207 63 146 102 79 159 195 26 100 72 127 157 159 152 53 0 117 111 125 19 188 179 145 240 50 205 207 113 246 42 56 181 13 188 244 159 222 119 204 87 182 212 175 199 69 81 45 30 32 238 255 81 61 177 125 149 121 35 38",
"output": "33 236 236 149 89 24 123 130 66 53 16 60 130 107 96 75 247 198 156 107 89 181 5 221 139 146 96 40 75 12 107 89 139 191 123 181 0 181 205 24 181 205 60 146 96 75 156 191 24 96 66 123 156 156 149 53 0 114 107 123 16 188 173 139 236 44 205 205 107 243 40 53 181 12 188 243 156 221 114 198 82 181 209 173 198 66 75 44 24 31 236 254 75 60 173 123 149 120 33 33"
},
{
"input": "4 2\n122 108 224 154",
"output": "121 107 223 153"
}
] | 1,525,798,610
| 6,710
|
PyPy 3
|
WRONG_ANSWER
|
PRETESTS
| 8
| 93
| 21,401,600
|
import sys
n, k = map(int, next(sys.stdin).rstrip().split())
xs = list(map(int, next(sys.stdin).rstrip().split()))
mapka = {}
lengths = {}
result = []
for x in xs:
if x in mapka:
result.append(mapka[x])
else:
left = max(0, x - k + 1)
range_potential = x - left
for i in range(range_potential, -1, -1):
potential_left = x - i
if potential_left not in mapka:
result.append(potential_left)
for y in range(potential_left, x + 1):
mapka[y] = potential_left
lengths[potential_left] = x - potential_left + 1
break
else:
if lengths[mapka[potential_left]] + (x - potential_left) <= k:
result.append(mapka[potential_left])
for y in range(potential_left, x + 1):
mapka[y] = mapka[potential_left]
lengths[mapka[potential_left]] += 1
break
print(' '.join(map(str, result)))
|
Title: Posterized
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor Ibrahim has prepared the final homework for his algorithm’s class. He asked his students to implement the Posterization Image Filter.
Their algorithm will be tested on an array of integers, where the $i$-th integer represents the color of the $i$-th pixel in the image. The image is in black and white, therefore the color of each pixel will be an integer between 0 and 255 (inclusive).
To implement the filter, students are required to divide the black and white color range [0, 255] into groups of consecutive colors, and select one color in each group to be the group’s key. In order to preserve image details, the size of a group must not be greater than $k$, and each color should belong to exactly one group.
Finally, the students will replace the color of each pixel in the array with that color’s assigned group key.
To better understand the effect, here is an image of a basking turtle where the Posterization Filter was applied with increasing $k$ to the right.
To make the process of checking the final answer easier, Professor Ibrahim wants students to divide the groups and assign the keys in a way that produces the lexicographically smallest possible array.
Input Specification:
The first line of input contains two integers $n$ and $k$ ($1 \leq n \leq 10^5$, $1 \leq k \leq 256$), the number of pixels in the image, and the maximum size of a group, respectively.
The second line contains $n$ integers $p_1, p_2, \dots, p_n$ ($0 \leq p_i \leq 255$), where $p_i$ is the color of the $i$-th pixel.
Output Specification:
Print $n$ space-separated integers; the lexicographically smallest possible array that represents the image after applying the Posterization filter.
Demo Input:
['4 3\n2 14 3 4\n', '5 2\n0 2 1 255 254\n']
Demo Output:
['0 12 3 3\n', '0 1 1 254 254\n']
Note:
One possible way to group colors and assign keys for the first sample:
Color $2$ belongs to the group $[0,2]$, with group key $0$.
Color $14$ belongs to the group $[12,14]$, with group key $12$.
Colors $3$ and $4$ belong to group $[3, 5]$, with group key $3$.
Other groups won't affect the result so they are not listed here.
|
```python
import sys
n, k = map(int, next(sys.stdin).rstrip().split())
xs = list(map(int, next(sys.stdin).rstrip().split()))
mapka = {}
lengths = {}
result = []
for x in xs:
if x in mapka:
result.append(mapka[x])
else:
left = max(0, x - k + 1)
range_potential = x - left
for i in range(range_potential, -1, -1):
potential_left = x - i
if potential_left not in mapka:
result.append(potential_left)
for y in range(potential_left, x + 1):
mapka[y] = potential_left
lengths[potential_left] = x - potential_left + 1
break
else:
if lengths[mapka[potential_left]] + (x - potential_left) <= k:
result.append(mapka[potential_left])
for y in range(potential_left, x + 1):
mapka[y] = mapka[potential_left]
lengths[mapka[potential_left]] += 1
break
print(' '.join(map(str, result)))
```
| 0
|
|
496
|
B
|
Secret Combination
|
PROGRAMMING
| 1,500
|
[
"brute force",
"constructive algorithms",
"implementation"
] | null | null |
You got a box with a combination lock. The lock has a display showing *n* digits. There are two buttons on the box, each button changes digits on the display. You have quickly discovered that the first button adds 1 to all the digits (all digits 9 become digits 0), and the second button shifts all the digits on the display one position to the right (the last digit becomes the first one). For example, if the display is currently showing number 579, then if we push the first button, the display will show 680, and if after that we push the second button, the display will show 068.
You know that the lock will open if the display is showing the smallest possible number that can be obtained by pushing the buttons in some order. The leading zeros are ignored while comparing numbers. Now your task is to find the desired number.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of digits on the display.
The second line contains *n* digits — the initial state of the display.
|
Print a single line containing *n* digits — the desired state of the display containing the smallest possible number.
|
[
"3\n579\n",
"4\n2014\n"
] |
[
"024\n",
"0142\n"
] |
none
| 1,000
|
[
{
"input": "3\n579",
"output": "024"
},
{
"input": "4\n2014",
"output": "0142"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "3\n039",
"output": "014"
},
{
"input": "4\n4444",
"output": "0000"
},
{
"input": "5\n46802",
"output": "02468"
},
{
"input": "10\n4447444444",
"output": "0000000003"
},
{
"input": "10\n5810438174",
"output": "0147609473"
},
{
"input": "30\n027027027027027027027027027027",
"output": "027027027027027027027027027027"
},
{
"input": "50\n41012516454101251645410125164541012516454101251645",
"output": "01076781720107678172010767817201076781720107678172"
},
{
"input": "72\n464553044645330446455304464553064645530445455304464553044645530446455304",
"output": "001011960020119600201196002011960020119600201996002011960020119620201196"
},
{
"input": "100\n2144315253572020279108092911160072328496568665545836825277616363478721946398140227406814602154768031",
"output": "0005996121738545755443472571416650525236761083528703911639570359104365792010332041424619191680979818"
},
{
"input": "200\n79025531557298703099245700860027432585447902553155729870309924570086002743258544790255315572987030992457008600274325854479025531557298703099245700860027432585447902553155729870309924570086002743258544",
"output": "00274325854479025531557298703099245700860027432585447902553155729870309924570086002743258544790255315572987030992457008600274325854479025531557298703099245700860027432585447902553155729870309924570086"
},
{
"input": "100\n6669666666666666666866266666666666666666666666666666666666666666626666666666666966666766665667666656",
"output": "0000000000000000000000000000000000000000006000000000000030000010000900100009000030000000000000002006"
},
{
"input": "1\n0",
"output": "0"
}
] | 1,619,459,020
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 6
| 93
| 1,740,800
|
length = int(input())
number = input()
def add(n):
num = str(n)
s = ""
for i in num:
ad = int(i) + 1
if(ad>9):
ad = 0
s = s + str(ad)
return s
def reverse(num):
return num[-1] + num[:-1]
dict_map ={}
def recursion(num,height):
if(height == 10):
return num
return min( min( int(add(num)),int(recursion(add(num) ,height+1)) ) , min(int(reverse(num)) ,int( recursion(reverse(num),height+1) ) ) )
ans = str(recursion(number,1))
for each in range(len(ans) , length):
ans = "0" + ans
print(ans)
|
Title: Secret Combination
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You got a box with a combination lock. The lock has a display showing *n* digits. There are two buttons on the box, each button changes digits on the display. You have quickly discovered that the first button adds 1 to all the digits (all digits 9 become digits 0), and the second button shifts all the digits on the display one position to the right (the last digit becomes the first one). For example, if the display is currently showing number 579, then if we push the first button, the display will show 680, and if after that we push the second button, the display will show 068.
You know that the lock will open if the display is showing the smallest possible number that can be obtained by pushing the buttons in some order. The leading zeros are ignored while comparing numbers. Now your task is to find the desired number.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of digits on the display.
The second line contains *n* digits — the initial state of the display.
Output Specification:
Print a single line containing *n* digits — the desired state of the display containing the smallest possible number.
Demo Input:
['3\n579\n', '4\n2014\n']
Demo Output:
['024\n', '0142\n']
Note:
none
|
```python
length = int(input())
number = input()
def add(n):
num = str(n)
s = ""
for i in num:
ad = int(i) + 1
if(ad>9):
ad = 0
s = s + str(ad)
return s
def reverse(num):
return num[-1] + num[:-1]
dict_map ={}
def recursion(num,height):
if(height == 10):
return num
return min( min( int(add(num)),int(recursion(add(num) ,height+1)) ) , min(int(reverse(num)) ,int( recursion(reverse(num),height+1) ) ) )
ans = str(recursion(number,1))
for each in range(len(ans) , length):
ans = "0" + ans
print(ans)
```
| 0
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,684,496,973
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 60
| 0
|
num = int(input().split())
yomama = [0,0,0]
for a in range(num):
x = input().split()
for b in range(3):
yomama[b] += x[b]
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
num = int(input().split())
yomama = [0,0,0]
for a in range(num):
x = input().split()
for b in range(3):
yomama[b] += x[b]
```
| -1
|
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.