contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
In the year of $30XX$ participants of some world programming championship live in a single large hotel. The hotel has $n$ floors. Each floor has $m$ sections with a single corridor connecting all of them. The sections are enumerated from $1$ to $m$ along the corridor, and all sections with equal numbers on different floors are located exactly one above the other. Thus, the hotel can be represented as a rectangle of height $n$ and width $m$. We can denote sections with pairs of integers $(i, j)$, where $i$ is the floor, and $j$ is the section number on the floor.
The guests can walk along the corridor on each floor, use stairs and elevators. Each stairs or elevator occupies all sections $(1, x)$, $(2, x)$, $\ldots$, $(n, x)$ for some $x$ between $1$ and $m$. All sections not occupied with stairs or elevators contain guest rooms. It takes one time unit to move between neighboring sections on the same floor or to move one floor up or down using stairs. It takes one time unit to move up to $v$ floors in any direction using an elevator. You can assume you don't have to wait for an elevator, and the time needed to enter or exit an elevator is negligible.
You are to process $q$ queries. Each query is a question "what is the minimum time needed to go from a room in section $(x_1, y_1)$ to a room in section $(x_2, y_2)$?"
|
The first line contains five integers $n, m, c_l, c_e, v$ ($2 \leq n, m \leq 10^8$, $0 \leq c_l, c_e \leq 10^5$, $1 \leq c_l + c_e \leq m - 1$, $1 \leq v \leq n - 1$) — the number of floors and section on each floor, the number of stairs, the number of elevators and the maximum speed of an elevator, respectively.
The second line contains $c_l$ integers $l_1, \ldots, l_{c_l}$ in increasing order ($1 \leq l_i \leq m$), denoting the positions of the stairs. If $c_l = 0$, the second line is empty.
The third line contains $c_e$ integers $e_1, \ldots, e_{c_e}$ in increasing order, denoting the elevators positions in the same format. It is guaranteed that all integers $l_i$ and $e_i$ are distinct.
The fourth line contains a single integer $q$ ($1 \leq q \leq 10^5$) — the number of queries.
The next $q$ lines describe queries. Each of these lines contains four integers $x_1, y_1, x_2, y_2$ ($1 \leq x_1, x_2 \leq n$, $1 \leq y_1, y_2 \leq m$) — the coordinates of starting and finishing sections for the query. It is guaranteed that the starting and finishing sections are distinct. It is also guaranteed that these sections contain guest rooms, i. e. $y_1$ and $y_2$ are not among $l_i$ and $e_i$.
|
Print $q$ integers, one per line — the answers for the queries.
|
[
"5 6 1 1 3\n2\n5\n3\n1 1 5 6\n1 3 5 4\n3 3 5 3\n"
] |
[
"7\n5\n4\n"
] |
In the first query the optimal way is to go to the elevator in the 5-th section in four time units, use it to go to the fifth floor in two time units and go to the destination in one more time unit.
In the second query it is still optimal to use the elevator, but in the third query it is better to use the stairs in the section 2.
| 0
|
[
{
"input": "5 6 1 1 3\n2\n5\n3\n1 1 5 6\n1 3 5 4\n3 3 5 3",
"output": "7\n5\n4"
},
{
"input": "2 2 0 1 1\n\n1\n1\n1 2 2 2",
"output": "3"
},
{
"input": "4 4 1 0 1\n4\n\n5\n1 1 2 2\n1 3 2 2\n3 3 4 3\n3 2 2 2\n1 2 2 3",
"output": "6\n4\n3\n5\n4"
},
{
"input": "10 10 1 8 4\n10\n2 3 4 5 6 7 8 9\n10\n1 1 3 1\n2 1 7 1\n1 1 9 1\n7 1 4 1\n10 1 7 1\n2 1 7 1\n3 1 2 1\n5 1 2 1\n10 1 5 1\n6 1 9 1",
"output": "3\n4\n4\n3\n3\n4\n3\n3\n4\n3"
},
{
"input": "2 5 1 0 1\n2\n\n1\n1 4 1 5",
"output": "1"
},
{
"input": "2 10 1 1 1\n1\n10\n1\n1 5 1 8",
"output": "3"
},
{
"input": "4 4 1 0 1\n1\n\n1\n1 2 1 4",
"output": "2"
},
{
"input": "2 4 1 1 1\n1\n2\n1\n2 3 2 4",
"output": "1"
},
{
"input": "1000 1000 1 1 10\n1\n2\n1\n1 900 1 1000",
"output": "100"
},
{
"input": "2 4 1 1 1\n1\n4\n1\n1 2 1 3",
"output": "1"
},
{
"input": "5 5 1 1 1\n3\n2\n1\n1 5 1 1",
"output": "4"
}
] | 1,642,677,044
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 15
| 0
|
n = int(input())
bills = 0
while n >= 100:
n -= 100
bills += 1
while n >= 20:
n -= 20
bills += 1
while n >= 10:
n -= 10
bills += 1
while n >= 5:
n -= 5
bills += 1
while n >= 1:
n -= 1
bills += 1
print(bills)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the year of $30XX$ participants of some world programming championship live in a single large hotel. The hotel has $n$ floors. Each floor has $m$ sections with a single corridor connecting all of them. The sections are enumerated from $1$ to $m$ along the corridor, and all sections with equal numbers on different floors are located exactly one above the other. Thus, the hotel can be represented as a rectangle of height $n$ and width $m$. We can denote sections with pairs of integers $(i, j)$, where $i$ is the floor, and $j$ is the section number on the floor.
The guests can walk along the corridor on each floor, use stairs and elevators. Each stairs or elevator occupies all sections $(1, x)$, $(2, x)$, $\ldots$, $(n, x)$ for some $x$ between $1$ and $m$. All sections not occupied with stairs or elevators contain guest rooms. It takes one time unit to move between neighboring sections on the same floor or to move one floor up or down using stairs. It takes one time unit to move up to $v$ floors in any direction using an elevator. You can assume you don't have to wait for an elevator, and the time needed to enter or exit an elevator is negligible.
You are to process $q$ queries. Each query is a question "what is the minimum time needed to go from a room in section $(x_1, y_1)$ to a room in section $(x_2, y_2)$?"
Input Specification:
The first line contains five integers $n, m, c_l, c_e, v$ ($2 \leq n, m \leq 10^8$, $0 \leq c_l, c_e \leq 10^5$, $1 \leq c_l + c_e \leq m - 1$, $1 \leq v \leq n - 1$) — the number of floors and section on each floor, the number of stairs, the number of elevators and the maximum speed of an elevator, respectively.
The second line contains $c_l$ integers $l_1, \ldots, l_{c_l}$ in increasing order ($1 \leq l_i \leq m$), denoting the positions of the stairs. If $c_l = 0$, the second line is empty.
The third line contains $c_e$ integers $e_1, \ldots, e_{c_e}$ in increasing order, denoting the elevators positions in the same format. It is guaranteed that all integers $l_i$ and $e_i$ are distinct.
The fourth line contains a single integer $q$ ($1 \leq q \leq 10^5$) — the number of queries.
The next $q$ lines describe queries. Each of these lines contains four integers $x_1, y_1, x_2, y_2$ ($1 \leq x_1, x_2 \leq n$, $1 \leq y_1, y_2 \leq m$) — the coordinates of starting and finishing sections for the query. It is guaranteed that the starting and finishing sections are distinct. It is also guaranteed that these sections contain guest rooms, i. e. $y_1$ and $y_2$ are not among $l_i$ and $e_i$.
Output Specification:
Print $q$ integers, one per line — the answers for the queries.
Demo Input:
['5 6 1 1 3\n2\n5\n3\n1 1 5 6\n1 3 5 4\n3 3 5 3\n']
Demo Output:
['7\n5\n4\n']
Note:
In the first query the optimal way is to go to the elevator in the 5-th section in four time units, use it to go to the fifth floor in two time units and go to the destination in one more time unit.
In the second query it is still optimal to use the elevator, but in the third query it is better to use the stairs in the section 2.
|
```python
n = int(input())
bills = 0
while n >= 100:
n -= 100
bills += 1
while n >= 20:
n -= 20
bills += 1
while n >= 10:
n -= 10
bills += 1
while n >= 5:
n -= 5
bills += 1
while n >= 1:
n -= 1
bills += 1
print(bills)
```
| -1
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,664,004,961
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 5
| 122
| 2,867,200
|
n = int(input())
numbers_str = input()
numbers_evenness = []
for i in range(0,2*n,2):
numbers_evenness.append(int(numbers_str[i]))
if numbers_evenness[0]%2 != numbers_evenness[1]%2:
if numbers_evenness[2]%2 == numbers_evenness[0]%2:
print('2')
else:
print('1')
else:
for i in range(2,n+1):
if numbers_evenness[i]%2 != numbers_evenness[0]%2:
print(i+1)
break
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
n = int(input())
numbers_str = input()
numbers_evenness = []
for i in range(0,2*n,2):
numbers_evenness.append(int(numbers_str[i]))
if numbers_evenness[0]%2 != numbers_evenness[1]%2:
if numbers_evenness[2]%2 == numbers_evenness[0]%2:
print('2')
else:
print('1')
else:
for i in range(2,n+1):
if numbers_evenness[i]%2 != numbers_evenness[0]%2:
print(i+1)
break
```
| -1
|
102
|
B
|
Sum of Digits
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
B. Sum of Digits
|
2
|
265
|
Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit?
|
The first line contains the only integer *n* (0<=≤<=*n*<=≤<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes.
|
Print the number of times a number can be replaced by the sum of its digits until it only contains one digit.
|
[
"0\n",
"10\n",
"991\n"
] |
[
"0\n",
"1\n",
"3\n"
] |
In the first sample the number already is one-digit — Herald can't cast a spell.
The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once.
The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit.
| 1,000
|
[
{
"input": "0",
"output": "0"
},
{
"input": "10",
"output": "1"
},
{
"input": "991",
"output": "3"
},
{
"input": "99",
"output": "2"
},
{
"input": "100",
"output": "1"
},
{
"input": "123456789",
"output": "2"
},
{
"input": "32",
"output": "1"
},
{
"input": "86",
"output": "2"
},
{
"input": "2",
"output": "0"
},
{
"input": "8",
"output": "0"
},
{
"input": "34",
"output": "1"
},
{
"input": "13",
"output": "1"
},
{
"input": "28",
"output": "2"
},
{
"input": "23",
"output": "1"
},
{
"input": "57",
"output": "2"
},
{
"input": "29",
"output": "2"
},
{
"input": "353869285",
"output": "3"
},
{
"input": "549548646",
"output": "2"
},
{
"input": "858893424",
"output": "2"
},
{
"input": "644818852",
"output": "3"
},
{
"input": "360322525",
"output": "3"
},
{
"input": "122937520",
"output": "2"
},
{
"input": "288403032",
"output": "2"
},
{
"input": "677257481",
"output": "3"
},
{
"input": "58059561",
"output": "3"
},
{
"input": "211288847",
"output": "2"
},
{
"input": "339900034079539584",
"output": "2"
},
{
"input": "784084029310269952",
"output": "3"
},
{
"input": "774730557264864000",
"output": "3"
},
{
"input": "478233807148352256",
"output": "3"
},
{
"input": "165646874056812544",
"output": "3"
},
{
"input": "477533739511673792",
"output": "3"
},
{
"input": "660119944377002240",
"output": "3"
},
{
"input": "448375218506078080",
"output": "3"
},
{
"input": "77213334785795616",
"output": "3"
},
{
"input": "165767221702271872",
"output": "3"
},
{
"input": "1",
"output": "0"
},
{
"input": "5",
"output": "0"
},
{
"input": "8",
"output": "0"
},
{
"input": "156161456146164104103460452045416165146141414651641564105461465156445621465146514562146145465165145145614561465145614561",
"output": "3"
},
{
"input": "9",
"output": "0"
}
] | 1,614,689,007
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 51
| 1,996
| 1,638,400
|
import sys
input = sys.stdin.readline
import math
def inpit(): #int
return(int(input()))
def inplt(): #list
return(list(map(int,input().split())))
def inpstr(): #string
s = input()
return(list(s[:len(s) - 1]))
def inpspit(): #spaced intergers
return(map(int,input().split()))
n= str(inpit())
if(len(n) ==1):
print(0)
else:
t = 0
while(True):
n = str(sum([int(i) for i in n]))
t = t +1
if(len(n)==1):
print(t)
break
|
Title: Sum of Digits
Time Limit: 2 seconds
Memory Limit: 265 megabytes
Problem Description:
Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit?
Input Specification:
The first line contains the only integer *n* (0<=≤<=*n*<=≤<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes.
Output Specification:
Print the number of times a number can be replaced by the sum of its digits until it only contains one digit.
Demo Input:
['0\n', '10\n', '991\n']
Demo Output:
['0\n', '1\n', '3\n']
Note:
In the first sample the number already is one-digit — Herald can't cast a spell.
The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once.
The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit.
|
```python
import sys
input = sys.stdin.readline
import math
def inpit(): #int
return(int(input()))
def inplt(): #list
return(list(map(int,input().split())))
def inpstr(): #string
s = input()
return(list(s[:len(s) - 1]))
def inpspit(): #spaced intergers
return(map(int,input().split()))
n= str(inpit())
if(len(n) ==1):
print(0)
else:
t = 0
while(True):
n = str(sum([int(i) for i in n]))
t = t +1
if(len(n)==1):
print(t)
break
```
| 3.498052
|
264
|
A
|
Escape from Stones
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"data structures",
"implementation",
"two pointers"
] | null | null |
Squirrel Liss lived in a forest peacefully, but unexpected trouble happens. Stones fall from a mountain. Initially Squirrel Liss occupies an interval [0,<=1]. Next, *n* stones will fall and Liss will escape from the stones. The stones are numbered from 1 to *n* in order.
The stones always fall to the center of Liss's interval. When Liss occupies the interval [*k*<=-<=*d*,<=*k*<=+<=*d*] and a stone falls to *k*, she will escape to the left or to the right. If she escapes to the left, her new interval will be [*k*<=-<=*d*,<=*k*]. If she escapes to the right, her new interval will be [*k*,<=*k*<=+<=*d*].
You are given a string *s* of length *n*. If the *i*-th character of *s* is "l" or "r", when the *i*-th stone falls Liss will escape to the left or to the right, respectively. Find the sequence of stones' numbers from left to right after all the *n* stones falls.
|
The input consists of only one line. The only line contains the string *s* (1<=≤<=|*s*|<=≤<=106). Each character in *s* will be either "l" or "r".
|
Output *n* lines — on the *i*-th line you should print the *i*-th stone's number from the left.
|
[
"llrlr\n",
"rrlll\n",
"lrlrr\n"
] |
[
"3\n5\n4\n2\n1\n",
"1\n2\n5\n4\n3\n",
"2\n4\n5\n3\n1\n"
] |
In the first example, the positions of stones 1, 2, 3, 4, 5 will be <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/58fdb5684df807bfcb705a9da9ce175613362b7d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, respectively. So you should print the sequence: 3, 5, 4, 2, 1.
| 500
|
[
{
"input": "llrlr",
"output": "3\n5\n4\n2\n1"
},
{
"input": "rrlll",
"output": "1\n2\n5\n4\n3"
},
{
"input": "lrlrr",
"output": "2\n4\n5\n3\n1"
},
{
"input": "lllrlrllrl",
"output": "4\n6\n9\n10\n8\n7\n5\n3\n2\n1"
},
{
"input": "llrlrrrlrr",
"output": "3\n5\n6\n7\n9\n10\n8\n4\n2\n1"
},
{
"input": "rlrrrllrrr",
"output": "1\n3\n4\n5\n8\n9\n10\n7\n6\n2"
},
{
"input": "lrrlrrllrrrrllllllrr",
"output": "2\n3\n5\n6\n9\n10\n11\n12\n19\n20\n18\n17\n16\n15\n14\n13\n8\n7\n4\n1"
},
{
"input": "rlrrrlrrrllrrllrlrll",
"output": "1\n3\n4\n5\n7\n8\n9\n12\n13\n16\n18\n20\n19\n17\n15\n14\n11\n10\n6\n2"
},
{
"input": "lllrrlrlrllrrrrrllrl",
"output": "4\n5\n7\n9\n12\n13\n14\n15\n16\n19\n20\n18\n17\n11\n10\n8\n6\n3\n2\n1"
},
{
"input": "rrrllrrrlllrlllrlrrr",
"output": "1\n2\n3\n6\n7\n8\n12\n16\n18\n19\n20\n17\n15\n14\n13\n11\n10\n9\n5\n4"
},
{
"input": "rrlllrrrlrrlrrrlllrlrlrrrlllrllrrllrllrrlrlrrllllrlrrrrlrlllrlrrrlrlrllrlrlrrlrrllrrrlrlrlllrrllllrl",
"output": "1\n2\n6\n7\n8\n10\n11\n13\n14\n15\n19\n21\n23\n24\n25\n29\n32\n33\n36\n39\n40\n42\n44\n45\n50\n52\n53\n54\n55\n57\n61\n63\n64\n65\n67\n69\n72\n74\n76\n77\n79\n80\n83\n84\n85\n87\n89\n93\n94\n99\n100\n98\n97\n96\n95\n92\n91\n90\n88\n86\n82\n81\n78\n75\n73\n71\n70\n68\n66\n62\n60\n59\n58\n56\n51\n49\n48\n47\n46\n43\n41\n38\n37\n35\n34\n31\n30\n28\n27\n26\n22\n20\n18\n17\n16\n12\n9\n5\n4\n3"
},
{
"input": "llrlrlllrrllrllllrlrrlrlrrllrlrlrrlrrrrrrlllrrlrrrrrlrrrlrlrlrrlllllrrrrllrrlrlrrrllllrlrrlrrlrlrrll",
"output": "3\n5\n9\n10\n13\n18\n20\n21\n23\n25\n26\n29\n31\n33\n34\n36\n37\n38\n39\n40\n41\n45\n46\n48\n49\n50\n51\n52\n54\n55\n56\n58\n60\n62\n63\n69\n70\n71\n72\n75\n76\n78\n80\n81\n82\n87\n89\n90\n92\n93\n95\n97\n98\n100\n99\n96\n94\n91\n88\n86\n85\n84\n83\n79\n77\n74\n73\n68\n67\n66\n65\n64\n61\n59\n57\n53\n47\n44\n43\n42\n35\n32\n30\n28\n27\n24\n22\n19\n17\n16\n15\n14\n12\n11\n8\n7\n6\n4\n2\n1"
},
{
"input": "llrrrrllrrlllrlrllrlrllllllrrrrrrrrllrrrrrrllrlrrrlllrrrrrrlllllllrrlrrllrrrllllrrlllrrrlrlrrlrlrllr",
"output": "3\n4\n5\n6\n9\n10\n14\n16\n19\n21\n28\n29\n30\n31\n32\n33\n34\n35\n38\n39\n40\n41\n42\n43\n46\n48\n49\n50\n54\n55\n56\n57\n58\n59\n67\n68\n70\n71\n74\n75\n76\n81\n82\n86\n87\n88\n90\n92\n93\n95\n97\n100\n99\n98\n96\n94\n91\n89\n85\n84\n83\n80\n79\n78\n77\n73\n72\n69\n66\n65\n64\n63\n62\n61\n60\n53\n52\n51\n47\n45\n44\n37\n36\n27\n26\n25\n24\n23\n22\n20\n18\n17\n15\n13\n12\n11\n8\n7\n2\n1"
},
{
"input": "lllllrllrrlllrrrllrrrrlrrlrllllrrrrrllrlrllllllrrlrllrlrllrlrrlrlrrlrrrlrrrrllrlrrrrrrrllrllrrlrllrl",
"output": "6\n9\n10\n14\n15\n16\n19\n20\n21\n22\n24\n25\n27\n32\n33\n34\n35\n36\n39\n41\n48\n49\n51\n54\n56\n59\n61\n62\n64\n66\n67\n69\n70\n71\n73\n74\n75\n76\n79\n81\n82\n83\n84\n85\n86\n87\n90\n93\n94\n96\n99\n100\n98\n97\n95\n92\n91\n89\n88\n80\n78\n77\n72\n68\n65\n63\n60\n58\n57\n55\n53\n52\n50\n47\n46\n45\n44\n43\n42\n40\n38\n37\n31\n30\n29\n28\n26\n23\n18\n17\n13\n12\n11\n8\n7\n5\n4\n3\n2\n1"
},
{
"input": "llrlrlrlrlrlrrlllllllrllllrllrrrlllrrllrllrrlllrrlllrlrrllllrrlllrrllrrllllrrlllrlllrrrllrrrrrrllrrl",
"output": "3\n5\n7\n9\n11\n13\n14\n22\n27\n30\n31\n32\n36\n37\n40\n43\n44\n48\n49\n53\n55\n56\n61\n62\n66\n67\n70\n71\n76\n77\n81\n85\n86\n87\n90\n91\n92\n93\n94\n95\n98\n99\n100\n97\n96\n89\n88\n84\n83\n82\n80\n79\n78\n75\n74\n73\n72\n69\n68\n65\n64\n63\n60\n59\n58\n57\n54\n52\n51\n50\n47\n46\n45\n42\n41\n39\n38\n35\n34\n33\n29\n28\n26\n25\n24\n23\n21\n20\n19\n18\n17\n16\n15\n12\n10\n8\n6\n4\n2\n1"
},
{
"input": "l",
"output": "1"
},
{
"input": "r",
"output": "1"
}
] | 1,643,040,913
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 30
| 2,000
| 6,656,000
|
# Escape from Stones
ui = input()
output = []
pos = 0
for i, c in enumerate(ui):
output.insert(pos, i+1)
if(c == 'r'):
pos += 1
for num in output:
print(num)
|
Title: Escape from Stones
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Squirrel Liss lived in a forest peacefully, but unexpected trouble happens. Stones fall from a mountain. Initially Squirrel Liss occupies an interval [0,<=1]. Next, *n* stones will fall and Liss will escape from the stones. The stones are numbered from 1 to *n* in order.
The stones always fall to the center of Liss's interval. When Liss occupies the interval [*k*<=-<=*d*,<=*k*<=+<=*d*] and a stone falls to *k*, she will escape to the left or to the right. If she escapes to the left, her new interval will be [*k*<=-<=*d*,<=*k*]. If she escapes to the right, her new interval will be [*k*,<=*k*<=+<=*d*].
You are given a string *s* of length *n*. If the *i*-th character of *s* is "l" or "r", when the *i*-th stone falls Liss will escape to the left or to the right, respectively. Find the sequence of stones' numbers from left to right after all the *n* stones falls.
Input Specification:
The input consists of only one line. The only line contains the string *s* (1<=≤<=|*s*|<=≤<=106). Each character in *s* will be either "l" or "r".
Output Specification:
Output *n* lines — on the *i*-th line you should print the *i*-th stone's number from the left.
Demo Input:
['llrlr\n', 'rrlll\n', 'lrlrr\n']
Demo Output:
['3\n5\n4\n2\n1\n', '1\n2\n5\n4\n3\n', '2\n4\n5\n3\n1\n']
Note:
In the first example, the positions of stones 1, 2, 3, 4, 5 will be <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/58fdb5684df807bfcb705a9da9ce175613362b7d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, respectively. So you should print the sequence: 3, 5, 4, 2, 1.
|
```python
# Escape from Stones
ui = input()
output = []
pos = 0
for i, c in enumerate(ui):
output.insert(pos, i+1)
if(c == 'r'):
pos += 1
for num in output:
print(num)
```
| 0
|
|
508
|
A
|
Pasha and Pixels
|
PROGRAMMING
| 1,100
|
[
"brute force"
] | null | null |
Pasha loves his phone and also putting his hair up... But the hair is now irrelevant.
Pasha has installed a new game to his phone. The goal of the game is following. There is a rectangular field consisting of *n* row with *m* pixels in each row. Initially, all the pixels are colored white. In one move, Pasha can choose any pixel and color it black. In particular, he can choose the pixel that is already black, then after the boy's move the pixel does not change, that is, it remains black. Pasha loses the game when a 2<=×<=2 square consisting of black pixels is formed.
Pasha has made a plan of *k* moves, according to which he will paint pixels. Each turn in his plan is represented as a pair of numbers *i* and *j*, denoting respectively the row and the column of the pixel to be colored on the current move.
Determine whether Pasha loses if he acts in accordance with his plan, and if he does, on what move the 2<=×<=2 square consisting of black pixels is formed.
|
The first line of the input contains three integers *n*,<=*m*,<=*k* (1<=≤<=*n*,<=*m*<=≤<=1000, 1<=≤<=*k*<=≤<=105) — the number of rows, the number of columns and the number of moves that Pasha is going to perform.
The next *k* lines contain Pasha's moves in the order he makes them. Each line contains two integers *i* and *j* (1<=≤<=*i*<=≤<=*n*, 1<=≤<=*j*<=≤<=*m*), representing the row number and column number of the pixel that was painted during a move.
|
If Pasha loses, print the number of the move when the 2<=×<=2 square consisting of black pixels is formed.
If Pasha doesn't lose, that is, no 2<=×<=2 square consisting of black pixels is formed during the given *k* moves, print 0.
|
[
"2 2 4\n1 1\n1 2\n2 1\n2 2\n",
"2 3 6\n2 3\n2 2\n1 3\n2 2\n1 2\n1 1\n",
"5 3 7\n2 3\n1 2\n1 1\n4 1\n3 1\n5 3\n3 2\n"
] |
[
"4\n",
"5\n",
"0\n"
] |
none
| 500
|
[
{
"input": "2 2 4\n1 1\n1 2\n2 1\n2 2",
"output": "4"
},
{
"input": "2 3 6\n2 3\n2 2\n1 3\n2 2\n1 2\n1 1",
"output": "5"
},
{
"input": "5 3 7\n2 3\n1 2\n1 1\n4 1\n3 1\n5 3\n3 2",
"output": "0"
},
{
"input": "3 3 11\n2 1\n3 1\n1 1\n1 3\n1 2\n2 3\n3 3\n3 2\n2 2\n1 3\n3 3",
"output": "9"
},
{
"input": "2 2 5\n1 1\n2 1\n2 1\n1 2\n2 2",
"output": "5"
},
{
"input": "518 518 10\n37 97\n47 278\n17 467\n158 66\n483 351\n83 123\n285 219\n513 187\n380 75\n304 352",
"output": "0"
},
{
"input": "1 1 5\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "0"
},
{
"input": "1 5 5\n1 1\n1 2\n1 3\n1 4\n1 5",
"output": "0"
},
{
"input": "5 1 5\n1 1\n2 1\n3 1\n4 1\n5 1",
"output": "0"
},
{
"input": "1 1 1\n1 1",
"output": "0"
},
{
"input": "10 10 4\n5 9\n6 9\n6 10\n5 10",
"output": "4"
},
{
"input": "1000 1000 4\n999 999\n999 1000\n1000 999\n1000 1000",
"output": "4"
},
{
"input": "2 3 5\n2 3\n1 3\n1 2\n1 1\n2 2",
"output": "5"
},
{
"input": "1000 1000 4\n1000 1000\n999 999\n1000 999\n999 1000",
"output": "4"
}
] | 1,697,768,204
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
n, m, k = map(int, input().split())
black_pixels = set()
def check_square(i, j):
count = 0
for di in range(-1, 2):
for dj in range(-1, 2):
if (i+di, j+dj) in black_pixels:
count += 1
return count == 3
for move in range(1, k+1):
i, j = map(int, input().split())
black_pixels.add((i-1, j-1))
for di in range(-1, 2):
for dj in range(-1, 2):
if (i-1+di, j-1+dj) in black_pixels and check_square(i-1+di, j-1+dj):
print(move)
exit()
print(0)
|
Title: Pasha and Pixels
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha loves his phone and also putting his hair up... But the hair is now irrelevant.
Pasha has installed a new game to his phone. The goal of the game is following. There is a rectangular field consisting of *n* row with *m* pixels in each row. Initially, all the pixels are colored white. In one move, Pasha can choose any pixel and color it black. In particular, he can choose the pixel that is already black, then after the boy's move the pixel does not change, that is, it remains black. Pasha loses the game when a 2<=×<=2 square consisting of black pixels is formed.
Pasha has made a plan of *k* moves, according to which he will paint pixels. Each turn in his plan is represented as a pair of numbers *i* and *j*, denoting respectively the row and the column of the pixel to be colored on the current move.
Determine whether Pasha loses if he acts in accordance with his plan, and if he does, on what move the 2<=×<=2 square consisting of black pixels is formed.
Input Specification:
The first line of the input contains three integers *n*,<=*m*,<=*k* (1<=≤<=*n*,<=*m*<=≤<=1000, 1<=≤<=*k*<=≤<=105) — the number of rows, the number of columns and the number of moves that Pasha is going to perform.
The next *k* lines contain Pasha's moves in the order he makes them. Each line contains two integers *i* and *j* (1<=≤<=*i*<=≤<=*n*, 1<=≤<=*j*<=≤<=*m*), representing the row number and column number of the pixel that was painted during a move.
Output Specification:
If Pasha loses, print the number of the move when the 2<=×<=2 square consisting of black pixels is formed.
If Pasha doesn't lose, that is, no 2<=×<=2 square consisting of black pixels is formed during the given *k* moves, print 0.
Demo Input:
['2 2 4\n1 1\n1 2\n2 1\n2 2\n', '2 3 6\n2 3\n2 2\n1 3\n2 2\n1 2\n1 1\n', '5 3 7\n2 3\n1 2\n1 1\n4 1\n3 1\n5 3\n3 2\n']
Demo Output:
['4\n', '5\n', '0\n']
Note:
none
|
```python
n, m, k = map(int, input().split())
black_pixels = set()
def check_square(i, j):
count = 0
for di in range(-1, 2):
for dj in range(-1, 2):
if (i+di, j+dj) in black_pixels:
count += 1
return count == 3
for move in range(1, k+1):
i, j = map(int, input().split())
black_pixels.add((i-1, j-1))
for di in range(-1, 2):
for dj in range(-1, 2):
if (i-1+di, j-1+dj) in black_pixels and check_square(i-1+di, j-1+dj):
print(move)
exit()
print(0)
```
| 0
|
|
344
|
A
|
Magnets
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Mad scientist Mike entertains himself by arranging rows of dominoes. He doesn't need dominoes, though: he uses rectangular magnets instead. Each magnet has two poles, positive (a "plus") and negative (a "minus"). If two magnets are put together at a close distance, then the like poles will repel each other and the opposite poles will attract each other.
Mike starts by laying one magnet horizontally on the table. During each following step Mike adds one more magnet horizontally to the right end of the row. Depending on how Mike puts the magnet on the table, it is either attracted to the previous one (forming a group of multiple magnets linked together) or repelled by it (then Mike lays this magnet at some distance to the right from the previous one). We assume that a sole magnet not linked to others forms a group of its own.
Mike arranged multiple magnets in a row. Determine the number of groups that the magnets formed.
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100000) — the number of magnets. Then *n* lines follow. The *i*-th line (1<=≤<=*i*<=≤<=*n*) contains either characters "01", if Mike put the *i*-th magnet in the "plus-minus" position, or characters "10", if Mike put the magnet in the "minus-plus" position.
|
On the single line of the output print the number of groups of magnets.
|
[
"6\n10\n10\n10\n01\n10\n10\n",
"4\n01\n01\n10\n10\n"
] |
[
"3\n",
"2\n"
] |
The first testcase corresponds to the figure. The testcase has three groups consisting of three, one and two magnets.
The second testcase has two groups, each consisting of two magnets.
| 500
|
[
{
"input": "6\n10\n10\n10\n01\n10\n10",
"output": "3"
},
{
"input": "4\n01\n01\n10\n10",
"output": "2"
},
{
"input": "1\n10",
"output": "1"
},
{
"input": "2\n01\n10",
"output": "2"
},
{
"input": "2\n10\n10",
"output": "1"
},
{
"input": "3\n10\n01\n10",
"output": "3"
},
{
"input": "1\n01",
"output": "1"
},
{
"input": "2\n01\n01",
"output": "1"
},
{
"input": "2\n10\n01",
"output": "2"
},
{
"input": "3\n01\n01\n01",
"output": "1"
},
{
"input": "3\n10\n10\n01",
"output": "2"
},
{
"input": "3\n01\n10\n10",
"output": "2"
},
{
"input": "115\n10\n10\n10\n10\n01\n01\n10\n10\n10\n01\n01\n10\n01\n01\n10\n10\n10\n01\n10\n01\n10\n10\n01\n01\n10\n10\n10\n10\n01\n10\n01\n01\n10\n10\n10\n10\n01\n10\n10\n10\n01\n10\n01\n10\n10\n10\n10\n01\n01\n01\n10\n10\n01\n01\n01\n10\n10\n01\n10\n01\n01\n01\n01\n10\n10\n01\n10\n01\n01\n01\n01\n01\n10\n01\n10\n10\n01\n01\n01\n10\n01\n01\n10\n10\n01\n01\n01\n01\n01\n10\n01\n10\n01\n10\n01\n01\n01\n10\n01\n10\n10\n01\n10\n10\n01\n01\n01\n10\n10\n10\n10\n10\n10\n10\n10",
"output": "55"
}
] | 1,698,149,866
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 248
| 8,704,000
|
n = int(input())
x = [input() for i in range(n)]
count=0
k = None
for j in x:
if j !=k:
count += 1
k=j
print(count)
|
Title: Magnets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mad scientist Mike entertains himself by arranging rows of dominoes. He doesn't need dominoes, though: he uses rectangular magnets instead. Each magnet has two poles, positive (a "plus") and negative (a "minus"). If two magnets are put together at a close distance, then the like poles will repel each other and the opposite poles will attract each other.
Mike starts by laying one magnet horizontally on the table. During each following step Mike adds one more magnet horizontally to the right end of the row. Depending on how Mike puts the magnet on the table, it is either attracted to the previous one (forming a group of multiple magnets linked together) or repelled by it (then Mike lays this magnet at some distance to the right from the previous one). We assume that a sole magnet not linked to others forms a group of its own.
Mike arranged multiple magnets in a row. Determine the number of groups that the magnets formed.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100000) — the number of magnets. Then *n* lines follow. The *i*-th line (1<=≤<=*i*<=≤<=*n*) contains either characters "01", if Mike put the *i*-th magnet in the "plus-minus" position, or characters "10", if Mike put the magnet in the "minus-plus" position.
Output Specification:
On the single line of the output print the number of groups of magnets.
Demo Input:
['6\n10\n10\n10\n01\n10\n10\n', '4\n01\n01\n10\n10\n']
Demo Output:
['3\n', '2\n']
Note:
The first testcase corresponds to the figure. The testcase has three groups consisting of three, one and two magnets.
The second testcase has two groups, each consisting of two magnets.
|
```python
n = int(input())
x = [input() for i in range(n)]
count=0
k = None
for j in x:
if j !=k:
count += 1
k=j
print(count)
```
| 3
|
|
34
|
A
|
Reconnaissance 2
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Reconnaissance 2
|
2
|
256
|
*n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit.
|
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction.
|
Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle.
|
[
"5\n10 12 13 15 10\n",
"4\n10 20 30 40\n"
] |
[
"5 1\n",
"1 2\n"
] |
none
| 500
|
[
{
"input": "5\n10 12 13 15 10",
"output": "5 1"
},
{
"input": "4\n10 20 30 40",
"output": "1 2"
},
{
"input": "6\n744 359 230 586 944 442",
"output": "2 3"
},
{
"input": "5\n826 747 849 687 437",
"output": "1 2"
},
{
"input": "5\n999 999 993 969 999",
"output": "1 2"
},
{
"input": "5\n4 24 6 1 15",
"output": "3 4"
},
{
"input": "2\n511 32",
"output": "1 2"
},
{
"input": "3\n907 452 355",
"output": "2 3"
},
{
"input": "4\n303 872 764 401",
"output": "4 1"
},
{
"input": "10\n684 698 429 694 956 812 594 170 937 764",
"output": "1 2"
},
{
"input": "20\n646 840 437 946 640 564 936 917 487 752 844 734 468 969 674 646 728 642 514 695",
"output": "7 8"
},
{
"input": "30\n996 999 998 984 989 1000 996 993 1000 983 992 999 999 1000 979 992 987 1000 996 1000 1000 989 981 996 995 999 999 989 999 1000",
"output": "12 13"
},
{
"input": "50\n93 27 28 4 5 78 59 24 19 134 31 128 118 36 90 32 32 1 44 32 33 13 31 10 12 25 38 50 25 12 4 22 28 53 48 83 4 25 57 31 71 24 8 7 28 86 23 80 101 58",
"output": "16 17"
},
{
"input": "88\n1000 1000 1000 1000 1000 998 998 1000 1000 1000 1000 999 999 1000 1000 1000 999 1000 997 999 997 1000 999 998 1000 999 1000 1000 1000 999 1000 999 999 1000 1000 999 1000 999 1000 1000 998 1000 1000 1000 998 998 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 999 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 998 1000 1000 998 1000 999 1000 1000 1000 1000",
"output": "1 2"
},
{
"input": "99\n4 4 21 6 5 3 13 2 6 1 3 4 1 3 1 9 11 1 6 17 4 5 20 4 1 9 5 11 3 4 14 1 3 3 1 4 3 5 27 1 1 2 10 7 11 4 19 7 11 6 11 13 3 1 10 7 2 1 16 1 9 4 29 13 2 12 14 2 21 1 9 8 26 12 12 5 2 14 7 8 8 8 9 4 12 2 6 6 7 16 8 14 2 10 20 15 3 7 4",
"output": "1 2"
},
{
"input": "100\n713 572 318 890 577 657 646 146 373 783 392 229 455 871 20 593 573 336 26 381 280 916 907 732 820 713 111 840 570 446 184 711 481 399 788 647 492 15 40 530 549 506 719 782 126 20 778 996 712 761 9 74 812 418 488 175 103 585 900 3 604 521 109 513 145 708 990 361 682 827 791 22 596 780 596 385 450 643 158 496 876 975 319 783 654 895 891 361 397 81 682 899 347 623 809 557 435 279 513 438",
"output": "86 87"
},
{
"input": "100\n31 75 86 68 111 27 22 22 26 30 54 163 107 75 160 122 14 23 17 26 27 20 43 58 59 71 21 148 9 32 43 91 133 286 132 70 90 156 84 14 77 93 23 18 13 72 18 131 33 28 72 175 30 86 249 20 14 208 28 57 63 199 6 10 24 30 62 267 43 479 60 28 138 1 45 3 19 47 7 166 116 117 50 140 28 14 95 85 93 43 61 15 2 70 10 51 7 95 9 25",
"output": "7 8"
},
{
"input": "100\n896 898 967 979 973 709 961 968 806 967 896 967 826 975 936 903 986 856 851 931 852 971 786 837 949 978 686 936 952 909 965 749 908 916 943 973 983 975 939 886 964 928 960 976 907 788 994 773 949 871 947 980 945 985 726 981 887 943 907 990 931 874 840 867 948 951 961 904 888 901 976 967 994 921 828 970 972 722 755 970 860 855 914 869 714 899 969 978 898 862 642 939 904 936 819 934 884 983 955 964",
"output": "1 2"
},
{
"input": "100\n994 927 872 970 815 986 952 996 965 1000 877 986 978 999 950 990 936 997 993 960 921 860 895 869 943 998 983 968 973 953 999 990 995 871 853 979 973 963 953 938 997 989 993 964 960 973 946 975 1000 962 920 746 989 957 904 965 920 979 966 961 1000 993 975 952 846 971 991 979 985 969 984 973 956 1000 952 778 983 974 956 927 995 997 980 997 1000 970 960 970 988 983 947 904 935 972 1000 863 992 996 932 967",
"output": "81 82"
},
{
"input": "100\n48 108 63 21 27 8 49 21 75 8 24 42 149 18 8 28 21 18 25 35 59 70 59 33 40 1 67 34 120 82 4 115 72 87 3 15 15 63 37 12 40 27 83 14 38 20 14 58 93 10 31 3 39 6 197 77 54 16 31 146 9 49 14 8 77 82 5 11 80 116 8 61 50 24 7 103 29 11 3 3 1 12 46 24 21 131 39 29 36 2 107 40 16 99 31 41 29 48 17 17",
"output": "36 37"
}
] | 1,657,272,312
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 122
| 0
|
n = int(input())
l = list(map(int,input().split()))
f = []
for i in range(n):
f.append(abs(l[i] - l[i-1]))
c = f.index(min(f))
if c == 0:
print(n, 1)
else:
print(c, c + 1)
|
Title: Reconnaissance 2
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
*n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit.
Input Specification:
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction.
Output Specification:
Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle.
Demo Input:
['5\n10 12 13 15 10\n', '4\n10 20 30 40\n']
Demo Output:
['5 1\n', '1 2\n']
Note:
none
|
```python
n = int(input())
l = list(map(int,input().split()))
f = []
for i in range(n):
f.append(abs(l[i] - l[i-1]))
c = f.index(min(f))
if c == 0:
print(n, 1)
else:
print(c, c + 1)
```
| 3.9695
|
664
|
A
|
Complicated GCD
|
PROGRAMMING
| 800
|
[
"math",
"number theory"
] | null | null |
Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm.
Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type!
|
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100).
|
Output one integer — greatest common divisor of all integers from *a* to *b* inclusive.
|
[
"1 2\n",
"61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n"
] |
[
"1\n",
"61803398874989484820458683436563811772030917980576\n"
] |
none
| 500
|
[
{
"input": "1 2",
"output": "1"
},
{
"input": "61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576",
"output": "61803398874989484820458683436563811772030917980576"
},
{
"input": "1 100",
"output": "1"
},
{
"input": "100 100000",
"output": "1"
},
{
"input": "12345 67890123456789123457",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158 8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158",
"output": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158"
},
{
"input": "1 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "8328748239473982794239847237438782379810988324751 9328748239473982794239847237438782379810988324751",
"output": "1"
},
{
"input": "1029398958432734901284327523909481928483573793 1029398958432734901284327523909481928483573794",
"output": "1"
},
{
"input": "10000 1000000000",
"output": "1"
},
{
"input": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "11210171722243 65715435710585778347",
"output": "1"
},
{
"input": "2921881079263974825226940825843 767693191032295360887755303860323261471",
"output": "1"
},
{
"input": "8025352957265704896940312528736939363590612908210603 96027920417708260814607687034511406492969694925539085",
"output": "1"
},
{
"input": "23510978780782786207241069904470895053213996267165977112058175452757132930 210352653280909370107314249722987050753257161175393375412301228883856435481424",
"output": "1"
},
{
"input": "8150070767079366215626260746398623663859344142817267779361251788637547414925170226504788118262 49924902262298336032630839998470954964895251605110946547855439236151401194070172107435992986913614",
"output": "1"
},
{
"input": "15943150466658398903 15943150466658398903",
"output": "15943150466658398903"
},
{
"input": "410470228200245407491525399055972 410470228200245407491525399055972",
"output": "410470228200245407491525399055972"
},
{
"input": "51894705655711504622197349350106792045098781545973899451307 51894705655711504622197349350106792045098781545973899451307",
"output": "51894705655711504622197349350106792045098781545973899451307"
},
{
"input": "60353594589897438036015726222485085035927634677598681595162804007836722215668410 60353594589897438036015726222485085035927634677598681595162804007836722215668410",
"output": "60353594589897438036015726222485085035927634677598681595162804007836722215668410"
},
{
"input": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535 761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535",
"output": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535"
},
{
"input": "1 2000000000",
"output": "1"
},
{
"input": "13 1928834874",
"output": "1"
},
{
"input": "87 2938984237482934238",
"output": "1"
},
{
"input": "213 413",
"output": "1"
},
{
"input": "3 4",
"output": "1"
}
] | 1,582,752,405
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 28
| 108
| 0
|
def gcd(a, b):
while b != 0:
c = a % b
a = b
b = c
return a
x, y = map(int, input().split())
ans = set()
if y - x >= 1:
print(1)
else:
print(gcd(x, y))
|
Title: Complicated GCD
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm.
Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type!
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100).
Output Specification:
Output one integer — greatest common divisor of all integers from *a* to *b* inclusive.
Demo Input:
['1 2\n', '61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n']
Demo Output:
['1\n', '61803398874989484820458683436563811772030917980576\n']
Note:
none
|
```python
def gcd(a, b):
while b != 0:
c = a % b
a = b
b = c
return a
x, y = map(int, input().split())
ans = set()
if y - x >= 1:
print(1)
else:
print(gcd(x, y))
```
| 3
|
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,691,590,529
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 46
| 0
|
num = int(input())
words = []
for i in range(num):
words.append(input())
for i in words:
if len(i) > 10:
print(i[0] +str( len(i) - 2 )+ i [-1])
else:
print(i)
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
num = int(input())
words = []
for i in range(num):
words.append(input())
for i in words:
if len(i) > 10:
print(i[0] +str( len(i) - 2 )+ i [-1])
else:
print(i)
```
| 3.977
|
334
|
A
|
Candy Bags
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Gerald has *n* younger brothers and their number happens to be even. One day he bought *n*2 candy bags. One bag has one candy, one bag has two candies, one bag has three candies and so on. In fact, for each integer *k* from 1 to *n*2 he has exactly one bag with *k* candies.
Help him give *n* bags of candies to each brother so that all brothers got the same number of candies.
|
The single line contains a single integer *n* (*n* is even, 2<=≤<=*n*<=≤<=100) — the number of Gerald's brothers.
|
Let's assume that Gerald indexes his brothers with numbers from 1 to *n*. You need to print *n* lines, on the *i*-th line print *n* integers — the numbers of candies in the bags for the *i*-th brother. Naturally, all these numbers should be distinct and be within limits from 1 to *n*2. You can print the numbers in the lines in any order.
It is guaranteed that the solution exists at the given limits.
|
[
"2\n"
] |
[
"1 4\n2 3\n"
] |
The sample shows Gerald's actions if he has two brothers. In this case, his bags contain 1, 2, 3 and 4 candies. He can give the bags with 1 and 4 candies to one brother and the bags with 2 and 3 to the other brother.
| 500
|
[
{
"input": "2",
"output": "1 4\n2 3"
},
{
"input": "4",
"output": "1 16 2 15\n3 14 4 13\n5 12 6 11\n7 10 8 9"
},
{
"input": "6",
"output": "1 36 2 35 3 34\n4 33 5 32 6 31\n7 30 8 29 9 28\n10 27 11 26 12 25\n13 24 14 23 15 22\n16 21 17 20 18 19"
},
{
"input": "8",
"output": "1 64 2 63 3 62 4 61\n5 60 6 59 7 58 8 57\n9 56 10 55 11 54 12 53\n13 52 14 51 15 50 16 49\n17 48 18 47 19 46 20 45\n21 44 22 43 23 42 24 41\n25 40 26 39 27 38 28 37\n29 36 30 35 31 34 32 33"
},
{
"input": "10",
"output": "1 100 2 99 3 98 4 97 5 96\n6 95 7 94 8 93 9 92 10 91\n11 90 12 89 13 88 14 87 15 86\n16 85 17 84 18 83 19 82 20 81\n21 80 22 79 23 78 24 77 25 76\n26 75 27 74 28 73 29 72 30 71\n31 70 32 69 33 68 34 67 35 66\n36 65 37 64 38 63 39 62 40 61\n41 60 42 59 43 58 44 57 45 56\n46 55 47 54 48 53 49 52 50 51"
},
{
"input": "100",
"output": "1 10000 2 9999 3 9998 4 9997 5 9996 6 9995 7 9994 8 9993 9 9992 10 9991 11 9990 12 9989 13 9988 14 9987 15 9986 16 9985 17 9984 18 9983 19 9982 20 9981 21 9980 22 9979 23 9978 24 9977 25 9976 26 9975 27 9974 28 9973 29 9972 30 9971 31 9970 32 9969 33 9968 34 9967 35 9966 36 9965 37 9964 38 9963 39 9962 40 9961 41 9960 42 9959 43 9958 44 9957 45 9956 46 9955 47 9954 48 9953 49 9952 50 9951\n51 9950 52 9949 53 9948 54 9947 55 9946 56 9945 57 9944 58 9943 59 9942 60 9941 61 9940 62 9939 63 9938 64 9937 65 993..."
},
{
"input": "62",
"output": "1 3844 2 3843 3 3842 4 3841 5 3840 6 3839 7 3838 8 3837 9 3836 10 3835 11 3834 12 3833 13 3832 14 3831 15 3830 16 3829 17 3828 18 3827 19 3826 20 3825 21 3824 22 3823 23 3822 24 3821 25 3820 26 3819 27 3818 28 3817 29 3816 30 3815 31 3814\n32 3813 33 3812 34 3811 35 3810 36 3809 37 3808 38 3807 39 3806 40 3805 41 3804 42 3803 43 3802 44 3801 45 3800 46 3799 47 3798 48 3797 49 3796 50 3795 51 3794 52 3793 53 3792 54 3791 55 3790 56 3789 57 3788 58 3787 59 3786 60 3785 61 3784 62 3783\n63 3782 64 3781 65 378..."
},
{
"input": "66",
"output": "1 4356 2 4355 3 4354 4 4353 5 4352 6 4351 7 4350 8 4349 9 4348 10 4347 11 4346 12 4345 13 4344 14 4343 15 4342 16 4341 17 4340 18 4339 19 4338 20 4337 21 4336 22 4335 23 4334 24 4333 25 4332 26 4331 27 4330 28 4329 29 4328 30 4327 31 4326 32 4325 33 4324\n34 4323 35 4322 36 4321 37 4320 38 4319 39 4318 40 4317 41 4316 42 4315 43 4314 44 4313 45 4312 46 4311 47 4310 48 4309 49 4308 50 4307 51 4306 52 4305 53 4304 54 4303 55 4302 56 4301 57 4300 58 4299 59 4298 60 4297 61 4296 62 4295 63 4294 64 4293 65 4292..."
},
{
"input": "18",
"output": "1 324 2 323 3 322 4 321 5 320 6 319 7 318 8 317 9 316\n10 315 11 314 12 313 13 312 14 311 15 310 16 309 17 308 18 307\n19 306 20 305 21 304 22 303 23 302 24 301 25 300 26 299 27 298\n28 297 29 296 30 295 31 294 32 293 33 292 34 291 35 290 36 289\n37 288 38 287 39 286 40 285 41 284 42 283 43 282 44 281 45 280\n46 279 47 278 48 277 49 276 50 275 51 274 52 273 53 272 54 271\n55 270 56 269 57 268 58 267 59 266 60 265 61 264 62 263 63 262\n64 261 65 260 66 259 67 258 68 257 69 256 70 255 71 254 72 253\n73 252 7..."
},
{
"input": "68",
"output": "1 4624 2 4623 3 4622 4 4621 5 4620 6 4619 7 4618 8 4617 9 4616 10 4615 11 4614 12 4613 13 4612 14 4611 15 4610 16 4609 17 4608 18 4607 19 4606 20 4605 21 4604 22 4603 23 4602 24 4601 25 4600 26 4599 27 4598 28 4597 29 4596 30 4595 31 4594 32 4593 33 4592 34 4591\n35 4590 36 4589 37 4588 38 4587 39 4586 40 4585 41 4584 42 4583 43 4582 44 4581 45 4580 46 4579 47 4578 48 4577 49 4576 50 4575 51 4574 52 4573 53 4572 54 4571 55 4570 56 4569 57 4568 58 4567 59 4566 60 4565 61 4564 62 4563 63 4562 64 4561 65 4560..."
},
{
"input": "86",
"output": "1 7396 2 7395 3 7394 4 7393 5 7392 6 7391 7 7390 8 7389 9 7388 10 7387 11 7386 12 7385 13 7384 14 7383 15 7382 16 7381 17 7380 18 7379 19 7378 20 7377 21 7376 22 7375 23 7374 24 7373 25 7372 26 7371 27 7370 28 7369 29 7368 30 7367 31 7366 32 7365 33 7364 34 7363 35 7362 36 7361 37 7360 38 7359 39 7358 40 7357 41 7356 42 7355 43 7354\n44 7353 45 7352 46 7351 47 7350 48 7349 49 7348 50 7347 51 7346 52 7345 53 7344 54 7343 55 7342 56 7341 57 7340 58 7339 59 7338 60 7337 61 7336 62 7335 63 7334 64 7333 65 7332..."
},
{
"input": "96",
"output": "1 9216 2 9215 3 9214 4 9213 5 9212 6 9211 7 9210 8 9209 9 9208 10 9207 11 9206 12 9205 13 9204 14 9203 15 9202 16 9201 17 9200 18 9199 19 9198 20 9197 21 9196 22 9195 23 9194 24 9193 25 9192 26 9191 27 9190 28 9189 29 9188 30 9187 31 9186 32 9185 33 9184 34 9183 35 9182 36 9181 37 9180 38 9179 39 9178 40 9177 41 9176 42 9175 43 9174 44 9173 45 9172 46 9171 47 9170 48 9169\n49 9168 50 9167 51 9166 52 9165 53 9164 54 9163 55 9162 56 9161 57 9160 58 9159 59 9158 60 9157 61 9156 62 9155 63 9154 64 9153 65 9152..."
},
{
"input": "12",
"output": "1 144 2 143 3 142 4 141 5 140 6 139\n7 138 8 137 9 136 10 135 11 134 12 133\n13 132 14 131 15 130 16 129 17 128 18 127\n19 126 20 125 21 124 22 123 23 122 24 121\n25 120 26 119 27 118 28 117 29 116 30 115\n31 114 32 113 33 112 34 111 35 110 36 109\n37 108 38 107 39 106 40 105 41 104 42 103\n43 102 44 101 45 100 46 99 47 98 48 97\n49 96 50 95 51 94 52 93 53 92 54 91\n55 90 56 89 57 88 58 87 59 86 60 85\n61 84 62 83 63 82 64 81 65 80 66 79\n67 78 68 77 69 76 70 75 71 74 72 73"
},
{
"input": "88",
"output": "1 7744 2 7743 3 7742 4 7741 5 7740 6 7739 7 7738 8 7737 9 7736 10 7735 11 7734 12 7733 13 7732 14 7731 15 7730 16 7729 17 7728 18 7727 19 7726 20 7725 21 7724 22 7723 23 7722 24 7721 25 7720 26 7719 27 7718 28 7717 29 7716 30 7715 31 7714 32 7713 33 7712 34 7711 35 7710 36 7709 37 7708 38 7707 39 7706 40 7705 41 7704 42 7703 43 7702 44 7701\n45 7700 46 7699 47 7698 48 7697 49 7696 50 7695 51 7694 52 7693 53 7692 54 7691 55 7690 56 7689 57 7688 58 7687 59 7686 60 7685 61 7684 62 7683 63 7682 64 7681 65 7680..."
},
{
"input": "28",
"output": "1 784 2 783 3 782 4 781 5 780 6 779 7 778 8 777 9 776 10 775 11 774 12 773 13 772 14 771\n15 770 16 769 17 768 18 767 19 766 20 765 21 764 22 763 23 762 24 761 25 760 26 759 27 758 28 757\n29 756 30 755 31 754 32 753 33 752 34 751 35 750 36 749 37 748 38 747 39 746 40 745 41 744 42 743\n43 742 44 741 45 740 46 739 47 738 48 737 49 736 50 735 51 734 52 733 53 732 54 731 55 730 56 729\n57 728 58 727 59 726 60 725 61 724 62 723 63 722 64 721 65 720 66 719 67 718 68 717 69 716 70 715\n71 714 72 713 73 712 74 7..."
},
{
"input": "80",
"output": "1 6400 2 6399 3 6398 4 6397 5 6396 6 6395 7 6394 8 6393 9 6392 10 6391 11 6390 12 6389 13 6388 14 6387 15 6386 16 6385 17 6384 18 6383 19 6382 20 6381 21 6380 22 6379 23 6378 24 6377 25 6376 26 6375 27 6374 28 6373 29 6372 30 6371 31 6370 32 6369 33 6368 34 6367 35 6366 36 6365 37 6364 38 6363 39 6362 40 6361\n41 6360 42 6359 43 6358 44 6357 45 6356 46 6355 47 6354 48 6353 49 6352 50 6351 51 6350 52 6349 53 6348 54 6347 55 6346 56 6345 57 6344 58 6343 59 6342 60 6341 61 6340 62 6339 63 6338 64 6337 65 6336..."
},
{
"input": "48",
"output": "1 2304 2 2303 3 2302 4 2301 5 2300 6 2299 7 2298 8 2297 9 2296 10 2295 11 2294 12 2293 13 2292 14 2291 15 2290 16 2289 17 2288 18 2287 19 2286 20 2285 21 2284 22 2283 23 2282 24 2281\n25 2280 26 2279 27 2278 28 2277 29 2276 30 2275 31 2274 32 2273 33 2272 34 2271 35 2270 36 2269 37 2268 38 2267 39 2266 40 2265 41 2264 42 2263 43 2262 44 2261 45 2260 46 2259 47 2258 48 2257\n49 2256 50 2255 51 2254 52 2253 53 2252 54 2251 55 2250 56 2249 57 2248 58 2247 59 2246 60 2245 61 2244 62 2243 63 2242 64 2241 65 224..."
},
{
"input": "54",
"output": "1 2916 2 2915 3 2914 4 2913 5 2912 6 2911 7 2910 8 2909 9 2908 10 2907 11 2906 12 2905 13 2904 14 2903 15 2902 16 2901 17 2900 18 2899 19 2898 20 2897 21 2896 22 2895 23 2894 24 2893 25 2892 26 2891 27 2890\n28 2889 29 2888 30 2887 31 2886 32 2885 33 2884 34 2883 35 2882 36 2881 37 2880 38 2879 39 2878 40 2877 41 2876 42 2875 43 2874 44 2873 45 2872 46 2871 47 2870 48 2869 49 2868 50 2867 51 2866 52 2865 53 2864 54 2863\n55 2862 56 2861 57 2860 58 2859 59 2858 60 2857 61 2856 62 2855 63 2854 64 2853 65 285..."
},
{
"input": "58",
"output": "1 3364 2 3363 3 3362 4 3361 5 3360 6 3359 7 3358 8 3357 9 3356 10 3355 11 3354 12 3353 13 3352 14 3351 15 3350 16 3349 17 3348 18 3347 19 3346 20 3345 21 3344 22 3343 23 3342 24 3341 25 3340 26 3339 27 3338 28 3337 29 3336\n30 3335 31 3334 32 3333 33 3332 34 3331 35 3330 36 3329 37 3328 38 3327 39 3326 40 3325 41 3324 42 3323 43 3322 44 3321 45 3320 46 3319 47 3318 48 3317 49 3316 50 3315 51 3314 52 3313 53 3312 54 3311 55 3310 56 3309 57 3308 58 3307\n59 3306 60 3305 61 3304 62 3303 63 3302 64 3301 65 330..."
},
{
"input": "64",
"output": "1 4096 2 4095 3 4094 4 4093 5 4092 6 4091 7 4090 8 4089 9 4088 10 4087 11 4086 12 4085 13 4084 14 4083 15 4082 16 4081 17 4080 18 4079 19 4078 20 4077 21 4076 22 4075 23 4074 24 4073 25 4072 26 4071 27 4070 28 4069 29 4068 30 4067 31 4066 32 4065\n33 4064 34 4063 35 4062 36 4061 37 4060 38 4059 39 4058 40 4057 41 4056 42 4055 43 4054 44 4053 45 4052 46 4051 47 4050 48 4049 49 4048 50 4047 51 4046 52 4045 53 4044 54 4043 55 4042 56 4041 57 4040 58 4039 59 4038 60 4037 61 4036 62 4035 63 4034 64 4033\n65 403..."
},
{
"input": "44",
"output": "1 1936 2 1935 3 1934 4 1933 5 1932 6 1931 7 1930 8 1929 9 1928 10 1927 11 1926 12 1925 13 1924 14 1923 15 1922 16 1921 17 1920 18 1919 19 1918 20 1917 21 1916 22 1915\n23 1914 24 1913 25 1912 26 1911 27 1910 28 1909 29 1908 30 1907 31 1906 32 1905 33 1904 34 1903 35 1902 36 1901 37 1900 38 1899 39 1898 40 1897 41 1896 42 1895 43 1894 44 1893\n45 1892 46 1891 47 1890 48 1889 49 1888 50 1887 51 1886 52 1885 53 1884 54 1883 55 1882 56 1881 57 1880 58 1879 59 1878 60 1877 61 1876 62 1875 63 1874 64 1873 65 187..."
}
] | 1,568,899,957
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 21
| 312
| 2,969,600
|
n=int(input())
l=[]
for i in range(1,n*n//2+1):
l.append(i)
l.append(n*n-i+1)
for i in range(n):
print(*l[i*n:(i+1)*n])
|
Title: Candy Bags
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gerald has *n* younger brothers and their number happens to be even. One day he bought *n*2 candy bags. One bag has one candy, one bag has two candies, one bag has three candies and so on. In fact, for each integer *k* from 1 to *n*2 he has exactly one bag with *k* candies.
Help him give *n* bags of candies to each brother so that all brothers got the same number of candies.
Input Specification:
The single line contains a single integer *n* (*n* is even, 2<=≤<=*n*<=≤<=100) — the number of Gerald's brothers.
Output Specification:
Let's assume that Gerald indexes his brothers with numbers from 1 to *n*. You need to print *n* lines, on the *i*-th line print *n* integers — the numbers of candies in the bags for the *i*-th brother. Naturally, all these numbers should be distinct and be within limits from 1 to *n*2. You can print the numbers in the lines in any order.
It is guaranteed that the solution exists at the given limits.
Demo Input:
['2\n']
Demo Output:
['1 4\n2 3\n']
Note:
The sample shows Gerald's actions if he has two brothers. In this case, his bags contain 1, 2, 3 and 4 candies. He can give the bags with 1 and 4 candies to one brother and the bags with 2 and 3 to the other brother.
|
```python
n=int(input())
l=[]
for i in range(1,n*n//2+1):
l.append(i)
l.append(n*n-i+1)
for i in range(n):
print(*l[i*n:(i+1)*n])
```
| 3
|
|
910
|
A
|
The Way to Home
|
PROGRAMMING
| 800
|
[
"dfs and similar",
"dp",
"greedy",
"implementation"
] | null | null |
A frog lives on the axis *Ox* and needs to reach home which is in the point *n*. She starts from the point 1. The frog can jump to the right at a distance not more than *d*. So, after she jumped from the point *x* she can reach the point *x*<=+<=*a*, where *a* is an integer from 1 to *d*.
For each point from 1 to *n* is known if there is a lily flower in it. The frog can jump only in points with a lilies. Guaranteed that there are lilies in the points 1 and *n*.
Determine the minimal number of jumps that the frog needs to reach home which is in the point *n* from the point 1. Consider that initially the frog is in the point 1. If the frog can not reach home, print -1.
|
The first line contains two integers *n* and *d* (2<=≤<=*n*<=≤<=100, 1<=≤<=*d*<=≤<=*n*<=-<=1) — the point, which the frog wants to reach, and the maximal length of the frog jump.
The second line contains a string *s* of length *n*, consisting of zeros and ones. If a character of the string *s* equals to zero, then in the corresponding point there is no lily flower. In the other case, in the corresponding point there is a lily flower. Guaranteed that the first and the last characters of the string *s* equal to one.
|
If the frog can not reach the home, print -1.
In the other case, print the minimal number of jumps that the frog needs to reach the home which is in the point *n* from the point 1.
|
[
"8 4\n10010101\n",
"4 2\n1001\n",
"8 4\n11100101\n",
"12 3\n101111100101\n"
] |
[
"2\n",
"-1\n",
"3\n",
"4\n"
] |
In the first example the from can reach home in two jumps: the first jump from the point 1 to the point 4 (the length of the jump is three), and the second jump from the point 4 to the point 8 (the length of the jump is four).
In the second example the frog can not reach home, because to make it she need to jump on a distance three, but the maximum length of her jump equals to two.
| 500
|
[
{
"input": "8 4\n10010101",
"output": "2"
},
{
"input": "4 2\n1001",
"output": "-1"
},
{
"input": "8 4\n11100101",
"output": "3"
},
{
"input": "12 3\n101111100101",
"output": "4"
},
{
"input": "5 4\n11011",
"output": "1"
},
{
"input": "5 4\n10001",
"output": "1"
},
{
"input": "10 7\n1101111011",
"output": "2"
},
{
"input": "10 9\n1110000101",
"output": "1"
},
{
"input": "10 9\n1100000001",
"output": "1"
},
{
"input": "20 5\n11111111110111101001",
"output": "4"
},
{
"input": "20 11\n11100000111000011011",
"output": "2"
},
{
"input": "20 19\n10100000000000000001",
"output": "1"
},
{
"input": "50 13\n10011010100010100111010000010000000000010100000101",
"output": "5"
},
{
"input": "50 8\n11010100000011001100001100010001110000101100110011",
"output": "8"
},
{
"input": "99 4\n111111111111111111111111111111111111111111111111111111111011111111111111111111111111111111111111111",
"output": "25"
},
{
"input": "99 98\n100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "1"
},
{
"input": "100 5\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "20"
},
{
"input": "100 4\n1111111111111111111111111111111111111111111111111111111111111111111111111111110111111111111111111111",
"output": "25"
},
{
"input": "100 4\n1111111111111111111111111111111111111111111111111111111111111101111111011111111111111111111111111111",
"output": "25"
},
{
"input": "100 3\n1111110111111111111111111111111111111111101111111111111111111111111101111111111111111111111111111111",
"output": "34"
},
{
"input": "100 8\n1111111111101110111111111111111111111111111111111111111111111111111111110011111111111111011111111111",
"output": "13"
},
{
"input": "100 7\n1011111111111111111011101111111011111101111111111101111011110111111111111111111111110111111011111111",
"output": "15"
},
{
"input": "100 9\n1101111110111110101111111111111111011001110111011101011111111111010101111111100011011111111010111111",
"output": "12"
},
{
"input": "100 6\n1011111011111111111011010110011001010101111110111111000111011011111110101101110110101111110000100111",
"output": "18"
},
{
"input": "100 7\n1110001111101001110011111111111101111101101001010001101000101100000101101101011111111101101000100001",
"output": "16"
},
{
"input": "100 11\n1000010100011100011011100000010011001111011110100100001011010100011011111001101101110110010110001101",
"output": "10"
},
{
"input": "100 9\n1001001110000011100100000001000110111101101010101001000101001010011001101100110011011110110011011111",
"output": "13"
},
{
"input": "100 7\n1010100001110101111011000111000001110100100110110001110110011010100001100100001110111100110000101001",
"output": "18"
},
{
"input": "100 10\n1110110000000110000000101110100000111000001011100000100110010001110111001010101000011000000001011011",
"output": "12"
},
{
"input": "100 13\n1000000100000000100011000010010000101010011110000000001000011000110100001000010001100000011001011001",
"output": "9"
},
{
"input": "100 11\n1000000000100000010000100001000100000000010000100100000000100100001000000001011000110001000000000101",
"output": "12"
},
{
"input": "100 22\n1000100000001010000000000000000001000000100000000000000000010000000000001000000000000000000100000001",
"output": "7"
},
{
"input": "100 48\n1000000000000000011000000000000000000000000000000001100000000000000000000000000000000000000000000001",
"output": "3"
},
{
"input": "100 48\n1000000000000000000000100000000000000000000000000000000000000000000001000000000000000000100000000001",
"output": "3"
},
{
"input": "100 75\n1000000100000000000000000000000000000000000000000000000000000000000000000000000001000000000000000001",
"output": "3"
},
{
"input": "100 73\n1000000000000000000000000000000100000000000000000000000000000000000000000000000000000000000000000001",
"output": "2"
},
{
"input": "100 99\n1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "1"
},
{
"input": "100 1\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "99"
},
{
"input": "100 2\n1111111111111111111111111111111110111111111111111111111111111111111111111111111111111111111111111111",
"output": "50"
},
{
"input": "100 1\n1111111111111111011111111111111111111111111111111111111111111111111101111111111111111111111111111111",
"output": "-1"
},
{
"input": "100 3\n1111111111111111111111111101111111111111111111111011111111111111111111111111111011111111111111111111",
"output": "33"
},
{
"input": "100 1\n1101111111111111111111101111111111111111111111111111111111111011111111101111101111111111111111111111",
"output": "-1"
},
{
"input": "100 6\n1111111111111111111111101111111101011110001111111111111111110111111111111111111111111110010111111111",
"output": "17"
},
{
"input": "100 2\n1111111101111010110111011011110111101111111011111101010101011111011111111111111011111001101111101111",
"output": "-1"
},
{
"input": "100 8\n1100110101111001101001111000111100110100011110111011001011111110000110101000001110111011100111011011",
"output": "14"
},
{
"input": "100 10\n1000111110100000001001101100000010011100010101001100010011111001001101111110110111101111001010001101",
"output": "11"
},
{
"input": "100 7\n1110000011010001110101011010000011110001000000011101110111010110001000011101111010010001101111110001",
"output": "-1"
},
{
"input": "100 3\n1111010001000001011011000011001111000100101000101101000010111101111000010000011110110011001101010111",
"output": "-1"
},
{
"input": "100 9\n1101010101101100010111011000010100001010000101010011001001100010110110000000010000101000000001101101",
"output": "13"
},
{
"input": "100 14\n1010100000000000010101000010001100000000000011100010000001000001011010001110001010100000100001101101",
"output": "9"
},
{
"input": "100 13\n1000000001101001110000010000011001000000000000001010000000100001001010000000000000000100010000000001",
"output": "-1"
},
{
"input": "100 18\n1000000000000000110000000000000000010000000001000001000001000000000100000000000010000000000000000001",
"output": "-1"
},
{
"input": "100 32\n1000000000000000000000000001000000000000000000000101000000000000000000000000000000000001000000000001",
"output": "-1"
},
{
"input": "100 79\n1000000001000000000101000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "2"
},
{
"input": "100 41\n1000000000000000000000000000000000010000000000000000000000000000000000000000100000000000000000000001",
"output": "3"
},
{
"input": "100 82\n1000000000000000000100000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "2"
},
{
"input": "100 96\n1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "-1"
},
{
"input": "43 30\n1001000001111111010100100100110101011101101",
"output": "2"
},
{
"input": "7 1\n1111111",
"output": "6"
},
{
"input": "9 3\n101000001",
"output": "-1"
},
{
"input": "10 3\n1100000001",
"output": "-1"
},
{
"input": "8 2\n10000101",
"output": "-1"
},
{
"input": "2 1\n11",
"output": "1"
}
] | 1,614,989,327
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 3
| 109
| 0
|
import sys
n, d = map(int, sys.stdin.readline().split(' '))
ss = [i for i, s in enumerate(sys.stdin.readline().strip()) if s == '1']
if ss[1] > d:
print(-1)
exit()
c = 1
a = 0
b = ss[1]
for s in ss:
if s - a <= d:
b = s
else:
if s - b > d:
print(-1)
exit()
else:
a = b
b = d
c += 1
print(c)
|
Title: The Way to Home
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A frog lives on the axis *Ox* and needs to reach home which is in the point *n*. She starts from the point 1. The frog can jump to the right at a distance not more than *d*. So, after she jumped from the point *x* she can reach the point *x*<=+<=*a*, where *a* is an integer from 1 to *d*.
For each point from 1 to *n* is known if there is a lily flower in it. The frog can jump only in points with a lilies. Guaranteed that there are lilies in the points 1 and *n*.
Determine the minimal number of jumps that the frog needs to reach home which is in the point *n* from the point 1. Consider that initially the frog is in the point 1. If the frog can not reach home, print -1.
Input Specification:
The first line contains two integers *n* and *d* (2<=≤<=*n*<=≤<=100, 1<=≤<=*d*<=≤<=*n*<=-<=1) — the point, which the frog wants to reach, and the maximal length of the frog jump.
The second line contains a string *s* of length *n*, consisting of zeros and ones. If a character of the string *s* equals to zero, then in the corresponding point there is no lily flower. In the other case, in the corresponding point there is a lily flower. Guaranteed that the first and the last characters of the string *s* equal to one.
Output Specification:
If the frog can not reach the home, print -1.
In the other case, print the minimal number of jumps that the frog needs to reach the home which is in the point *n* from the point 1.
Demo Input:
['8 4\n10010101\n', '4 2\n1001\n', '8 4\n11100101\n', '12 3\n101111100101\n']
Demo Output:
['2\n', '-1\n', '3\n', '4\n']
Note:
In the first example the from can reach home in two jumps: the first jump from the point 1 to the point 4 (the length of the jump is three), and the second jump from the point 4 to the point 8 (the length of the jump is four).
In the second example the frog can not reach home, because to make it she need to jump on a distance three, but the maximum length of her jump equals to two.
|
```python
import sys
n, d = map(int, sys.stdin.readline().split(' '))
ss = [i for i, s in enumerate(sys.stdin.readline().strip()) if s == '1']
if ss[1] > d:
print(-1)
exit()
c = 1
a = 0
b = ss[1]
for s in ss:
if s - a <= d:
b = s
else:
if s - b > d:
print(-1)
exit()
else:
a = b
b = d
c += 1
print(c)
```
| 0
|
|
581
|
A
|
Vasya the Hipster
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him?
|
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
|
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
|
[
"3 1\n",
"2 3\n",
"7 3\n"
] |
[
"1 1\n",
"2 0\n",
"3 2\n"
] |
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
| 500
|
[
{
"input": "3 1",
"output": "1 1"
},
{
"input": "2 3",
"output": "2 0"
},
{
"input": "7 3",
"output": "3 2"
},
{
"input": "100 100",
"output": "100 0"
},
{
"input": "4 10",
"output": "4 3"
},
{
"input": "6 10",
"output": "6 2"
},
{
"input": "6 11",
"output": "6 2"
},
{
"input": "10 40",
"output": "10 15"
},
{
"input": "11 56",
"output": "11 22"
},
{
"input": "34 30",
"output": "30 2"
},
{
"input": "33 33",
"output": "33 0"
},
{
"input": "100 45",
"output": "45 27"
},
{
"input": "100 23",
"output": "23 38"
},
{
"input": "45 12",
"output": "12 16"
},
{
"input": "1 1",
"output": "1 0"
},
{
"input": "1 100",
"output": "1 49"
},
{
"input": "100 1",
"output": "1 49"
},
{
"input": "68 59",
"output": "59 4"
},
{
"input": "45 99",
"output": "45 27"
},
{
"input": "99 100",
"output": "99 0"
},
{
"input": "100 98",
"output": "98 1"
},
{
"input": "59 12",
"output": "12 23"
},
{
"input": "86 4",
"output": "4 41"
},
{
"input": "68 21",
"output": "21 23"
},
{
"input": "100 11",
"output": "11 44"
},
{
"input": "100 10",
"output": "10 45"
},
{
"input": "15 45",
"output": "15 15"
},
{
"input": "11 32",
"output": "11 10"
},
{
"input": "34 96",
"output": "34 31"
},
{
"input": "89 89",
"output": "89 0"
}
] | 1,675,933,022
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 46
| 0
|
l=list(map(int,input().split()))
n=max(l)
m=min(l)
print(m,(n-m)//2)
|
Title: Vasya the Hipster
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him?
Input Specification:
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
Output Specification:
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
Demo Input:
['3 1\n', '2 3\n', '7 3\n']
Demo Output:
['1 1\n', '2 0\n', '3 2\n']
Note:
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
|
```python
l=list(map(int,input().split()))
n=max(l)
m=min(l)
print(m,(n-m)//2)
```
| 3
|
|
414
|
B
|
Mashmokh and ACM
|
PROGRAMMING
| 1,400
|
[
"combinatorics",
"dp",
"number theory"
] | null | null |
Mashmokh's boss, Bimokh, didn't like Mashmokh. So he fired him. Mashmokh decided to go to university and participate in ACM instead of finding a new job. He wants to become a member of Bamokh's team. In order to join he was given some programming tasks and one week to solve them. Mashmokh is not a very experienced programmer. Actually he is not a programmer at all. So he wasn't able to solve them. That's why he asked you to help him with these tasks. One of these tasks is the following.
A sequence of *l* integers *b*1,<=*b*2,<=...,<=*b**l* (1<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**l*<=≤<=*n*) is called good if each number divides (without a remainder) by the next number in the sequence. More formally for all *i* (1<=≤<=*i*<=≤<=*l*<=-<=1).
Given *n* and *k* find the number of good sequences of length *k*. As the answer can be rather large print it modulo 1000000007 (109<=+<=7).
|
The first line of input contains two space-separated integers *n*,<=*k* (1<=≤<=*n*,<=*k*<=≤<=2000).
|
Output a single integer — the number of good sequences of length *k* modulo 1000000007 (109<=+<=7).
|
[
"3 2\n",
"6 4\n",
"2 1\n"
] |
[
"5\n",
"39\n",
"2\n"
] |
In the first sample the good sequences are: [1, 1], [2, 2], [3, 3], [1, 2], [1, 3].
| 1,000
|
[
{
"input": "3 2",
"output": "5"
},
{
"input": "6 4",
"output": "39"
},
{
"input": "2 1",
"output": "2"
},
{
"input": "1478 194",
"output": "312087753"
},
{
"input": "1415 562",
"output": "953558593"
},
{
"input": "1266 844",
"output": "735042656"
},
{
"input": "680 1091",
"output": "351905328"
},
{
"input": "1229 1315",
"output": "100240813"
},
{
"input": "1766 1038",
"output": "435768250"
},
{
"input": "1000 1",
"output": "1000"
},
{
"input": "2000 100",
"output": "983281065"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2000 1000",
"output": "228299266"
},
{
"input": "1928 1504",
"output": "81660104"
},
{
"input": "2000 2000",
"output": "585712681"
},
{
"input": "29 99",
"output": "23125873"
},
{
"input": "56 48",
"output": "20742237"
},
{
"input": "209 370",
"output": "804680894"
},
{
"input": "83 37",
"output": "22793555"
},
{
"input": "49 110",
"output": "956247348"
},
{
"input": "217 3",
"output": "4131"
},
{
"input": "162 161",
"output": "591739753"
},
{
"input": "273 871",
"output": "151578252"
},
{
"input": "43 1640",
"output": "173064407"
},
{
"input": "1472 854",
"output": "748682383"
},
{
"input": "1639 1056",
"output": "467464129"
},
{
"input": "359 896",
"output": "770361185"
},
{
"input": "1544 648",
"output": "9278889"
},
{
"input": "436 1302",
"output": "874366220"
},
{
"input": "1858 743",
"output": "785912917"
},
{
"input": "991 1094",
"output": "483493131"
},
{
"input": "1013 1550",
"output": "613533467"
},
{
"input": "675 741",
"output": "474968598"
},
{
"input": "1420 1223",
"output": "922677437"
},
{
"input": "1544 1794",
"output": "933285446"
},
{
"input": "1903 1612",
"output": "620810276"
},
{
"input": "500 1304",
"output": "706176027"
},
{
"input": "525 314",
"output": "245394744"
},
{
"input": "39 1930",
"output": "992125404"
},
{
"input": "1895 753",
"output": "180474828"
},
{
"input": "1722 1474",
"output": "742424590"
},
{
"input": "1153 1823",
"output": "791493066"
},
{
"input": "1409 734",
"output": "627413973"
},
{
"input": "478 1301",
"output": "476483030"
},
{
"input": "1887 1729",
"output": "730033374"
},
{
"input": "1610 774",
"output": "50897314"
},
{
"input": "1770 679",
"output": "235295539"
},
{
"input": "987 1292",
"output": "560110556"
},
{
"input": "1707 1117",
"output": "237674323"
},
{
"input": "1424 1431",
"output": "184145444"
},
{
"input": "86 1078",
"output": "252515343"
},
{
"input": "1066 995",
"output": "180753612"
},
{
"input": "1024 133",
"output": "392603027"
},
{
"input": "659 974",
"output": "397026719"
},
{
"input": "1349 1606",
"output": "522392901"
},
{
"input": "473 211",
"output": "809550224"
},
{
"input": "634 1825",
"output": "438513382"
},
{
"input": "22 373",
"output": "907321755"
},
{
"input": "531 147",
"output": "242883376"
},
{
"input": "1307 1247",
"output": "21512331"
},
{
"input": "415 735",
"output": "393705804"
},
{
"input": "1659 1501",
"output": "225266660"
},
{
"input": "1454 296",
"output": "750032659"
},
{
"input": "158 772",
"output": "850911301"
},
{
"input": "2000 1",
"output": "2000"
}
] | 1,633,422,828
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 3
| 1,000
| 8,089,600
|
a,b=list(map(int,input().split()))
g={}
def recr(val,ind):
if (val,ind) in g:
return g[(val,ind)]
if ind==b:
return 1
ans=0
for i in range(1,a+1):
if i%val==0:
ans=ans+recr(i,ind+1)
g[(val,ind)]=ans
return ans
print(recr(1,0))
|
Title: Mashmokh and ACM
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mashmokh's boss, Bimokh, didn't like Mashmokh. So he fired him. Mashmokh decided to go to university and participate in ACM instead of finding a new job. He wants to become a member of Bamokh's team. In order to join he was given some programming tasks and one week to solve them. Mashmokh is not a very experienced programmer. Actually he is not a programmer at all. So he wasn't able to solve them. That's why he asked you to help him with these tasks. One of these tasks is the following.
A sequence of *l* integers *b*1,<=*b*2,<=...,<=*b**l* (1<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**l*<=≤<=*n*) is called good if each number divides (without a remainder) by the next number in the sequence. More formally for all *i* (1<=≤<=*i*<=≤<=*l*<=-<=1).
Given *n* and *k* find the number of good sequences of length *k*. As the answer can be rather large print it modulo 1000000007 (109<=+<=7).
Input Specification:
The first line of input contains two space-separated integers *n*,<=*k* (1<=≤<=*n*,<=*k*<=≤<=2000).
Output Specification:
Output a single integer — the number of good sequences of length *k* modulo 1000000007 (109<=+<=7).
Demo Input:
['3 2\n', '6 4\n', '2 1\n']
Demo Output:
['5\n', '39\n', '2\n']
Note:
In the first sample the good sequences are: [1, 1], [2, 2], [3, 3], [1, 2], [1, 3].
|
```python
a,b=list(map(int,input().split()))
g={}
def recr(val,ind):
if (val,ind) in g:
return g[(val,ind)]
if ind==b:
return 1
ans=0
for i in range(1,a+1):
if i%val==0:
ans=ans+recr(i,ind+1)
g[(val,ind)]=ans
return ans
print(recr(1,0))
```
| 0
|
|
225
|
A
|
Dice Tower
|
PROGRAMMING
| 1,100
|
[
"constructive algorithms",
"greedy"
] | null | null |
A dice is a cube, its faces contain distinct integers from 1 to 6 as black points. The sum of numbers at the opposite dice faces always equals 7. Please note that there are only two dice (these dices are mirror of each other) that satisfy the given constraints (both of them are shown on the picture on the left).
Alice and Bob play dice. Alice has built a tower from *n* dice. We know that in this tower the adjacent dice contact with faces with distinct numbers. Bob wants to uniquely identify the numbers written on the faces of all dice, from which the tower is built. Unfortunately, Bob is looking at the tower from the face, and so he does not see all the numbers on the faces. Bob sees the number on the top of the tower and the numbers on the two adjacent sides (on the right side of the picture shown what Bob sees).
Help Bob, tell whether it is possible to uniquely identify the numbers on the faces of all the dice in the tower, or not.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of dice in the tower.
The second line contains an integer *x* (1<=≤<=*x*<=≤<=6) — the number Bob sees at the top of the tower. Next *n* lines contain two space-separated integers each: the *i*-th line contains numbers *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=6; *a**i*<=≠<=*b**i*) — the numbers Bob sees on the two sidelong faces of the *i*-th dice in the tower.
Consider the dice in the tower indexed from top to bottom from 1 to *n*. That is, the topmost dice has index 1 (the dice whose top face Bob can see). It is guaranteed that it is possible to make a dice tower that will look as described in the input.
|
Print "YES" (without the quotes), if it is possible to to uniquely identify the numbers on the faces of all the dice in the tower. If it is impossible, print "NO" (without the quotes).
|
[
"3\n6\n3 2\n5 4\n2 4\n",
"3\n3\n2 6\n4 1\n5 3\n"
] |
[
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "3\n6\n3 2\n5 4\n2 4",
"output": "YES"
},
{
"input": "3\n3\n2 6\n4 1\n5 3",
"output": "NO"
},
{
"input": "1\n3\n2 1",
"output": "YES"
},
{
"input": "2\n2\n3 1\n1 5",
"output": "NO"
},
{
"input": "3\n2\n1 4\n5 3\n6 4",
"output": "NO"
},
{
"input": "4\n3\n5 6\n1 3\n1 5\n4 1",
"output": "NO"
},
{
"input": "2\n2\n3 1\n1 3",
"output": "YES"
},
{
"input": "3\n2\n1 4\n3 1\n4 6",
"output": "YES"
},
{
"input": "4\n3\n5 6\n1 5\n5 1\n1 5",
"output": "YES"
},
{
"input": "5\n1\n2 3\n5 3\n5 4\n5 1\n3 5",
"output": "NO"
},
{
"input": "10\n5\n1 3\n2 3\n6 5\n6 5\n4 5\n1 3\n1 2\n3 2\n4 2\n1 2",
"output": "NO"
},
{
"input": "15\n4\n2 1\n2 4\n6 4\n5 3\n4 1\n4 2\n6 3\n4 5\n3 5\n2 6\n5 6\n1 5\n3 5\n6 4\n3 2",
"output": "NO"
},
{
"input": "20\n6\n3 2\n4 6\n3 6\n6 4\n5 1\n1 5\n2 6\n1 2\n1 4\n5 3\n2 3\n6 2\n5 4\n2 6\n1 3\n4 6\n4 5\n6 3\n3 1\n6 2",
"output": "NO"
},
{
"input": "25\n4\n1 2\n4 1\n3 5\n2 1\n3 5\n6 5\n3 5\n5 6\n1 2\n2 4\n6 2\n2 3\n2 4\n6 5\n2 3\n6 3\n2 3\n1 3\n2 1\n3 1\n5 6\n3 1\n6 4\n3 6\n2 3",
"output": "NO"
},
{
"input": "100\n3\n6 5\n5 1\n3 2\n1 5\n3 6\n5 4\n2 6\n4 1\n6 3\n4 5\n1 5\n1 4\n4 2\n2 6\n5 4\n4 1\n1 3\n6 5\n5 1\n2 1\n2 4\n2 1\n3 6\n4 1\n6 3\n2 3\n5 1\n2 6\n6 4\n3 5\n4 1\n6 5\n1 5\n1 5\n2 3\n4 1\n5 3\n6 4\n1 3\n5 3\n4 1\n1 4\n2 1\n6 2\n1 5\n6 2\n6 2\n4 5\n4 2\n5 6\n6 3\n1 3\n2 3\n5 4\n6 5\n3 1\n1 2\n4 1\n1 3\n1 3\n6 5\n4 6\n3 1\n2 1\n2 3\n3 2\n4 1\n1 5\n4 1\n6 3\n1 5\n4 5\n4 2\n4 5\n2 6\n2 1\n3 5\n4 6\n4 2\n4 5\n2 4\n3 1\n6 4\n5 6\n3 1\n1 4\n4 5\n6 3\n6 3\n2 1\n5 1\n3 6\n3 5\n2 1\n4 6\n4 2\n5 6\n3 1\n3 5\n3 6",
"output": "NO"
},
{
"input": "99\n3\n2 1\n6 2\n3 6\n1 3\n5 1\n2 6\n4 6\n6 4\n6 4\n6 5\n3 6\n2 6\n1 5\n2 3\n4 6\n1 4\n4 1\n2 3\n4 5\n4 1\n5 1\n1 2\n6 5\n4 6\n6 5\n6 2\n3 6\n6 4\n2 1\n3 1\n2 1\n6 2\n3 5\n4 1\n5 3\n3 1\n1 5\n3 6\n6 2\n1 5\n2 1\n5 1\n4 1\n2 6\n5 4\n4 2\n2 1\n1 5\n1 3\n4 6\n4 6\n4 5\n2 3\n6 2\n3 2\n2 1\n4 6\n6 2\n3 5\n3 6\n3 1\n2 3\n2 1\n3 6\n6 5\n6 3\n1 2\n5 1\n1 4\n6 2\n5 3\n1 3\n5 4\n2 3\n6 3\n1 5\n1 2\n2 6\n5 6\n5 6\n3 5\n3 1\n4 6\n3 1\n4 5\n4 2\n3 5\n6 2\n2 4\n4 6\n6 2\n4 2\n2 3\n2 4\n1 5\n1 4\n3 5\n1 2\n4 5",
"output": "NO"
},
{
"input": "98\n6\n4 2\n1 2\n3 2\n2 1\n2 1\n3 2\n2 3\n6 5\n4 6\n1 5\n4 5\n5 1\n6 5\n1 4\n1 2\n2 4\n6 5\n4 5\n4 6\n3 1\n2 3\n4 1\n4 2\n6 5\n3 2\n4 2\n5 1\n2 4\n1 3\n4 5\n3 2\n1 2\n3 1\n3 2\n3 6\n6 4\n3 6\n3 5\n4 6\n6 5\n3 5\n3 2\n4 2\n6 4\n1 3\n2 4\n5 3\n2 3\n1 3\n5 6\n5 3\n5 3\n4 6\n4 6\n3 6\n4 1\n6 5\n6 2\n1 5\n2 1\n6 2\n5 4\n6 3\n1 5\n2 3\n2 6\n5 6\n2 6\n5 1\n3 2\n6 2\n6 2\n1 2\n2 1\n3 5\n2 1\n4 6\n1 4\n4 5\n3 2\n3 2\n5 4\n1 3\n5 1\n2 3\n6 2\n2 6\n1 5\n5 1\n5 4\n5 1\n5 4\n2 1\n6 5\n1 4\n6 5\n1 2\n3 5",
"output": "NO"
},
{
"input": "97\n3\n2 1\n6 5\n4 1\n6 5\n3 2\n1 2\n6 3\n6 4\n6 3\n1 3\n1 3\n3 1\n3 6\n3 2\n5 6\n4 2\n3 6\n1 5\n2 6\n3 2\n6 2\n2 1\n2 4\n1 3\n3 1\n2 6\n3 6\n4 6\n6 2\n5 1\n6 3\n2 6\n3 6\n2 4\n4 5\n6 5\n4 1\n5 6\n6 2\n5 4\n5 1\n6 5\n1 4\n2 1\n4 5\n4 5\n4 1\n5 4\n1 4\n2 6\n2 6\n1 5\n5 6\n3 2\n2 3\n1 4\n4 1\n3 6\n6 2\n5 3\n6 2\n4 5\n6 2\n2 6\n6 5\n1 4\n2 6\n3 5\n2 6\n4 1\n4 5\n1 3\n4 2\n3 2\n1 2\n5 6\n1 5\n3 5\n2 1\n1 2\n1 2\n6 4\n5 1\n1 2\n2 4\n6 3\n4 5\n1 5\n4 2\n5 1\n3 1\n6 4\n4 2\n1 5\n4 6\n2 1\n2 6",
"output": "NO"
},
{
"input": "96\n4\n1 5\n1 5\n4 6\n1 2\n4 2\n3 2\n4 6\n6 4\n6 3\n6 2\n4 1\n6 4\n5 1\n2 4\n5 6\n6 5\n3 2\n6 2\n3 1\n1 4\n3 2\n6 2\n2 4\n1 3\n5 4\n1 3\n6 2\n6 2\n5 6\n1 4\n4 2\n6 2\n3 1\n6 5\n3 1\n4 2\n6 3\n3 2\n3 6\n1 3\n5 6\n6 4\n1 4\n5 4\n2 6\n3 5\n5 4\n5 1\n2 4\n1 5\n1 3\n1 2\n1 3\n6 4\n6 3\n4 5\n4 1\n3 6\n1 2\n6 4\n1 2\n2 3\n2 1\n4 6\n1 3\n5 1\n4 5\n5 4\n6 3\n2 6\n5 1\n6 2\n3 1\n3 1\n5 4\n3 1\n5 6\n2 6\n5 6\n4 2\n6 5\n3 2\n6 5\n2 3\n6 4\n6 2\n1 2\n4 1\n1 2\n6 3\n2 1\n5 1\n6 5\n5 4\n4 5\n1 2",
"output": "NO"
},
{
"input": "5\n1\n2 3\n3 5\n4 5\n5 4\n5 3",
"output": "YES"
},
{
"input": "10\n5\n1 3\n3 1\n6 3\n6 3\n4 6\n3 1\n1 4\n3 1\n4 6\n1 3",
"output": "YES"
},
{
"input": "15\n4\n2 1\n2 6\n6 5\n5 1\n1 5\n2 1\n6 5\n5 1\n5 1\n6 2\n6 5\n5 1\n5 1\n6 5\n2 6",
"output": "YES"
},
{
"input": "20\n6\n3 2\n4 2\n3 5\n4 2\n5 3\n5 4\n2 3\n2 3\n4 5\n3 5\n3 2\n2 4\n4 5\n2 4\n3 2\n4 2\n5 4\n3 2\n3 5\n2 4",
"output": "YES"
},
{
"input": "25\n4\n1 2\n1 5\n5 6\n1 2\n5 1\n5 6\n5 1\n6 5\n2 1\n2 6\n2 6\n2 6\n2 6\n5 6\n2 6\n6 5\n2 1\n1 5\n1 2\n1 2\n6 5\n1 2\n6 5\n6 2\n2 6",
"output": "YES"
},
{
"input": "100\n3\n6 5\n1 5\n2 1\n5 1\n6 5\n5 1\n6 2\n1 2\n6 5\n5 1\n5 1\n1 5\n2 6\n6 2\n5 6\n1 2\n1 5\n5 6\n1 5\n1 2\n2 6\n1 2\n6 2\n1 5\n6 2\n2 6\n1 5\n6 2\n6 5\n5 6\n1 5\n5 6\n5 1\n5 1\n2 1\n1 2\n5 6\n6 5\n1 5\n5 1\n1 2\n1 5\n1 2\n2 6\n5 1\n2 6\n2 6\n5 6\n2 6\n6 5\n6 5\n1 5\n2 1\n5 6\n5 6\n1 2\n2 1\n1 2\n1 2\n1 2\n5 6\n6 2\n1 5\n1 2\n2 1\n2 6\n1 2\n5 1\n1 5\n6 5\n5 1\n5 1\n2 6\n5 6\n6 2\n1 2\n5 1\n6 2\n2 1\n5 6\n2 1\n1 5\n6 5\n6 5\n1 2\n1 2\n5 1\n6 2\n6 2\n1 2\n1 5\n6 5\n5 6\n1 2\n6 5\n2 1\n6 5\n1 5\n5 6\n6 5",
"output": "YES"
},
{
"input": "99\n3\n2 1\n2 6\n6 2\n1 5\n1 5\n6 2\n6 5\n6 5\n6 2\n5 6\n6 5\n6 2\n5 1\n2 6\n6 5\n1 5\n1 5\n2 6\n5 1\n1 5\n1 5\n2 1\n5 6\n6 5\n5 6\n2 6\n6 2\n6 5\n1 2\n1 2\n1 2\n2 6\n5 6\n1 2\n5 6\n1 2\n5 1\n6 5\n2 6\n5 1\n1 2\n1 5\n1 5\n6 2\n5 1\n2 6\n1 2\n5 1\n1 5\n6 5\n6 5\n5 6\n2 1\n2 6\n2 6\n1 2\n6 2\n2 6\n5 6\n6 5\n1 5\n2 1\n1 2\n6 2\n5 6\n6 5\n2 1\n1 5\n1 5\n2 6\n5 1\n1 2\n5 6\n2 1\n6 5\n5 1\n2 1\n6 2\n6 5\n6 5\n5 6\n1 2\n6 5\n1 2\n5 1\n2 1\n5 1\n2 6\n2 1\n6 2\n2 6\n2 6\n2 1\n2 1\n5 1\n1 5\n5 6\n2 1\n5 6",
"output": "YES"
},
{
"input": "98\n6\n4 2\n2 3\n2 3\n2 3\n2 3\n2 3\n3 2\n5 4\n4 2\n5 4\n5 4\n5 4\n5 3\n4 5\n2 3\n4 2\n5 3\n5 4\n4 5\n3 5\n3 2\n4 2\n2 4\n5 4\n2 3\n2 4\n5 4\n4 2\n3 5\n5 4\n2 3\n2 4\n3 5\n2 3\n3 5\n4 2\n3 5\n5 3\n4 2\n5 3\n5 3\n2 3\n2 4\n4 5\n3 2\n4 2\n3 5\n3 2\n3 5\n5 4\n3 5\n3 5\n4 2\n4 2\n3 2\n4 5\n5 4\n2 3\n5 4\n2 4\n2 3\n4 5\n3 5\n5 4\n3 2\n2 3\n5 3\n2 3\n5 3\n2 3\n2 3\n2 4\n2 3\n2 3\n5 3\n2 3\n4 2\n4 2\n5 4\n2 3\n2 3\n4 5\n3 2\n5 3\n3 2\n2 4\n2 4\n5 3\n5 4\n4 5\n5 3\n4 5\n2 4\n5 3\n4 2\n5 4\n2 4\n5 3",
"output": "YES"
},
{
"input": "97\n3\n2 1\n5 6\n1 2\n5 6\n2 6\n2 1\n6 2\n6 5\n6 2\n1 5\n1 2\n1 2\n6 2\n2 6\n6 5\n2 6\n6 5\n5 1\n6 2\n2 6\n2 6\n1 2\n2 6\n1 2\n1 5\n6 2\n6 5\n6 5\n2 6\n1 5\n6 5\n6 2\n6 2\n2 6\n5 6\n5 6\n1 5\n6 5\n2 6\n5 6\n1 5\n5 6\n1 5\n1 2\n5 1\n5 1\n1 5\n5 1\n1 5\n6 2\n6 2\n5 1\n6 5\n2 1\n2 6\n1 5\n1 5\n6 2\n2 6\n5 6\n2 6\n5 6\n2 6\n6 2\n5 6\n1 2\n6 2\n5 6\n6 2\n1 5\n5 6\n1 5\n2 6\n2 6\n2 1\n6 5\n5 1\n5 1\n1 2\n2 1\n2 1\n6 2\n1 5\n2 1\n2 1\n6 2\n5 1\n5 1\n2 6\n1 5\n1 2\n6 2\n2 6\n5 1\n6 5\n1 2\n6 2",
"output": "YES"
},
{
"input": "96\n4\n1 5\n5 1\n6 5\n2 1\n2 1\n2 6\n6 5\n6 5\n6 2\n2 6\n1 5\n6 5\n1 5\n2 6\n6 5\n5 6\n2 1\n2 6\n1 2\n1 5\n2 6\n2 6\n2 1\n1 5\n5 1\n1 2\n2 6\n2 6\n6 5\n1 5\n2 1\n2 6\n1 2\n5 6\n1 5\n2 6\n6 2\n2 6\n6 5\n1 5\n6 5\n6 5\n1 5\n5 1\n6 2\n5 1\n5 1\n1 5\n2 6\n5 1\n1 5\n2 1\n1 2\n6 2\n6 2\n5 6\n1 5\n6 5\n2 1\n6 5\n2 1\n2 1\n1 2\n6 2\n1 2\n1 5\n5 1\n5 6\n6 5\n6 2\n1 5\n2 6\n1 2\n1 2\n5 1\n1 5\n6 5\n6 2\n6 5\n2 6\n5 6\n2 1\n5 6\n2 1\n6 5\n2 6\n2 1\n1 5\n2 1\n6 2\n1 2\n1 5\n5 6\n5 1\n5 6\n2 1",
"output": "YES"
},
{
"input": "3\n6\n3 2\n5 4\n2 6",
"output": "NO"
},
{
"input": "4\n1\n2 3\n2 3\n2 3\n1 3",
"output": "NO"
},
{
"input": "2\n6\n3 2\n6 4",
"output": "NO"
},
{
"input": "3\n6\n3 2\n5 6\n2 4",
"output": "NO"
},
{
"input": "2\n5\n6 3\n4 5",
"output": "NO"
},
{
"input": "2\n6\n3 2\n6 5",
"output": "NO"
},
{
"input": "2\n1\n3 2\n1 2",
"output": "NO"
},
{
"input": "2\n3\n5 1\n3 5",
"output": "NO"
},
{
"input": "2\n1\n2 3\n1 2",
"output": "NO"
},
{
"input": "2\n1\n2 3\n2 1",
"output": "NO"
},
{
"input": "3\n1\n4 5\n4 1\n4 5",
"output": "NO"
},
{
"input": "2\n4\n2 6\n5 4",
"output": "NO"
},
{
"input": "2\n6\n3 2\n6 2",
"output": "NO"
},
{
"input": "2\n3\n2 1\n3 5",
"output": "NO"
},
{
"input": "2\n3\n1 2\n3 1",
"output": "NO"
},
{
"input": "2\n3\n2 6\n5 3",
"output": "NO"
},
{
"input": "3\n3\n1 2\n3 2\n3 1",
"output": "NO"
},
{
"input": "3\n5\n3 1\n1 3\n2 3",
"output": "NO"
},
{
"input": "2\n6\n2 4\n6 5",
"output": "NO"
},
{
"input": "2\n6\n4 5\n6 5",
"output": "NO"
},
{
"input": "2\n6\n3 5\n3 6",
"output": "NO"
},
{
"input": "2\n4\n1 2\n4 5",
"output": "NO"
},
{
"input": "2\n3\n2 6\n3 1",
"output": "NO"
}
] | 1,641,723,979
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 8
| 154
| 0
|
n = int(input())
x = int(input())
faces = []
default = {1,2,3,4,5,6}
for i in range(n):
raw = set(map(int, input().split()))
impr = set()
for v in raw:
impr.add(v)
impr.add(7-v)
if i == 0:
impr.add(x)
faces.append(default - impr)
i = 1
if n == 1:
print("YES")
exit()
faces[1] = faces[1] - faces[0]
if len(faces[1]) == 2:
print("NO")
exit()
i = 2
while i < n:
exc = faces[i] - faces[i-1]
if len(exc) == 0:
print("NO")
exit()
i += 1
print("YES")
|
Title: Dice Tower
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A dice is a cube, its faces contain distinct integers from 1 to 6 as black points. The sum of numbers at the opposite dice faces always equals 7. Please note that there are only two dice (these dices are mirror of each other) that satisfy the given constraints (both of them are shown on the picture on the left).
Alice and Bob play dice. Alice has built a tower from *n* dice. We know that in this tower the adjacent dice contact with faces with distinct numbers. Bob wants to uniquely identify the numbers written on the faces of all dice, from which the tower is built. Unfortunately, Bob is looking at the tower from the face, and so he does not see all the numbers on the faces. Bob sees the number on the top of the tower and the numbers on the two adjacent sides (on the right side of the picture shown what Bob sees).
Help Bob, tell whether it is possible to uniquely identify the numbers on the faces of all the dice in the tower, or not.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of dice in the tower.
The second line contains an integer *x* (1<=≤<=*x*<=≤<=6) — the number Bob sees at the top of the tower. Next *n* lines contain two space-separated integers each: the *i*-th line contains numbers *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=6; *a**i*<=≠<=*b**i*) — the numbers Bob sees on the two sidelong faces of the *i*-th dice in the tower.
Consider the dice in the tower indexed from top to bottom from 1 to *n*. That is, the topmost dice has index 1 (the dice whose top face Bob can see). It is guaranteed that it is possible to make a dice tower that will look as described in the input.
Output Specification:
Print "YES" (without the quotes), if it is possible to to uniquely identify the numbers on the faces of all the dice in the tower. If it is impossible, print "NO" (without the quotes).
Demo Input:
['3\n6\n3 2\n5 4\n2 4\n', '3\n3\n2 6\n4 1\n5 3\n']
Demo Output:
['YES', 'NO']
Note:
none
|
```python
n = int(input())
x = int(input())
faces = []
default = {1,2,3,4,5,6}
for i in range(n):
raw = set(map(int, input().split()))
impr = set()
for v in raw:
impr.add(v)
impr.add(7-v)
if i == 0:
impr.add(x)
faces.append(default - impr)
i = 1
if n == 1:
print("YES")
exit()
faces[1] = faces[1] - faces[0]
if len(faces[1]) == 2:
print("NO")
exit()
i = 2
while i < n:
exc = faces[i] - faces[i-1]
if len(exc) == 0:
print("NO")
exit()
i += 1
print("YES")
```
| 0
|
|
253
|
B
|
Physics Practical
|
PROGRAMMING
| 1,400
|
[
"binary search",
"dp",
"sortings",
"two pointers"
] | null | null |
One day Vasya was on a physics practical, performing the task on measuring the capacitance. He followed the teacher's advice and did as much as *n* measurements, and recorded the results in the notebook. After that he was about to show the results to the teacher, but he remembered that at the last lesson, the teacher had made his friend Petya redo the experiment because the largest and the smallest results differed by more than two times. Vasya is lazy, and he does not want to redo the experiment. He wants to do the task and go home play computer games. So he decided to cheat: before Vasya shows the measurements to the teacher, he will erase some of them, so as to make the largest and the smallest results of the remaining measurements differ in no more than two times. In other words, if the remaining measurements have the smallest result *x*, and the largest result *y*, then the inequality *y*<=≤<=2·*x* must fulfill. Of course, to avoid the teacher's suspicion, Vasya wants to remove as few measurement results as possible from his notes.
Help Vasya, find what minimum number of measurement results he will have to erase from his notes so that the largest and the smallest of the remaining results of the measurements differed in no more than two times.
|
The first line contains integer *n* (2<=≤<=*n*<=≤<=105) — the number of measurements Vasya made. The second line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=5000) — the results of the measurements. The numbers on the second line are separated by single spaces.
|
Print a single integer — the minimum number of results Vasya will have to remove.
|
[
"6\n4 5 3 8 3 7\n",
"4\n4 3 2 4\n"
] |
[
"2\n",
"0\n"
] |
In the first sample you can remove the fourth and the sixth measurement results (values 8 and 7). Then the maximum of the remaining values will be 5, and the minimum one will be 3. Or else, you can remove the third and fifth results (both equal 3). After that the largest remaining result will be 8, and the smallest one will be 4.
| 1,000
|
[
{
"input": "6\n4 5 3 8 3 7",
"output": "2"
},
{
"input": "4\n4 3 2 4",
"output": "0"
},
{
"input": "6\n5 6 4 9 4 8",
"output": "1"
},
{
"input": "4\n5 4 1 5",
"output": "1"
},
{
"input": "2\n3 2",
"output": "0"
},
{
"input": "10\n39 9 18 13 6 16 47 15 1 24",
"output": "5"
},
{
"input": "20\n43 49 46 46 40 41 49 49 48 30 35 36 33 34 42 38 40 46 50 45",
"output": "0"
},
{
"input": "30\n6 1 26 13 16 30 16 23 9 1 5 14 7 2 17 22 21 23 16 3 5 17 22 10 1 24 4 30 8 18",
"output": "15"
},
{
"input": "50\n3 61 16 13 13 12 3 8 14 16 1 32 8 23 29 7 28 13 8 5 9 2 3 2 29 13 1 2 18 29 28 4 13 3 14 9 20 26 1 19 13 7 8 22 7 5 13 14 10 23",
"output": "29"
},
{
"input": "10\n135 188 160 167 179 192 195 192 193 191",
"output": "0"
},
{
"input": "15\n2 19 19 22 15 24 6 36 20 3 18 27 20 1 10",
"output": "6"
},
{
"input": "25\n8 1 2 1 2 5 3 4 2 6 3 3 4 1 6 1 6 1 4 5 2 9 1 2 1",
"output": "13"
},
{
"input": "40\n4784 4824 4707 4343 4376 4585 4917 4848 3748 4554 3390 4944 4845 3922 4617 4606 4815 4698 4595 4942 4327 4983 4833 4507 3721 4863 4633 4553 4991 4922 4733 4396 4747 4724 4886 4226 4025 4928 4990 4792",
"output": "0"
},
{
"input": "60\n1219 19 647 1321 21 242 677 901 10 165 434 978 448 163 919 517 1085 10 516 920 653 1363 62 98 629 928 998 1335 1448 85 357 432 1298 561 663 182 2095 801 59 208 765 1653 642 645 1378 221 911 749 347 849 43 1804 62 73 613 143 860 297 278 148",
"output": "37"
},
{
"input": "100\n4204 4719 4688 3104 4012 4927 4696 4614 4826 4792 3891 4672 4914 4740 4968 3879 4424 4755 3856 3837 4965 4939 4030 4941 4504 4668 4908 4608 3660 4822 4846 3945 4539 4819 4895 3746 4324 4233 4135 4956 4983 4546 4673 4617 3533 4851 4868 4838 4998 4769 4899 4578 3841 4974 4627 4990 4524 4939 4469 4233 4434 4339 4446 4979 4354 4912 4558 4609 4436 3883 4379 4927 4824 4819 4984 4660 4874 3732 4853 4268 4761 4402 4642 4577 4635 4564 4113 4896 4943 4122 4413 4597 3768 4731 4669 4958 4548 4263 4657 3651",
"output": "0"
},
{
"input": "100\n1354 1797 588 3046 1290 745 217 907 113 381 523 935 791 415 92 1597 1739 1774 240 27 1262 2498 52 1339 1031 1355 2036 230 489 7 69 877 530 2664 1230 940 2712 2651 3410 480 332 699 957 2257 1877 1940 452 1652 1216 3144 236 165 1109 888 1649 346 24 183 1061 1226 2694 3225 2021 1145 907 1671 1599 3395 942 1959 555 1281 675 1125 1386 732 1081 326 256 26 1009 1772 2687 1173 491 709 390 992 519 203 1029 1381 846 1515 705 2859 282 147 1824 299",
"output": "63"
},
{
"input": "100\n2794 2201 4935 564 2876 4472 4196 2571 2260 1479 1451 3497 245 2805 4834 3872 4294 1299 937 2983 1458 3278 1098 2990 4447 4337 4388 947 3708 3382 3694 4562 3827 2312 3760 1181 2830 1256 1054 1583 2094 931 86 2526 998 3420 2248 3461 3662 1715 5 4123 1051 545 3704 1084 1916 695 794 121 1000 1611 3674 1910 4795 2805 825 2392 3551 1148 3738 4650 791 288 1064 2011 2991 2116 2179 3333 1303 498 1610 3092 1935 3450 3524 2624 1596 2801 2290 2297 2327 1602 4779 3135 1231 4203 3283 3580",
"output": "51"
},
{
"input": "2\n1 5",
"output": "1"
}
] | 1,660,572,505
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 5
| 92
| 0
|
from bisect import bisect, bisect_right
from math import ceil
f = open('input.txt')
n = int(f.readline())
arr = list(map(int, f.readline().split(' ')))
arr.sort()
i = bisect(arr, arr[0]*2)
j = bisect_right(arr, ceil(arr[-1]/2))
f = open('output.txt', 'w')
f.write(str(min(j, n-i)))
f.close()
|
Title: Physics Practical
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya was on a physics practical, performing the task on measuring the capacitance. He followed the teacher's advice and did as much as *n* measurements, and recorded the results in the notebook. After that he was about to show the results to the teacher, but he remembered that at the last lesson, the teacher had made his friend Petya redo the experiment because the largest and the smallest results differed by more than two times. Vasya is lazy, and he does not want to redo the experiment. He wants to do the task and go home play computer games. So he decided to cheat: before Vasya shows the measurements to the teacher, he will erase some of them, so as to make the largest and the smallest results of the remaining measurements differ in no more than two times. In other words, if the remaining measurements have the smallest result *x*, and the largest result *y*, then the inequality *y*<=≤<=2·*x* must fulfill. Of course, to avoid the teacher's suspicion, Vasya wants to remove as few measurement results as possible from his notes.
Help Vasya, find what minimum number of measurement results he will have to erase from his notes so that the largest and the smallest of the remaining results of the measurements differed in no more than two times.
Input Specification:
The first line contains integer *n* (2<=≤<=*n*<=≤<=105) — the number of measurements Vasya made. The second line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=5000) — the results of the measurements. The numbers on the second line are separated by single spaces.
Output Specification:
Print a single integer — the minimum number of results Vasya will have to remove.
Demo Input:
['6\n4 5 3 8 3 7\n', '4\n4 3 2 4\n']
Demo Output:
['2\n', '0\n']
Note:
In the first sample you can remove the fourth and the sixth measurement results (values 8 and 7). Then the maximum of the remaining values will be 5, and the minimum one will be 3. Or else, you can remove the third and fifth results (both equal 3). After that the largest remaining result will be 8, and the smallest one will be 4.
|
```python
from bisect import bisect, bisect_right
from math import ceil
f = open('input.txt')
n = int(f.readline())
arr = list(map(int, f.readline().split(' ')))
arr.sort()
i = bisect(arr, arr[0]*2)
j = bisect_right(arr, ceil(arr[-1]/2))
f = open('output.txt', 'w')
f.write(str(min(j, n-i)))
f.close()
```
| 0
|
|
863
|
C
|
1-2-3
|
PROGRAMMING
| 1,800
|
[
"graphs",
"implementation"
] | null | null |
Ilya is working for the company that constructs robots. Ilya writes programs for entertainment robots, and his current project is "Bob", a new-generation game robot. Ilya's boss wants to know his progress so far. Especially he is interested if Bob is better at playing different games than the previous model, "Alice".
So now Ilya wants to compare his robots' performance in a simple game called "1-2-3". This game is similar to the "Rock-Paper-Scissors" game: both robots secretly choose a number from the set {1,<=2,<=3} and say it at the same moment. If both robots choose the same number, then it's a draw and noone gets any points. But if chosen numbers are different, then one of the robots gets a point: 3 beats 2, 2 beats 1 and 1 beats 3.
Both robots' programs make them choose their numbers in such a way that their choice in (*i*<=+<=1)-th game depends only on the numbers chosen by them in *i*-th game.
Ilya knows that the robots will play *k* games, Alice will choose number *a* in the first game, and Bob will choose *b* in the first game. He also knows both robots' programs and can tell what each robot will choose depending on their choices in previous game. Ilya doesn't want to wait until robots play all *k* games, so he asks you to predict the number of points they will have after the final game.
|
The first line contains three numbers *k*, *a*, *b* (1<=≤<=*k*<=≤<=1018, 1<=≤<=*a*,<=*b*<=≤<=3).
Then 3 lines follow, *i*-th of them containing 3 numbers *A**i*,<=1, *A**i*,<=2, *A**i*,<=3, where *A**i*,<=*j* represents Alice's choice in the game if Alice chose *i* in previous game and Bob chose *j* (1<=≤<=*A**i*,<=*j*<=≤<=3).
Then 3 lines follow, *i*-th of them containing 3 numbers *B**i*,<=1, *B**i*,<=2, *B**i*,<=3, where *B**i*,<=*j* represents Bob's choice in the game if Alice chose *i* in previous game and Bob chose *j* (1<=≤<=*B**i*,<=*j*<=≤<=3).
|
Print two numbers. First of them has to be equal to the number of points Alice will have, and second of them must be Bob's score after *k* games.
|
[
"10 2 1\n1 1 1\n1 1 1\n1 1 1\n2 2 2\n2 2 2\n2 2 2\n",
"8 1 1\n2 2 1\n3 3 1\n3 1 3\n1 1 1\n2 1 1\n1 2 3\n",
"5 1 1\n1 2 2\n2 2 2\n2 2 2\n1 2 2\n2 2 2\n2 2 2\n"
] |
[
"1 9\n",
"5 2\n",
"0 0\n"
] |
In the second example game goes like this:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1e21b6e200707470571d69c9946ace6b56f5279b.png" style="max-width: 100.0%;max-height: 100.0%;"/>
The fourth and the seventh game are won by Bob, the first game is draw and the rest are won by Alice.
| 0
|
[
{
"input": "10 2 1\n1 1 1\n1 1 1\n1 1 1\n2 2 2\n2 2 2\n2 2 2",
"output": "1 9"
},
{
"input": "8 1 1\n2 2 1\n3 3 1\n3 1 3\n1 1 1\n2 1 1\n1 2 3",
"output": "5 2"
},
{
"input": "5 1 1\n1 2 2\n2 2 2\n2 2 2\n1 2 2\n2 2 2\n2 2 2",
"output": "0 0"
},
{
"input": "1 1 1\n3 3 1\n1 1 1\n3 2 2\n2 2 2\n1 3 1\n3 3 2",
"output": "0 0"
},
{
"input": "1 3 1\n1 3 3\n2 3 2\n2 1 3\n1 3 2\n3 3 2\n3 1 1",
"output": "0 1"
},
{
"input": "10 2 1\n2 2 1\n3 2 2\n3 1 3\n3 1 3\n1 2 2\n3 3 2",
"output": "8 1"
},
{
"input": "10 1 2\n1 1 2\n2 1 2\n1 3 1\n2 3 3\n3 2 2\n3 2 1",
"output": "3 5"
},
{
"input": "1000000 2 3\n3 1 1\n3 1 1\n1 2 2\n3 1 1\n3 1 1\n1 1 3",
"output": "0 333334"
},
{
"input": "1000000 1 3\n1 2 3\n2 1 2\n2 1 2\n1 2 3\n1 1 1\n2 3 3",
"output": "999998 1"
},
{
"input": "1000000000000 1 3\n3 1 1\n3 2 1\n2 2 2\n2 2 1\n1 2 2\n1 1 3",
"output": "500000000001 499999999998"
},
{
"input": "1000000000000 3 2\n2 3 3\n2 1 2\n1 1 1\n2 3 1\n1 3 3\n3 3 3",
"output": "500000000001 499999999999"
},
{
"input": "1000000000000000000 2 3\n1 3 1\n2 3 3\n2 2 2\n1 2 3\n3 1 2\n2 2 2",
"output": "1 500000000000000000"
},
{
"input": "999999999999999999 2 2\n2 3 2\n2 1 2\n1 3 3\n2 2 2\n1 3 2\n1 2 1",
"output": "499999999999999999 0"
},
{
"input": "1000000000000000000 2 1\n3 1 2\n2 3 3\n1 2 3\n2 2 3\n1 1 3\n2 3 2",
"output": "1000000000000000000 0"
},
{
"input": "1000000000000000000 3 3\n2 1 3\n1 2 3\n1 3 2\n3 2 2\n3 1 3\n3 3 1",
"output": "750000000000000000 0"
},
{
"input": "1000000000000000000 3 1\n2 3 2\n2 2 1\n2 3 3\n3 3 3\n2 1 1\n1 2 1",
"output": "500000000000000000 1"
},
{
"input": "478359268475263455 1 1\n3 2 3\n2 3 3\n2 1 1\n3 3 3\n2 3 3\n1 3 1",
"output": "0 0"
},
{
"input": "837264528963824683 3 3\n3 1 1\n1 3 1\n1 3 1\n3 2 1\n2 3 3\n2 2 2",
"output": "0 837264528963824682"
},
{
"input": "129341234876124184 1 2\n1 3 3\n1 1 2\n1 2 3\n3 1 1\n3 1 3\n3 2 3",
"output": "64670617438062091 64670617438062093"
},
{
"input": "981267318925341267 3 2\n1 2 1\n3 2 2\n3 3 3\n3 2 2\n2 2 3\n2 2 1",
"output": "981267318925341267 0"
},
{
"input": "12 2 2\n1 1 2\n2 2 3\n3 3 1\n2 3 1\n2 3 1\n2 3 1",
"output": "3 5"
},
{
"input": "3 1 3\n1 1 2\n2 1 3\n3 3 3\n2 3 1\n1 1 3\n3 3 3",
"output": "3 0"
},
{
"input": "3 2 2\n1 1 2\n2 1 3\n3 3 3\n2 3 1\n1 1 3\n3 3 3",
"output": "0 1"
},
{
"input": "67 1 1\n1 1 2\n2 2 3\n3 3 1\n2 3 1\n2 3 1\n2 3 1",
"output": "23 22"
},
{
"input": "4991 1 2\n1 1 2\n2 2 3\n3 1 3\n2 3 1\n2 3 1\n2 1 3",
"output": "1872 1872"
},
{
"input": "3 1 1\n1 1 2\n2 1 3\n3 3 3\n2 3 1\n1 1 3\n3 3 3",
"output": "1 1"
},
{
"input": "4 1 1\n1 1 2\n2 2 3\n3 3 1\n2 3 1\n2 3 1\n2 3 1",
"output": "2 1"
},
{
"input": "1 2 1\n1 2 3\n1 3 2\n2 1 3\n1 2 3\n3 3 3\n2 1 3",
"output": "1 0"
},
{
"input": "1000000000002 1 1\n2 2 1\n3 3 1\n3 1 3\n1 1 1\n2 1 1\n1 2 3",
"output": "666666666668 333333333333"
},
{
"input": "1000000000005 1 1\n2 2 1\n3 3 1\n3 1 3\n1 1 1\n2 1 1\n1 2 3",
"output": "666666666670 333333333334"
},
{
"input": "4 3 1\n1 1 2\n2 1 3\n3 3 3\n2 3 1\n1 1 3\n3 3 3",
"output": "0 1"
}
] | 1,506,751,152
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 3
| 61
| 204,800
|
k, a, b = [int(i) for i in input().split(" ")]
A = []
B = []
ap = 0
bp = 0
ac = a
bc = b
ah = []
bh = []
sh = []
alert = 0
for i in range(3):
A.append(input())
for i in range(3):
B.append(input())
def Alice_choice(i,j):
return int((A[i-1])[2*j-2])
def Bob_choice(i,j):
return int((B[i-1])[2*j-2])
if ac == bc + 1 or ac == bc - 2:
ap += 1
ah.append(ac)
bh.append(bc)
sh.append(1)
elif bc == ac + 1 or bc == ac - 2:
bp += 1
ah.append(ac)
bh.append(bc)
sh.append(-1)
else:
ah.append(ac)
bh.append(bc)
sh.append(0)
for q in range(k-1):
temp_a = Alice_choice(ac,bc)
temp_b = Bob_choice(ac,bc)
ac = temp_a
bc = temp_b
if ac == bc + 1 or ac == bc - 2:
ap += 1
ah.append(ac)
bh.append(bc)
sh.append(1)
elif bc == ac + 1 or bc == ac - 2:
bp += 1
ah.append(ac)
bh.append(bc)
sh.append(-1)
else:
ah.append(ac)
bh.append(bc)
sh.append(0)
for r in range(q + 1):
if ac == ah[r] and bc == bh[r]:
alert = 1
break
if alert == 1:
break
q += 1
period = q - r
score_pp = sh[r:q]
end = (k - len(sh)) % period
repeat = int((k - len(sh) - end) / period)
aadd = 0
badd = 0
for i in score_pp:
if i == 1:
aadd += 1
elif i == -1:
badd += 1
ap += aadd*repeat
bp += badd*repeat
for i in score_pp[:end]:
if i == 1:
ap += 1
elif i == -1:
bp += 1
print(ap, end = ' ')
print(bp)
# print(ah)
# print(bh)
# print(sh)
# print(period)
# print((q,r))
# print(score_pp)
# print(repeat)
# print((aadd,badd))
# print(end)
# Time Limit Exceeded #
|
Title: 1-2-3
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ilya is working for the company that constructs robots. Ilya writes programs for entertainment robots, and his current project is "Bob", a new-generation game robot. Ilya's boss wants to know his progress so far. Especially he is interested if Bob is better at playing different games than the previous model, "Alice".
So now Ilya wants to compare his robots' performance in a simple game called "1-2-3". This game is similar to the "Rock-Paper-Scissors" game: both robots secretly choose a number from the set {1,<=2,<=3} and say it at the same moment. If both robots choose the same number, then it's a draw and noone gets any points. But if chosen numbers are different, then one of the robots gets a point: 3 beats 2, 2 beats 1 and 1 beats 3.
Both robots' programs make them choose their numbers in such a way that their choice in (*i*<=+<=1)-th game depends only on the numbers chosen by them in *i*-th game.
Ilya knows that the robots will play *k* games, Alice will choose number *a* in the first game, and Bob will choose *b* in the first game. He also knows both robots' programs and can tell what each robot will choose depending on their choices in previous game. Ilya doesn't want to wait until robots play all *k* games, so he asks you to predict the number of points they will have after the final game.
Input Specification:
The first line contains three numbers *k*, *a*, *b* (1<=≤<=*k*<=≤<=1018, 1<=≤<=*a*,<=*b*<=≤<=3).
Then 3 lines follow, *i*-th of them containing 3 numbers *A**i*,<=1, *A**i*,<=2, *A**i*,<=3, where *A**i*,<=*j* represents Alice's choice in the game if Alice chose *i* in previous game and Bob chose *j* (1<=≤<=*A**i*,<=*j*<=≤<=3).
Then 3 lines follow, *i*-th of them containing 3 numbers *B**i*,<=1, *B**i*,<=2, *B**i*,<=3, where *B**i*,<=*j* represents Bob's choice in the game if Alice chose *i* in previous game and Bob chose *j* (1<=≤<=*B**i*,<=*j*<=≤<=3).
Output Specification:
Print two numbers. First of them has to be equal to the number of points Alice will have, and second of them must be Bob's score after *k* games.
Demo Input:
['10 2 1\n1 1 1\n1 1 1\n1 1 1\n2 2 2\n2 2 2\n2 2 2\n', '8 1 1\n2 2 1\n3 3 1\n3 1 3\n1 1 1\n2 1 1\n1 2 3\n', '5 1 1\n1 2 2\n2 2 2\n2 2 2\n1 2 2\n2 2 2\n2 2 2\n']
Demo Output:
['1 9\n', '5 2\n', '0 0\n']
Note:
In the second example game goes like this:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1e21b6e200707470571d69c9946ace6b56f5279b.png" style="max-width: 100.0%;max-height: 100.0%;"/>
The fourth and the seventh game are won by Bob, the first game is draw and the rest are won by Alice.
|
```python
k, a, b = [int(i) for i in input().split(" ")]
A = []
B = []
ap = 0
bp = 0
ac = a
bc = b
ah = []
bh = []
sh = []
alert = 0
for i in range(3):
A.append(input())
for i in range(3):
B.append(input())
def Alice_choice(i,j):
return int((A[i-1])[2*j-2])
def Bob_choice(i,j):
return int((B[i-1])[2*j-2])
if ac == bc + 1 or ac == bc - 2:
ap += 1
ah.append(ac)
bh.append(bc)
sh.append(1)
elif bc == ac + 1 or bc == ac - 2:
bp += 1
ah.append(ac)
bh.append(bc)
sh.append(-1)
else:
ah.append(ac)
bh.append(bc)
sh.append(0)
for q in range(k-1):
temp_a = Alice_choice(ac,bc)
temp_b = Bob_choice(ac,bc)
ac = temp_a
bc = temp_b
if ac == bc + 1 or ac == bc - 2:
ap += 1
ah.append(ac)
bh.append(bc)
sh.append(1)
elif bc == ac + 1 or bc == ac - 2:
bp += 1
ah.append(ac)
bh.append(bc)
sh.append(-1)
else:
ah.append(ac)
bh.append(bc)
sh.append(0)
for r in range(q + 1):
if ac == ah[r] and bc == bh[r]:
alert = 1
break
if alert == 1:
break
q += 1
period = q - r
score_pp = sh[r:q]
end = (k - len(sh)) % period
repeat = int((k - len(sh) - end) / period)
aadd = 0
badd = 0
for i in score_pp:
if i == 1:
aadd += 1
elif i == -1:
badd += 1
ap += aadd*repeat
bp += badd*repeat
for i in score_pp[:end]:
if i == 1:
ap += 1
elif i == -1:
bp += 1
print(ap, end = ' ')
print(bp)
# print(ah)
# print(bh)
# print(sh)
# print(period)
# print((q,r))
# print(score_pp)
# print(repeat)
# print((aadd,badd))
# print(end)
# Time Limit Exceeded #
```
| -1
|
|
808
|
E
|
Selling Souvenirs
|
PROGRAMMING
| 2,300
|
[
"binary search",
"dp",
"greedy",
"ternary search"
] | null | null |
After several latest reforms many tourists are planning to visit Berland, and Berland people understood that it's an opportunity to earn money and changed their jobs to attract tourists. Petya, for example, left the IT corporation he had been working for and started to sell souvenirs at the market.
This morning, as usual, Petya will come to the market. Petya has *n* different souvenirs to sell; *i*th souvenir is characterised by its weight *w**i* and cost *c**i*. Petya knows that he might not be able to carry all the souvenirs to the market. So Petya wants to choose a subset of souvenirs such that its total weight is not greater than *m*, and total cost is maximum possible.
Help Petya to determine maximum possible total cost.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100000, 1<=≤<=*m*<=≤<=300000) — the number of Petya's souvenirs and total weight that he can carry to the market.
Then *n* lines follow. *i*th line contains two integers *w**i* and *c**i* (1<=≤<=*w**i*<=≤<=3, 1<=≤<=*c**i*<=≤<=109) — the weight and the cost of *i*th souvenir.
|
Print one number — maximum possible total cost of souvenirs that Petya can carry to the market.
|
[
"1 1\n2 1\n",
"2 2\n1 3\n2 2\n",
"4 3\n3 10\n2 7\n2 8\n1 1\n"
] |
[
"0\n",
"3\n",
"10\n"
] |
none
| 0
|
[
{
"input": "1 1\n2 1",
"output": "0"
},
{
"input": "2 2\n1 3\n2 2",
"output": "3"
},
{
"input": "4 3\n3 10\n2 7\n2 8\n1 1",
"output": "10"
},
{
"input": "5 5\n3 5\n2 6\n3 2\n1 1\n1 6",
"output": "13"
},
{
"input": "6 6\n1 6\n1 4\n1 8\n3 2\n3 2\n2 8",
"output": "26"
},
{
"input": "6 12\n1 7\n1 10\n2 8\n1 2\n2 9\n3 5",
"output": "41"
},
{
"input": "6 18\n3 3\n1 10\n2 10\n3 6\n1 3\n2 3",
"output": "35"
},
{
"input": "20 25\n2 13\n3 11\n1 32\n1 43\n3 85\n1 14\n2 57\n1 54\n1 38\n2 96\n2 89\n3 64\n1 79\n2 73\n1 73\n2 34\n1 52\n1 79\n1 42\n3 34",
"output": "990"
},
{
"input": "40 45\n2 82\n2 70\n2 48\n3 50\n2 15\n1 23\n1 80\n2 46\n1 20\n3 8\n3 81\n2 27\n1 59\n1 15\n3 95\n2 82\n2 40\n2 9\n2 61\n1 49\n2 5\n2 82\n1 55\n2 11\n1 26\n1 33\n1 2\n1 7\n3 57\n2 29\n1 59\n2 50\n3 63\n1 40\n1 99\n2 91\n2 39\n3 50\n1 75\n3 77",
"output": "1605"
},
{
"input": "4 28\n2 2\n3 1\n3 10\n1 9",
"output": "22"
},
{
"input": "10 5\n1 9\n1 8\n2 10\n3 4\n3 1\n2 2\n3 6\n1 1\n3 8\n2 2",
"output": "28"
},
{
"input": "10 12\n3 7\n3 6\n3 8\n3 2\n1 9\n2 5\n2 1\n2 5\n2 10\n2 9",
"output": "46"
},
{
"input": "1 29\n2 8",
"output": "8"
},
{
"input": "10 2\n3 4\n3 5\n3 7\n1 10\n1 2\n1 2\n1 8\n3 2\n1 8\n3 3",
"output": "18"
},
{
"input": "6 5\n3 1\n3 1\n1 2\n2 9\n3 10\n1 8",
"output": "20"
},
{
"input": "4 2\n3 4\n3 8\n1 1\n1 4",
"output": "5"
},
{
"input": "7 12\n2 10\n2 8\n2 1\n3 8\n3 8\n3 7\n1 7",
"output": "41"
},
{
"input": "70 203\n1 105\n1 105\n1 105\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300\n3 300",
"output": "20310"
},
{
"input": "10 6\n1 8\n1 10\n1 7\n2 9\n3 8\n1 8\n1 7\n1 4\n3 1\n3 8",
"output": "44"
},
{
"input": "2 40\n1 10\n3 6",
"output": "16"
},
{
"input": "7 6\n2 9\n3 10\n1 2\n2 6\n3 6\n2 1\n1 3",
"output": "22"
},
{
"input": "2 4\n3 8\n1 6",
"output": "14"
},
{
"input": "9 19\n2 5\n2 3\n3 9\n1 9\n3 8\n3 5\n3 4\n3 2\n3 6",
"output": "46"
},
{
"input": "13 23\n3 17\n2 83\n1 81\n3 83\n3 59\n3 71\n2 61\n3 8\n3 64\n2 80\n3 47\n1 46\n1 82",
"output": "711"
},
{
"input": "9 10\n3 6\n2 1\n2 4\n2 3\n3 6\n3 1\n1 8\n2 4\n3 3",
"output": "25"
},
{
"input": "3 4\n2 10\n2 10\n3 15",
"output": "20"
},
{
"input": "9 15\n3 8\n1 2\n2 5\n1 5\n3 3\n1 7\n1 7\n2 7\n2 9",
"output": "51"
},
{
"input": "8 21\n2 6\n3 3\n3 7\n3 8\n3 8\n3 8\n2 6\n3 9",
"output": "52"
},
{
"input": "6 7\n2 5\n2 4\n3 9\n3 2\n3 1\n3 8",
"output": "18"
},
{
"input": "8 5\n3 9\n3 3\n1 4\n3 1\n2 5\n3 1\n3 6\n3 1",
"output": "14"
},
{
"input": "1 1\n1 10",
"output": "10"
},
{
"input": "1 2\n2 10",
"output": "10"
},
{
"input": "5 9\n2 8\n3 7\n2 6\n1 4\n2 7",
"output": "28"
},
{
"input": "4 4\n2 13\n2 15\n2 5\n1 9",
"output": "28"
},
{
"input": "2 1\n1 5\n2 11",
"output": "5"
},
{
"input": "8 6\n1 9\n1 5\n1 3\n1 10\n3 8\n1 6\n1 4\n1 2",
"output": "37"
},
{
"input": "5 7\n1 8\n2 13\n2 13\n3 20\n3 14",
"output": "46"
},
{
"input": "52 102\n3 199\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100\n2 100",
"output": "5100"
},
{
"input": "3 4\n1 4\n2 10\n3 100",
"output": "104"
},
{
"input": "61 120\n3 5\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3\n2 3",
"output": "180"
}
] | 1,496,910,949
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 10
| 2,000
| 62,361,600
|
def cost(w,c,m,n):
y = [[0 for i in range(m+1)]for i in range(n+1)]
for i in range(0,n+1):
for a in range(0,m+1):
if i==0 or a==0:
y[i][a] = 0
elif w[i-1] <= a:
y[i][a] = max(c[i-1] + y[i-1][a-w[i-1]], y[i-1][a]);
else:
y[i][a] = y[i-1][a]
return y[n][m]
p = input()
p = p.split()
x = [int(i) for i in p]
n = x[0]
m = x[1]
w = [0 for i in range(n)]
c = [0 for i in range(n)]
for j in range(0,n):
p = input()
p = p.split()
x = [int(i) for i in p]
w[j] = x[0]
c[j] = x[1]
print(cost(w,c,m,n))
|
Title: Selling Souvenirs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After several latest reforms many tourists are planning to visit Berland, and Berland people understood that it's an opportunity to earn money and changed their jobs to attract tourists. Petya, for example, left the IT corporation he had been working for and started to sell souvenirs at the market.
This morning, as usual, Petya will come to the market. Petya has *n* different souvenirs to sell; *i*th souvenir is characterised by its weight *w**i* and cost *c**i*. Petya knows that he might not be able to carry all the souvenirs to the market. So Petya wants to choose a subset of souvenirs such that its total weight is not greater than *m*, and total cost is maximum possible.
Help Petya to determine maximum possible total cost.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100000, 1<=≤<=*m*<=≤<=300000) — the number of Petya's souvenirs and total weight that he can carry to the market.
Then *n* lines follow. *i*th line contains two integers *w**i* and *c**i* (1<=≤<=*w**i*<=≤<=3, 1<=≤<=*c**i*<=≤<=109) — the weight and the cost of *i*th souvenir.
Output Specification:
Print one number — maximum possible total cost of souvenirs that Petya can carry to the market.
Demo Input:
['1 1\n2 1\n', '2 2\n1 3\n2 2\n', '4 3\n3 10\n2 7\n2 8\n1 1\n']
Demo Output:
['0\n', '3\n', '10\n']
Note:
none
|
```python
def cost(w,c,m,n):
y = [[0 for i in range(m+1)]for i in range(n+1)]
for i in range(0,n+1):
for a in range(0,m+1):
if i==0 or a==0:
y[i][a] = 0
elif w[i-1] <= a:
y[i][a] = max(c[i-1] + y[i-1][a-w[i-1]], y[i-1][a]);
else:
y[i][a] = y[i-1][a]
return y[n][m]
p = input()
p = p.split()
x = [int(i) for i in p]
n = x[0]
m = x[1]
w = [0 for i in range(n)]
c = [0 for i in range(n)]
for j in range(0,n):
p = input()
p = p.split()
x = [int(i) for i in p]
w[j] = x[0]
c[j] = x[1]
print(cost(w,c,m,n))
```
| 0
|
|
498
|
C
|
Array and Operations
|
PROGRAMMING
| 2,100
|
[
"flows",
"graph matchings",
"number theory"
] | null | null |
You have written on a piece of paper an array of *n* positive integers *a*[1],<=*a*[2],<=...,<=*a*[*n*] and *m* good pairs of integers (*i*1,<=*j*1),<=(*i*2,<=*j*2),<=...,<=(*i**m*,<=*j**m*). Each good pair (*i**k*,<=*j**k*) meets the following conditions: *i**k*<=+<=*j**k* is an odd number and 1<=≤<=*i**k*<=<<=*j**k*<=≤<=*n*.
In one operation you can perform a sequence of actions:
- take one of the good pairs (*i**k*,<=*j**k*) and some integer *v* (*v*<=><=1), which divides both numbers *a*[*i**k*] and *a*[*j**k*]; - divide both numbers by *v*, i. e. perform the assignments: and .
Determine the maximum number of operations you can sequentially perform on the given array. Note that one pair may be used several times in the described operations.
|
The first line contains two space-separated integers *n*, *m* (2<=≤<=*n*<=≤<=100, 1<=≤<=*m*<=≤<=100).
The second line contains *n* space-separated integers *a*[1],<=*a*[2],<=...,<=*a*[*n*] (1<=≤<=*a*[*i*]<=≤<=109) — the description of the array.
The following *m* lines contain the description of good pairs. The *k*-th line contains two space-separated integers *i**k*, *j**k* (1<=≤<=*i**k*<=<<=*j**k*<=≤<=*n*, *i**k*<=+<=*j**k* is an odd number).
It is guaranteed that all the good pairs are distinct.
|
Output the answer for the problem.
|
[
"3 2\n8 3 8\n1 2\n2 3\n",
"3 2\n8 12 8\n1 2\n2 3\n"
] |
[
"0\n",
"2\n"
] |
none
| 1,000
|
[
{
"input": "3 2\n8 3 8\n1 2\n2 3",
"output": "0"
},
{
"input": "3 2\n8 12 8\n1 2\n2 3",
"output": "2"
},
{
"input": "6 4\n35 33 46 58 7 61\n4 5\n3 6\n5 6\n1 6",
"output": "0"
},
{
"input": "10 25\n262144 262144 64 64 16 134217728 32 512 32 8192\n1 2\n3 10\n5 8\n9 10\n2 5\n5 10\n3 6\n3 8\n2 9\n4 5\n8 9\n1 4\n4 9\n3 4\n1 6\n4 7\n7 8\n5 6\n2 3\n1 10\n1 8\n6 9\n6 7\n2 7\n7 10",
"output": "38"
},
{
"input": "10 9\n67108864 8 2 131072 268435456 256 16384 128 8 128\n4 9\n5 10\n6 9\n9 10\n1 4\n3 8\n8 9\n1 2\n4 5",
"output": "31"
},
{
"input": "20 10\n512 64 536870912 256 1 262144 8 2097152 8192 524288 32 2 16 16777216 524288 64 268435456 256 67108864 131072\n17 20\n2 13\n11 12\n18 19\n4 7\n4 13\n8 9\n14 17\n8 19\n7 10",
"output": "65"
},
{
"input": "20 19\n512 524288 268435456 2048 16384 8192 524288 16777216 128 536870912 256 1 32768 2097152 131072 268435456 262144 134217728 8388608 16\n3 20\n5 12\n19 20\n10 15\n3 18\n3 4\n6 19\n3 14\n3 16\n5 10\n3 12\n5 20\n12 17\n6 9\n13 18\n2 11\n7 12\n6 11\n2 15",
"output": "99"
},
{
"input": "20 19\n4 65536 2097152 512 16777216 262144 4096 4096 64 32 268435456 2 2048 128 512 1048576 524288 1024 512 536870912\n10 15\n16 17\n15 18\n19 20\n9 12\n2 9\n12 19\n8 19\n2 11\n4 17\n2 5\n7 18\n7 10\n17 20\n9 10\n4 15\n10 19\n5 18\n1 16",
"output": "71"
},
{
"input": "22 2\n2097152 2048 1024 134217728 536870912 2097152 32768 2 16777216 67108864 4194304 4194304 512 16 1048576 8 16384 131072 8388608 8192 2097152 4\n9 10\n14 21",
"output": "28"
},
{
"input": "10 25\n2048 536870912 64 65536 524288 2048 4194304 131072 8 128\n7 10\n3 6\n8 9\n9 10\n1 2\n1 8\n2 9\n2 3\n4 7\n5 6\n5 8\n6 9\n1 4\n3 10\n4 5\n3 8\n5 10\n6 7\n2 7\n1 10\n4 9\n1 6\n3 4\n2 5\n7 8",
"output": "61"
},
{
"input": "2 1\n1020407 1020407\n1 2",
"output": "1"
},
{
"input": "8 6\n1020407 1020407 1020407 1020407 1020407 1020407 1020407 1020407\n1 2\n1 4\n2 3\n5 6\n6 7\n7 8",
"output": "4"
},
{
"input": "2 1\n9999991 9999991\n1 2",
"output": "1"
},
{
"input": "2 1\n19961993 19961993\n1 2",
"output": "1"
},
{
"input": "5 3\n1 2 2 2 2\n2 3\n3 4\n2 5",
"output": "2"
},
{
"input": "2 1\n10 10\n1 2",
"output": "2"
},
{
"input": "5 3\n1 1000003 1000003 1000003 1000003\n2 3\n3 4\n2 5",
"output": "2"
},
{
"input": "6 3\n12 7 8 12 7 8\n1 4\n1 6\n3 4",
"output": "5"
},
{
"input": "4 3\n2 2 2 2\n1 2\n1 4\n2 3",
"output": "2"
},
{
"input": "6 3\n12 3 4 12 8 8\n1 4\n4 5\n1 6",
"output": "5"
}
] | 1,569,080,400
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 4
| 155
| 2,048,000
|
import math
if __name__ == '__main__':
n, m = (int(_) for _ in input().split())
data = [int(_) for _ in input().split()]
tuples = [input() for _ in range(m)]
tuples = [_.split() for _ in tuples]
tuples = [(int(val[0]) - 1, int(val[1]) - 1) for val in tuples]
size = math.floor(math.sqrt(max(data)))
primes = [0] * (size + 1)
operations = 0
for i in range(2, size + 1):
if primes[i] == 0:
j = i
while j <= size:
primes[j] = 1
j += i
for j, k in tuples:
while data[j] % i == 0 and data[k] % i == 0:
operations += 1
data[j] /= i
data[k] /= i
print(operations)
|
Title: Array and Operations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have written on a piece of paper an array of *n* positive integers *a*[1],<=*a*[2],<=...,<=*a*[*n*] and *m* good pairs of integers (*i*1,<=*j*1),<=(*i*2,<=*j*2),<=...,<=(*i**m*,<=*j**m*). Each good pair (*i**k*,<=*j**k*) meets the following conditions: *i**k*<=+<=*j**k* is an odd number and 1<=≤<=*i**k*<=<<=*j**k*<=≤<=*n*.
In one operation you can perform a sequence of actions:
- take one of the good pairs (*i**k*,<=*j**k*) and some integer *v* (*v*<=><=1), which divides both numbers *a*[*i**k*] and *a*[*j**k*]; - divide both numbers by *v*, i. e. perform the assignments: and .
Determine the maximum number of operations you can sequentially perform on the given array. Note that one pair may be used several times in the described operations.
Input Specification:
The first line contains two space-separated integers *n*, *m* (2<=≤<=*n*<=≤<=100, 1<=≤<=*m*<=≤<=100).
The second line contains *n* space-separated integers *a*[1],<=*a*[2],<=...,<=*a*[*n*] (1<=≤<=*a*[*i*]<=≤<=109) — the description of the array.
The following *m* lines contain the description of good pairs. The *k*-th line contains two space-separated integers *i**k*, *j**k* (1<=≤<=*i**k*<=<<=*j**k*<=≤<=*n*, *i**k*<=+<=*j**k* is an odd number).
It is guaranteed that all the good pairs are distinct.
Output Specification:
Output the answer for the problem.
Demo Input:
['3 2\n8 3 8\n1 2\n2 3\n', '3 2\n8 12 8\n1 2\n2 3\n']
Demo Output:
['0\n', '2\n']
Note:
none
|
```python
import math
if __name__ == '__main__':
n, m = (int(_) for _ in input().split())
data = [int(_) for _ in input().split()]
tuples = [input() for _ in range(m)]
tuples = [_.split() for _ in tuples]
tuples = [(int(val[0]) - 1, int(val[1]) - 1) for val in tuples]
size = math.floor(math.sqrt(max(data)))
primes = [0] * (size + 1)
operations = 0
for i in range(2, size + 1):
if primes[i] == 0:
j = i
while j <= size:
primes[j] = 1
j += i
for j, k in tuples:
while data[j] % i == 0 and data[k] % i == 0:
operations += 1
data[j] /= i
data[k] /= i
print(operations)
```
| 0
|
|
476
|
B
|
Dreamoon and WiFi
|
PROGRAMMING
| 1,300
|
[
"bitmasks",
"brute force",
"combinatorics",
"dp",
"math",
"probabilities"
] | null | null |
Dreamoon is standing at the position 0 on a number line. Drazil is sending a list of commands through Wi-Fi to Dreamoon's smartphone and Dreamoon follows them.
Each command is one of the following two types:
1. Go 1 unit towards the positive direction, denoted as '+' 1. Go 1 unit towards the negative direction, denoted as '-'
But the Wi-Fi condition is so poor that Dreamoon's smartphone reports some of the commands can't be recognized and Dreamoon knows that some of them might even be wrong though successfully recognized. Dreamoon decides to follow every recognized command and toss a fair coin to decide those unrecognized ones (that means, he moves to the 1 unit to the negative or positive direction with the same probability 0.5).
You are given an original list of commands sent by Drazil and list received by Dreamoon. What is the probability that Dreamoon ends in the position originally supposed to be final by Drazil's commands?
|
The first line contains a string *s*1 — the commands Drazil sends to Dreamoon, this string consists of only the characters in the set {'+', '-'}.
The second line contains a string *s*2 — the commands Dreamoon's smartphone recognizes, this string consists of only the characters in the set {'+', '-', '?'}. '?' denotes an unrecognized command.
Lengths of two strings are equal and do not exceed 10.
|
Output a single real number corresponding to the probability. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=9.
|
[
"++-+-\n+-+-+\n",
"+-+-\n+-??\n",
"+++\n??-\n"
] |
[
"1.000000000000\n",
"0.500000000000\n",
"0.000000000000\n"
] |
For the first sample, both *s*<sub class="lower-index">1</sub> and *s*<sub class="lower-index">2</sub> will lead Dreamoon to finish at the same position + 1.
For the second sample, *s*<sub class="lower-index">1</sub> will lead Dreamoon to finish at position 0, while there are four possibilites for *s*<sub class="lower-index">2</sub>: {"+-++", "+-+-", "+--+", "+---"} with ending position {+2, 0, 0, -2} respectively. So there are 2 correct cases out of 4, so the probability of finishing at the correct position is 0.5.
For the third sample, *s*<sub class="lower-index">2</sub> could only lead us to finish at positions {+1, -1, -3}, so the probability to finish at the correct position + 3 is 0.
| 1,500
|
[
{
"input": "++-+-\n+-+-+",
"output": "1.000000000000"
},
{
"input": "+-+-\n+-??",
"output": "0.500000000000"
},
{
"input": "+++\n??-",
"output": "0.000000000000"
},
{
"input": "++++++++++\n+++??++?++",
"output": "0.125000000000"
},
{
"input": "--+++---+-\n??????????",
"output": "0.205078125000"
},
{
"input": "+--+++--+-\n??????????",
"output": "0.246093750000"
},
{
"input": "+\n+",
"output": "1.000000000000"
},
{
"input": "-\n?",
"output": "0.500000000000"
},
{
"input": "+\n-",
"output": "0.000000000000"
},
{
"input": "-\n-",
"output": "1.000000000000"
},
{
"input": "-\n+",
"output": "0.000000000000"
},
{
"input": "+\n?",
"output": "0.500000000000"
},
{
"input": "++++++++++\n++++++++++",
"output": "1.000000000000"
},
{
"input": "++++++++++\n++++-+++++",
"output": "0.000000000000"
},
{
"input": "----------\n++++++++++",
"output": "0.000000000000"
},
{
"input": "++++++++++\n++++??++++",
"output": "0.250000000000"
},
{
"input": "----------\n+++?++++-+",
"output": "0.000000000000"
},
{
"input": "++++++++++\n++++++++?+",
"output": "0.500000000000"
},
{
"input": "--++++--+\n?-+?-??+-",
"output": "0.250000000000"
},
{
"input": "----------\n??????????",
"output": "0.000976562500"
},
{
"input": "+--++\n+--+-",
"output": "0.000000000000"
},
{
"input": "-----++---\n????????+?",
"output": "0.017578125000"
},
{
"input": "------+--+\n??????????",
"output": "0.043945312500"
},
{
"input": "---++--\n???????",
"output": "0.164062500000"
},
{
"input": "-----++\n???????",
"output": "0.164062500000"
},
{
"input": "+---+--\n???????",
"output": "0.164062500000"
},
{
"input": "---+-+\n??????",
"output": "0.234375000000"
},
{
"input": "+++-+\n---++",
"output": "0.000000000000"
},
{
"input": "++-+--+\n?-?+??+",
"output": "0.375000000000"
},
{
"input": "----+++--\n-+?+++?--",
"output": "0.000000000000"
},
{
"input": "+-----\n+?----",
"output": "0.500000000000"
}
] | 1,660,739,242
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 46
| 0
|
r=[x for x in input()]
a=[x for x in input()]
if r.count("+")==a.count("+") and r.count('-')==a.count("-"):
print(1.0)
elif r.count("+")>=a.count("+") and r.count('-')>=a.count("-"):
print(0.500000000000)
elif r.count("+")!=a.count("+") and r.count('-')!=a.count("-"):
print(0.000000000000)
|
Title: Dreamoon and WiFi
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dreamoon is standing at the position 0 on a number line. Drazil is sending a list of commands through Wi-Fi to Dreamoon's smartphone and Dreamoon follows them.
Each command is one of the following two types:
1. Go 1 unit towards the positive direction, denoted as '+' 1. Go 1 unit towards the negative direction, denoted as '-'
But the Wi-Fi condition is so poor that Dreamoon's smartphone reports some of the commands can't be recognized and Dreamoon knows that some of them might even be wrong though successfully recognized. Dreamoon decides to follow every recognized command and toss a fair coin to decide those unrecognized ones (that means, he moves to the 1 unit to the negative or positive direction with the same probability 0.5).
You are given an original list of commands sent by Drazil and list received by Dreamoon. What is the probability that Dreamoon ends in the position originally supposed to be final by Drazil's commands?
Input Specification:
The first line contains a string *s*1 — the commands Drazil sends to Dreamoon, this string consists of only the characters in the set {'+', '-'}.
The second line contains a string *s*2 — the commands Dreamoon's smartphone recognizes, this string consists of only the characters in the set {'+', '-', '?'}. '?' denotes an unrecognized command.
Lengths of two strings are equal and do not exceed 10.
Output Specification:
Output a single real number corresponding to the probability. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=9.
Demo Input:
['++-+-\n+-+-+\n', '+-+-\n+-??\n', '+++\n??-\n']
Demo Output:
['1.000000000000\n', '0.500000000000\n', '0.000000000000\n']
Note:
For the first sample, both *s*<sub class="lower-index">1</sub> and *s*<sub class="lower-index">2</sub> will lead Dreamoon to finish at the same position + 1.
For the second sample, *s*<sub class="lower-index">1</sub> will lead Dreamoon to finish at position 0, while there are four possibilites for *s*<sub class="lower-index">2</sub>: {"+-++", "+-+-", "+--+", "+---"} with ending position {+2, 0, 0, -2} respectively. So there are 2 correct cases out of 4, so the probability of finishing at the correct position is 0.5.
For the third sample, *s*<sub class="lower-index">2</sub> could only lead us to finish at positions {+1, -1, -3}, so the probability to finish at the correct position + 3 is 0.
|
```python
r=[x for x in input()]
a=[x for x in input()]
if r.count("+")==a.count("+") and r.count('-')==a.count("-"):
print(1.0)
elif r.count("+")>=a.count("+") and r.count('-')>=a.count("-"):
print(0.500000000000)
elif r.count("+")!=a.count("+") and r.count('-')!=a.count("-"):
print(0.000000000000)
```
| 0
|
|
828
|
A
|
Restaurant Tables
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
In a small restaurant there are *a* tables for one person and *b* tables for two persons.
It it known that *n* groups of people come today, each consisting of one or two people.
If a group consist of one person, it is seated at a vacant one-seater table. If there are none of them, it is seated at a vacant two-seater table. If there are none of them, it is seated at a two-seater table occupied by single person. If there are still none of them, the restaurant denies service to this group.
If a group consist of two people, it is seated at a vacant two-seater table. If there are none of them, the restaurant denies service to this group.
You are given a chronological order of groups coming. You are to determine the total number of people the restaurant denies service to.
|
The first line contains three integers *n*, *a* and *b* (1<=≤<=*n*<=≤<=2·105, 1<=≤<=*a*,<=*b*<=≤<=2·105) — the number of groups coming to the restaurant, the number of one-seater and the number of two-seater tables.
The second line contains a sequence of integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=2) — the description of clients in chronological order. If *t**i* is equal to one, then the *i*-th group consists of one person, otherwise the *i*-th group consists of two people.
|
Print the total number of people the restaurant denies service to.
|
[
"4 1 2\n1 2 1 1\n",
"4 1 1\n1 1 2 1\n"
] |
[
"0\n",
"2\n"
] |
In the first example the first group consists of one person, it is seated at a vacant one-seater table. The next group occupies a whole two-seater table. The third group consists of one person, it occupies one place at the remaining two-seater table. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, all clients are served.
In the second example the first group consists of one person, it is seated at the vacant one-seater table. The next group consists of one person, it occupies one place at the two-seater table. It's impossible to seat the next group of two people, so the restaurant denies service to them. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, the restaurant denies service to 2 clients.
| 500
|
[
{
"input": "4 1 2\n1 2 1 1",
"output": "0"
},
{
"input": "4 1 1\n1 1 2 1",
"output": "2"
},
{
"input": "1 1 1\n1",
"output": "0"
},
{
"input": "2 1 2\n2 2",
"output": "0"
},
{
"input": "5 1 3\n1 2 2 2 1",
"output": "1"
},
{
"input": "7 6 1\n1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "10 2 1\n2 1 2 2 2 2 1 2 1 2",
"output": "13"
},
{
"input": "20 4 3\n2 2 2 2 2 2 2 2 1 2 1 1 2 2 1 2 2 2 1 2",
"output": "25"
},
{
"input": "1 1 1\n1",
"output": "0"
},
{
"input": "1 1 1\n2",
"output": "0"
},
{
"input": "1 200000 200000\n2",
"output": "0"
},
{
"input": "30 10 10\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2",
"output": "20"
},
{
"input": "4 1 2\n1 1 1 2",
"output": "2"
},
{
"input": "6 2 3\n1 2 1 1 1 2",
"output": "2"
},
{
"input": "6 1 4\n1 1 1 1 1 2",
"output": "2"
},
{
"input": "6 1 3\n1 1 1 1 2 2",
"output": "4"
},
{
"input": "6 1 3\n1 1 1 1 1 2",
"output": "2"
},
{
"input": "6 4 2\n2 1 2 2 1 1",
"output": "2"
},
{
"input": "3 10 1\n2 2 2",
"output": "4"
},
{
"input": "5 1 3\n1 1 1 1 2",
"output": "2"
},
{
"input": "5 2 2\n1 1 1 1 2",
"output": "2"
},
{
"input": "15 5 5\n1 1 1 1 1 1 1 1 1 1 2 2 2 2 2",
"output": "10"
},
{
"input": "5 1 2\n1 1 1 1 1",
"output": "0"
},
{
"input": "3 6 1\n2 2 2",
"output": "4"
},
{
"input": "5 3 3\n2 2 2 2 2",
"output": "4"
},
{
"input": "8 3 3\n1 1 1 1 1 1 2 2",
"output": "4"
},
{
"input": "5 1 2\n1 1 1 2 1",
"output": "2"
},
{
"input": "6 1 4\n1 2 2 1 2 2",
"output": "2"
},
{
"input": "2 1 1\n2 2",
"output": "2"
},
{
"input": "2 2 1\n2 2",
"output": "2"
},
{
"input": "5 8 1\n2 2 2 2 2",
"output": "8"
},
{
"input": "3 1 4\n1 1 2",
"output": "0"
},
{
"input": "7 1 5\n1 1 1 1 1 1 2",
"output": "2"
},
{
"input": "6 1 3\n1 1 1 2 1 1",
"output": "0"
},
{
"input": "6 1 2\n1 1 1 2 2 2",
"output": "6"
},
{
"input": "8 1 4\n2 1 1 1 2 2 2 2",
"output": "6"
},
{
"input": "4 2 3\n2 2 2 2",
"output": "2"
},
{
"input": "3 1 1\n1 1 2",
"output": "2"
},
{
"input": "5 1 1\n2 2 2 2 2",
"output": "8"
},
{
"input": "10 1 5\n1 1 1 1 1 2 2 2 2 2",
"output": "8"
},
{
"input": "5 1 2\n1 1 1 2 2",
"output": "4"
},
{
"input": "4 1 1\n1 1 2 2",
"output": "4"
},
{
"input": "7 1 2\n1 1 1 1 1 1 1",
"output": "2"
},
{
"input": "5 1 4\n2 2 2 2 2",
"output": "2"
},
{
"input": "6 2 3\n1 1 1 1 2 2",
"output": "2"
},
{
"input": "5 2 2\n2 1 2 1 2",
"output": "2"
},
{
"input": "4 6 1\n2 2 2 2",
"output": "6"
},
{
"input": "6 1 4\n1 1 2 1 1 2",
"output": "2"
},
{
"input": "7 1 3\n1 1 1 1 2 2 2",
"output": "6"
},
{
"input": "4 1 2\n1 1 2 2",
"output": "2"
},
{
"input": "3 1 2\n1 1 2",
"output": "0"
},
{
"input": "6 1 3\n1 2 1 1 2 1",
"output": "2"
},
{
"input": "6 1 3\n1 1 1 2 2 2",
"output": "4"
},
{
"input": "10 2 2\n1 1 1 1 2 2 2 2 2 2",
"output": "12"
},
{
"input": "10 1 4\n1 1 1 1 1 2 2 2 2 2",
"output": "10"
},
{
"input": "3 10 2\n2 2 2",
"output": "2"
},
{
"input": "4 3 1\n1 2 2 2",
"output": "4"
},
{
"input": "7 1 4\n1 1 1 1 1 2 2",
"output": "4"
},
{
"input": "3 4 1\n2 2 2",
"output": "4"
},
{
"input": "4 1 2\n2 1 1 2",
"output": "2"
},
{
"input": "10 1 2\n1 1 1 1 1 1 1 1 1 2",
"output": "6"
},
{
"input": "5 1 3\n1 1 2 1 2",
"output": "2"
},
{
"input": "6 1 3\n1 1 1 1 2 1",
"output": "2"
},
{
"input": "6 1 4\n1 1 1 2 2 2",
"output": "2"
},
{
"input": "7 1 2\n1 2 1 1 1 1 1",
"output": "3"
},
{
"input": "6 2 2\n1 1 1 1 1 1",
"output": "0"
},
{
"input": "6 1 2\n1 1 2 1 1 1",
"output": "2"
},
{
"input": "3 3 1\n2 2 1",
"output": "2"
},
{
"input": "8 4 2\n1 1 1 1 1 1 1 2",
"output": "2"
},
{
"input": "9 1 4\n1 1 1 1 1 2 2 2 2",
"output": "8"
},
{
"input": "5 10 1\n2 2 2 2 2",
"output": "8"
},
{
"input": "3 5 1\n2 2 2",
"output": "4"
},
{
"input": "5 100 1\n2 2 2 2 2",
"output": "8"
},
{
"input": "4 1 2\n1 1 1 1",
"output": "0"
},
{
"input": "4 1 1\n1 1 1 1",
"output": "1"
},
{
"input": "7 2 2\n1 1 1 1 1 1 1",
"output": "1"
}
] | 1,499,792,157
| 657
|
Python 3
|
CHALLENGED
|
CHALLENGES
| 7
| 187
| 7,987,200
|
n,a,b = map(int,input().split())
arr = [ int(x) for x in input().split()]
arr.sort(reverse=True)
#print(arr)
deny = 0
for i in range(n):
if(arr[i]==1 and a>0):
a-=1
#print("1")
elif(arr[i]==2 and b>0):
b-=1
#print("2")
elif(arr[i]==2 and b<=0):
deny+=2
#print("3")
elif(arr[i]==1 and b>0):
b-=0.5
#print("4")
else:
#print("5")
deny+=(arr[i])
#print(arr[i])
print(deny)
|
Title: Restaurant Tables
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In a small restaurant there are *a* tables for one person and *b* tables for two persons.
It it known that *n* groups of people come today, each consisting of one or two people.
If a group consist of one person, it is seated at a vacant one-seater table. If there are none of them, it is seated at a vacant two-seater table. If there are none of them, it is seated at a two-seater table occupied by single person. If there are still none of them, the restaurant denies service to this group.
If a group consist of two people, it is seated at a vacant two-seater table. If there are none of them, the restaurant denies service to this group.
You are given a chronological order of groups coming. You are to determine the total number of people the restaurant denies service to.
Input Specification:
The first line contains three integers *n*, *a* and *b* (1<=≤<=*n*<=≤<=2·105, 1<=≤<=*a*,<=*b*<=≤<=2·105) — the number of groups coming to the restaurant, the number of one-seater and the number of two-seater tables.
The second line contains a sequence of integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=2) — the description of clients in chronological order. If *t**i* is equal to one, then the *i*-th group consists of one person, otherwise the *i*-th group consists of two people.
Output Specification:
Print the total number of people the restaurant denies service to.
Demo Input:
['4 1 2\n1 2 1 1\n', '4 1 1\n1 1 2 1\n']
Demo Output:
['0\n', '2\n']
Note:
In the first example the first group consists of one person, it is seated at a vacant one-seater table. The next group occupies a whole two-seater table. The third group consists of one person, it occupies one place at the remaining two-seater table. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, all clients are served.
In the second example the first group consists of one person, it is seated at the vacant one-seater table. The next group consists of one person, it occupies one place at the two-seater table. It's impossible to seat the next group of two people, so the restaurant denies service to them. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, the restaurant denies service to 2 clients.
|
```python
n,a,b = map(int,input().split())
arr = [ int(x) for x in input().split()]
arr.sort(reverse=True)
#print(arr)
deny = 0
for i in range(n):
if(arr[i]==1 and a>0):
a-=1
#print("1")
elif(arr[i]==2 and b>0):
b-=1
#print("2")
elif(arr[i]==2 and b<=0):
deny+=2
#print("3")
elif(arr[i]==1 and b>0):
b-=0.5
#print("4")
else:
#print("5")
deny+=(arr[i])
#print(arr[i])
print(deny)
```
| -1
|
|
658
|
A
|
Bear and Reverse Radewoosh
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Limak and Radewoosh are going to compete against each other in the upcoming algorithmic contest. They are equally skilled but they won't solve problems in the same order.
There will be *n* problems. The *i*-th problem has initial score *p**i* and it takes exactly *t**i* minutes to solve it. Problems are sorted by difficulty — it's guaranteed that *p**i*<=<<=*p**i*<=+<=1 and *t**i*<=<<=*t**i*<=+<=1.
A constant *c* is given too, representing the speed of loosing points. Then, submitting the *i*-th problem at time *x* (*x* minutes after the start of the contest) gives *max*(0,<= *p**i*<=-<=*c*·*x*) points.
Limak is going to solve problems in order 1,<=2,<=...,<=*n* (sorted increasingly by *p**i*). Radewoosh is going to solve them in order *n*,<=*n*<=-<=1,<=...,<=1 (sorted decreasingly by *p**i*). Your task is to predict the outcome — print the name of the winner (person who gets more points at the end) or a word "Tie" in case of a tie.
You may assume that the duration of the competition is greater or equal than the sum of all *t**i*. That means both Limak and Radewoosh will accept all *n* problems.
|
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=50,<=1<=≤<=*c*<=≤<=1000) — the number of problems and the constant representing the speed of loosing points.
The second line contains *n* integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=1000,<=*p**i*<=<<=*p**i*<=+<=1) — initial scores.
The third line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000,<=*t**i*<=<<=*t**i*<=+<=1) where *t**i* denotes the number of minutes one needs to solve the *i*-th problem.
|
Print "Limak" (without quotes) if Limak will get more points in total. Print "Radewoosh" (without quotes) if Radewoosh will get more points in total. Print "Tie" (without quotes) if Limak and Radewoosh will get the same total number of points.
|
[
"3 2\n50 85 250\n10 15 25\n",
"3 6\n50 85 250\n10 15 25\n",
"8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76\n"
] |
[
"Limak\n",
"Radewoosh\n",
"Tie\n"
] |
In the first sample, there are 3 problems. Limak solves them as follows:
1. Limak spends 10 minutes on the 1-st problem and he gets 50 - *c*·10 = 50 - 2·10 = 30 points. 1. Limak spends 15 minutes on the 2-nd problem so he submits it 10 + 15 = 25 minutes after the start of the contest. For the 2-nd problem he gets 85 - 2·25 = 35 points. 1. He spends 25 minutes on the 3-rd problem so he submits it 10 + 15 + 25 = 50 minutes after the start. For this problem he gets 250 - 2·50 = 150 points.
So, Limak got 30 + 35 + 150 = 215 points.
Radewoosh solves problem in the reversed order:
1. Radewoosh solves 3-rd problem after 25 minutes so he gets 250 - 2·25 = 200 points. 1. He spends 15 minutes on the 2-nd problem so he submits it 25 + 15 = 40 minutes after the start. He gets 85 - 2·40 = 5 points for this problem. 1. He spends 10 minutes on the 1-st problem so he submits it 25 + 15 + 10 = 50 minutes after the start. He gets *max*(0, 50 - 2·50) = *max*(0, - 50) = 0 points.
Radewoosh got 200 + 5 + 0 = 205 points in total. Limak has 215 points so Limak wins.
In the second sample, Limak will get 0 points for each problem and Radewoosh will first solve the hardest problem and he will get 250 - 6·25 = 100 points for that. Radewoosh will get 0 points for other two problems but he is the winner anyway.
In the third sample, Limak will get 2 points for the 1-st problem and 2 points for the 2-nd problem. Radewoosh will get 4 points for the 8-th problem. They won't get points for other problems and thus there is a tie because 2 + 2 = 4.
| 500
|
[
{
"input": "3 2\n50 85 250\n10 15 25",
"output": "Limak"
},
{
"input": "3 6\n50 85 250\n10 15 25",
"output": "Radewoosh"
},
{
"input": "8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76",
"output": "Tie"
},
{
"input": "4 1\n3 5 6 9\n1 2 4 8",
"output": "Limak"
},
{
"input": "4 1\n1 3 6 10\n1 5 7 8",
"output": "Radewoosh"
},
{
"input": "4 1\n2 4 5 10\n2 3 9 10",
"output": "Tie"
},
{
"input": "18 4\n68 97 121 132 146 277 312 395 407 431 458 461 595 634 751 855 871 994\n1 2 3 4 9 10 13 21 22 29 31 34 37 38 39 41 48 49",
"output": "Radewoosh"
},
{
"input": "50 1\n5 14 18 73 137 187 195 197 212 226 235 251 262 278 287 304 310 322 342 379 393 420 442 444 448 472 483 485 508 515 517 523 559 585 618 627 636 646 666 682 703 707 780 853 937 951 959 989 991 992\n30 84 113 173 199 220 235 261 266 277 300 306 310 312 347 356 394 396 397 409 414 424 446 462 468 487 507 517 537 566 594 643 656 660 662 668 706 708 773 774 779 805 820 827 868 896 929 942 961 995",
"output": "Tie"
},
{
"input": "4 1\n4 6 9 10\n2 3 4 5",
"output": "Radewoosh"
},
{
"input": "4 1\n4 6 9 10\n3 4 5 7",
"output": "Radewoosh"
},
{
"input": "4 1\n1 6 7 10\n2 7 8 10",
"output": "Tie"
},
{
"input": "4 1\n4 5 7 9\n1 4 5 8",
"output": "Limak"
},
{
"input": "50 1\n6 17 44 82 94 127 134 156 187 211 212 252 256 292 294 303 352 355 379 380 398 409 424 434 480 524 584 594 631 714 745 756 777 778 789 793 799 821 841 849 859 878 879 895 925 932 944 952 958 990\n15 16 40 42 45 71 99 100 117 120 174 181 186 204 221 268 289 332 376 394 403 409 411 444 471 487 499 539 541 551 567 589 619 623 639 669 689 722 735 776 794 822 830 840 847 907 917 927 936 988",
"output": "Radewoosh"
},
{
"input": "50 10\n25 49 52 73 104 117 127 136 149 164 171 184 226 251 257 258 286 324 337 341 386 390 428 453 464 470 492 517 543 565 609 634 636 660 678 693 710 714 729 736 739 749 781 836 866 875 956 960 977 979\n2 4 7 10 11 22 24 26 27 28 31 35 37 38 42 44 45 46 52 53 55 56 57 59 60 61 64 66 67 68 69 71 75 76 77 78 79 81 83 85 86 87 89 90 92 93 94 98 99 100",
"output": "Limak"
},
{
"input": "50 10\n11 15 25 71 77 83 95 108 143 150 182 183 198 203 213 223 279 280 346 348 350 355 375 376 412 413 415 432 470 545 553 562 589 595 607 633 635 637 688 719 747 767 771 799 842 883 905 924 942 944\n1 3 5 6 7 10 11 12 13 14 15 16 19 20 21 23 25 32 35 36 37 38 40 41 42 43 47 50 51 54 55 56 57 58 59 60 62 63 64 65 66 68 69 70 71 72 73 75 78 80",
"output": "Radewoosh"
},
{
"input": "32 6\n25 77 141 148 157 159 192 196 198 244 245 255 332 392 414 457 466 524 575 603 629 700 738 782 838 841 845 847 870 945 984 985\n1 2 4 5 8 9 10 12 13 14 15 16 17 18 20 21 22 23 24 26 28 31 38 39 40 41 42 43 45 47 48 49",
"output": "Radewoosh"
},
{
"input": "5 1\n256 275 469 671 842\n7 9 14 17 26",
"output": "Limak"
},
{
"input": "2 1000\n1 2\n1 2",
"output": "Tie"
},
{
"input": "3 1\n1 50 809\n2 8 800",
"output": "Limak"
},
{
"input": "1 13\n866\n10",
"output": "Tie"
},
{
"input": "15 1\n9 11 66 128 199 323 376 386 393 555 585 718 935 960 971\n3 11 14 19 20 21 24 26 32 38 40 42 44 47 50",
"output": "Limak"
},
{
"input": "1 10\n546\n45",
"output": "Tie"
},
{
"input": "50 20\n21 43 51 99 117 119 158 167 175 190 196 244 250 316 335 375 391 403 423 428 451 457 460 480 487 522 539 559 566 584 598 602 604 616 626 666 675 730 771 787 828 841 861 867 886 889 898 970 986 991\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Limak"
},
{
"input": "50 21\n13 20 22 38 62 84 118 135 141 152 170 175 194 218 227 229 232 253 260 263 278 313 329 357 396 402 422 452 454 533 575 576 580 594 624 644 653 671 676 759 789 811 816 823 831 833 856 924 933 987\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Tie"
},
{
"input": "1 36\n312\n42",
"output": "Tie"
},
{
"input": "1 1000\n1\n1000",
"output": "Tie"
},
{
"input": "1 1\n1000\n1",
"output": "Tie"
},
{
"input": "50 35\n9 17 28 107 136 152 169 174 186 188 201 262 291 312 324 330 341 358 385 386 393 397 425 431 479 498 502 523 530 540 542 554 578 588 622 623 684 696 709 722 784 819 836 845 850 932 945 969 983 984\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Tie"
},
{
"input": "50 20\n12 113 116 120 138 156 167 183 185 194 211 228 234 261 278 287 310 317 346 361 364 397 424 470 496 522 527 536 611 648 668 704 707 712 717 752 761 766 815 828 832 864 872 885 889 901 904 929 982 993\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Limak"
}
] | 1,578,866,800
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 124
| 512,000
|
n,c=map(int,input().split())
p=list(map(int,input().split()))
t=list(map(int,input().split()))
q=[0,0]
tm=0
for i in range(n):
tm+=t[i]
q[0]+=max(0,p[i]-c*tm)
tm=0
for i in list(range(n))[::-1]:
tm+=t[i]
q[1]+=max(0,p[i]-c*tm)
if q[0]>q[1]: print('Limak')
elif q[1]>q[0]:print("Radewoosh")
else: print("Tie")
|
Title: Bear and Reverse Radewoosh
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak and Radewoosh are going to compete against each other in the upcoming algorithmic contest. They are equally skilled but they won't solve problems in the same order.
There will be *n* problems. The *i*-th problem has initial score *p**i* and it takes exactly *t**i* minutes to solve it. Problems are sorted by difficulty — it's guaranteed that *p**i*<=<<=*p**i*<=+<=1 and *t**i*<=<<=*t**i*<=+<=1.
A constant *c* is given too, representing the speed of loosing points. Then, submitting the *i*-th problem at time *x* (*x* minutes after the start of the contest) gives *max*(0,<= *p**i*<=-<=*c*·*x*) points.
Limak is going to solve problems in order 1,<=2,<=...,<=*n* (sorted increasingly by *p**i*). Radewoosh is going to solve them in order *n*,<=*n*<=-<=1,<=...,<=1 (sorted decreasingly by *p**i*). Your task is to predict the outcome — print the name of the winner (person who gets more points at the end) or a word "Tie" in case of a tie.
You may assume that the duration of the competition is greater or equal than the sum of all *t**i*. That means both Limak and Radewoosh will accept all *n* problems.
Input Specification:
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=50,<=1<=≤<=*c*<=≤<=1000) — the number of problems and the constant representing the speed of loosing points.
The second line contains *n* integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=1000,<=*p**i*<=<<=*p**i*<=+<=1) — initial scores.
The third line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000,<=*t**i*<=<<=*t**i*<=+<=1) where *t**i* denotes the number of minutes one needs to solve the *i*-th problem.
Output Specification:
Print "Limak" (without quotes) if Limak will get more points in total. Print "Radewoosh" (without quotes) if Radewoosh will get more points in total. Print "Tie" (without quotes) if Limak and Radewoosh will get the same total number of points.
Demo Input:
['3 2\n50 85 250\n10 15 25\n', '3 6\n50 85 250\n10 15 25\n', '8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76\n']
Demo Output:
['Limak\n', 'Radewoosh\n', 'Tie\n']
Note:
In the first sample, there are 3 problems. Limak solves them as follows:
1. Limak spends 10 minutes on the 1-st problem and he gets 50 - *c*·10 = 50 - 2·10 = 30 points. 1. Limak spends 15 minutes on the 2-nd problem so he submits it 10 + 15 = 25 minutes after the start of the contest. For the 2-nd problem he gets 85 - 2·25 = 35 points. 1. He spends 25 minutes on the 3-rd problem so he submits it 10 + 15 + 25 = 50 minutes after the start. For this problem he gets 250 - 2·50 = 150 points.
So, Limak got 30 + 35 + 150 = 215 points.
Radewoosh solves problem in the reversed order:
1. Radewoosh solves 3-rd problem after 25 minutes so he gets 250 - 2·25 = 200 points. 1. He spends 15 minutes on the 2-nd problem so he submits it 25 + 15 = 40 minutes after the start. He gets 85 - 2·40 = 5 points for this problem. 1. He spends 10 minutes on the 1-st problem so he submits it 25 + 15 + 10 = 50 minutes after the start. He gets *max*(0, 50 - 2·50) = *max*(0, - 50) = 0 points.
Radewoosh got 200 + 5 + 0 = 205 points in total. Limak has 215 points so Limak wins.
In the second sample, Limak will get 0 points for each problem and Radewoosh will first solve the hardest problem and he will get 250 - 6·25 = 100 points for that. Radewoosh will get 0 points for other two problems but he is the winner anyway.
In the third sample, Limak will get 2 points for the 1-st problem and 2 points for the 2-nd problem. Radewoosh will get 4 points for the 8-th problem. They won't get points for other problems and thus there is a tie because 2 + 2 = 4.
|
```python
n,c=map(int,input().split())
p=list(map(int,input().split()))
t=list(map(int,input().split()))
q=[0,0]
tm=0
for i in range(n):
tm+=t[i]
q[0]+=max(0,p[i]-c*tm)
tm=0
for i in list(range(n))[::-1]:
tm+=t[i]
q[1]+=max(0,p[i]-c*tm)
if q[0]>q[1]: print('Limak')
elif q[1]>q[0]:print("Radewoosh")
else: print("Tie")
```
| 3
|
|
441
|
A
|
Valera and Antique Items
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Valera is a collector. Once he wanted to expand his collection with exactly one antique item.
Valera knows *n* sellers of antiques, the *i*-th of them auctioned *k**i* items. Currently the auction price of the *j*-th object of the *i*-th seller is *s**ij*. Valera gets on well with each of the *n* sellers. He is perfectly sure that if he outbids the current price of one of the items in the auction (in other words, offers the seller the money that is strictly greater than the current price of the item at the auction), the seller of the object will immediately sign a contract with him.
Unfortunately, Valera has only *v* units of money. Help him to determine which of the *n* sellers he can make a deal with.
|
The first line contains two space-separated integers *n*,<=*v* (1<=≤<=*n*<=≤<=50; 104<=≤<=*v*<=≤<=106) — the number of sellers and the units of money the Valera has.
Then *n* lines follow. The *i*-th line first contains integer *k**i* (1<=≤<=*k**i*<=≤<=50) the number of items of the *i*-th seller. Then go *k**i* space-separated integers *s**i*1,<=*s**i*2,<=...,<=*s**ik**i* (104<=≤<=*s**ij*<=≤<=106) — the current prices of the items of the *i*-th seller.
|
In the first line, print integer *p* — the number of sellers with who Valera can make a deal.
In the second line print *p* space-separated integers *q*1,<=*q*2,<=...,<=*q**p* (1<=≤<=*q**i*<=≤<=*n*) — the numbers of the sellers with who Valera can make a deal. Print the numbers of the sellers in the increasing order.
|
[
"3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000\n",
"3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000\n"
] |
[
"3\n1 2 3\n",
"0\n\n"
] |
In the first sample Valera can bargain with each of the sellers. He can outbid the following items: a 40000 item from the first seller, a 20000 item from the second seller, and a 10000 item from the third seller.
In the second sample Valera can not make a deal with any of the sellers, as the prices of all items in the auction too big for him.
| 500
|
[
{
"input": "3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000",
"output": "3\n1 2 3"
},
{
"input": "3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000",
"output": "0"
},
{
"input": "2 100001\n1 895737\n1 541571",
"output": "0"
},
{
"input": "1 1000000\n1 1000000",
"output": "0"
},
{
"input": "1 1000000\n1 561774",
"output": "1\n1"
},
{
"input": "3 1000000\n5 1000000 568832 1000000 1000000 1000000\n13 1000000 1000000 1000000 596527 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000\n20 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000",
"output": "2\n1 2"
},
{
"input": "3 999999\n7 1000000 1000000 1000000 999999 1000000 999999 1000000\n6 999999 1000000 999999 1000000 999999 999999\n7 999999 1000000 1000000 999999 1000000 1000000 1000000",
"output": "0"
},
{
"input": "3 999999\n22 1000000 1000000 999999 999999 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 999999 1000000 1000000 999999 1000000 1000000 1000000 352800 999999 1000000\n14 999999 999999 999999 999999 999999 1000000 999999 999999 999999 999999 702638 999999 1000000 999999\n5 999999 1000000 1000000 999999 363236",
"output": "3\n1 2 3"
},
{
"input": "1 50001\n1 50000",
"output": "1\n1"
}
] | 1,516,378,753
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 26
| 77
| 5,632,000
|
# python 3
num_sellers, money = list(map(int, input().split()))
seller_antiques = list()
for idx in range(num_sellers):
seller_antiques.append(list(map(int, input().split()))[1:])
# print(seller_antiques)
deals = list()
for idx in range(num_sellers):
seller_antiques[idx].sort()
if money > seller_antiques[idx][0]:
deals.append(idx+1)
deals_len = len(deals)
print(deals_len)
if deals_len > 0:
print(' '.join(list(map(str, deals))))
|
Title: Valera and Antique Items
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera is a collector. Once he wanted to expand his collection with exactly one antique item.
Valera knows *n* sellers of antiques, the *i*-th of them auctioned *k**i* items. Currently the auction price of the *j*-th object of the *i*-th seller is *s**ij*. Valera gets on well with each of the *n* sellers. He is perfectly sure that if he outbids the current price of one of the items in the auction (in other words, offers the seller the money that is strictly greater than the current price of the item at the auction), the seller of the object will immediately sign a contract with him.
Unfortunately, Valera has only *v* units of money. Help him to determine which of the *n* sellers he can make a deal with.
Input Specification:
The first line contains two space-separated integers *n*,<=*v* (1<=≤<=*n*<=≤<=50; 104<=≤<=*v*<=≤<=106) — the number of sellers and the units of money the Valera has.
Then *n* lines follow. The *i*-th line first contains integer *k**i* (1<=≤<=*k**i*<=≤<=50) the number of items of the *i*-th seller. Then go *k**i* space-separated integers *s**i*1,<=*s**i*2,<=...,<=*s**ik**i* (104<=≤<=*s**ij*<=≤<=106) — the current prices of the items of the *i*-th seller.
Output Specification:
In the first line, print integer *p* — the number of sellers with who Valera can make a deal.
In the second line print *p* space-separated integers *q*1,<=*q*2,<=...,<=*q**p* (1<=≤<=*q**i*<=≤<=*n*) — the numbers of the sellers with who Valera can make a deal. Print the numbers of the sellers in the increasing order.
Demo Input:
['3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000\n', '3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000\n']
Demo Output:
['3\n1 2 3\n', '0\n\n']
Note:
In the first sample Valera can bargain with each of the sellers. He can outbid the following items: a 40000 item from the first seller, a 20000 item from the second seller, and a 10000 item from the third seller.
In the second sample Valera can not make a deal with any of the sellers, as the prices of all items in the auction too big for him.
|
```python
# python 3
num_sellers, money = list(map(int, input().split()))
seller_antiques = list()
for idx in range(num_sellers):
seller_antiques.append(list(map(int, input().split()))[1:])
# print(seller_antiques)
deals = list()
for idx in range(num_sellers):
seller_antiques[idx].sort()
if money > seller_antiques[idx][0]:
deals.append(idx+1)
deals_len = len(deals)
print(deals_len)
if deals_len > 0:
print(' '.join(list(map(str, deals))))
```
| 3
|
|
320
|
B
|
Ping-Pong (Easy Version)
|
PROGRAMMING
| 1,500
|
[
"dfs and similar",
"graphs"
] | null | null |
In this problem at each moment you have a set of intervals. You can move from interval (*a*,<=*b*) from our set to interval (*c*,<=*d*) from our set if and only if *c*<=<<=*a*<=<<=*d* or *c*<=<<=*b*<=<<=*d*. Also there is a path from interval *I*1 from our set to interval *I*2 from our set if there is a sequence of successive moves starting from *I*1 so that we can reach *I*2.
Your program should handle the queries of the following two types:
1. "1 x y" (*x*<=<<=*y*) — add the new interval (*x*,<=*y*) to the set of intervals. The length of the new interval is guaranteed to be strictly greater than all the previous intervals.1. "2 a b" (*a*<=≠<=*b*) — answer the question: is there a path from *a*-th (one-based) added interval to *b*-th (one-based) added interval?
Answer all the queries. Note, that initially you have an empty set of intervals.
|
The first line of the input contains integer *n* denoting the number of queries, (1<=≤<=*n*<=≤<=100). Each of the following lines contains a query as described above. All numbers in the input are integers and don't exceed 109 by their absolute value.
It's guaranteed that all queries are correct.
|
For each query of the second type print "YES" or "NO" on a separate line depending on the answer.
|
[
"5\n1 1 5\n1 5 11\n2 1 2\n1 2 9\n2 1 2\n"
] |
[
"NO\nYES\n"
] |
none
| 1,000
|
[
{
"input": "5\n1 1 5\n1 5 11\n2 1 2\n1 2 9\n2 1 2",
"output": "NO\nYES"
},
{
"input": "10\n1 -311 -186\n1 -1070 -341\n1 -1506 -634\n1 688 1698\n2 2 4\n1 70 1908\n2 1 2\n2 2 4\n1 -1053 1327\n2 5 4",
"output": "NO\nNO\nNO\nYES"
},
{
"input": "10\n1 -1365 -865\n1 1244 1834\n2 1 2\n1 -1508 -752\n2 3 2\n2 2 1\n1 -779 595\n1 -1316 877\n2 2 1\n1 -698 1700",
"output": "NO\nNO\nNO\nNO"
},
{
"input": "20\n1 1208 1583\n1 -258 729\n1 -409 1201\n1 194 1938\n1 -958 1575\n1 -1466 1752\n2 1 2\n2 1 2\n2 6 5\n1 -1870 1881\n1 -2002 2749\n1 -2002 2984\n1 -2002 3293\n2 2 4\n2 8 10\n2 9 6\n1 -2002 3572\n1 -2002 4175\n1 -2002 4452\n1 -2002 4605",
"output": "YES\nYES\nYES\nYES\nYES\nNO"
},
{
"input": "9\n1 1 4\n1 5 20\n1 11 30\n1 29 60\n1 59 100\n1 100 200\n2 1 5\n2 1 6\n2 2 5",
"output": "NO\nNO\nYES"
}
] | 1,633,033,672
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 3
| 124
| 20,275,200
|
# import bisect
from collections import deque
n = int(input())
intervals = []
for i in range(n):
op, x, y = [int(j) for j in input().split()]
if op == 1:
intervals.append((x, y))
if op == 2:
start = intervals[x - 1]
end = intervals[y - 1]
visited = [False for _ in range(len(intervals))]
stack = deque()
stack.append(x - 1)
while (len(stack)):
cur_idx = stack.pop()
if cur_idx == y - 1:
visited[cur_idx] = True
print("YES")
break
cur_val = intervals[cur_idx]
if not visited[cur_idx]:
for idx, val in enumerate(intervals):
if not visited[idx]:
if cur_val[0] < val[0] < cur_val[1] or cur_val[0] < val[1] < cur_val[1]:
stack.append(idx)
visited[cur_idx] = True
if visited[y - 1] == False:
print("NO")
|
Title: Ping-Pong (Easy Version)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In this problem at each moment you have a set of intervals. You can move from interval (*a*,<=*b*) from our set to interval (*c*,<=*d*) from our set if and only if *c*<=<<=*a*<=<<=*d* or *c*<=<<=*b*<=<<=*d*. Also there is a path from interval *I*1 from our set to interval *I*2 from our set if there is a sequence of successive moves starting from *I*1 so that we can reach *I*2.
Your program should handle the queries of the following two types:
1. "1 x y" (*x*<=<<=*y*) — add the new interval (*x*,<=*y*) to the set of intervals. The length of the new interval is guaranteed to be strictly greater than all the previous intervals.1. "2 a b" (*a*<=≠<=*b*) — answer the question: is there a path from *a*-th (one-based) added interval to *b*-th (one-based) added interval?
Answer all the queries. Note, that initially you have an empty set of intervals.
Input Specification:
The first line of the input contains integer *n* denoting the number of queries, (1<=≤<=*n*<=≤<=100). Each of the following lines contains a query as described above. All numbers in the input are integers and don't exceed 109 by their absolute value.
It's guaranteed that all queries are correct.
Output Specification:
For each query of the second type print "YES" or "NO" on a separate line depending on the answer.
Demo Input:
['5\n1 1 5\n1 5 11\n2 1 2\n1 2 9\n2 1 2\n']
Demo Output:
['NO\nYES\n']
Note:
none
|
```python
# import bisect
from collections import deque
n = int(input())
intervals = []
for i in range(n):
op, x, y = [int(j) for j in input().split()]
if op == 1:
intervals.append((x, y))
if op == 2:
start = intervals[x - 1]
end = intervals[y - 1]
visited = [False for _ in range(len(intervals))]
stack = deque()
stack.append(x - 1)
while (len(stack)):
cur_idx = stack.pop()
if cur_idx == y - 1:
visited[cur_idx] = True
print("YES")
break
cur_val = intervals[cur_idx]
if not visited[cur_idx]:
for idx, val in enumerate(intervals):
if not visited[idx]:
if cur_val[0] < val[0] < cur_val[1] or cur_val[0] < val[1] < cur_val[1]:
stack.append(idx)
visited[cur_idx] = True
if visited[y - 1] == False:
print("NO")
```
| 0
|
|
284
|
A
|
Cows and Primitive Roots
|
PROGRAMMING
| 1,400
|
[
"implementation",
"math",
"number theory"
] | null | null |
The cows have just learned what a primitive root is! Given a prime *p*, a primitive root is an integer *x* (1<=≤<=*x*<=<<=*p*) such that none of integers *x*<=-<=1,<=*x*2<=-<=1,<=...,<=*x**p*<=-<=2<=-<=1 are divisible by *p*, but *x**p*<=-<=1<=-<=1 is.
Unfortunately, computing primitive roots can be time consuming, so the cows need your help. Given a prime *p*, help the cows find the number of primitive roots .
|
The input contains a single line containing an integer *p* (2<=≤<=*p*<=<<=2000). It is guaranteed that *p* is a prime.
|
Output on a single line the number of primitive roots .
|
[
"3\n",
"5\n"
] |
[
"1\n",
"2\n"
] |
The only primitive root <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/3722298ba062e95b18705d1253eb4e5d31e3b2d1.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2.
The primitive roots <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1d85c6a17ef1c42b53cf94d00bc49a7ac458fd58.png" style="max-width: 100.0%;max-height: 100.0%;"/> are 2 and 3.
| 500
|
[
{
"input": "3",
"output": "1"
},
{
"input": "5",
"output": "2"
},
{
"input": "7",
"output": "2"
},
{
"input": "11",
"output": "4"
},
{
"input": "17",
"output": "8"
},
{
"input": "19",
"output": "6"
},
{
"input": "1583",
"output": "672"
},
{
"input": "997",
"output": "328"
},
{
"input": "2",
"output": "1"
},
{
"input": "1987",
"output": "660"
},
{
"input": "1993",
"output": "656"
},
{
"input": "1997",
"output": "996"
},
{
"input": "1999",
"output": "648"
},
{
"input": "1297",
"output": "432"
},
{
"input": "163",
"output": "54"
},
{
"input": "1259",
"output": "576"
},
{
"input": "821",
"output": "320"
},
{
"input": "29",
"output": "12"
},
{
"input": "43",
"output": "12"
},
{
"input": "1949",
"output": "972"
},
{
"input": "1879",
"output": "624"
},
{
"input": "1759",
"output": "584"
},
{
"input": "1597",
"output": "432"
},
{
"input": "1619",
"output": "808"
},
{
"input": "1277",
"output": "560"
},
{
"input": "1097",
"output": "544"
},
{
"input": "953",
"output": "384"
},
{
"input": "751",
"output": "200"
},
{
"input": "607",
"output": "200"
},
{
"input": "509",
"output": "252"
},
{
"input": "431",
"output": "168"
},
{
"input": "317",
"output": "156"
},
{
"input": "211",
"output": "48"
},
{
"input": "127",
"output": "36"
},
{
"input": "101",
"output": "40"
},
{
"input": "31",
"output": "8"
}
] | 1,619,881,218
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 0
|
p=int(input())
x=set()
for j in range(1,p+1):
k=True
a=1
for i in range(1,p-2):
a*=j
if (a-1)%p==0:
k=False
break
if k and (j**(p-1)-1)%p==0:
x.add(j)
print(len(x))
|
Title: Cows and Primitive Roots
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The cows have just learned what a primitive root is! Given a prime *p*, a primitive root is an integer *x* (1<=≤<=*x*<=<<=*p*) such that none of integers *x*<=-<=1,<=*x*2<=-<=1,<=...,<=*x**p*<=-<=2<=-<=1 are divisible by *p*, but *x**p*<=-<=1<=-<=1 is.
Unfortunately, computing primitive roots can be time consuming, so the cows need your help. Given a prime *p*, help the cows find the number of primitive roots .
Input Specification:
The input contains a single line containing an integer *p* (2<=≤<=*p*<=<<=2000). It is guaranteed that *p* is a prime.
Output Specification:
Output on a single line the number of primitive roots .
Demo Input:
['3\n', '5\n']
Demo Output:
['1\n', '2\n']
Note:
The only primitive root <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/3722298ba062e95b18705d1253eb4e5d31e3b2d1.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2.
The primitive roots <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1d85c6a17ef1c42b53cf94d00bc49a7ac458fd58.png" style="max-width: 100.0%;max-height: 100.0%;"/> are 2 and 3.
|
```python
p=int(input())
x=set()
for j in range(1,p+1):
k=True
a=1
for i in range(1,p-2):
a*=j
if (a-1)%p==0:
k=False
break
if k and (j**(p-1)-1)%p==0:
x.add(j)
print(len(x))
```
| 0
|
|
677
|
A
|
Vanya and Fence
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
|
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
|
Print a single integer — the minimum possible valid width of the road.
|
[
"3 7\n4 5 14\n",
"6 1\n1 1 1 1 1 1\n",
"6 5\n7 6 8 9 10 5\n"
] |
[
"4\n",
"6\n",
"11\n"
] |
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
| 500
|
[
{
"input": "3 7\n4 5 14",
"output": "4"
},
{
"input": "6 1\n1 1 1 1 1 1",
"output": "6"
},
{
"input": "6 5\n7 6 8 9 10 5",
"output": "11"
},
{
"input": "10 420\n214 614 297 675 82 740 174 23 255 15",
"output": "13"
},
{
"input": "10 561\n657 23 1096 487 785 66 481 554 1000 821",
"output": "15"
},
{
"input": "100 342\n478 143 359 336 162 333 385 515 117 496 310 538 469 539 258 676 466 677 1 296 150 560 26 213 627 221 255 126 617 174 279 178 24 435 70 145 619 46 669 566 300 67 576 251 58 176 441 564 569 194 24 669 73 262 457 259 619 78 400 579 222 626 269 47 80 315 160 194 455 186 315 424 197 246 683 220 68 682 83 233 290 664 273 598 362 305 674 614 321 575 362 120 14 534 62 436 294 351 485 396",
"output": "144"
},
{
"input": "100 290\n244 49 276 77 449 261 468 458 201 424 9 131 300 88 432 394 104 77 13 289 435 259 111 453 168 394 156 412 351 576 178 530 81 271 228 564 125 328 42 372 205 61 180 471 33 360 567 331 222 318 241 117 529 169 188 484 202 202 299 268 246 343 44 364 333 494 59 236 84 485 50 8 428 8 571 227 205 310 210 9 324 472 368 490 114 84 296 305 411 351 569 393 283 120 510 171 232 151 134 366",
"output": "145"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 1\n2",
"output": "2"
},
{
"input": "46 71\n30 26 56 138 123 77 60 122 73 45 79 10 130 3 14 1 38 46 128 50 82 16 32 68 28 98 62 106 2 49 131 11 114 39 139 70 40 50 45 137 33 30 35 136 135 19",
"output": "63"
},
{
"input": "20 723\n212 602 293 591 754 91 1135 640 80 495 845 928 1399 498 926 1431 1226 869 814 1386",
"output": "31"
},
{
"input": "48 864\n843 1020 751 1694 18 1429 1395 1174 272 1158 1628 1233 1710 441 765 561 778 748 1501 1200 563 1263 1398 1687 1518 1640 1591 839 500 466 1603 1587 1201 1209 432 868 1159 639 649 628 9 91 1036 147 896 1557 941 518",
"output": "75"
},
{
"input": "26 708\n549 241 821 734 945 1161 566 1268 216 30 1142 730 529 1014 255 168 796 1148 89 113 1328 286 743 871 1259 1397",
"output": "41"
},
{
"input": "75 940\n1620 1745 1599 441 64 1466 1496 1239 1716 1475 778 106 1136 1212 1261 444 781 257 1071 747 626 232 609 1544 682 1326 469 1361 1460 1450 1207 1319 922 625 1737 1057 1698 592 692 80 1016 541 1254 201 682 1007 847 206 1066 809 259 109 240 1611 219 1455 1326 1377 1827 786 42 1002 1382 1592 543 1866 1198 334 1524 1760 340 1566 955 257 1118",
"output": "116"
}
] | 1,689,411,239
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 46
| 0
|
n,h = map(int,input().split())
a = list(map(int,input().split()))
c = 0
for i in a:
if i>h:
c+=2
else:
c+=1
print(c)
|
Title: Vanya and Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
Input Specification:
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
Output Specification:
Print a single integer — the minimum possible valid width of the road.
Demo Input:
['3 7\n4 5 14\n', '6 1\n1 1 1 1 1 1\n', '6 5\n7 6 8 9 10 5\n']
Demo Output:
['4\n', '6\n', '11\n']
Note:
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
|
```python
n,h = map(int,input().split())
a = list(map(int,input().split()))
c = 0
for i in a:
if i>h:
c+=2
else:
c+=1
print(c)
```
| 3
|
|
141
|
A
|
Amusing Joke
|
PROGRAMMING
| 800
|
[
"implementation",
"sortings",
"strings"
] | null | null |
So, the New Year holidays are over. Santa Claus and his colleagues can take a rest and have guests at last. When two "New Year and Christmas Men" meet, thear assistants cut out of cardboard the letters from the guest's name and the host's name in honor of this event. Then the hung the letters above the main entrance. One night, when everyone went to bed, someone took all the letters of our characters' names. Then he may have shuffled the letters and put them in one pile in front of the door.
The next morning it was impossible to find the culprit who had made the disorder. But everybody wondered whether it is possible to restore the names of the host and his guests from the letters lying at the door? That is, we need to verify that there are no extra letters, and that nobody will need to cut more letters.
Help the "New Year and Christmas Men" and their friends to cope with this problem. You are given both inscriptions that hung over the front door the previous night, and a pile of letters that were found at the front door next morning.
|
The input file consists of three lines: the first line contains the guest's name, the second line contains the name of the residence host and the third line contains letters in a pile that were found at the door in the morning. All lines are not empty and contain only uppercase Latin letters. The length of each line does not exceed 100.
|
Print "YES" without the quotes, if the letters in the pile could be permuted to make the names of the "New Year and Christmas Men". Otherwise, print "NO" without the quotes.
|
[
"SANTACLAUS\nDEDMOROZ\nSANTAMOROZDEDCLAUS\n",
"PAPAINOEL\nJOULUPUKKI\nJOULNAPAOILELUPUKKI\n",
"BABBONATALE\nFATHERCHRISTMAS\nBABCHRISTMASBONATALLEFATHER\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
In the first sample the letters written in the last line can be used to write the names and there won't be any extra letters left.
In the second sample letter "P" is missing from the pile and there's an extra letter "L".
In the third sample there's an extra letter "L".
| 500
|
[
{
"input": "SANTACLAUS\nDEDMOROZ\nSANTAMOROZDEDCLAUS",
"output": "YES"
},
{
"input": "PAPAINOEL\nJOULUPUKKI\nJOULNAPAOILELUPUKKI",
"output": "NO"
},
{
"input": "BABBONATALE\nFATHERCHRISTMAS\nBABCHRISTMASBONATALLEFATHER",
"output": "NO"
},
{
"input": "B\nA\nAB",
"output": "YES"
},
{
"input": "ONDOL\nJNPB\nONLNJBODP",
"output": "YES"
},
{
"input": "Y\nW\nYW",
"output": "YES"
},
{
"input": "OI\nM\nIMO",
"output": "YES"
},
{
"input": "VFQRWWWACX\nGHZJPOQUSXRAQDGOGMR\nOPAWDOUSGWWCGQXXQAZJRQRGHRMVF",
"output": "YES"
},
{
"input": "JUTCN\nPIGMZOPMEUFADQBW\nNWQGZMAIPUPOMCDUB",
"output": "NO"
},
{
"input": "Z\nO\nZOCNDOLTBZKQLTBOLDEGXRHZGTTPBJBLSJCVSVXISQZCSFDEBXRCSGBGTHWOVIXYHACAGBRYBKBJAEPIQZHVEGLYH",
"output": "NO"
},
{
"input": "IQ\nOQ\nQOQIGGKFNHJSGCGM",
"output": "NO"
},
{
"input": "ROUWANOPNIGTVMIITVMZ\nOQTUPZMTKUGY\nVTVNGZITGPUNPMQOOATUUIYIWMMKZOTR",
"output": "YES"
},
{
"input": "OVQELLOGFIOLEHXMEMBJDIGBPGEYFG\nJNKFPFFIJOFHRIFHXEWYZOPDJBZTJZKBWQTECNHRFSJPJOAPQT\nYAIPFFFEXJJNEJPLREIGODEGQZVMCOBDFKWTMWJSBEBTOFFQOHIQJLHFNXIGOHEZRZLFOKJBJPTPHPGY",
"output": "YES"
},
{
"input": "NBJGVNGUISUXQTBOBKYHQCOOVQWUXWPXBUDLXPKX\nNSFQDFUMQDQWQ\nWXKKVNTDQQFXCUQBIMQGQHSLVGWSBFYBUPOWPBDUUJUXQNOQDNXOX",
"output": "YES"
},
{
"input": "IJHHGKCXWDBRWJUPRDBZJLNTTNWKXLUGJSBWBOAUKWRAQWGFNL\nNJMWRMBCNPHXTDQQNZ\nWDNJRCLILNQRHWBANLTXWMJBPKUPGKJDJZAQWKTZFBRCTXHHBNXRGUQUNBNMWODGSJWW",
"output": "YES"
},
{
"input": "SRROWANGUGZHCIEFYMQVTWVOMDWPUZJFRDUMVFHYNHNTTGNXCJ\nDJYWGLBFCCECXFHOLORDGDCNRHPWXNHXFCXQCEZUHRRNAEKUIX\nWCUJDNYHNHYOPWMHLDCDYRWBVOGHFFUKOZTXJRXJHRGWICCMRNEVNEGQWTZPNFCSHDRFCFQDCXMHTLUGZAXOFNXNVGUEXIACRERU",
"output": "YES"
},
{
"input": "H\nJKFGHMIAHNDBMFXWYQLZRSVNOTEGCQSVUBYUOZBTNKTXPFQDCMKAGFITEUGOYDFIYQIORMFJEOJDNTFVIQEBICSNGKOSNLNXJWC\nBQSVDOGIHCHXSYNYTQFCHNJGYFIXTSOQINZOKSVQJMTKNTGFNXAVTUYEONMBQMGJLEWJOFGEARIOPKFUFCEMUBRBDNIIDFZDCLWK",
"output": "YES"
},
{
"input": "DSWNZRFVXQ\nPVULCZGOOU\nUOLVZXNUPOQRZGWFVDSCANQTCLEIE",
"output": "NO"
},
{
"input": "EUHTSCENIPXLTSBMLFHD\nIZAVSZPDLXOAGESUSE\nLXAELAZ",
"output": "NO"
},
{
"input": "WYSJFEREGELSKRQRXDXCGBODEFZVSI\nPEJKMGFLBFFDWRCRFSHVEFLEBTJCVCHRJTLDTISHPOGFWPLEWNYJLMXWIAOTYOXMV\nHXERTZWLEXTPIOTFRVMEJVYFFJLRPFMXDEBNSGCEOFFCWTKIDDGCFYSJKGLHBORWEPLDRXRSJYBGASSVCMHEEJFLVI",
"output": "NO"
},
{
"input": "EPBMDIUQAAUGLBIETKOKFLMTCVEPETWJRHHYKCKU\nHGMAETVPCFZYNNKDQXVXUALHYLOTCHM\nECGXACVKEYMCEDOTMKAUFHLHOMT",
"output": "NO"
},
{
"input": "NUBKQEJHALANSHEIFUZHYEZKKDRFHQKAJHLAOWTZIMOCWOVVDW\nEFVOBIGAUAUSQGVSNBKNOBDMINODMFSHDL\nKLAMKNTHBFFOHVKWICHBKNDDQNEISODUSDNLUSIOAVWY",
"output": "NO"
},
{
"input": "VXINHOMEQCATZUGAJEIUIZZLPYFGUTVLNBNWCUVMEENUXKBWBGZTMRJJVJDLVSLBABVCEUDDSQFHOYPYQTWVAGTWOLKYISAGHBMC\nZMRGXPZSHOGCSAECAPGVOIGCWEOWWOJXLGYRDMPXBLOKZVRACPYQLEQGFQCVYXAGBEBELUTDAYEAGPFKXRULZCKFHZCHVCWIRGPK\nRCVUXGQVNWFGRUDLLENNDQEJHYYVWMKTLOVIPELKPWCLSQPTAXAYEMGWCBXEVAIZGGDDRBRT",
"output": "NO"
},
{
"input": "PHBDHHWUUTZAHELGSGGOPOQXSXEZIXHZTOKYFBQLBDYWPVCNQSXHEAXRRPVHFJBVBYCJIFOTQTWSUOWXLKMVJJBNLGTVITWTCZZ\nFUPDLNVIHRWTEEEHOOEC\nLOUSUUSZCHJBPEWIILUOXEXRQNCJEGTOBRVZLTTZAHTKVEJSNGHFTAYGY",
"output": "NO"
},
{
"input": "GDSLNIIKTO\nJF\nPDQYFKDTNOLI",
"output": "NO"
},
{
"input": "AHOKHEKKPJLJIIWJRCGY\nORELJCSIX\nZVWPXVFWFSWOXXLIHJKPXIOKRELYE",
"output": "NO"
},
{
"input": "ZWCOJFORBPHXCOVJIDPKVECMHVHCOC\nTEV\nJVGTBFTLFVIEPCCHODOFOMCVZHWXVCPEH",
"output": "NO"
},
{
"input": "AGFIGYWJLVMYZGNQHEHWKJIAWBPUAQFERMCDROFN\nPMJNHMVNRGCYZAVRWNDSMLSZHFNYIUWFPUSKKIGU\nMCDVPPRXGUAYLSDRHRURZASXUWZSIIEZCPXUVEONKNGNWRYGOSFMCKESMVJZHWWUCHWDQMLASLNNMHAU",
"output": "NO"
},
{
"input": "XLOWVFCZSSXCSYQTIIDKHNTKNKEEDFMDZKXSPVLBIDIREDUAIN\nZKIWNDGBISDB\nSLPKLYFYSRNRMOSWYLJJDGFFENPOXYLPZFTQDANKBDNZDIIEWSUTTKYBKVICLG",
"output": "NO"
},
{
"input": "PMUKBTRKFIAYVGBKHZHUSJYSSEPEOEWPOSPJLWLOCTUYZODLTUAFCMVKGQKRRUSOMPAYOTBTFPXYAZXLOADDEJBDLYOTXJCJYTHA\nTWRRAJLCQJTKOKWCGUH\nEWDPNXVCXWCDQCOYKKSOYTFSZTOOPKPRDKFJDETKSRAJRVCPDOBWUGPYRJPUWJYWCBLKOOTUPBESTOFXZHTYLLMCAXDYAEBUTAHM",
"output": "NO"
},
{
"input": "QMIMGQRQDMJDPNFEFXSXQMCHEJKTWCTCVZPUAYICOIRYOWKUSIWXJLHDYWSBOITHTMINXFKBKAWZTXXBJIVYCRWKXNKIYKLDDXL\nV\nFWACCXBVDOJFIUAVYRALBYJKXXWIIFORRUHKHCXLDBZMXIYJWISFEAWTIQFIZSBXMKNOCQKVKRWDNDAMQSTKYLDNYVTUCGOJXJTW",
"output": "NO"
},
{
"input": "XJXPVOOQODELPPWUISSYVVXRJTYBPDHJNENQEVQNVFIXSESKXVYPVVHPMOSX\nLEXOPFPVPSZK\nZVXVPYEYOYXVOISVLXPOVHEQVXPNQJIOPFDTXEUNMPEPPHELNXKKWSVSOXSBPSJDPVJVSRFQ",
"output": "YES"
},
{
"input": "OSKFHGYNQLSRFSAHPXKGPXUHXTRBJNAQRBSSWJVEENLJCDDHFXVCUNPZAIVVO\nFNUOCXAGRRHNDJAHVVLGGEZQHWARYHENBKHP\nUOEFNWVXCUNERLKVTHAGPSHKHDYFPYWZHJKHQLSNFBJHVJANRXCNSDUGVDABGHVAOVHBJZXGRACHRXEGNRPQEAPORQSILNXFS",
"output": "YES"
},
{
"input": "VYXYVVACMLPDHONBUTQFZTRREERBLKUJYKAHZRCTRLRCLOZYWVPBRGDQPFPQIF\nFE\nRNRPEVDRLYUQFYRZBCQLCYZEABKLRXCJLKVZBVFUEYRATOMDRTHFPGOWQVTIFPPH",
"output": "YES"
},
{
"input": "WYXUZQJQNLASEGLHPMSARWMTTQMQLVAZLGHPIZTRVTCXDXBOLNXZPOFCTEHCXBZ\nBLQZRRWP\nGIQZXPLTTMNHQVWPPEAPLOCDMBSTHRCFLCQRRZXLVAOQEGZBRUZJXXZTMAWLZHSLWNQTYXB",
"output": "YES"
},
{
"input": "MKVJTSSTDGKPVVDPYSRJJYEVGKBMSIOKHLZQAEWLRIBINVRDAJIBCEITKDHUCCVY\nPUJJQFHOGZKTAVNUGKQUHMKTNHCCTI\nQVJKUSIGTSVYUMOMLEGHWYKSKQTGATTKBNTKCJKJPCAIRJIRMHKBIZISEGFHVUVQZBDERJCVAKDLNTHUDCHONDCVVJIYPP",
"output": "YES"
},
{
"input": "OKNJOEYVMZXJMLVJHCSPLUCNYGTDASKSGKKCRVIDGEIBEWRVBVRVZZTLMCJLXHJIA\nDJBFVRTARTFZOWN\nAGHNVUNJVCPLWSVYBJKZSVTFGLELZASLWTIXDDJXCZDICTVIJOTMVEYOVRNMJGRKKHRMEBORAKFCZJBR",
"output": "YES"
},
{
"input": "OQZACLPSAGYDWHFXDFYFRRXWGIEJGSXWUONAFWNFXDTGVNDEWNQPHUXUJNZWWLBPYL\nOHBKWRFDRQUAFRCMT\nWIQRYXRJQWWRUWCYXNXALKFZGXFTLOODWRDPGURFUFUQOHPWBASZNVWXNCAGHWEHFYESJNFBMNFDDAPLDGT",
"output": "YES"
},
{
"input": "OVIRQRFQOOWVDEPLCJETWQSINIOPLTLXHSQWUYUJNFBMKDNOSHNJQQCDHZOJVPRYVSV\nMYYDQKOOYPOOUELCRIT\nNZSOTVLJTTVQLFHDQEJONEOUOFOLYVSOIYUDNOSIQVIRMVOERCLMYSHPCQKIDRDOQPCUPQBWWRYYOXJWJQPNKH",
"output": "YES"
},
{
"input": "WGMBZWNMSJXNGDUQUJTCNXDSJJLYRDOPEGPQXYUGBESDLFTJRZDDCAAFGCOCYCQMDBWK\nYOBMOVYTUATTFGJLYUQD\nDYXVTLQCYFJUNJTUXPUYOPCBCLBWNSDUJRJGWDOJDSQAAMUOJWSYERDYDXYTMTOTMQCGQZDCGNFBALGGDFKZMEBG",
"output": "YES"
},
{
"input": "CWLRBPMEZCXAPUUQFXCUHAQTLPBTXUUKWVXKBHKNSSJFEXLZMXGVFHHVTPYAQYTIKXJJE\nMUFOSEUEXEQTOVLGDSCWM\nJUKEQCXOXWEHCGKFPBIGMWVJLXUONFXBYTUAXERYTXKCESKLXAEHVPZMMUFTHLXTTZSDMBJLQPEUWCVUHSQQVUASPF",
"output": "YES"
},
{
"input": "IDQRX\nWETHO\nODPDGBHVUVSSISROHQJTUKPUCLXABIZQQPPBPKOSEWGEHRSRRNBAVLYEMZISMWWGKHVTXKUGUXEFBSWOIWUHRJGMWBMHQLDZHBWA",
"output": "NO"
},
{
"input": "IXFDY\nJRMOU\nDF",
"output": "NO"
},
{
"input": "JPSPZ\nUGCUB\nJMZZZZZZZZ",
"output": "NO"
},
{
"input": "AC\nA\nBBA",
"output": "NO"
},
{
"input": "UIKWWKXLSHTOOZOVGXKYSOJEHAUEEG\nKZXQDWJJWRXFHKJDQHJK\nXMZHTFOGEXAUJXXJUYVJIFOTKLZHDKELJWERHMGAWGKWAQKEKHIDWGGZVYOHKXRPWSJDPESFJUMKQYWBYUTHQYEFZUGKQOBHYDWB",
"output": "NO"
},
{
"input": "PXWRXRPFLR\nPJRWWXIVHODV\nXW",
"output": "NO"
},
{
"input": "CHTAZVHGSHCVIBK\nEQINEBKXEPYJSAZIMLDF\nZCZZZZDZMCZZEZDZZEZZZZQZZBZZZOZZCZE",
"output": "NO"
},
{
"input": "GXPZFSELJJNDAXYRV\nUYBKPMVBSOVOJWMONLTJOJCNQKMTAHEWLHOWIIBH\nHCWNFWJPEJIWOVPTBMVCRJLSISSVNOHCKLBFMIUAIMASQWPXEYXBOXQGFEMYJLBKDCZIMJNHOJEDGGANIVYKQTUOSOVOPWHVJGXH",
"output": "NO"
},
{
"input": "LFGJCJJDUTUP\nOVSBILTIYCJCRHKCIXCETJQJJ\nGIJJTJCLTJJJ",
"output": "NO"
},
{
"input": "GIO\nPRL\nPRL",
"output": "NO"
},
{
"input": "A\nB\nABC",
"output": "NO"
},
{
"input": "KKK\nKKK\nZZZZZ",
"output": "NO"
},
{
"input": "ZMYGQLDBLAPN\nZFJBKWHROVNPSJQUDFTHOCGREUFLYIWYICD\nZMJZZEDAZANKZZZZZZEZZBZDZZZZZZKHZZFZZZDZNZMDZZA",
"output": "NO"
}
] | 1,691,672,263
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 124
| 307,200
|
from collections import Counter
input1 = str(input())
input2 = str(input())
input3 = str(input())
mainStr = sorted(input1+input2.upper())
countMain = Counter(mainStr)
testCase = sorted(input3)
countTest = Counter(testCase)
if countMain == countTest:
print("YES")
else:
print("NO")
|
Title: Amusing Joke
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
So, the New Year holidays are over. Santa Claus and his colleagues can take a rest and have guests at last. When two "New Year and Christmas Men" meet, thear assistants cut out of cardboard the letters from the guest's name and the host's name in honor of this event. Then the hung the letters above the main entrance. One night, when everyone went to bed, someone took all the letters of our characters' names. Then he may have shuffled the letters and put them in one pile in front of the door.
The next morning it was impossible to find the culprit who had made the disorder. But everybody wondered whether it is possible to restore the names of the host and his guests from the letters lying at the door? That is, we need to verify that there are no extra letters, and that nobody will need to cut more letters.
Help the "New Year and Christmas Men" and their friends to cope with this problem. You are given both inscriptions that hung over the front door the previous night, and a pile of letters that were found at the front door next morning.
Input Specification:
The input file consists of three lines: the first line contains the guest's name, the second line contains the name of the residence host and the third line contains letters in a pile that were found at the door in the morning. All lines are not empty and contain only uppercase Latin letters. The length of each line does not exceed 100.
Output Specification:
Print "YES" without the quotes, if the letters in the pile could be permuted to make the names of the "New Year and Christmas Men". Otherwise, print "NO" without the quotes.
Demo Input:
['SANTACLAUS\nDEDMOROZ\nSANTAMOROZDEDCLAUS\n', 'PAPAINOEL\nJOULUPUKKI\nJOULNAPAOILELUPUKKI\n', 'BABBONATALE\nFATHERCHRISTMAS\nBABCHRISTMASBONATALLEFATHER\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
In the first sample the letters written in the last line can be used to write the names and there won't be any extra letters left.
In the second sample letter "P" is missing from the pile and there's an extra letter "L".
In the third sample there's an extra letter "L".
|
```python
from collections import Counter
input1 = str(input())
input2 = str(input())
input3 = str(input())
mainStr = sorted(input1+input2.upper())
countMain = Counter(mainStr)
testCase = sorted(input3)
countTest = Counter(testCase)
if countMain == countTest:
print("YES")
else:
print("NO")
```
| 3
|
|
171
|
D
|
Broken checker
|
PROGRAMMING
| 1,300
|
[
"*special",
"brute force"
] | null | null |
"This problem is rubbish! There is not statement, and there are only 5 test cases. The problemsetter took liberties with this problem!" — people complained in the comments to one round on Codeforces. And even more... No, wait, the checker for the problem was alright, that's a mercy.
|
The only line of the input contains an integer between 1 and 5, inclusive. All tests for this problem are different. The contents of the test case doesn't need to be equal to its index.
|
The only line of the output contains an integer between 1 and 3, inclusive.
|
[] |
[] |
This problem has no samples, since there so few test cases.
| 0
|
[
{
"input": "3",
"output": "1"
},
{
"input": "1",
"output": "2"
},
{
"input": "4",
"output": "2"
},
{
"input": "2",
"output": "3"
},
{
"input": "5",
"output": "1"
}
] | 1,617,248,294
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 2
| 186
| 0
|
n=int(input())
if n==3:
print(1)
elif n==1:
print(2)
else:
print(n)
|
Title: Broken checker
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"This problem is rubbish! There is not statement, and there are only 5 test cases. The problemsetter took liberties with this problem!" — people complained in the comments to one round on Codeforces. And even more... No, wait, the checker for the problem was alright, that's a mercy.
Input Specification:
The only line of the input contains an integer between 1 and 5, inclusive. All tests for this problem are different. The contents of the test case doesn't need to be equal to its index.
Output Specification:
The only line of the output contains an integer between 1 and 3, inclusive.
Note:
This problem has no samples, since there so few test cases.
|
```python
n=int(input())
if n==3:
print(1)
elif n==1:
print(2)
else:
print(n)
```
| 0
|
|
382
|
A
|
Ksenia and Pan Scales
|
PROGRAMMING
| 1,100
|
[
"greedy",
"implementation"
] | null | null |
Ksenia has ordinary pan scales and several weights of an equal mass. Ksenia has already put some weights on the scales, while other weights are untouched. Ksenia is now wondering whether it is possible to put all the remaining weights on the scales so that the scales were in equilibrium.
The scales is in equilibrium if the total sum of weights on the left pan is equal to the total sum of weights on the right pan.
|
The first line has a non-empty sequence of characters describing the scales. In this sequence, an uppercase English letter indicates a weight, and the symbol "|" indicates the delimiter (the character occurs in the sequence exactly once). All weights that are recorded in the sequence before the delimiter are initially on the left pan of the scale. All weights that are recorded in the sequence after the delimiter are initially on the right pan of the scale.
The second line contains a non-empty sequence containing uppercase English letters. Each letter indicates a weight which is not used yet.
It is guaranteed that all the English letters in the input data are different. It is guaranteed that the input does not contain any extra characters.
|
If you cannot put all the weights on the scales so that the scales were in equilibrium, print string "Impossible". Otherwise, print the description of the resulting scales, copy the format of the input.
If there are multiple answers, print any of them.
|
[
"AC|T\nL\n",
"|ABC\nXYZ\n",
"W|T\nF\n",
"ABC|\nD\n"
] |
[
"AC|TL\n",
"XYZ|ABC\n",
"Impossible\n",
"Impossible\n"
] |
none
| 500
|
[
{
"input": "AC|T\nL",
"output": "AC|TL"
},
{
"input": "|ABC\nXYZ",
"output": "XYZ|ABC"
},
{
"input": "W|T\nF",
"output": "Impossible"
},
{
"input": "ABC|\nD",
"output": "Impossible"
},
{
"input": "A|BC\nDEF",
"output": "ADF|BCE"
},
{
"input": "|\nABC",
"output": "Impossible"
},
{
"input": "|\nZXCVBANMIO",
"output": "XVAMO|ZCBNI"
},
{
"input": "|C\nA",
"output": "A|C"
},
{
"input": "|\nAB",
"output": "B|A"
},
{
"input": "A|XYZ\nUIOPL",
"output": "Impossible"
},
{
"input": "K|B\nY",
"output": "Impossible"
},
{
"input": "EQJWDOHKZRBISPLXUYVCMNFGT|\nA",
"output": "Impossible"
},
{
"input": "|MACKERIGZPVHNDYXJBUFLWSO\nQT",
"output": "Impossible"
},
{
"input": "ERACGIZOVPT|WXUYMDLJNQS\nKB",
"output": "ERACGIZOVPTB|WXUYMDLJNQSK"
},
{
"input": "CKQHRUZMISGE|FBVWPXDLTJYN\nOA",
"output": "CKQHRUZMISGEA|FBVWPXDLTJYNO"
},
{
"input": "V|CMOEUTAXBFWSK\nDLRZJGIYNQHP",
"output": "VDLRZJGIYNQHP|CMOEUTAXBFWSK"
},
{
"input": "QWHNMALDGKTJ|\nPBRYVXZUESCOIF",
"output": "QWHNMALDGKTJF|PBRYVXZUESCOI"
},
{
"input": "|\nFXCVMUEWZAHNDOSITPRLKQJYBG",
"output": "XVUWANOIPLQYG|FCMEZHDSTRKJB"
},
{
"input": "IB|PCGHZ\nFXWTJQNEKAUM",
"output": "Impossible"
},
{
"input": "EC|IWAXQ\nJUHSRKGZTOMYN",
"output": "ECJUHRGTMN|IWAXQSKZOY"
},
{
"input": "VDINYMA|UQKWBCLRHZJ\nXEGOF",
"output": "Impossible"
},
{
"input": "ZLTPSIQUBAR|XFDEMYC\nHNOJWG",
"output": "ZLTPSIQUBARG|XFDEMYCHNOJW"
},
{
"input": "R|FLZOTJNU\nGIYHKVX",
"output": "RGIYHKVX|FLZOTJNU"
},
{
"input": "W|TL\nQROFSADYPKHEJNMXBZVUCIG",
"output": "WQOSDPHJMBVCG|TLRFAYKENXZUI"
},
{
"input": "NRDFQSEKLAYMOT|ZH\nGUXIBJCVPW",
"output": "Impossible"
},
{
"input": "FGRT|\nAC",
"output": "Impossible"
},
{
"input": "|FGRT\nAC",
"output": "Impossible"
},
{
"input": "A|\nB",
"output": "A|B"
},
{
"input": "|A\nB",
"output": "B|A"
},
{
"input": "|\nA",
"output": "Impossible"
},
{
"input": "|\nQWERTYUIOPASDFGHJKLZXCVBNM",
"output": "WRYIPSFHKZCBM|QETUOADGJLXVN"
},
{
"input": "QWERTYUIOPASDFGHJKLZXCVBN|\nM",
"output": "Impossible"
},
{
"input": "QWERTY|VBN\nUIOPASDFGHJKLZXC",
"output": "Impossible"
},
{
"input": "ABC|D\nKSL",
"output": "Impossible"
},
{
"input": "A|BCDEF\nGH",
"output": "Impossible"
},
{
"input": "|ABC\nD",
"output": "Impossible"
},
{
"input": "A|BC\nDE",
"output": "Impossible"
},
{
"input": "|ASD\nX",
"output": "Impossible"
},
{
"input": "AB|CDEF\nXYZRT",
"output": "Impossible"
}
] | 1,633,206,460
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 0
|
a = input()
b = input()
lst_left = []
r = 1
for i in a:
if i=="|":
break
lst_left.append(i)
r = r + 1
lst_right = []
for i in range(r,len(a)):
lst_right.append(a[i])
for i in b:
if len(lst_right)<len(lst_left):
lst_right.append(i)
else:
lst_left.append(i)
if lst_left == lst_right:
lst = lst_left + ["|"] + lst_right
print("".join(lst))
else:
print("Impossible")
|
Title: Ksenia and Pan Scales
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ksenia has ordinary pan scales and several weights of an equal mass. Ksenia has already put some weights on the scales, while other weights are untouched. Ksenia is now wondering whether it is possible to put all the remaining weights on the scales so that the scales were in equilibrium.
The scales is in equilibrium if the total sum of weights on the left pan is equal to the total sum of weights on the right pan.
Input Specification:
The first line has a non-empty sequence of characters describing the scales. In this sequence, an uppercase English letter indicates a weight, and the symbol "|" indicates the delimiter (the character occurs in the sequence exactly once). All weights that are recorded in the sequence before the delimiter are initially on the left pan of the scale. All weights that are recorded in the sequence after the delimiter are initially on the right pan of the scale.
The second line contains a non-empty sequence containing uppercase English letters. Each letter indicates a weight which is not used yet.
It is guaranteed that all the English letters in the input data are different. It is guaranteed that the input does not contain any extra characters.
Output Specification:
If you cannot put all the weights on the scales so that the scales were in equilibrium, print string "Impossible". Otherwise, print the description of the resulting scales, copy the format of the input.
If there are multiple answers, print any of them.
Demo Input:
['AC|T\nL\n', '|ABC\nXYZ\n', 'W|T\nF\n', 'ABC|\nD\n']
Demo Output:
['AC|TL\n', 'XYZ|ABC\n', 'Impossible\n', 'Impossible\n']
Note:
none
|
```python
a = input()
b = input()
lst_left = []
r = 1
for i in a:
if i=="|":
break
lst_left.append(i)
r = r + 1
lst_right = []
for i in range(r,len(a)):
lst_right.append(a[i])
for i in b:
if len(lst_right)<len(lst_left):
lst_right.append(i)
else:
lst_left.append(i)
if lst_left == lst_right:
lst = lst_left + ["|"] + lst_right
print("".join(lst))
else:
print("Impossible")
```
| 0
|
|
11
|
B
|
Jumping Jack
|
PROGRAMMING
| 1,600
|
[
"math"
] |
B. Jumping Jack
|
1
|
64
|
Jack is working on his jumping skills recently. Currently he's located at point zero of the number line. He would like to get to the point *x*. In order to train, he has decided that he'll first jump by only one unit, and each subsequent jump will be exactly one longer than the previous one. He can go either left or right with each jump. He wonders how many jumps he needs to reach *x*.
|
The input data consists of only one integer *x* (<=-<=109<=≤<=*x*<=≤<=109).
|
Output the minimal number of jumps that Jack requires to reach *x*.
|
[
"2\n",
"6\n",
"0\n"
] |
[
"3\n",
"3\n",
"0\n"
] |
none
| 0
|
[
{
"input": "2",
"output": "3"
},
{
"input": "6",
"output": "3"
},
{
"input": "0",
"output": "0"
},
{
"input": "-1000000000",
"output": "44723"
},
{
"input": "999961560",
"output": "44720"
},
{
"input": "999961561",
"output": "44721"
},
{
"input": "999961559",
"output": "44721"
},
{
"input": "-488979819",
"output": "31273"
},
{
"input": "-865918189",
"output": "41617"
},
{
"input": "-278253406",
"output": "23591"
},
{
"input": "-87275307",
"output": "13213"
},
{
"input": "103702792",
"output": "14403"
},
{
"input": "294680891",
"output": "24277"
},
{
"input": "485658989",
"output": "31166"
},
{
"input": "676637088",
"output": "36787"
},
{
"input": "867615187",
"output": "41657"
},
{
"input": "-941406715",
"output": "43393"
},
{
"input": "-897912263",
"output": "42377"
},
{
"input": "-706934164",
"output": "37603"
},
{
"input": "-790244010",
"output": "39755"
},
{
"input": "16417015",
"output": "5730"
},
{
"input": "823078041",
"output": "40573"
},
{
"input": "-517744582",
"output": "32179"
},
{
"input": "288916443",
"output": "24038"
},
{
"input": "-904422532",
"output": "42531"
},
{
"input": "-245245154",
"output": "22147"
},
{
"input": "561415872",
"output": "33511"
},
{
"input": "-779406751",
"output": "39482"
},
{
"input": "27254274",
"output": "7383"
},
{
"input": "845249034",
"output": "41116"
}
] | 1,643,856,373
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 3
| 92
| 0
|
x = int(input())
n = 0
while 1:
if n*(n+1)/2 >= x and x % 2 == n*(n+1)/2 % 2:
print(n)
break
else:
n += 1
|
Title: Jumping Jack
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Jack is working on his jumping skills recently. Currently he's located at point zero of the number line. He would like to get to the point *x*. In order to train, he has decided that he'll first jump by only one unit, and each subsequent jump will be exactly one longer than the previous one. He can go either left or right with each jump. He wonders how many jumps he needs to reach *x*.
Input Specification:
The input data consists of only one integer *x* (<=-<=109<=≤<=*x*<=≤<=109).
Output Specification:
Output the minimal number of jumps that Jack requires to reach *x*.
Demo Input:
['2\n', '6\n', '0\n']
Demo Output:
['3\n', '3\n', '0\n']
Note:
none
|
```python
x = int(input())
n = 0
while 1:
if n*(n+1)/2 >= x and x % 2 == n*(n+1)/2 % 2:
print(n)
break
else:
n += 1
```
| 0
|
80
|
A
|
Panoramix's Prediction
|
PROGRAMMING
| 800
|
[
"brute force"
] |
A. Panoramix's Prediction
|
2
|
256
|
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
|
The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4.
|
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
|
[
"3 5\n",
"7 11\n",
"7 9\n"
] |
[
"YES",
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "3 5",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "7 9",
"output": "NO"
},
{
"input": "2 3",
"output": "YES"
},
{
"input": "2 4",
"output": "NO"
},
{
"input": "3 4",
"output": "NO"
},
{
"input": "3 5",
"output": "YES"
},
{
"input": "5 7",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "11 13",
"output": "YES"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "17 19",
"output": "YES"
},
{
"input": "19 23",
"output": "YES"
},
{
"input": "23 29",
"output": "YES"
},
{
"input": "29 31",
"output": "YES"
},
{
"input": "31 37",
"output": "YES"
},
{
"input": "37 41",
"output": "YES"
},
{
"input": "41 43",
"output": "YES"
},
{
"input": "43 47",
"output": "YES"
},
{
"input": "2 5",
"output": "NO"
},
{
"input": "2 7",
"output": "NO"
},
{
"input": "2 6",
"output": "NO"
},
{
"input": "2 11",
"output": "NO"
},
{
"input": "3 6",
"output": "NO"
},
{
"input": "3 7",
"output": "NO"
},
{
"input": "3 9",
"output": "NO"
},
{
"input": "5 6",
"output": "NO"
},
{
"input": "5 9",
"output": "NO"
},
{
"input": "5 11",
"output": "NO"
},
{
"input": "5 13",
"output": "NO"
},
{
"input": "5 15",
"output": "NO"
},
{
"input": "7 8",
"output": "NO"
},
{
"input": "7 13",
"output": "NO"
},
{
"input": "13 15",
"output": "NO"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "19 21",
"output": "NO"
},
{
"input": "13 20",
"output": "NO"
},
{
"input": "41 49",
"output": "NO"
},
{
"input": "43 49",
"output": "NO"
},
{
"input": "47 50",
"output": "NO"
},
{
"input": "47 49",
"output": "NO"
},
{
"input": "47 48",
"output": "NO"
},
{
"input": "23 25",
"output": "NO"
},
{
"input": "2 50",
"output": "NO"
},
{
"input": "31 33",
"output": "NO"
}
] | 1,586,272,393
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 218
| 307,200
|
m,n=map(int,input().split())
while(1):
m=m+1
for i in range(2,m):
if(m%i==0):
break
else:
v=m
break
if(v==n):
print("YES")
else:
print("NO")
|
Title: Panoramix's Prediction
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
Input Specification:
The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4.
Output Specification:
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
Demo Input:
['3 5\n', '7 11\n', '7 9\n']
Demo Output:
['YES', 'YES', 'NO']
Note:
none
|
```python
m,n=map(int,input().split())
while(1):
m=m+1
for i in range(2,m):
if(m%i==0):
break
else:
v=m
break
if(v==n):
print("YES")
else:
print("NO")
```
| 3.944928
|
607
|
A
|
Chain Reaction
|
PROGRAMMING
| 1,600
|
[
"binary search",
"dp"
] | null | null |
There are *n* beacons located at distinct positions on a number line. The *i*-th beacon has position *a**i* and power level *b**i*. When the *i*-th beacon is activated, it destroys all beacons to its left (direction of decreasing coordinates) within distance *b**i* inclusive. The beacon itself is not destroyed however. Saitama will activate the beacons one at a time from right to left. If a beacon is destroyed, it cannot be activated.
Saitama wants Genos to add a beacon strictly to the right of all the existing beacons, with any position and any power level, such that the least possible number of beacons are destroyed. Note that Genos's placement of the beacon means it will be the first beacon activated. Help Genos by finding the minimum number of beacons that could be destroyed.
|
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the initial number of beacons.
The *i*-th of next *n* lines contains two integers *a**i* and *b**i* (0<=≤<=*a**i*<=≤<=1<=000<=000, 1<=≤<=*b**i*<=≤<=1<=000<=000) — the position and power level of the *i*-th beacon respectively. No two beacons will have the same position, so *a**i*<=≠<=*a**j* if *i*<=≠<=*j*.
|
Print a single integer — the minimum number of beacons that could be destroyed if exactly one beacon is added.
|
[
"4\n1 9\n3 1\n6 1\n7 4\n",
"7\n1 1\n2 1\n3 1\n4 1\n5 1\n6 1\n7 1\n"
] |
[
"1\n",
"3\n"
] |
For the first sample case, the minimum number of beacons destroyed is 1. One way to achieve this is to place a beacon at position 9 with power level 2.
For the second sample case, the minimum number of beacons destroyed is 3. One way to achieve this is to place a beacon at position 1337 with power level 42.
| 500
|
[
{
"input": "4\n1 9\n3 1\n6 1\n7 4",
"output": "1"
},
{
"input": "7\n1 1\n2 1\n3 1\n4 1\n5 1\n6 1\n7 1",
"output": "3"
},
{
"input": "1\n0 1",
"output": "0"
},
{
"input": "1\n0 1000000",
"output": "0"
},
{
"input": "1\n1000000 1000000",
"output": "0"
},
{
"input": "7\n1 1\n2 1\n3 1\n4 1\n5 1\n6 6\n7 7",
"output": "4"
},
{
"input": "5\n1 1\n3 1\n5 1\n7 10\n8 10",
"output": "2"
},
{
"input": "11\n110 90\n100 70\n90 10\n80 10\n70 1\n60 1\n50 10\n40 1\n30 1\n10 1\n20 1",
"output": "4"
}
] | 1,684,420,497
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 8
| 109
| 10,752,000
|
import sys
input = lambda: sys.stdin.readline().rstrip()
from bisect import *
N = int(input())
A,B = [],[]
for _ in range(N):
a,b = map(int, input().split())
A.append(a)
B.append(b)
dp = [0]*(N+1)
for i in range(N):
a,b = A[i],B[i]
pre = a-b
idx = bisect_left(A, pre)
dp[i+1] = dp[idx]+1
print(N-max(dp))
|
Title: Chain Reaction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* beacons located at distinct positions on a number line. The *i*-th beacon has position *a**i* and power level *b**i*. When the *i*-th beacon is activated, it destroys all beacons to its left (direction of decreasing coordinates) within distance *b**i* inclusive. The beacon itself is not destroyed however. Saitama will activate the beacons one at a time from right to left. If a beacon is destroyed, it cannot be activated.
Saitama wants Genos to add a beacon strictly to the right of all the existing beacons, with any position and any power level, such that the least possible number of beacons are destroyed. Note that Genos's placement of the beacon means it will be the first beacon activated. Help Genos by finding the minimum number of beacons that could be destroyed.
Input Specification:
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the initial number of beacons.
The *i*-th of next *n* lines contains two integers *a**i* and *b**i* (0<=≤<=*a**i*<=≤<=1<=000<=000, 1<=≤<=*b**i*<=≤<=1<=000<=000) — the position and power level of the *i*-th beacon respectively. No two beacons will have the same position, so *a**i*<=≠<=*a**j* if *i*<=≠<=*j*.
Output Specification:
Print a single integer — the minimum number of beacons that could be destroyed if exactly one beacon is added.
Demo Input:
['4\n1 9\n3 1\n6 1\n7 4\n', '7\n1 1\n2 1\n3 1\n4 1\n5 1\n6 1\n7 1\n']
Demo Output:
['1\n', '3\n']
Note:
For the first sample case, the minimum number of beacons destroyed is 1. One way to achieve this is to place a beacon at position 9 with power level 2.
For the second sample case, the minimum number of beacons destroyed is 3. One way to achieve this is to place a beacon at position 1337 with power level 42.
|
```python
import sys
input = lambda: sys.stdin.readline().rstrip()
from bisect import *
N = int(input())
A,B = [],[]
for _ in range(N):
a,b = map(int, input().split())
A.append(a)
B.append(b)
dp = [0]*(N+1)
for i in range(N):
a,b = A[i],B[i]
pre = a-b
idx = bisect_left(A, pre)
dp[i+1] = dp[idx]+1
print(N-max(dp))
```
| 0
|
|
474
|
B
|
Worms
|
PROGRAMMING
| 1,200
|
[
"binary search",
"implementation"
] | null | null |
It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch.
Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding.
Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained.
Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile.
The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot.
The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms.
|
Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is.
|
[
"5\n2 7 3 4 9\n3\n1 25 11\n"
] |
[
"1\n5\n3\n"
] |
For the sample input:
- The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
| 1,000
|
[
{
"input": "5\n2 7 3 4 9\n3\n1 25 11",
"output": "1\n5\n3"
}
] | 1,678,883,538
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 31
| 1,000
| 9,932,800
|
n = int(input())
a = list(map(int, input().split()))
# Calculamos la posición de inicio y fin de cada montón de gusanos
s = [0] * (n+1)
for i in range(1, n+1):
s[i] = s[i-1] + a[i-1]
# Realizamos una búsqueda binaria para cada consulta
m = int(input())
q = list(map(int, input().split()))
for i in range(m):
l, r = 1, n
while l < r:
mid = (l + r) // 2
if s[mid] < q[i]:
l = mid + 1
else:
r = mid
print(l)
|
Title: Worms
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch.
Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding.
Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained.
Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile.
The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot.
The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms.
Output Specification:
Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is.
Demo Input:
['5\n2 7 3 4 9\n3\n1 25 11\n']
Demo Output:
['1\n5\n3\n']
Note:
For the sample input:
- The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
|
```python
n = int(input())
a = list(map(int, input().split()))
# Calculamos la posición de inicio y fin de cada montón de gusanos
s = [0] * (n+1)
for i in range(1, n+1):
s[i] = s[i-1] + a[i-1]
# Realizamos una búsqueda binaria para cada consulta
m = int(input())
q = list(map(int, input().split()))
for i in range(m):
l, r = 1, n
while l < r:
mid = (l + r) // 2
if s[mid] < q[i]:
l = mid + 1
else:
r = mid
print(l)
```
| 0
|
|
875
|
A
|
Classroom Watch
|
PROGRAMMING
| 1,200
|
[
"brute force",
"math"
] | null | null |
Eighth-grader Vova is on duty today in the class. After classes, he went into the office to wash the board, and found on it the number *n*. He asked what is this number and the teacher of mathematics Inna Petrovna answered Vova that *n* is the answer to the arithmetic task for first-graders. In the textbook, a certain positive integer *x* was given. The task was to add *x* to the sum of the digits of the number *x* written in decimal numeral system.
Since the number *n* on the board was small, Vova quickly guessed which *x* could be in the textbook. Now he wants to get a program which will search for arbitrary values of the number *n* for all suitable values of *x* or determine that such *x* does not exist. Write such a program for Vova.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=109).
|
In the first line print one integer *k* — number of different values of *x* satisfying the condition.
In next *k* lines print these values in ascending order.
|
[
"21\n",
"20\n"
] |
[
"1\n15\n",
"0\n"
] |
In the first test case *x* = 15 there is only one variant: 15 + 1 + 5 = 21.
In the second test case there are no such *x*.
| 500
|
[
{
"input": "21",
"output": "1\n15"
},
{
"input": "20",
"output": "0"
},
{
"input": "1",
"output": "0"
},
{
"input": "2",
"output": "1\n1"
},
{
"input": "3",
"output": "0"
},
{
"input": "100000001",
"output": "2\n99999937\n100000000"
},
{
"input": "1000000000",
"output": "1\n999999932"
},
{
"input": "999999979",
"output": "2\n999999899\n999999908"
},
{
"input": "9",
"output": "0"
},
{
"input": "10",
"output": "1\n5"
},
{
"input": "11",
"output": "1\n10"
},
{
"input": "39",
"output": "1\n33"
},
{
"input": "66",
"output": "1\n60"
},
{
"input": "75",
"output": "0"
},
{
"input": "100",
"output": "1\n86"
},
{
"input": "101",
"output": "2\n91\n100"
},
{
"input": "2014",
"output": "2\n1988\n2006"
},
{
"input": "999999994",
"output": "0"
}
] | 1,508,343,398
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 46
| 5,529,600
|
n = int(input())
x = n
z = 0
t = 0
fty = []
for i in range(min(1000,n)):
z = 0
x = str(x)
for i in range(len(x)):
z += int(x[i])
x = int(x)
if (x + z) == n:
t += 1
fty += [x]
x -= 1
if t == 0:
print(t)
else:
print(t)
for i in fty:
print(i)
|
Title: Classroom Watch
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Eighth-grader Vova is on duty today in the class. After classes, he went into the office to wash the board, and found on it the number *n*. He asked what is this number and the teacher of mathematics Inna Petrovna answered Vova that *n* is the answer to the arithmetic task for first-graders. In the textbook, a certain positive integer *x* was given. The task was to add *x* to the sum of the digits of the number *x* written in decimal numeral system.
Since the number *n* on the board was small, Vova quickly guessed which *x* could be in the textbook. Now he wants to get a program which will search for arbitrary values of the number *n* for all suitable values of *x* or determine that such *x* does not exist. Write such a program for Vova.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=109).
Output Specification:
In the first line print one integer *k* — number of different values of *x* satisfying the condition.
In next *k* lines print these values in ascending order.
Demo Input:
['21\n', '20\n']
Demo Output:
['1\n15\n', '0\n']
Note:
In the first test case *x* = 15 there is only one variant: 15 + 1 + 5 = 21.
In the second test case there are no such *x*.
|
```python
n = int(input())
x = n
z = 0
t = 0
fty = []
for i in range(min(1000,n)):
z = 0
x = str(x)
for i in range(len(x)):
z += int(x[i])
x = int(x)
if (x + z) == n:
t += 1
fty += [x]
x -= 1
if t == 0:
print(t)
else:
print(t)
for i in fty:
print(i)
```
| 0
|
|
492
|
A
|
Vanya and Cubes
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Vanya got *n* cubes. He decided to build a pyramid from them. Vanya wants to build the pyramid as follows: the top level of the pyramid must consist of 1 cube, the second level must consist of 1<=+<=2<==<=3 cubes, the third level must have 1<=+<=2<=+<=3<==<=6 cubes, and so on. Thus, the *i*-th level of the pyramid must have 1<=+<=2<=+<=...<=+<=(*i*<=-<=1)<=+<=*i* cubes.
Vanya wants to know what is the maximum height of the pyramid that he can make using the given cubes.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=104) — the number of cubes given to Vanya.
|
Print the maximum possible height of the pyramid in the single line.
|
[
"1\n",
"25\n"
] |
[
"1\n",
"4\n"
] |
Illustration to the second sample:
| 500
|
[
{
"input": "1",
"output": "1"
},
{
"input": "25",
"output": "4"
},
{
"input": "2",
"output": "1"
},
{
"input": "4115",
"output": "28"
},
{
"input": "9894",
"output": "38"
},
{
"input": "7969",
"output": "35"
},
{
"input": "6560",
"output": "33"
},
{
"input": "4",
"output": "2"
},
{
"input": "3",
"output": "1"
},
{
"input": "5",
"output": "2"
},
{
"input": "19",
"output": "3"
},
{
"input": "20",
"output": "4"
},
{
"input": "9880",
"output": "38"
},
{
"input": "9879",
"output": "37"
},
{
"input": "7770",
"output": "35"
},
{
"input": "7769",
"output": "34"
},
{
"input": "2925",
"output": "25"
},
{
"input": "220",
"output": "10"
},
{
"input": "219",
"output": "9"
},
{
"input": "3046",
"output": "25"
},
{
"input": "7590",
"output": "34"
},
{
"input": "1014",
"output": "17"
},
{
"input": "7142",
"output": "34"
},
{
"input": "9999",
"output": "38"
},
{
"input": "10000",
"output": "38"
}
] | 1,684,850,566
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 46
| 0
|
x = int(input())
l = 1
p = 1
sm = 1
while l <= x:
p += 1
sm += p
l += sm
print(p - 1)
|
Title: Vanya and Cubes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya got *n* cubes. He decided to build a pyramid from them. Vanya wants to build the pyramid as follows: the top level of the pyramid must consist of 1 cube, the second level must consist of 1<=+<=2<==<=3 cubes, the third level must have 1<=+<=2<=+<=3<==<=6 cubes, and so on. Thus, the *i*-th level of the pyramid must have 1<=+<=2<=+<=...<=+<=(*i*<=-<=1)<=+<=*i* cubes.
Vanya wants to know what is the maximum height of the pyramid that he can make using the given cubes.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=104) — the number of cubes given to Vanya.
Output Specification:
Print the maximum possible height of the pyramid in the single line.
Demo Input:
['1\n', '25\n']
Demo Output:
['1\n', '4\n']
Note:
Illustration to the second sample:
|
```python
x = int(input())
l = 1
p = 1
sm = 1
while l <= x:
p += 1
sm += p
l += sm
print(p - 1)
```
| 3
|
|
524
|
A
|
Возможно, вы знаете этих людей?
|
PROGRAMMING
| 1,600
|
[
"implementation"
] | null | null |
Основой любой социальной сети является отношение дружбы между двумя пользователями в том или ином смысле. В одной известной социальной сети дружба симметрична, то есть если *a* является другом *b*, то *b* также является другом *a*.
В этой же сети есть функция, которая демонстрирует множество людей, имеющих высокую вероятность быть знакомыми для пользователя. Эта функция работает следующим образом. Зафиксируем пользователя *x*. Пусть некоторый другой человек *y*, не являющийся другом *x* на текущий момент, является другом не менее, чем для *k*% друзей *x*. Тогда он является предполагаемым другом для *x*.
У каждого человека в социальной сети есть свой уникальный идентификатор — это целое число от 1 до 109. Вам дан список пар пользователей, являющихся друзьями. Определите для каждого упомянутого пользователя множество его предполагаемых друзей.
|
В первой строке следуют два целых числа *m* и *k* (1<=≤<=*m*<=≤<=100, 0<=≤<=*k*<=≤<=100) — количество пар друзей и необходимый процент общих друзей для того, чтобы считаться предполагаемым другом.
В последующих *m* строках записано по два числа *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=109, *a**i*<=≠<=*b**i*), обозначающих идентификаторы пользователей, являющихся друзьями.
Гарантируется, что каждая пара людей фигурирует в списке не более одного раза.
|
Для всех упомянутых людей в порядке возрастания id выведите информацию о предполагаемых друзьях. Информация должна иметь вид "*id*:<= *k* *id*1 *id*2 ... *id**k*", где *id* — это id самого человека, *k* — количество его предполагаемых друзей, а *id*1, *id*2, ..., *id**k* — идентификаторы его предполагаемых друзей в возрастающем порядке.
|
[
"5 51\n10 23\n23 42\n39 42\n10 39\n39 58\n",
"5 100\n1 2\n1 3\n1 4\n2 3\n2 4\n"
] |
[
"10: 1 42\n23: 1 39\n39: 1 23\n42: 1 10\n58: 2 10 42\n",
"1: 0\n2: 0\n3: 1 4\n4: 1 3\n"
] |
none
| 500
|
[
{
"input": "5 51\n10 23\n23 42\n39 42\n10 39\n39 58",
"output": "10: 1 42\n23: 1 39\n39: 1 23\n42: 1 10\n58: 2 10 42"
},
{
"input": "5 100\n1 2\n1 3\n1 4\n2 3\n2 4",
"output": "1: 0\n2: 0\n3: 1 4\n4: 1 3"
},
{
"input": "4 1\n1 2\n1 3\n2 3\n4 5",
"output": "1: 0\n2: 0\n3: 0\n4: 0\n5: 0"
},
{
"input": "10 0\n648169314 459970755\n973677547 255163231\n982998000 498743911\n959912791 891928\n404623428 891928\n474720235 271683165\n709045873 539751127\n973677547 179588015\n629049356 622519100\n624998275 958914560",
"output": "891928: 15 179588015 255163231 271683165 459970755 474720235 498743911 539751127 622519100 624998275 629049356 648169314 709045873 958914560 973677547 982998000\n179588015: 16 891928 255163231 271683165 404623428 459970755 474720235 498743911 539751127 622519100 624998275 629049356 648169314 709045873 958914560 959912791 982998000\n255163231: 16 891928 179588015 271683165 404623428 459970755 474720235 498743911 539751127 622519100 624998275 629049356 648169314 709045873 958914560 959912791 982998000\n27168..."
},
{
"input": "10 100\n60976680 603454792\n575754027 696647370\n7534463 570826751\n117972518 472387015\n35713567 439985965\n439985965 928160845\n443596853 828504858\n689509731 117972518\n909843480 592765058\n251752353 490387136",
"output": "7534463: 0\n35713567: 1 928160845\n60976680: 0\n117972518: 0\n251752353: 0\n439985965: 0\n443596853: 0\n472387015: 1 689509731\n490387136: 0\n570826751: 0\n575754027: 0\n592765058: 0\n603454792: 0\n689509731: 1 472387015\n696647370: 0\n828504858: 0\n909843480: 0\n928160845: 1 35713567"
},
{
"input": "10 50\n389900784 512305545\n839319681 243581524\n653226215 616982889\n448655722 826601897\n681021965 23289895\n719595063 481480420\n919744525 839319681\n231872856 784056465\n971842495 248017394\n653226215 297224467",
"output": "23289895: 0\n231872856: 0\n243581524: 1 919744525\n248017394: 0\n297224467: 1 616982889\n389900784: 0\n448655722: 0\n481480420: 0\n512305545: 0\n616982889: 1 297224467\n653226215: 0\n681021965: 0\n719595063: 0\n784056465: 0\n826601897: 0\n839319681: 0\n919744525: 1 243581524\n971842495: 0"
},
{
"input": "10 0\n180745113 666631448\n362104151 349631376\n214251560 538865550\n562805929 576329835\n64121410 646478528\n283223383 861810719\n773038401 214251560\n64208401 693054606\n493180926 960545197\n159614568 831490031",
"output": "64121410: 17 64208401 159614568 180745113 214251560 283223383 349631376 362104151 493180926 538865550 562805929 576329835 666631448 693054606 773038401 831490031 861810719 960545197\n64208401: 17 64121410 159614568 180745113 214251560 283223383 349631376 362104151 493180926 538865550 562805929 576329835 646478528 666631448 773038401 831490031 861810719 960545197\n159614568: 17 64121410 64208401 180745113 214251560 283223383 349631376 362104151 493180926 538865550 562805929 576329835 646478528 666631448 693..."
},
{
"input": "10 50\n946010975 207263044\n923545573 749203275\n862015642 426425906\n749203275 839134958\n910721783 289091881\n827003531 333726912\n49704846 538788252\n382891592 207263044\n333726912 438209022\n974360048 49704846",
"output": "49704846: 0\n207263044: 0\n289091881: 0\n333726912: 0\n382891592: 1 946010975\n426425906: 0\n438209022: 1 827003531\n538788252: 1 974360048\n749203275: 0\n827003531: 1 438209022\n839134958: 1 923545573\n862015642: 0\n910721783: 0\n923545573: 1 839134958\n946010975: 1 382891592\n974360048: 1 538788252"
},
{
"input": "10 100\n570936669 651631651\n508122950 793810569\n374422919 757639639\n395046911 359158844\n544971368 55608511\n554227847 109843524\n199021332 421407912\n82125712 395046911\n923097829 637659245\n754413496 971876441",
"output": "55608511: 0\n82125712: 1 359158844\n109843524: 0\n199021332: 0\n359158844: 1 82125712\n374422919: 0\n395046911: 0\n421407912: 0\n508122950: 0\n544971368: 0\n554227847: 0\n570936669: 0\n637659245: 0\n651631651: 0\n754413496: 0\n757639639: 0\n793810569: 0\n923097829: 0\n971876441: 0"
},
{
"input": "1 0\n42 23",
"output": "23: 0\n42: 0"
},
{
"input": "1 1\n42 23",
"output": "23: 0\n42: 0"
},
{
"input": "1 50\n42 23",
"output": "23: 0\n42: 0"
},
{
"input": "1 99\n42 23",
"output": "23: 0\n42: 0"
},
{
"input": "1 100\n42 23",
"output": "23: 0\n42: 0"
},
{
"input": "2 49\n42 23\n23 14",
"output": "14: 1 42\n23: 0\n42: 1 14"
},
{
"input": "2 50\n42 23\n23 19",
"output": "19: 1 42\n23: 0\n42: 1 19"
},
{
"input": "2 51\n42 23\n23 19",
"output": "19: 1 42\n23: 0\n42: 1 19"
},
{
"input": "3 49\n42 23\n23 19\n32 23",
"output": "19: 2 32 42\n23: 0\n32: 2 19 42\n42: 2 19 32"
},
{
"input": "3 50\n42 23\n23 19\n32 23",
"output": "19: 2 32 42\n23: 0\n32: 2 19 42\n42: 2 19 32"
},
{
"input": "3 51\n42 23\n23 19\n32 23",
"output": "19: 2 32 42\n23: 0\n32: 2 19 42\n42: 2 19 32"
},
{
"input": "10 50\n642733947 618790811\n508838679 118350938\n175990043 144671010\n246628250 434416712\n77433126 913934904\n414906480 399777199\n252618318 930317425\n316103842 356219969\n530311152 441130575\n15047025 839165125",
"output": "15047025: 0\n77433126: 0\n118350938: 0\n144671010: 0\n175990043: 0\n246628250: 0\n252618318: 0\n316103842: 0\n356219969: 0\n399777199: 0\n414906480: 0\n434416712: 0\n441130575: 0\n508838679: 0\n530311152: 0\n618790811: 0\n642733947: 0\n839165125: 0\n913934904: 0\n930317425: 0"
},
{
"input": "10 0\n106531296 450097353\n947110486 953723914\n774225709 111023810\n774225709 642354614\n559826213 258125349\n768234906 870027419\n4234645 388060649\n870027419 545107061\n484961505 497401821\n76024092 367527096",
"output": "4234645: 16 76024092 106531296 111023810 258125349 367527096 450097353 484961505 497401821 545107061 559826213 642354614 768234906 774225709 870027419 947110486 953723914\n76024092: 16 4234645 106531296 111023810 258125349 388060649 450097353 484961505 497401821 545107061 559826213 642354614 768234906 774225709 870027419 947110486 953723914\n106531296: 16 4234645 76024092 111023810 258125349 367527096 388060649 484961505 497401821 545107061 559826213 642354614 768234906 774225709 870027419 947110486 953723..."
},
{
"input": "10 50\n384319275 425419607\n201879842 153061155\n308316219 268723666\n20837191 401468340\n969142307 78803322\n55247385 365896022\n479817129 222255243\n980789245 697120853\n550086907 652472194\n203728124 229637404",
"output": "20837191: 0\n55247385: 0\n78803322: 0\n153061155: 0\n201879842: 0\n203728124: 0\n222255243: 0\n229637404: 0\n268723666: 0\n308316219: 0\n365896022: 0\n384319275: 0\n401468340: 0\n425419607: 0\n479817129: 0\n550086907: 0\n652472194: 0\n697120853: 0\n969142307: 0\n980789245: 0"
},
{
"input": "10 100\n620468113 665248777\n541840309 963681159\n144393749 136223789\n800116851 648535048\n730845154 277782209\n142473309 2838660\n14940106 355463174\n745034887 545886019\n570717131 701899093\n250611530 857683655",
"output": "2838660: 0\n14940106: 0\n136223789: 0\n142473309: 0\n144393749: 0\n250611530: 0\n277782209: 0\n355463174: 0\n541840309: 0\n545886019: 0\n570717131: 0\n620468113: 0\n648535048: 0\n665248777: 0\n701899093: 0\n730845154: 0\n745034887: 0\n800116851: 0\n857683655: 0\n963681159: 0"
},
{
"input": "5 66\n4242 1\n4242 2\n4242 3\n2323 1\n2323 2",
"output": "1: 1 2\n2: 1 1\n3: 2 1 2\n2323: 1 4242\n4242: 1 2323"
},
{
"input": "5 67\n4242 1\n4242 2\n4242 3\n2323 1\n2323 2",
"output": "1: 1 2\n2: 1 1\n3: 2 1 2\n2323: 1 4242\n4242: 0"
},
{
"input": "6 49\n4242 1\n4242 2\n4242 3\n4242 4\n2323 1\n2323 2",
"output": "1: 3 2 3 4\n2: 3 1 3 4\n3: 3 1 2 4\n4: 3 1 2 3\n2323: 1 4242\n4242: 1 2323"
},
{
"input": "6 50\n4242 1\n4242 2\n4242 3\n4242 4\n2323 1\n2323 2",
"output": "1: 3 2 3 4\n2: 3 1 3 4\n3: 3 1 2 4\n4: 3 1 2 3\n2323: 1 4242\n4242: 1 2323"
},
{
"input": "6 51\n4242 1\n4242 2\n4242 3\n4242 4\n2323 1\n2323 2",
"output": "1: 1 2\n2: 1 1\n3: 3 1 2 4\n4: 3 1 2 3\n2323: 1 4242\n4242: 0"
},
{
"input": "11 12\n4242 1\n4242 2\n4242 3\n4242 4\n4242 5\n4242 6\n4242 7\n4242 8\n2323 1\n2323 2\n2323 3",
"output": "1: 7 2 3 4 5 6 7 8\n2: 7 1 3 4 5 6 7 8\n3: 7 1 2 4 5 6 7 8\n4: 7 1 2 3 5 6 7 8\n5: 7 1 2 3 4 6 7 8\n6: 7 1 2 3 4 5 7 8\n7: 7 1 2 3 4 5 6 8\n8: 7 1 2 3 4 5 6 7\n2323: 1 4242\n4242: 1 2323"
},
{
"input": "11 13\n4242 1\n4242 2\n4242 3\n4242 4\n4242 5\n4242 6\n4242 7\n4242 8\n2323 1\n2323 2\n2323 3",
"output": "1: 7 2 3 4 5 6 7 8\n2: 7 1 3 4 5 6 7 8\n3: 7 1 2 4 5 6 7 8\n4: 7 1 2 3 5 6 7 8\n5: 7 1 2 3 4 6 7 8\n6: 7 1 2 3 4 5 7 8\n7: 7 1 2 3 4 5 6 8\n8: 7 1 2 3 4 5 6 7\n2323: 1 4242\n4242: 1 2323"
},
{
"input": "79 58\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n2 11\n2 12\n2 13\n2 14\n2 15\n2 16\n2 17\n2 18\n2 19\n2 20\n2 21\n2 22\n2 23\n2 24\n2 25\n2 26\n2 27\n2 28\n2 29\n2 30\n2 31",
"output": "1: 1 2\n2: 1 1\n3: 28 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31\n4: 28 3 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31\n5: 28 3 4 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31\n6: 28 3 4 5 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31\n7: 28 3 4 5 6 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31\n8: 28 3 4 5 6 7 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 2..."
}
] | 1,426,947,014
| 614
|
PyPy 3
|
WRONG_ANSWER
|
PRETESTS
| 2
| 93
| 0
|
def main():
from collections import defaultdict
m, k = [int(i) for i in input().split()]
d = defaultdict(set)
for i in range(m):
a, b = [int(i) for i in input().split()]
d[a].add(b)
d[b].add(a)
keys = sorted(d.keys())
for i in keys:
result = []
for j in keys:
if i != j and len(d[i] & d[j]) >= (len(d[i]) * k + 99) // 100:
result.append(j)
print("{0}: {1} {2}".format(i, len(result), ' '.join(str(i) for i in result)))
main()
|
Title: Возможно, вы знаете этих людей?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Основой любой социальной сети является отношение дружбы между двумя пользователями в том или ином смысле. В одной известной социальной сети дружба симметрична, то есть если *a* является другом *b*, то *b* также является другом *a*.
В этой же сети есть функция, которая демонстрирует множество людей, имеющих высокую вероятность быть знакомыми для пользователя. Эта функция работает следующим образом. Зафиксируем пользователя *x*. Пусть некоторый другой человек *y*, не являющийся другом *x* на текущий момент, является другом не менее, чем для *k*% друзей *x*. Тогда он является предполагаемым другом для *x*.
У каждого человека в социальной сети есть свой уникальный идентификатор — это целое число от 1 до 109. Вам дан список пар пользователей, являющихся друзьями. Определите для каждого упомянутого пользователя множество его предполагаемых друзей.
Input Specification:
В первой строке следуют два целых числа *m* и *k* (1<=≤<=*m*<=≤<=100, 0<=≤<=*k*<=≤<=100) — количество пар друзей и необходимый процент общих друзей для того, чтобы считаться предполагаемым другом.
В последующих *m* строках записано по два числа *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=109, *a**i*<=≠<=*b**i*), обозначающих идентификаторы пользователей, являющихся друзьями.
Гарантируется, что каждая пара людей фигурирует в списке не более одного раза.
Output Specification:
Для всех упомянутых людей в порядке возрастания id выведите информацию о предполагаемых друзьях. Информация должна иметь вид "*id*:<= *k* *id*1 *id*2 ... *id**k*", где *id* — это id самого человека, *k* — количество его предполагаемых друзей, а *id*1, *id*2, ..., *id**k* — идентификаторы его предполагаемых друзей в возрастающем порядке.
Demo Input:
['5 51\n10 23\n23 42\n39 42\n10 39\n39 58\n', '5 100\n1 2\n1 3\n1 4\n2 3\n2 4\n']
Demo Output:
['10: 1 42\n23: 1 39\n39: 1 23\n42: 1 10\n58: 2 10 42\n', '1: 0\n2: 0\n3: 1 4\n4: 1 3\n']
Note:
none
|
```python
def main():
from collections import defaultdict
m, k = [int(i) for i in input().split()]
d = defaultdict(set)
for i in range(m):
a, b = [int(i) for i in input().split()]
d[a].add(b)
d[b].add(a)
keys = sorted(d.keys())
for i in keys:
result = []
for j in keys:
if i != j and len(d[i] & d[j]) >= (len(d[i]) * k + 99) // 100:
result.append(j)
print("{0}: {1} {2}".format(i, len(result), ' '.join(str(i) for i in result)))
main()
```
| 0
|
|
208
|
A
|
Dubstep
|
PROGRAMMING
| 900
|
[
"strings"
] | null | null |
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
|
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
|
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
|
[
"WUBWUBABCWUB\n",
"WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n"
] |
[
"ABC ",
"WE ARE THE CHAMPIONS MY FRIEND "
] |
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
| 500
|
[
{
"input": "WUBWUBABCWUB",
"output": "ABC "
},
{
"input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB",
"output": "WE ARE THE CHAMPIONS MY FRIEND "
},
{
"input": "WUBWUBWUBSR",
"output": "SR "
},
{
"input": "RWUBWUBWUBLWUB",
"output": "R L "
},
{
"input": "ZJWUBWUBWUBJWUBWUBWUBL",
"output": "ZJ J L "
},
{
"input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB",
"output": "C B E Q "
},
{
"input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB",
"output": "JKD WBIRAQKF YE WV "
},
{
"input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB",
"output": "KSDHEMIXUJ R S H "
},
{
"input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB",
"output": "OG X I KO "
},
{
"input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH",
"output": "Q QQ I WW JOPJPBRH "
},
{
"input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB",
"output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C "
},
{
"input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV",
"output": "E IQMJNIQ GZZBQZAUHYP PMR DCV "
},
{
"input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB",
"output": "FV BPS RXNETCJ JDMBH B V B "
},
{
"input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL",
"output": "FBQ IDFSY CTWDM SXO QI L "
},
{
"input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL",
"output": "I QLHD YIIKZDFQ CX U K NL "
},
{
"input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE",
"output": "K UPDYXGOKU AGOAH IZD IY V P E "
},
{
"input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB",
"output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ "
},
{
"input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB",
"output": "PAMJGY XGPQM TKGSXUY E N H E "
},
{
"input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB",
"output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB "
},
{
"input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM",
"output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M "
},
{
"input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW",
"output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W "
},
{
"input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG",
"output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G "
},
{
"input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN",
"output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N "
},
{
"input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG",
"output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG "
},
{
"input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB",
"output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L "
},
{
"input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB",
"output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U "
},
{
"input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB",
"output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ "
},
{
"input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB",
"output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J "
},
{
"input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO",
"output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O "
},
{
"input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR",
"output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R "
},
{
"input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB",
"output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM "
},
{
"input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB",
"output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H "
},
{
"input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB",
"output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S "
},
{
"input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB",
"output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J "
},
{
"input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF",
"output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F "
},
{
"input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY",
"output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y "
},
{
"input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB",
"output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO "
},
{
"input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW",
"output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W "
},
{
"input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD",
"output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D "
},
{
"input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB",
"output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A "
},
{
"input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB",
"output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y "
},
{
"input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB",
"output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R "
},
{
"input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY",
"output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y "
},
{
"input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE",
"output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E "
},
{
"input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS",
"output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S "
},
{
"input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP",
"output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP "
},
{
"input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB",
"output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y "
},
{
"input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL",
"output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL "
},
{
"input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO",
"output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O "
},
{
"input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU",
"output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU "
},
{
"input": "A",
"output": "A "
},
{
"input": "WUBA",
"output": "A "
},
{
"input": "WUBWUBA",
"output": "A "
},
{
"input": "AWUBWUBWUB",
"output": "A "
},
{
"input": "AWUBBWUBCWUBD",
"output": "A B C D "
},
{
"input": "WUBWWUBWUBWUBUWUBWUBBWUB",
"output": "W U B "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "WUWUBBWWUBUB",
"output": "WU BW UB "
},
{
"input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB",
"output": "WUAB "
},
{
"input": "ZWUB",
"output": "Z "
},
{
"input": "WU",
"output": "WU "
},
{
"input": "UB",
"output": "UB "
},
{
"input": "U",
"output": "U "
},
{
"input": "WUBW",
"output": "W "
},
{
"input": "WUBWU",
"output": "WU "
},
{
"input": "WUWUB",
"output": "WU "
},
{
"input": "UBWUB",
"output": "UB "
},
{
"input": "WUWUBUBWUBUWUB",
"output": "WU UB U "
},
{
"input": "WUBWWUBAWUB",
"output": "W A "
},
{
"input": "WUUUUU",
"output": "WUUUUU "
}
] | 1,688,108,749
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 62
| 0
|
song=input().split("WUB")
print(song)
for i in song:
if i.isalpha():
print(i,end=" ")
|
Title: Dubstep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
Input Specification:
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
Output Specification:
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
Demo Input:
['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n']
Demo Output:
['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND ']
Note:
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
|
```python
song=input().split("WUB")
print(song)
for i in song:
if i.isalpha():
print(i,end=" ")
```
| 0
|
|
35
|
A
|
Shell Game
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
A. Shell Game
|
2
|
64
|
Today the «Z» city residents enjoy a shell game competition. The residents are gathered on the main square to watch the breath-taking performance. The performer puts 3 non-transparent cups upside down in a row. Then he openly puts a small ball under one of the cups and starts to shuffle the cups around very quickly so that on the whole he makes exactly 3 shuffles. After that the spectators have exactly one attempt to guess in which cup they think the ball is and if the answer is correct they get a prize. Maybe you can try to find the ball too?
|
The first input line contains an integer from 1 to 3 — index of the cup which covers the ball before the shuffles. The following three lines describe the shuffles. Each description of a shuffle contains two distinct integers from 1 to 3 — indexes of the cups which the performer shuffled this time. The cups are numbered from left to right and are renumbered after each shuffle from left to right again. In other words, the cup on the left always has index 1, the one in the middle — index 2 and the one on the right — index 3.
|
In the first line output an integer from 1 to 3 — index of the cup which will have the ball after all the shuffles.
|
[
"1\n1 2\n2 1\n2 1\n",
"1\n2 1\n3 1\n1 3\n"
] |
[
"2\n",
"2\n"
] |
none
| 500
|
[
{
"input": "1\n1 2\n2 1\n2 1",
"output": "2"
},
{
"input": "1\n2 1\n3 1\n1 3",
"output": "2"
},
{
"input": "3\n3 1\n2 1\n1 2",
"output": "1"
},
{
"input": "1\n1 3\n1 2\n2 3",
"output": "2"
},
{
"input": "3\n3 2\n3 1\n3 1",
"output": "2"
},
{
"input": "1\n2 1\n1 3\n1 3",
"output": "2"
},
{
"input": "3\n3 1\n2 3\n3 2",
"output": "1"
},
{
"input": "2\n1 3\n1 2\n2 1",
"output": "2"
},
{
"input": "1\n1 3\n3 2\n1 2",
"output": "1"
},
{
"input": "1\n1 3\n1 3\n2 3",
"output": "1"
},
{
"input": "2\n1 2\n2 3\n2 1",
"output": "2"
},
{
"input": "3\n1 3\n3 2\n2 1",
"output": "2"
},
{
"input": "1\n1 2\n2 1\n2 3",
"output": "1"
},
{
"input": "1\n2 3\n1 3\n1 2",
"output": "3"
},
{
"input": "2\n3 1\n3 2\n2 3",
"output": "2"
},
{
"input": "2\n1 3\n3 1\n3 1",
"output": "2"
},
{
"input": "1\n3 2\n1 3\n3 1",
"output": "1"
},
{
"input": "3\n1 3\n1 2\n1 3",
"output": "2"
},
{
"input": "1\n3 2\n3 1\n1 2",
"output": "3"
},
{
"input": "2\n2 3\n1 3\n1 3",
"output": "3"
}
] | 1,618,707,831
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 92
| 0
|
a=int(input())
for i in range(3):
b,c=list(map(int,input().split()))
a=c if a==b else ( b if a==c else a )
print(a)
|
Title: Shell Game
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Today the «Z» city residents enjoy a shell game competition. The residents are gathered on the main square to watch the breath-taking performance. The performer puts 3 non-transparent cups upside down in a row. Then he openly puts a small ball under one of the cups and starts to shuffle the cups around very quickly so that on the whole he makes exactly 3 shuffles. After that the spectators have exactly one attempt to guess in which cup they think the ball is and if the answer is correct they get a prize. Maybe you can try to find the ball too?
Input Specification:
The first input line contains an integer from 1 to 3 — index of the cup which covers the ball before the shuffles. The following three lines describe the shuffles. Each description of a shuffle contains two distinct integers from 1 to 3 — indexes of the cups which the performer shuffled this time. The cups are numbered from left to right and are renumbered after each shuffle from left to right again. In other words, the cup on the left always has index 1, the one in the middle — index 2 and the one on the right — index 3.
Output Specification:
In the first line output an integer from 1 to 3 — index of the cup which will have the ball after all the shuffles.
Demo Input:
['1\n1 2\n2 1\n2 1\n', '1\n2 1\n3 1\n1 3\n']
Demo Output:
['2\n', '2\n']
Note:
none
|
```python
a=int(input())
for i in range(3):
b,c=list(map(int,input().split()))
a=c if a==b else ( b if a==c else a )
print(a)
```
| -1
|
9
|
A
|
Die Roll
|
PROGRAMMING
| 800
|
[
"math",
"probabilities"
] |
A. Die Roll
|
1
|
64
|
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
|
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
|
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
|
[
"4 2\n"
] |
[
"1/2\n"
] |
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
| 0
|
[
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,688,670,870
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 60
| 0
|
nums = list(map(int,input().split()))
maximum = max(nums)
num = 6 - maximum + 1
def gcdCalculator(a , b) :
if a % b == 0 : return b
return gcdCalculator(b , a % b)
gcd = gcdCalculator(6 , num)
print(gcd)
print(num // gcd , 6 // gcd)
|
Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
|
```python
nums = list(map(int,input().split()))
maximum = max(nums)
num = 6 - maximum + 1
def gcdCalculator(a , b) :
if a % b == 0 : return b
return gcdCalculator(b , a % b)
gcd = gcdCalculator(6 , num)
print(gcd)
print(num // gcd , 6 // gcd)
```
| 0
|
214
|
A
|
System of Equations
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Furik loves math lessons very much, so he doesn't attend them, unlike Rubik. But now Furik wants to get a good mark for math. For that Ms. Ivanova, his math teacher, gave him a new task. Furik solved the task immediately. Can you?
You are given a system of equations:
You should count, how many there are pairs of integers (*a*,<=*b*) (0<=≤<=*a*,<=*b*) which satisfy the system.
|
A single line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the parameters of the system. The numbers on the line are separated by a space.
|
On a single line print the answer to the problem.
|
[
"9 3\n",
"14 28\n",
"4 20\n"
] |
[
"1\n",
"1\n",
"0\n"
] |
In the first sample the suitable pair is integers (3, 0). In the second sample the suitable pair is integers (3, 5). In the third sample there is no suitable pair.
| 500
|
[
{
"input": "9 3",
"output": "1"
},
{
"input": "14 28",
"output": "1"
},
{
"input": "4 20",
"output": "0"
},
{
"input": "18 198",
"output": "1"
},
{
"input": "22 326",
"output": "1"
},
{
"input": "26 104",
"output": "1"
},
{
"input": "14 10",
"output": "0"
},
{
"input": "8 20",
"output": "0"
},
{
"input": "2 8",
"output": "0"
},
{
"input": "20 11",
"output": "0"
},
{
"input": "57 447",
"output": "1"
},
{
"input": "1 1",
"output": "2"
},
{
"input": "66 296",
"output": "1"
},
{
"input": "75 683",
"output": "1"
},
{
"input": "227 975",
"output": "1"
},
{
"input": "247 499",
"output": "1"
},
{
"input": "266 116",
"output": "1"
},
{
"input": "286 916",
"output": "1"
},
{
"input": "307 341",
"output": "1"
},
{
"input": "451 121",
"output": "1"
},
{
"input": "471 921",
"output": "1"
},
{
"input": "502 346",
"output": "1"
},
{
"input": "535 59",
"output": "1"
},
{
"input": "555 699",
"output": "1"
},
{
"input": "747 351",
"output": "1"
},
{
"input": "790 64",
"output": "1"
},
{
"input": "810 704",
"output": "1"
},
{
"input": "855 225",
"output": "1"
},
{
"input": "902 34",
"output": "1"
},
{
"input": "922 514",
"output": "1"
},
{
"input": "971 131",
"output": "1"
},
{
"input": "991 931",
"output": "1"
},
{
"input": "840 780",
"output": "0"
},
{
"input": "102 595",
"output": "0"
},
{
"input": "139 433",
"output": "0"
},
{
"input": "968 288",
"output": "0"
},
{
"input": "563 354",
"output": "0"
},
{
"input": "994 975",
"output": "0"
},
{
"input": "456 221",
"output": "0"
},
{
"input": "205 210",
"output": "0"
},
{
"input": "1 11",
"output": "0"
},
{
"input": "1000 1000",
"output": "0"
},
{
"input": "3 3",
"output": "0"
},
{
"input": "11 99",
"output": "0"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "11 1",
"output": "0"
},
{
"input": "6 6",
"output": "1"
},
{
"input": "100 452",
"output": "0"
},
{
"input": "420 380",
"output": "0"
},
{
"input": "31 31",
"output": "0"
},
{
"input": "2 6",
"output": "0"
},
{
"input": "112 134",
"output": "0"
},
{
"input": "13 13",
"output": "0"
},
{
"input": "1 571",
"output": "0"
}
] | 1,667,926,507
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 3
| 154
| 2,867,200
|
num_str = input()
num_str = list(num_str)
n = ''
list_store = []
# creating values
for k in num_str:
if k != ' ':
n = str(n) + k
n = int(n)
if k == ' ' or k == num_str[len(num_str)-1]:
list_store = list_store + [n]
n = ''
# satisfying condition
i, j = 0, 0
final_sum = 0
while i < 1001:
if i**2 <= list_store[0] or i**2 <= list_store[1]:
while j < 1001:
if j**2 <= list_store[0] or j**2 <= list_store[1]:
if i**2 + j == list_store[0] and j**2 + i == list_store[1]:
final_sum = final_sum + 1
j = j + 1
i = i + 1
j = 0
print(final_sum)
|
Title: System of Equations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Furik loves math lessons very much, so he doesn't attend them, unlike Rubik. But now Furik wants to get a good mark for math. For that Ms. Ivanova, his math teacher, gave him a new task. Furik solved the task immediately. Can you?
You are given a system of equations:
You should count, how many there are pairs of integers (*a*,<=*b*) (0<=≤<=*a*,<=*b*) which satisfy the system.
Input Specification:
A single line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the parameters of the system. The numbers on the line are separated by a space.
Output Specification:
On a single line print the answer to the problem.
Demo Input:
['9 3\n', '14 28\n', '4 20\n']
Demo Output:
['1\n', '1\n', '0\n']
Note:
In the first sample the suitable pair is integers (3, 0). In the second sample the suitable pair is integers (3, 5). In the third sample there is no suitable pair.
|
```python
num_str = input()
num_str = list(num_str)
n = ''
list_store = []
# creating values
for k in num_str:
if k != ' ':
n = str(n) + k
n = int(n)
if k == ' ' or k == num_str[len(num_str)-1]:
list_store = list_store + [n]
n = ''
# satisfying condition
i, j = 0, 0
final_sum = 0
while i < 1001:
if i**2 <= list_store[0] or i**2 <= list_store[1]:
while j < 1001:
if j**2 <= list_store[0] or j**2 <= list_store[1]:
if i**2 + j == list_store[0] and j**2 + i == list_store[1]:
final_sum = final_sum + 1
j = j + 1
i = i + 1
j = 0
print(final_sum)
```
| -1
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,668,581,475
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 30
| 0
|
a, b, c =map(int,input().split())
print(c)
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
a, b, c =map(int,input().split())
print(c)
```
| 0
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,651,523,096
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 20
| 92
| 0
|
m ,n = map(int, input().split())
if (m%2 == 0 and n%2 ==0):
print(max(m,n))
elif (m%2 == 0 and n%2 !=0) or (m%2 != 0 and n%2 ==0):
print((m*n)//2)
elif (m%2 != 0 and n%2 !=0):
print(((m*n)-1)//2)
else:
print(0)
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
m ,n = map(int, input().split())
if (m%2 == 0 and n%2 ==0):
print(max(m,n))
elif (m%2 == 0 and n%2 !=0) or (m%2 != 0 and n%2 ==0):
print((m*n)//2)
elif (m%2 != 0 and n%2 !=0):
print(((m*n)-1)//2)
else:
print(0)
```
| 0
|
106
|
A
|
Card Game
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
A. Card Game
|
2
|
256
|
There is a card game called "Durak", which means "Fool" in Russian. The game is quite popular in the countries that used to form USSR. The problem does not state all the game's rules explicitly — you can find them later yourselves if you want.
To play durak you need a pack of 36 cards. Each card has a suit ("S", "H", "D" and "C") and a rank (in the increasing order "6", "7", "8", "9", "T", "J", "Q", "K" and "A"). At the beginning of the game one suit is arbitrarily chosen as trump.
The players move like that: one player puts one or several of his cards on the table and the other one should beat each of them with his cards.
A card beats another one if both cards have similar suits and the first card has a higher rank then the second one. Besides, a trump card can beat any non-trump card whatever the cards’ ranks are. In all other cases you can not beat the second card with the first one.
You are given the trump suit and two different cards. Determine whether the first one beats the second one or not.
|
The first line contains the tramp suit. It is "S", "H", "D" or "C".
The second line contains the description of the two different cards. Each card is described by one word consisting of two symbols. The first symbol stands for the rank ("6", "7", "8", "9", "T", "J", "Q", "K" and "A"), and the second one stands for the suit ("S", "H", "D" and "C").
|
Print "YES" (without the quotes) if the first cards beats the second one. Otherwise, print "NO" (also without the quotes).
|
[
"H\nQH 9S\n",
"S\n8D 6D\n",
"C\n7H AS\n"
] |
[
"YES\n",
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "H\nQH 9S",
"output": "YES"
},
{
"input": "S\n8D 6D",
"output": "YES"
},
{
"input": "C\n7H AS",
"output": "NO"
},
{
"input": "C\nKC 9C",
"output": "YES"
},
{
"input": "D\n7D KD",
"output": "NO"
},
{
"input": "H\n7H KD",
"output": "YES"
},
{
"input": "D\nAS AH",
"output": "NO"
},
{
"input": "H\nKH KS",
"output": "YES"
},
{
"input": "C\n9H 6C",
"output": "NO"
},
{
"input": "C\n9H JC",
"output": "NO"
},
{
"input": "D\nTD JD",
"output": "NO"
},
{
"input": "H\n6S 7S",
"output": "NO"
},
{
"input": "D\n7S 8S",
"output": "NO"
},
{
"input": "S\n8H 9H",
"output": "NO"
},
{
"input": "C\n9D TD",
"output": "NO"
},
{
"input": "H\nTC JC",
"output": "NO"
},
{
"input": "C\nJH QH",
"output": "NO"
},
{
"input": "H\nQD KD",
"output": "NO"
},
{
"input": "D\nKS AS",
"output": "NO"
},
{
"input": "S\nAH 6H",
"output": "YES"
},
{
"input": "H\n7D 6D",
"output": "YES"
},
{
"input": "S\n8H 7H",
"output": "YES"
},
{
"input": "D\n9S 8S",
"output": "YES"
},
{
"input": "S\nTC 9C",
"output": "YES"
},
{
"input": "H\nJS TS",
"output": "YES"
},
{
"input": "S\nQD JD",
"output": "YES"
},
{
"input": "D\nKH QH",
"output": "YES"
},
{
"input": "H\nAD KD",
"output": "YES"
},
{
"input": "H\nQS QD",
"output": "NO"
},
{
"input": "C\nTS TH",
"output": "NO"
},
{
"input": "C\n6C 6D",
"output": "YES"
},
{
"input": "H\n8H 8D",
"output": "YES"
},
{
"input": "S\n7D 7S",
"output": "NO"
},
{
"input": "H\nJC JH",
"output": "NO"
},
{
"input": "H\n8H 9C",
"output": "YES"
},
{
"input": "D\n9D 6S",
"output": "YES"
},
{
"input": "C\nJC AH",
"output": "YES"
},
{
"input": "S\nAS KD",
"output": "YES"
},
{
"input": "S\n7S JS",
"output": "NO"
},
{
"input": "H\nTH 8H",
"output": "YES"
},
{
"input": "S\n7S QS",
"output": "NO"
},
{
"input": "C\nKC QC",
"output": "YES"
},
{
"input": "S\nAD 9S",
"output": "NO"
},
{
"input": "D\n7H 8D",
"output": "NO"
},
{
"input": "H\nJC 9H",
"output": "NO"
},
{
"input": "C\n7S AC",
"output": "NO"
},
{
"input": "C\n8C 7C",
"output": "YES"
},
{
"input": "H\n9D 8S",
"output": "NO"
},
{
"input": "D\nAC KS",
"output": "NO"
},
{
"input": "H\n8C QH",
"output": "NO"
},
{
"input": "S\n7S TS",
"output": "NO"
},
{
"input": "C\nAH 6S",
"output": "NO"
},
{
"input": "S\nKS QS",
"output": "YES"
},
{
"input": "H\nAC QC",
"output": "YES"
},
{
"input": "S\n9H 8D",
"output": "NO"
},
{
"input": "S\nTS JS",
"output": "NO"
},
{
"input": "S\n8H 7C",
"output": "NO"
},
{
"input": "C\nAH 6S",
"output": "NO"
},
{
"input": "S\n7S QS",
"output": "NO"
},
{
"input": "C\nAH 6S",
"output": "NO"
},
{
"input": "S\nTS KS",
"output": "NO"
},
{
"input": "C\nTH KH",
"output": "NO"
},
{
"input": "H\n9C 6D",
"output": "NO"
},
{
"input": "H\n9C 8D",
"output": "NO"
},
{
"input": "H\nTH AH",
"output": "NO"
},
{
"input": "H\nTH JH",
"output": "NO"
},
{
"input": "H\nQS 9C",
"output": "NO"
},
{
"input": "H\nKC AC",
"output": "NO"
},
{
"input": "H\nAH KH",
"output": "YES"
},
{
"input": "H\nKS QS",
"output": "YES"
},
{
"input": "C\nAD KS",
"output": "NO"
},
{
"input": "H\nQS 9C",
"output": "NO"
},
{
"input": "H\n9D 7S",
"output": "NO"
},
{
"input": "D\n6D 9S",
"output": "YES"
},
{
"input": "H\nAH KH",
"output": "YES"
},
{
"input": "H\nKC AC",
"output": "NO"
},
{
"input": "D\n8S 6C",
"output": "NO"
},
{
"input": "S\nAC KC",
"output": "YES"
}
] | 1,616,185,348
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 92
| 307,200
|
import sys,math
sys.setrecursionlimit(10**8)
'''
def fun():
for i in range(16):
for j in range(4):
if i&(1<<j):
print(j,end='')
print()
import binarytree
from collections import deque
bst = binarytree.tree(height=4,is_perfect=True)
print(bst)
def s(bst):
if bst:
bst.left,bst.right = bst.right,bst.left
s(bst.right)
s(bst.left)
s(bst)
print(bst)
'''
s = input()
p = input().split(' ')
c = ['6','7','8','9','T','J','Q','K','A']
print('YES' if s == p[0][1] or (p[0][1] == p[1][1] and\
c.index(p[0][0])>c.index(p[1][0])) else 'NO')
|
Title: Card Game
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There is a card game called "Durak", which means "Fool" in Russian. The game is quite popular in the countries that used to form USSR. The problem does not state all the game's rules explicitly — you can find them later yourselves if you want.
To play durak you need a pack of 36 cards. Each card has a suit ("S", "H", "D" and "C") and a rank (in the increasing order "6", "7", "8", "9", "T", "J", "Q", "K" and "A"). At the beginning of the game one suit is arbitrarily chosen as trump.
The players move like that: one player puts one or several of his cards on the table and the other one should beat each of them with his cards.
A card beats another one if both cards have similar suits and the first card has a higher rank then the second one. Besides, a trump card can beat any non-trump card whatever the cards’ ranks are. In all other cases you can not beat the second card with the first one.
You are given the trump suit and two different cards. Determine whether the first one beats the second one or not.
Input Specification:
The first line contains the tramp suit. It is "S", "H", "D" or "C".
The second line contains the description of the two different cards. Each card is described by one word consisting of two symbols. The first symbol stands for the rank ("6", "7", "8", "9", "T", "J", "Q", "K" and "A"), and the second one stands for the suit ("S", "H", "D" and "C").
Output Specification:
Print "YES" (without the quotes) if the first cards beats the second one. Otherwise, print "NO" (also without the quotes).
Demo Input:
['H\nQH 9S\n', 'S\n8D 6D\n', 'C\n7H AS\n']
Demo Output:
['YES\n', 'YES', 'NO']
Note:
none
|
```python
import sys,math
sys.setrecursionlimit(10**8)
'''
def fun():
for i in range(16):
for j in range(4):
if i&(1<<j):
print(j,end='')
print()
import binarytree
from collections import deque
bst = binarytree.tree(height=4,is_perfect=True)
print(bst)
def s(bst):
if bst:
bst.left,bst.right = bst.right,bst.left
s(bst.right)
s(bst.left)
s(bst)
print(bst)
'''
s = input()
p = input().split(' ')
c = ['6','7','8','9','T','J','Q','K','A']
print('YES' if s == p[0][1] or (p[0][1] == p[1][1] and\
c.index(p[0][0])>c.index(p[1][0])) else 'NO')
```
| 0
|
476
|
B
|
Dreamoon and WiFi
|
PROGRAMMING
| 1,300
|
[
"bitmasks",
"brute force",
"combinatorics",
"dp",
"math",
"probabilities"
] | null | null |
Dreamoon is standing at the position 0 on a number line. Drazil is sending a list of commands through Wi-Fi to Dreamoon's smartphone and Dreamoon follows them.
Each command is one of the following two types:
1. Go 1 unit towards the positive direction, denoted as '+' 1. Go 1 unit towards the negative direction, denoted as '-'
But the Wi-Fi condition is so poor that Dreamoon's smartphone reports some of the commands can't be recognized and Dreamoon knows that some of them might even be wrong though successfully recognized. Dreamoon decides to follow every recognized command and toss a fair coin to decide those unrecognized ones (that means, he moves to the 1 unit to the negative or positive direction with the same probability 0.5).
You are given an original list of commands sent by Drazil and list received by Dreamoon. What is the probability that Dreamoon ends in the position originally supposed to be final by Drazil's commands?
|
The first line contains a string *s*1 — the commands Drazil sends to Dreamoon, this string consists of only the characters in the set {'+', '-'}.
The second line contains a string *s*2 — the commands Dreamoon's smartphone recognizes, this string consists of only the characters in the set {'+', '-', '?'}. '?' denotes an unrecognized command.
Lengths of two strings are equal and do not exceed 10.
|
Output a single real number corresponding to the probability. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=9.
|
[
"++-+-\n+-+-+\n",
"+-+-\n+-??\n",
"+++\n??-\n"
] |
[
"1.000000000000\n",
"0.500000000000\n",
"0.000000000000\n"
] |
For the first sample, both *s*<sub class="lower-index">1</sub> and *s*<sub class="lower-index">2</sub> will lead Dreamoon to finish at the same position + 1.
For the second sample, *s*<sub class="lower-index">1</sub> will lead Dreamoon to finish at position 0, while there are four possibilites for *s*<sub class="lower-index">2</sub>: {"+-++", "+-+-", "+--+", "+---"} with ending position {+2, 0, 0, -2} respectively. So there are 2 correct cases out of 4, so the probability of finishing at the correct position is 0.5.
For the third sample, *s*<sub class="lower-index">2</sub> could only lead us to finish at positions {+1, -1, -3}, so the probability to finish at the correct position + 3 is 0.
| 1,500
|
[
{
"input": "++-+-\n+-+-+",
"output": "1.000000000000"
},
{
"input": "+-+-\n+-??",
"output": "0.500000000000"
},
{
"input": "+++\n??-",
"output": "0.000000000000"
},
{
"input": "++++++++++\n+++??++?++",
"output": "0.125000000000"
},
{
"input": "--+++---+-\n??????????",
"output": "0.205078125000"
},
{
"input": "+--+++--+-\n??????????",
"output": "0.246093750000"
},
{
"input": "+\n+",
"output": "1.000000000000"
},
{
"input": "-\n?",
"output": "0.500000000000"
},
{
"input": "+\n-",
"output": "0.000000000000"
},
{
"input": "-\n-",
"output": "1.000000000000"
},
{
"input": "-\n+",
"output": "0.000000000000"
},
{
"input": "+\n?",
"output": "0.500000000000"
},
{
"input": "++++++++++\n++++++++++",
"output": "1.000000000000"
},
{
"input": "++++++++++\n++++-+++++",
"output": "0.000000000000"
},
{
"input": "----------\n++++++++++",
"output": "0.000000000000"
},
{
"input": "++++++++++\n++++??++++",
"output": "0.250000000000"
},
{
"input": "----------\n+++?++++-+",
"output": "0.000000000000"
},
{
"input": "++++++++++\n++++++++?+",
"output": "0.500000000000"
},
{
"input": "--++++--+\n?-+?-??+-",
"output": "0.250000000000"
},
{
"input": "----------\n??????????",
"output": "0.000976562500"
},
{
"input": "+--++\n+--+-",
"output": "0.000000000000"
},
{
"input": "-----++---\n????????+?",
"output": "0.017578125000"
},
{
"input": "------+--+\n??????????",
"output": "0.043945312500"
},
{
"input": "---++--\n???????",
"output": "0.164062500000"
},
{
"input": "-----++\n???????",
"output": "0.164062500000"
},
{
"input": "+---+--\n???????",
"output": "0.164062500000"
},
{
"input": "---+-+\n??????",
"output": "0.234375000000"
},
{
"input": "+++-+\n---++",
"output": "0.000000000000"
},
{
"input": "++-+--+\n?-?+??+",
"output": "0.375000000000"
},
{
"input": "----+++--\n-+?+++?--",
"output": "0.000000000000"
},
{
"input": "+-----\n+?----",
"output": "0.500000000000"
}
] | 1,671,570,716
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 31
| 109
| 137,216,000
|
#from heapq import heappop,heappush,heapify #heappop(hq), heapify(list)
#from collections import deque as dq #deque e.g. myqueue=dq(list)
#append/appendleft/appendright/pop/popleft
#from bisect import bisect as bis #a=[1,3,4,6,7,8] #bis(a,5)-->3
#import bisect #bisect.bisect_left(a,4)-->2 #bisect.bisect(a,4)-->3
#import statistics as stat # stat.median(a), mode, mean
#from itertools import permutations(p,r)#combinations(p,r)
#combinations(p,r) gives r-length tuples #combinations_with_replacement
#every element can be repeated
import sys, threading
import math
import time
from os import path
from collections import defaultdict, Counter, deque
from bisect import *
from string import ascii_lowercase
from functools import cmp_to_key
import heapq
# # # # # # # # # # # # # # # #
# JAI SHREE RAM #
# # # # # # # # # # # # # # # #
def lcm(a, b):
return (a*b)//(math.gcd(a,b))
si= lambda:str(input())
ii = lambda: int(input())
mii = lambda: map(int, input().split())
lmii = lambda: list(map(int, input().split()))
i2c = lambda n: chr(ord('a') + n)
c2i = lambda c: ord(c) - ord('a')
def factorial(n):
if n==1:
return 1
else:
return n*factorial(n-1)
def solve():
s1=si()
s2=si()
q=0
final_pos=0
till_now =0
for i in range(len(s1)):
if s1[i]=="+":
final_pos+=1
else:
final_pos-=1
for i in range(len(s2)):
if s2[i]=="+":
till_now+=1
elif s2[i]=="-":
till_now-=1
elif s2[i]=="?":
q+=1
t=abs(final_pos-till_now)
if t>q or (q-t)%2:
print(0.000000000000)
else:
numerator = math.comb(q,t+((q-t)//2))
denominator = pow(2,q)
ans = (numerator*1.0)/denominator
print("{:.11f}".format(ans))
def main():
t = 1
if path.exists("/Users/nitishkumar/Documents/Template_Codes/Python/CP/Codeforces/input.txt"):
sys.stdin = open("/Users/nitishkumar/Documents/Template_Codes/Python/CP/Codeforces/input.txt", 'r')
sys.stdout = open("/Users/nitishkumar/Documents/Template_Codes/Python/CP/Codeforces/output.txt", 'w')
start_time = time.time()
print("--- %s seconds ---" % (time.time() - start_time))
sys.setrecursionlimit(10**5)
solve()
if __name__ == '__main__':
main()
|
Title: Dreamoon and WiFi
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dreamoon is standing at the position 0 on a number line. Drazil is sending a list of commands through Wi-Fi to Dreamoon's smartphone and Dreamoon follows them.
Each command is one of the following two types:
1. Go 1 unit towards the positive direction, denoted as '+' 1. Go 1 unit towards the negative direction, denoted as '-'
But the Wi-Fi condition is so poor that Dreamoon's smartphone reports some of the commands can't be recognized and Dreamoon knows that some of them might even be wrong though successfully recognized. Dreamoon decides to follow every recognized command and toss a fair coin to decide those unrecognized ones (that means, he moves to the 1 unit to the negative or positive direction with the same probability 0.5).
You are given an original list of commands sent by Drazil and list received by Dreamoon. What is the probability that Dreamoon ends in the position originally supposed to be final by Drazil's commands?
Input Specification:
The first line contains a string *s*1 — the commands Drazil sends to Dreamoon, this string consists of only the characters in the set {'+', '-'}.
The second line contains a string *s*2 — the commands Dreamoon's smartphone recognizes, this string consists of only the characters in the set {'+', '-', '?'}. '?' denotes an unrecognized command.
Lengths of two strings are equal and do not exceed 10.
Output Specification:
Output a single real number corresponding to the probability. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=9.
Demo Input:
['++-+-\n+-+-+\n', '+-+-\n+-??\n', '+++\n??-\n']
Demo Output:
['1.000000000000\n', '0.500000000000\n', '0.000000000000\n']
Note:
For the first sample, both *s*<sub class="lower-index">1</sub> and *s*<sub class="lower-index">2</sub> will lead Dreamoon to finish at the same position + 1.
For the second sample, *s*<sub class="lower-index">1</sub> will lead Dreamoon to finish at position 0, while there are four possibilites for *s*<sub class="lower-index">2</sub>: {"+-++", "+-+-", "+--+", "+---"} with ending position {+2, 0, 0, -2} respectively. So there are 2 correct cases out of 4, so the probability of finishing at the correct position is 0.5.
For the third sample, *s*<sub class="lower-index">2</sub> could only lead us to finish at positions {+1, -1, -3}, so the probability to finish at the correct position + 3 is 0.
|
```python
#from heapq import heappop,heappush,heapify #heappop(hq), heapify(list)
#from collections import deque as dq #deque e.g. myqueue=dq(list)
#append/appendleft/appendright/pop/popleft
#from bisect import bisect as bis #a=[1,3,4,6,7,8] #bis(a,5)-->3
#import bisect #bisect.bisect_left(a,4)-->2 #bisect.bisect(a,4)-->3
#import statistics as stat # stat.median(a), mode, mean
#from itertools import permutations(p,r)#combinations(p,r)
#combinations(p,r) gives r-length tuples #combinations_with_replacement
#every element can be repeated
import sys, threading
import math
import time
from os import path
from collections import defaultdict, Counter, deque
from bisect import *
from string import ascii_lowercase
from functools import cmp_to_key
import heapq
# # # # # # # # # # # # # # # #
# JAI SHREE RAM #
# # # # # # # # # # # # # # # #
def lcm(a, b):
return (a*b)//(math.gcd(a,b))
si= lambda:str(input())
ii = lambda: int(input())
mii = lambda: map(int, input().split())
lmii = lambda: list(map(int, input().split()))
i2c = lambda n: chr(ord('a') + n)
c2i = lambda c: ord(c) - ord('a')
def factorial(n):
if n==1:
return 1
else:
return n*factorial(n-1)
def solve():
s1=si()
s2=si()
q=0
final_pos=0
till_now =0
for i in range(len(s1)):
if s1[i]=="+":
final_pos+=1
else:
final_pos-=1
for i in range(len(s2)):
if s2[i]=="+":
till_now+=1
elif s2[i]=="-":
till_now-=1
elif s2[i]=="?":
q+=1
t=abs(final_pos-till_now)
if t>q or (q-t)%2:
print(0.000000000000)
else:
numerator = math.comb(q,t+((q-t)//2))
denominator = pow(2,q)
ans = (numerator*1.0)/denominator
print("{:.11f}".format(ans))
def main():
t = 1
if path.exists("/Users/nitishkumar/Documents/Template_Codes/Python/CP/Codeforces/input.txt"):
sys.stdin = open("/Users/nitishkumar/Documents/Template_Codes/Python/CP/Codeforces/input.txt", 'r')
sys.stdout = open("/Users/nitishkumar/Documents/Template_Codes/Python/CP/Codeforces/output.txt", 'w')
start_time = time.time()
print("--- %s seconds ---" % (time.time() - start_time))
sys.setrecursionlimit(10**5)
solve()
if __name__ == '__main__':
main()
```
| 3
|
|
761
|
A
|
Dasha and Stairs
|
PROGRAMMING
| 1,000
|
[
"brute force",
"constructive algorithms",
"implementation",
"math"
] | null | null |
On her way to programming school tiger Dasha faced her first test — a huge staircase!
The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers.
You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct.
|
In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly.
|
In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise.
|
[
"2 3\n",
"3 1\n"
] |
[
"YES\n",
"NO\n"
] |
In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5.
| 500
|
[
{
"input": "2 3",
"output": "YES"
},
{
"input": "3 1",
"output": "NO"
},
{
"input": "5 4",
"output": "YES"
},
{
"input": "9 9",
"output": "YES"
},
{
"input": "85 95",
"output": "NO"
},
{
"input": "0 1",
"output": "YES"
},
{
"input": "89 25",
"output": "NO"
},
{
"input": "74 73",
"output": "YES"
},
{
"input": "62 39",
"output": "NO"
},
{
"input": "57 57",
"output": "YES"
},
{
"input": "100 99",
"output": "YES"
},
{
"input": "0 0",
"output": "NO"
},
{
"input": "98 100",
"output": "NO"
},
{
"input": "99 100",
"output": "YES"
},
{
"input": "1 0",
"output": "YES"
},
{
"input": "100 0",
"output": "NO"
},
{
"input": "0 100",
"output": "NO"
},
{
"input": "100 98",
"output": "NO"
},
{
"input": "100 100",
"output": "YES"
},
{
"input": "0 5",
"output": "NO"
},
{
"input": "2 2",
"output": "YES"
}
] | 1,599,935,353
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 108
| 0
|
z=list(map(int,input().split()))
if abs(z[0]-z[1])>1 :
print("NO")
else:
if z[0]==0 and z[1]==0:
print("NO")
else:
print("YES")
|
Title: Dasha and Stairs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
On her way to programming school tiger Dasha faced her first test — a huge staircase!
The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers.
You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct.
Input Specification:
In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly.
Output Specification:
In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise.
Demo Input:
['2 3\n', '3 1\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5.
|
```python
z=list(map(int,input().split()))
if abs(z[0]-z[1])>1 :
print("NO")
else:
if z[0]==0 and z[1]==0:
print("NO")
else:
print("YES")
```
| 3
|
|
401
|
C
|
Team
|
PROGRAMMING
| 1,400
|
[
"constructive algorithms",
"greedy",
"implementation"
] | null | null |
Now it's time of Olympiads. Vanya and Egor decided to make his own team to take part in a programming Olympiad. They've been best friends ever since primary school and hopefully, that can somehow help them in teamwork.
For each team Olympiad, Vanya takes his play cards with numbers. He takes only the cards containing numbers 1 and 0. The boys are very superstitious. They think that they can do well at the Olympiad if they begin with laying all the cards in a row so that:
- there wouldn't be a pair of any side-adjacent cards with zeroes in a row; - there wouldn't be a group of three consecutive cards containing numbers one.
Today Vanya brought *n* cards with zeroes and *m* cards with numbers one. The number of cards was so much that the friends do not know how to put all those cards in the described way. Help them find the required arrangement of the cards or else tell the guys that it is impossible to arrange cards in such a way.
|
The first line contains two integers: *n* (1<=≤<=*n*<=≤<=106) — the number of cards containing number 0; *m* (1<=≤<=*m*<=≤<=106) — the number of cards containing number 1.
|
In a single line print the required sequence of zeroes and ones without any spaces. If such sequence is impossible to obtain, print -1.
|
[
"1 2\n",
"4 8\n",
"4 10\n",
"1 5\n"
] |
[
"101\n",
"110110110101\n",
"11011011011011\n",
"-1\n"
] |
none
| 1,500
|
[
{
"input": "1 2",
"output": "101"
},
{
"input": "4 8",
"output": "110110110101"
},
{
"input": "4 10",
"output": "11011011011011"
},
{
"input": "1 5",
"output": "-1"
},
{
"input": "3 4",
"output": "1010101"
},
{
"input": "3 10",
"output": "-1"
},
{
"input": "74 99",
"output": "11011011011011011011011011011011011011011011011011011011011011011011011010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101"
},
{
"input": "19 30",
"output": "1101101101101101101101101101101010101010101010101"
},
{
"input": "33 77",
"output": "-1"
},
{
"input": "3830 6966",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "1000000 1000000",
"output": "1010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101..."
},
{
"input": "1027 2030",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "4610 4609",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "3342 3339",
"output": "-1"
},
{
"input": "7757 7755",
"output": "-1"
},
{
"input": "10 8",
"output": "-1"
},
{
"input": "4247 8495",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "7101 14204",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "9801 19605",
"output": "-1"
},
{
"input": "4025 6858",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "7129 13245",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "8826 12432",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "6322 9256",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "8097 14682",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "6196 6197",
"output": "1010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101..."
},
{
"input": "1709 2902",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "455 512",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101..."
},
{
"input": "1781 1272",
"output": "-1"
},
{
"input": "3383 5670",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "954 1788",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "9481 15554",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "9079 100096",
"output": "-1"
},
{
"input": "481533 676709",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "423472 564888",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "227774 373297",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "42346 51898",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "739107 1000000",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "455043 798612",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "801460 801459",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "303498 503791",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "518822 597833",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "32342 64687",
"output": "-1"
},
{
"input": "873192 873189",
"output": "-1"
},
{
"input": "384870 450227",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "201106 208474",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "775338 980888",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "263338 393171",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "241043 330384",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "307203 614408",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "379310 417986",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "661101 785111",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "284634 319008",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "500000 1000000",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "499999 1000000",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "3 1",
"output": "-1"
},
{
"input": "14124 242112",
"output": "-1"
},
{
"input": "2 1",
"output": "010"
},
{
"input": "2 3",
"output": "10101"
},
{
"input": "1 4",
"output": "11011"
},
{
"input": "2 6",
"output": "11011011"
},
{
"input": "2 5",
"output": "1101101"
},
{
"input": "2 4",
"output": "110101"
},
{
"input": "2 3",
"output": "10101"
},
{
"input": "2 2",
"output": "1010"
},
{
"input": "2 1",
"output": "010"
},
{
"input": "1 1",
"output": "10"
},
{
"input": "1 3",
"output": "1101"
},
{
"input": "3 2",
"output": "01010"
},
{
"input": "5 4",
"output": "010101010"
},
{
"input": "4 3",
"output": "0101010"
},
{
"input": "11 10",
"output": "010101010101010101010"
},
{
"input": "8 7",
"output": "010101010101010"
},
{
"input": "4 2",
"output": "-1"
},
{
"input": "6 5",
"output": "01010101010"
},
{
"input": "3 7",
"output": "1101101101"
},
{
"input": "5 1",
"output": "-1"
},
{
"input": "10 1",
"output": "-1"
},
{
"input": "4 9",
"output": "1101101101101"
},
{
"input": "6 4",
"output": "-1"
},
{
"input": "12 10",
"output": "-1"
},
{
"input": "4 100",
"output": "-1"
}
] | 1,645,313,262
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 32
| 1,000
| 8,294,400
|
from time import sleep as sle
from math import *
from random import randint as ri
def gcd(a,b):
if a == b:
return a
elif a > b:
return gcd(a-b,b)
else:
return gcd(b,a)
def pr(x):
print()
for s in x:
print(s)
def solve():
n,m = map(int,input().split())
if (n-1) <= m and (m-2) <= 2*n:
if m == (n-1):
print('%s0'%('01'*m))
elif m == n:
print('01'*m)
else:
L = []
while n >= 1 and m >= 1:
L += ['1','0']
n,m = n-1,m-1
L += ['1']
m -= 1
while m >= 1:
L[L.index('1')] = '11'
m -= 1
print(''.join(L))
else:
print(-1)
solve()
|
Title: Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Now it's time of Olympiads. Vanya and Egor decided to make his own team to take part in a programming Olympiad. They've been best friends ever since primary school and hopefully, that can somehow help them in teamwork.
For each team Olympiad, Vanya takes his play cards with numbers. He takes only the cards containing numbers 1 and 0. The boys are very superstitious. They think that they can do well at the Olympiad if they begin with laying all the cards in a row so that:
- there wouldn't be a pair of any side-adjacent cards with zeroes in a row; - there wouldn't be a group of three consecutive cards containing numbers one.
Today Vanya brought *n* cards with zeroes and *m* cards with numbers one. The number of cards was so much that the friends do not know how to put all those cards in the described way. Help them find the required arrangement of the cards or else tell the guys that it is impossible to arrange cards in such a way.
Input Specification:
The first line contains two integers: *n* (1<=≤<=*n*<=≤<=106) — the number of cards containing number 0; *m* (1<=≤<=*m*<=≤<=106) — the number of cards containing number 1.
Output Specification:
In a single line print the required sequence of zeroes and ones without any spaces. If such sequence is impossible to obtain, print -1.
Demo Input:
['1 2\n', '4 8\n', '4 10\n', '1 5\n']
Demo Output:
['101\n', '110110110101\n', '11011011011011\n', '-1\n']
Note:
none
|
```python
from time import sleep as sle
from math import *
from random import randint as ri
def gcd(a,b):
if a == b:
return a
elif a > b:
return gcd(a-b,b)
else:
return gcd(b,a)
def pr(x):
print()
for s in x:
print(s)
def solve():
n,m = map(int,input().split())
if (n-1) <= m and (m-2) <= 2*n:
if m == (n-1):
print('%s0'%('01'*m))
elif m == n:
print('01'*m)
else:
L = []
while n >= 1 and m >= 1:
L += ['1','0']
n,m = n-1,m-1
L += ['1']
m -= 1
while m >= 1:
L[L.index('1')] = '11'
m -= 1
print(''.join(L))
else:
print(-1)
solve()
```
| 0
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,609,656,556
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 1
| 140
| 0
|
n=input()
k=['h','e','l','l','o']
ki=0
for i in n:
if k[ki]==i:
ki=ki+1
if ki==4:
print("YES")
exit(0)
if ki==4:
print("YES")
else:
print("no")
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
n=input()
k=['h','e','l','l','o']
ki=0
for i in n:
if k[ki]==i:
ki=ki+1
if ki==4:
print("YES")
exit(0)
if ki==4:
print("YES")
else:
print("no")
```
| 0
|
346
|
B
|
Lucky Common Subsequence
|
PROGRAMMING
| 2,000
|
[
"dp",
"strings"
] | null | null |
In mathematics, a subsequence is a sequence that can be derived from another sequence by deleting some elements without changing the order of the remaining elements. For example, the sequence BDF is a subsequence of ABCDEF. A substring of a string is a continuous subsequence of the string. For example, BCD is a substring of ABCDEF.
You are given two strings *s*1, *s*2 and another string called *virus*. Your task is to find the longest common subsequence of *s*1 and *s*2, such that it doesn't contain *virus* as a substring.
|
The input contains three strings in three separate lines: *s*1, *s*2 and *virus* (1<=≤<=|*s*1|,<=|*s*2|,<=|*virus*|<=≤<=100). Each string consists only of uppercase English letters.
|
Output the longest common subsequence of *s*1 and *s*2 without *virus* as a substring. If there are multiple answers, any of them will be accepted.
If there is no valid common subsequence, output 0.
|
[
"AJKEQSLOBSROFGZ\nOVGURWZLWVLUXTH\nOZ\n",
"AA\nA\nA\n"
] |
[
"ORZ\n",
"0\n"
] |
none
| 1,000
|
[
{
"input": "AJKEQSLOBSROFGZ\nOVGURWZLWVLUXTH\nOZ",
"output": "ORZ"
},
{
"input": "AA\nA\nA",
"output": "0"
},
{
"input": "PWBJTZPQHA\nZJMKLWSROQ\nUQ",
"output": "WQ"
},
{
"input": "QNHRPFYMAAPJDUHBAEXNEEZSTMYHVGQPYKNMVKMBVSVLIYGUVMJHEFLJEPIWFHSLISTGOKRXNMSCXYKMAXBPKCOCNTIRPCUEPHXM\nRRFCZUGFDRKKMQTOETNELXMEWGOCDHFKIXOPVHHEWTCDNXVFKFKTKNWKEIKTCMHMHDNCLLVQSGKHBCDDYVVVQIRPZEOPUGQUGRHH\nR",
"output": "QNHFPHEXNETMHMHLLSGKCYPOPUH"
},
{
"input": "CGPWTAPEVBTGANLCLVSHQIIKHDPVUHRSQPXHSNYAHPGBECICFQYDFRTRELLLEDZYWJSLOBSKDGRRDHNRRGIXAMEBGFJJTEIGUGRU\nHAWYVKRRBEIWNOGYMIYQXDCFXMMCSAYSOXQFHHIFRRCJRAWHLDDHHHAKHXVKCVPBFGGEXUKWTFWMOUUGMXTSBUTHXCJCWHCQQTYQ\nANKFDWLYSX",
"output": "WVBGCSSQHHIFRRWLDDHXBGFUGU"
},
{
"input": "AUNBEKNURNUPHXQYKUTAHCOLMPRQZZTVDUYCTNIRACQQTQAIDTAWJXBUTIZUASDIJZWLHAQVGCAHKTZMXSDVVWAIGQEALRFKFYTT\nQBVRFKPKLYZLYNRFTRJZZQEYAEKPFXVICUVFVQSDENBJYYNCFTOZHULSWJQTNELYLKCZTGHOARDCFXBXQGGSQIVUCJVNGFZEEZQE\nN",
"output": "BKPYTRZZVICQDJTZUSJZHAQGSVVGQE"
},
{
"input": "BGIIURZTEUJJULBWKHDQBRFGEUOMQSREOTILICRSBUHBGTSRDHKVDDEBVHGMHXUVFJURSMFDJOOOWCYPJDVRVKLDHICPNKTBFXDJ\nXOADNTKNILGNHHBNFYNDWUNXBGDFUKUVHLPDOGOYRMOTAQELLRMHFAQEOXFWGAQUROVUSWOAWFRVIRJQVXPCXLSCQLCUWKBZUFQP\nYVF",
"output": "ILBWKHDGOMQELRHEGUVUSOWVRVLCKBF"
},
{
"input": "AXBPBDEYIYKKCZBTLKBUNEQLCXXLKIUTOOATYDXYYQCLFAXAEIGTFMNTTQKCQRMEEFRYVYXAOLMUQNPJBMFBUGVXFZAJSBXWALSI\nVWFONLLKSHGHHQSFBBFWTXAITPUKNDANOCLMNFTAAMJVDLXYPILPCJCFWTNBQWEOMMXHRYHEGBJIVSXBBGQKXRIYNZFIWSZPPUUM\nPPKKLHXWWT",
"output": "BBITKNCLTADXYCFTNQMRYVXBBGXFWS"
},
{
"input": "XKTAOCPCVMIOGCQKPENDKIZRZBZVRTBTGCDRQUIMVHABDIHSCGWPUTQKLPBOXAYICPWJBFLFSEPERGJZHRINEHQMYTOTKLCQCSMZ\nAITFIOUTUVZLSSIYWXSYTQMFLICCXOFSACHTKGPXRHRCGXFZXPYWKWPUOIDNEEZOKMOUYGVUJRQTIRQFCSBCWXVFCIAOLZDGENNI\nDBHOIORVCPNXCDOJKSYYIENQRJGZFHOWBYQIITMTVWXRMAMYILTHBBAJRJELWMIZOZBGPDGSTIRTQIILJRYICMUQTUAFKDYGECPY",
"output": "TOVMIOCKPRRCGWPUOIEEGJRQTQCSZ"
},
{
"input": "UNGXODEEINVYVPHYVGSWPIPFMFLZJYRJIPCUSWVUDLLSLRPJJFWCUOYDUGXBRKWPARGLXFJCNNFUIGEZUCTPFYUIMQMJLQHTIVPO\nBWDEGORKXYCXIDWZKGFCUYIDYLTWLCDBUVHPAPFLIZPEUINQSTNRAOVYKZCKFWIJQVLSVCGLTCOEMAYRCDVVQWQENTWZALWUKKKA\nXDGPZXADAFCHKILONSXFGRHIQVMIYWUTJUPCCEKYQVYAENRHVWERJSNPVEMRYSZGYBNTQLIFKFISKZJQIQQGSKVGCNMPNIJDRTXI",
"output": "GODIYVHPPFLZPUSWVLSLCOYDWALU"
},
{
"input": "KOROXDDWEUVYWJIXSFPEJFYZJDDUXISOFJTIFJSBTWIJQHMTQWLAGGMXTFALRXYCMGZNKYQRCDVTPRQDBAALTWAXTNLDPYWNSFKE\nNHZGRZFMFQGSAYOJTFKMMUPOOQXWCPPAIVRJHINJPHXTTBWRIYNOHMJKBBGXVXYZDBVBBTQRXTOFLBBCXGNICBKAAGOKAYCCJYCW\nXCXLBESCRBNKWYGFDZFKWYNLFAKEWWGRUIAQGNCFDQXCHDBEQDSWSNGVKUFOGGSPFFZWTXGZQMMFJXDWOPUEZCMZEFDHXTRJTNLW",
"output": "KOOXWVJIPXTBWIHMTQXTFLCGNCBAAAYW"
},
{
"input": "ESQZPIRAWBTUZSOWLYKIYCHZJPYERRXPJANKPZVPEDCXCJIDTLCARMAOTZMHJVDJXRDNQRIIOFIUTALVSCKDUSAKANKKOFKWINLQ\nGKSTYEAXFJQQUTKPZDAKHZKXCJDONKBZOTYGLYQJOGKOYMYNNNQRRVAGARKBQYJRVYYPFXTIBJJYQUWJUGAUQZUVMUHXLIQWGRMP\nUFPHNRDXLNYRIIYVOFRKRUQCWAICQUUBPHHEGBCILXHHGLOBKADQVPSQCMXJRLIZQPSRLZJNZVQPIURDQUKNHVVYNVBYGXXXXJDI",
"output": "STYEXJKPZDXCJDTLOMVRQRFIUAVUIQ"
},
{
"input": "UAYQUMTSNGMYBORUYXJJQZVAGBRVDWUTGUYYYOTWAHVKGGOHADXULFUFQULSAGDWFJCSDKPWBROYZIFRGGRVZQMEHKHCKNHTQSMK\nSVKVTPUZOBRKGLEAAXMIUSRISOTDIFFUCODYGNYIPSWEEBHGNWRZETXSVVMQTRBVFZMYHOHUCMLBUXBMPMSNCSHFZTAFUVTMQFGL\nTNICVANBEBOQASUEJJAOJXWNMDGAAVYNHRPSMKGMXZDJHCZHFHRRMIDWUOQCZSBKDPLSGHNHFKFYDRGVKXOLPOOWBPOWSDFLEJVX",
"output": "SVVTUOKGAXUFFUCDPWBRZRVZMHHCNHTQ"
},
{
"input": "KEJHTOKHMKWTYSJEAJAXGADRHUKBCRHACSRDNSZIHTPQNLOSRKYBGYIIJDINTXRPMWSVMMBODAYPVVDDTIXGDIOMWUAKZVFKDAUM\nWTEVPIFAAJYIDTZSZKPPQKIOMHDZTKDMFVKSJRUFMNHZJPVSQYELWYAFACGGNRORSLGYVXAEYVLZBLDEHYDGOFDSWUYCXLXDKFSU\nTUZEQBWVBVTKETQ",
"output": "EJTOKMKSJRUHZPQLYGNRSVAYVDDGDWUKFU"
},
{
"input": "EGQYYSKTFTURZNRDVIWBYXMRDGFWMYKFXGIFOGYJSXKDCJUAGZPVTYCHIXVFTVTCXMKHZFTXSMMQVFXZGKHCIYODDRZEYECDLKNG\nPEXXCTRFJAAKPOTBAEFRLDRZKORNMXHHXTLKMKCGPVPUOBELPLFQFXOBZWIVIQCHEJQPXKGSCQAWIMETCJVTAGXJIINTADDXJTKQ\nQURSEKPMSSEVQZI",
"output": "EKTFRZNXMGFFXIJXKCATCVTXTDDK"
},
{
"input": "ZFFBNYVXOZCJPSRAEACVPAUKVTCVZYQPHVENTKOCMHNIYYMIKKLNKHLWHHWAQMWFTSYEOQQFEYAAYGMPNZCRYBVNAQTDSLXZGBCG\nPIQHLNEWAMFAKGHBGZAWRWAXCSKUDZBDOCTXAHSVFZACXGFMDSYBYYDDNQNBEZCYCULSMMPBTQOJQNRPZTRCSDLIYPLVUGJPKDTG\nZBFJPLNAKWQBTUVJKMHVBATAM",
"output": "FBZRACUZOCHAMSYYYNZCYBNTDLGG"
},
{
"input": "BTWZLIKDACZVLCKMVTIQHLFBNRCBDSWPFFKGPCQFPTOIJLPFCDMFGQKFHTDFFCCULUAYPXXIIIWBZIDMOPNHPZBEXLVARJFTBFOE\nMDXYKKWZVASJPPWRCYNMRAOBBLUNBSMQAPCPSFAGLXWJRBQTBRWXYNQGWECYNFIAJXDMUHIIMDFMSHLPIMYQXNRRUSSNXALGNWIK\nKNFVBVAOWXMZVUHAVUDKDBUVAKNHACZBGBHMUOPHWGQSDFXLHB",
"output": "WZACLMQLBRWGCFIJDMHDFLPIMNXL"
},
{
"input": "GOZVMIRQIGYGVAGOREQTXFXPEZYOJOXPNDGAESICXHMKQDXQPRLMRVWHXFEJVCWZDLYMQLDURUXZPTLEHPTSKXGSNEQDKLVFFLDX\nIMEVFCZXACKRRJVXDRKFWTLTRTLQQDHEBZLCOCNVPABQMIWJHRLKFUKWOVVWGGNWCJNRYOYOAJFQWCLHQIQRBZTVWKBFOXKEHHQP\nSZ",
"output": "MVARXFEZOPAIHRLVWFCLQRZTKXEQ"
},
{
"input": "BBYUVCIYLNUJPSEYCAAPQSDNSDDTNEHQZDPBEKQAWNAKEYFBNEEBGPDPRLCSVOWYDEDRPPEDOROCHRCNQUSPNVXGRXHNLKDETWQC\nBQCQXCAHADGJHBYIKEUWNXFUOOTVCCKJPJJCMWLAWWKSDGHFNZTCPSQNRTPCBLXDTSJLRHSCCZXQXCVLVGTROOUCUQASIQHZGNEI\nRYE",
"output": "BBYUVCJPCASDNTPQNBDRLVROOCQSGNE"
},
{
"input": "WZRKLETJRBBRZKGHEFBVEFVLIERBPSEGJVSNUZUICONWWBOOTHCOJLLZFNOCNOFJQZTZWBLKHGIWWWPBUYWBAHYJGEBJZJDTNBGN\nZINFGDCNKHYFZYYWHTIHZTKWXXXMSWOVOPQDTRWSQKBWWCPEMYFVGARELELBLGEVJCMOCFTTUVCYUQUSFONAMWKVDWMGXVNZJBWH\nAFPA",
"output": "WZKTRBEFVELEBEJCOTCFONWKWGZJB"
},
{
"input": "ABABABB\nABABABB\nABABB",
"output": "ABABAB"
},
{
"input": "ABBB\nABBB\nABB",
"output": "BBB"
},
{
"input": "A\nBABAABAAABABABABABABAABABABABBABABABABAABBABBABAABABAABAABBAAAAAABBABABABABAABABAABABABABAABAABABABA\nB",
"output": "A"
},
{
"input": "ABBAABAAABABAABAABABABABAABBBABABABAAABBABAAABABABABBABBABABAABABABABABABBABAABABAABABABAAABBABABABA\nA\nB",
"output": "A"
},
{
"input": "ABBBABABABABABBABAABAAABABAABABABABBABAAAABABABBABAABABAAABAABBAAABAABABBABBABABBABAABABABAAAAABABAB\nB\nBABBABAABABABABABABABABABBAABABBABABBAAABAAABABBAABAABBABABBABABAABBABAABABBAABAABAABABABABABBABABAB",
"output": "B"
},
{
"input": "AABABAABAAABABAAABAAAABBAAABABAAABABAABAABAAAABAABAAAABAAAABAAAABBAABAAAAABAAAAABABAAAAAABABAABAAAAA\nABAABABABAAABABAABABBAABAABAABABAABABAAABBAABAAAABABABAAAAABAAAAABABABABAABAABAABAABABAABABAABAABAAB\nBABAAABABBAABABAABAA",
"output": "ABAABABABAAABAAAABBAABAAAABABAABABAAABAABAAAABAAAAAAABAAAAAAABAAAAABAAAAAAABABAABAAAA"
},
{
"input": "AABABABABAAAABBAAAABABABABAAAAABABAAAA\nAABABAAABABABAAABAAAAABAAABAAABABABBBABBAAABAABAAAAABABBABAAABAABAABABAAAABABAAABAAABAABABBBABBABABA\nAAAAA",
"output": "AABABABABAAAABBAAAABABABABAAAABABAAAA"
},
{
"input": "ZZXXAAZZAXAAZZAZZXXAAZZAXAXZZXXAAZZZZXXAZZXXAAAZZXXAAAZZXXZZXXXAAAZZXZZXXAZZXXZXXAAXAAZZZXXAXAXAZZXZ\nAZZXXAAZZXXAAXZXXAZZXAZZXZZXXAAZZXXAAZAAZZAAZZXXAA\nAAZZXAAXXAAAZZXXAZZXXAAZZXXAAAZZXXZ",
"output": "ZZXXAAZZXXAAXZXXAZZXAZZXZZXXAAZZXXAAZAZZAAZZXXAA"
},
{
"input": "SDASSDADASDASDASDSDADASASDAAASDASDDASDDASDADASDASDSSDASDD\nSDASDASDDASDASDASDSDSDASDASDASDASDASDASDASDADASDASDASDSDASDASDDDASSD\nSDASDSDDAA",
"output": "SDASSDADASDASDSDSDADASASDAAASDASDDASDDASDDASDASDDASD"
},
{
"input": "DASSDASDASDDAASDASDADASDASASDAS\nSDADASDASSDAASDASDASDADASSDDA\nSD",
"output": "DADADADAADADADADASSA"
},
{
"input": "ASDASSDASDS\nDASDASDDDASDADASDASDASDASSDADASDDAASDA\nDSD",
"output": "ASDASSDASDS"
},
{
"input": "ASDASASDASDASDAASDASDASDASASDDAASDASSASDSDAD\nDASDASSSDASDASDASASDASSDAASDASSDDSASDASDAASDDAASDASDAASDASDDASDASDASDASDASS\nDASD",
"output": "ASDASASDASASDAASDASASDASASDDAASDASSASDSDAD"
},
{
"input": "DASDSDASDADASDDDSDASSDDAASDA\nDASDDASDSDADSDASDADSDSDADDASDASDDASDASDASDSDASD\nDAASD",
"output": "DASDSDASDADASDDDSDASSDDASDA"
},
{
"input": "ABAAAABABADABAABAABCCABADABACABACABCABADABADABACABBACAADABACABABACABADABACABABA\nBACAACABABABACABCABADABAACABADABACABAA\nABBAB",
"output": "BAAACABABABACABCABADABAACABADABACABAA"
},
{
"input": "ABAABACABADAACADABACAAB\nBAACABADABACABAAAADADAABACABACABADABABADABACABAADABBADABACAAACAABACABADABBBAA\nDABACA",
"output": "ABAABACABADAACADABAAAB"
},
{
"input": "BACABACABAACABADABABACAABACABBACAACAACABCABADAACABAABAABBADABACABADABCABAD\nBACAABADABABADABACABABACABADABACABCBADABACADABCABABADAABA\nBADABAA",
"output": "BACAABAAABADABACAABACABAAACABCBADAACADABCABADAABA"
},
{
"input": "ACABADABACABCABAAB\nBADAB\nACAACABA",
"output": "BADAB"
},
{
"input": "ABABAC\nABABAC\nABAC",
"output": "ABABA"
},
{
"input": "BCBCBC\nBCBCBC\nBC",
"output": "CCB"
},
{
"input": "AAACAAACAAADAAAAAAA\nAADAAAAAAAACDAAAAAAAAAAACAAAAABCACAAACAAAAABAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAADA\nAAACAADAAAAADD",
"output": "AAACAAACAAAAAAAAAA"
},
{
"input": "ABABBB\nABABBB\nABB",
"output": "ABAB"
},
{
"input": "ABABABAC\nABABABAC\nABABAC",
"output": "ABABABA"
},
{
"input": "BBAABAAAAABBBBBBBABABAABAABAABBABABABBBABBABBABBBABAABBBBBBAABAAAAAAAAABABAAABBABBAAAAAABAABABBAAABB\nBBAABAAAAABBBBBBBABABAABAABAABBABABABBBABBABBABBBABAABBBBBBAABAAAAAAAAABABAAABBABBAAAAAABAABABBAAABB\nBBBAA",
"output": "BBAABAAAAABBBBBBBABABAABAABAABBABABABBBABBABBABBBABAABBBBBBABAAAAAAAAABABAAABBABBAAAAAABAABABBAAABB"
},
{
"input": "ABABC\nABABC\nABC",
"output": "ABAB"
},
{
"input": "BABBB\nBABBB\nABB",
"output": "BBBB"
},
{
"input": "ABCCCCCCCC\nABCCCCCCCC\nABC",
"output": "BCCCCCCCC"
}
] | 1,609,248,130
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 404
| 2,048,000
|
def cseq(n,a,b):
for i in range(len(a)):
if(a[i] in b):
return a[i]
return -1
t=int(input())
for i in range(t):
n, m = map(int, input().split())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
answer = cseq(n, a, b)
if(answer==-1):
print("NO")
else:
print("YES")
print(1, answer)
|
Title: Lucky Common Subsequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In mathematics, a subsequence is a sequence that can be derived from another sequence by deleting some elements without changing the order of the remaining elements. For example, the sequence BDF is a subsequence of ABCDEF. A substring of a string is a continuous subsequence of the string. For example, BCD is a substring of ABCDEF.
You are given two strings *s*1, *s*2 and another string called *virus*. Your task is to find the longest common subsequence of *s*1 and *s*2, such that it doesn't contain *virus* as a substring.
Input Specification:
The input contains three strings in three separate lines: *s*1, *s*2 and *virus* (1<=≤<=|*s*1|,<=|*s*2|,<=|*virus*|<=≤<=100). Each string consists only of uppercase English letters.
Output Specification:
Output the longest common subsequence of *s*1 and *s*2 without *virus* as a substring. If there are multiple answers, any of them will be accepted.
If there is no valid common subsequence, output 0.
Demo Input:
['AJKEQSLOBSROFGZ\nOVGURWZLWVLUXTH\nOZ\n', 'AA\nA\nA\n']
Demo Output:
['ORZ\n', '0\n']
Note:
none
|
```python
def cseq(n,a,b):
for i in range(len(a)):
if(a[i] in b):
return a[i]
return -1
t=int(input())
for i in range(t):
n, m = map(int, input().split())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
answer = cseq(n, a, b)
if(answer==-1):
print("NO")
else:
print("YES")
print(1, answer)
```
| -1
|
|
509
|
A
|
Maximum in Table
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
|
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
|
Print a single line containing a positive integer *m* — the maximum value in the table.
|
[
"1\n",
"5\n"
] |
[
"1",
"70"
] |
In the second test the rows of the table look as follows:
| 0
|
[
{
"input": "1",
"output": "1"
},
{
"input": "5",
"output": "70"
},
{
"input": "2",
"output": "2"
},
{
"input": "3",
"output": "6"
},
{
"input": "4",
"output": "20"
},
{
"input": "6",
"output": "252"
},
{
"input": "7",
"output": "924"
},
{
"input": "9",
"output": "12870"
},
{
"input": "10",
"output": "48620"
},
{
"input": "8",
"output": "3432"
}
] | 1,645,537,095
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include <stdio.h>
int main()
{
int n,i,j;
scanf("%d",&n);
int a[n][n];
if(n!=0)
{
for(i=0;i<n;i++)
{
for(j=0;j<n;j++)
{
if (i==0 || j==0)
{
a[i][j]=1;
}
else
{
a[i][j]=a[i][j-1]+a[i-1][j];
}
}
}
printf("%d",a[n-1][n-1]);
}
else
{
printf("%d",0);
}
return 0;
}
|
Title: Maximum in Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
Input Specification:
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
Output Specification:
Print a single line containing a positive integer *m* — the maximum value in the table.
Demo Input:
['1\n', '5\n']
Demo Output:
['1', '70']
Note:
In the second test the rows of the table look as follows:
|
```python
#include <stdio.h>
int main()
{
int n,i,j;
scanf("%d",&n);
int a[n][n];
if(n!=0)
{
for(i=0;i<n;i++)
{
for(j=0;j<n;j++)
{
if (i==0 || j==0)
{
a[i][j]=1;
}
else
{
a[i][j]=a[i][j-1]+a[i-1][j];
}
}
}
printf("%d",a[n-1][n-1]);
}
else
{
printf("%d",0);
}
return 0;
}
```
| -1
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,610,778,866
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 80
| 186
| 0
|
n=int(input())
a=[]
for i in range(n):
x,y,z=map(int,input().split())
s=x+y+z
a.append(s)
f=sum(a)
if f==0:
print('YES')
else:
print('NO')
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
n=int(input())
a=[]
for i in range(n):
x,y,z=map(int,input().split())
s=x+y+z
a.append(s)
f=sum(a)
if f==0:
print('YES')
else:
print('NO')
```
| 0
|
788
|
A
|
Functions again
|
PROGRAMMING
| 1,600
|
[
"dp",
"two pointers"
] | null | null |
Something happened in Uzhlyandia again... There are riots on the streets... Famous Uzhlyandian superheroes Shean the Sheep and Stas the Giraffe were called in order to save the situation. Upon the arriving, they found that citizens are worried about maximum values of the Main Uzhlyandian Function *f*, which is defined as follows:
In the above formula, 1<=≤<=*l*<=<<=*r*<=≤<=*n* must hold, where *n* is the size of the Main Uzhlyandian Array *a*, and |*x*| means absolute value of *x*. But the heroes skipped their math lessons in school, so they asked you for help. Help them calculate the maximum value of *f* among all possible values of *l* and *r* for the given array *a*.
|
The first line contains single integer *n* (2<=≤<=*n*<=≤<=105) — the size of the array *a*.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (-109<=≤<=*a**i*<=≤<=109) — the array elements.
|
Print the only integer — the maximum value of *f*.
|
[
"5\n1 4 2 3 1\n",
"4\n1 5 4 7\n"
] |
[
"3",
"6"
] |
In the first sample case, the optimal value of *f* is reached on intervals [1, 2] and [2, 5].
In the second case maximal value of *f* is reachable only on the whole array.
| 500
|
[
{
"input": "5\n1 4 2 3 1",
"output": "3"
},
{
"input": "4\n1 5 4 7",
"output": "6"
},
{
"input": "8\n16 14 12 10 8 100 50 0",
"output": "92"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "50\n-5 -9 0 44 -10 37 34 -49 11 -22 -26 44 8 -13 23 -46 34 12 -24 2 -40 -15 -28 38 -40 -42 -42 7 -43 5 2 -11 10 43 9 49 -13 36 2 24 46 50 -15 -26 -6 -6 8 4 -44 -3",
"output": "208"
},
{
"input": "100\n23 64 60 -45 -36 -64 -59 15 -75 69 -30 -7 -20 17 -77 58 93 -76 -98 -22 -31 16 -50 6 -20 -85 1 64 -88 -8 -15 -6 -57 25 91 10 2 -90 74 -66 -42 73 28 49 -85 59 96 79 -25 49 -59 -89 -75 12 -96 -33 -65 -8 -100 -81 17 99 -91 -5 7 -21 1 85 63 86 -26 85 -31 11 -75 35 -82 15 98 93 -55 66 70 36 -38 8 92 -63 -5 60 -78 -7 -22 -1 4 54 36 16 32 -20",
"output": "632"
},
{
"input": "3\n0 0 0",
"output": "0"
},
{
"input": "3\n0 1 -1",
"output": "2"
},
{
"input": "5\n1000000000 0 0 1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "2\n1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "4\n1000000000 0 0 -1000000000",
"output": "2000000000"
},
{
"input": "4\n1 0 1 0",
"output": "1"
},
{
"input": "5\n0 10 20 30 40",
"output": "10"
},
{
"input": "2\n-1000000000 1000000000",
"output": "2000000000"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "9\n1000000000 0 0 1000000000 1000000000 0 0 1000000000 1000000000",
"output": "4000000000"
},
{
"input": "16\n-1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000",
"output": "16000000000"
},
{
"input": "6\n1000000000 0 0 1000000000 1000000000 0",
"output": "3000000000"
},
{
"input": "17\n1000000000 0 0 1000000000 1000000000 0 0 1000000000 1000000000 0 0 1000000000 1000000000 0 0 1000000000 1000000000",
"output": "8000000000"
},
{
"input": "11\n1000000000 0 1 1000000000 999999999 1 0 1000000000 999999999 1 1000000000",
"output": "4999999991"
},
{
"input": "4\n1000000000 -1000000000 -1000000000 1000000000",
"output": "4000000000"
},
{
"input": "10\n1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000",
"output": "10000000000"
}
] | 1,608,015,425
| 425
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 93
| 0
|
b = input()
a = [str(i) for i in input().split()]
print(int(min(a))-1)
|
Title: Functions again
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Something happened in Uzhlyandia again... There are riots on the streets... Famous Uzhlyandian superheroes Shean the Sheep and Stas the Giraffe were called in order to save the situation. Upon the arriving, they found that citizens are worried about maximum values of the Main Uzhlyandian Function *f*, which is defined as follows:
In the above formula, 1<=≤<=*l*<=<<=*r*<=≤<=*n* must hold, where *n* is the size of the Main Uzhlyandian Array *a*, and |*x*| means absolute value of *x*. But the heroes skipped their math lessons in school, so they asked you for help. Help them calculate the maximum value of *f* among all possible values of *l* and *r* for the given array *a*.
Input Specification:
The first line contains single integer *n* (2<=≤<=*n*<=≤<=105) — the size of the array *a*.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (-109<=≤<=*a**i*<=≤<=109) — the array elements.
Output Specification:
Print the only integer — the maximum value of *f*.
Demo Input:
['5\n1 4 2 3 1\n', '4\n1 5 4 7\n']
Demo Output:
['3', '6']
Note:
In the first sample case, the optimal value of *f* is reached on intervals [1, 2] and [2, 5].
In the second case maximal value of *f* is reachable only on the whole array.
|
```python
b = input()
a = [str(i) for i in input().split()]
print(int(min(a))-1)
```
| 0
|
|
664
|
A
|
Complicated GCD
|
PROGRAMMING
| 800
|
[
"math",
"number theory"
] | null | null |
Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm.
Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type!
|
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100).
|
Output one integer — greatest common divisor of all integers from *a* to *b* inclusive.
|
[
"1 2\n",
"61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n"
] |
[
"1\n",
"61803398874989484820458683436563811772030917980576\n"
] |
none
| 500
|
[
{
"input": "1 2",
"output": "1"
},
{
"input": "61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576",
"output": "61803398874989484820458683436563811772030917980576"
},
{
"input": "1 100",
"output": "1"
},
{
"input": "100 100000",
"output": "1"
},
{
"input": "12345 67890123456789123457",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158 8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158",
"output": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158"
},
{
"input": "1 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "8328748239473982794239847237438782379810988324751 9328748239473982794239847237438782379810988324751",
"output": "1"
},
{
"input": "1029398958432734901284327523909481928483573793 1029398958432734901284327523909481928483573794",
"output": "1"
},
{
"input": "10000 1000000000",
"output": "1"
},
{
"input": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "11210171722243 65715435710585778347",
"output": "1"
},
{
"input": "2921881079263974825226940825843 767693191032295360887755303860323261471",
"output": "1"
},
{
"input": "8025352957265704896940312528736939363590612908210603 96027920417708260814607687034511406492969694925539085",
"output": "1"
},
{
"input": "23510978780782786207241069904470895053213996267165977112058175452757132930 210352653280909370107314249722987050753257161175393375412301228883856435481424",
"output": "1"
},
{
"input": "8150070767079366215626260746398623663859344142817267779361251788637547414925170226504788118262 49924902262298336032630839998470954964895251605110946547855439236151401194070172107435992986913614",
"output": "1"
},
{
"input": "15943150466658398903 15943150466658398903",
"output": "15943150466658398903"
},
{
"input": "410470228200245407491525399055972 410470228200245407491525399055972",
"output": "410470228200245407491525399055972"
},
{
"input": "51894705655711504622197349350106792045098781545973899451307 51894705655711504622197349350106792045098781545973899451307",
"output": "51894705655711504622197349350106792045098781545973899451307"
},
{
"input": "60353594589897438036015726222485085035927634677598681595162804007836722215668410 60353594589897438036015726222485085035927634677598681595162804007836722215668410",
"output": "60353594589897438036015726222485085035927634677598681595162804007836722215668410"
},
{
"input": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535 761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535",
"output": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535"
},
{
"input": "1 2000000000",
"output": "1"
},
{
"input": "13 1928834874",
"output": "1"
},
{
"input": "87 2938984237482934238",
"output": "1"
},
{
"input": "213 413",
"output": "1"
},
{
"input": "3 4",
"output": "1"
}
] | 1,568,789,771
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 3
| 1,000
| 0
|
def isprime(a,b):
flag = 1
for j in range(a,b+1):
for i in range(2,j//2+1):
if j%i == 0:
flag = 0
break
if flag == 1:
return True
def gcd(a, b):
if a == 0 :
return b
return gcd(b%a, a)
a,b = map(int,input().split())
if isprime(a,b):
print(1)
else:
print(gcd(a,b))
|
Title: Complicated GCD
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm.
Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type!
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100).
Output Specification:
Output one integer — greatest common divisor of all integers from *a* to *b* inclusive.
Demo Input:
['1 2\n', '61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n']
Demo Output:
['1\n', '61803398874989484820458683436563811772030917980576\n']
Note:
none
|
```python
def isprime(a,b):
flag = 1
for j in range(a,b+1):
for i in range(2,j//2+1):
if j%i == 0:
flag = 0
break
if flag == 1:
return True
def gcd(a, b):
if a == 0 :
return b
return gcd(b%a, a)
a,b = map(int,input().split())
if isprime(a,b):
print(1)
else:
print(gcd(a,b))
```
| 0
|
|
609
|
B
|
The Best Gift
|
PROGRAMMING
| 1,100
|
[
"constructive algorithms",
"implementation"
] | null | null |
Emily's birthday is next week and Jack has decided to buy a present for her. He knows she loves books so he goes to the local bookshop, where there are *n* books on sale from one of *m* genres.
In the bookshop, Jack decides to buy two books of different genres.
Based on the genre of books on sale in the shop, find the number of options available to Jack for choosing two books of different genres for Emily. Options are considered different if they differ in at least one book.
The books are given by indices of their genres. The genres are numbered from 1 to *m*.
|
The first line contains two positive integers *n* and *m* (2<=≤<=*n*<=≤<=2·105,<=2<=≤<=*m*<=≤<=10) — the number of books in the bookstore and the number of genres.
The second line contains a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (1<=≤<=*a**i*<=≤<=*m*) equals the genre of the *i*-th book.
It is guaranteed that for each genre there is at least one book of that genre.
|
Print the only integer — the number of ways in which Jack can choose books.
It is guaranteed that the answer doesn't exceed the value 2·109.
|
[
"4 3\n2 1 3 1\n",
"7 4\n4 2 3 1 2 4 3\n"
] |
[
"5\n",
"18\n"
] |
The answer to the first test sample equals 5 as Sasha can choose:
1. the first and second books, 1. the first and third books, 1. the first and fourth books, 1. the second and third books, 1. the third and fourth books.
| 0
|
[
{
"input": "4 3\n2 1 3 1",
"output": "5"
},
{
"input": "7 4\n4 2 3 1 2 4 3",
"output": "18"
},
{
"input": "2 2\n1 2",
"output": "1"
},
{
"input": "3 2\n1 2 2",
"output": "2"
},
{
"input": "10 10\n1 2 3 4 5 6 7 8 9 10",
"output": "45"
},
{
"input": "9 2\n1 1 1 1 2 1 1 1 1",
"output": "8"
},
{
"input": "12 3\n1 2 3 1 2 3 1 2 3 1 2 3",
"output": "48"
},
{
"input": "100 3\n2 1 1 1 3 2 3 3 2 3 3 1 3 3 1 3 3 1 1 1 2 3 1 2 3 1 2 3 3 1 3 1 1 2 3 2 3 3 2 3 3 1 2 2 1 2 3 2 3 2 2 1 1 3 1 3 2 1 3 1 3 1 3 1 1 3 3 3 2 3 2 2 2 2 1 3 3 3 1 2 1 2 3 2 1 3 1 3 2 1 3 1 2 1 2 3 1 3 2 3",
"output": "3296"
},
{
"input": "100 5\n5 5 2 4 5 4 4 4 4 2 5 3 4 2 4 4 1 1 5 3 2 2 1 3 3 2 5 3 4 5 1 3 5 4 4 4 3 1 4 4 3 4 5 2 5 4 2 1 2 2 3 5 5 5 1 4 5 3 1 4 2 2 5 1 5 3 4 1 5 1 2 2 3 5 1 3 2 4 2 4 2 2 4 1 3 5 2 2 2 3 3 4 3 2 2 5 5 4 2 5",
"output": "3953"
},
{
"input": "100 10\n7 4 5 5 10 10 5 8 5 7 4 5 4 6 8 8 2 6 3 3 10 7 10 8 6 2 7 3 9 7 7 2 4 5 2 4 9 5 10 1 10 5 10 4 1 3 4 2 6 9 9 9 10 6 2 5 6 1 8 10 4 10 3 4 10 5 5 4 10 4 5 3 7 10 2 7 3 6 9 6 1 6 5 5 4 6 6 4 4 1 5 1 6 6 6 8 8 6 2 6",
"output": "4428"
}
] | 1,577,568,712
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 171
| 3,993,600
|
n, m = map(int, input().split())
a = list(map(int, input().split()))
d = {i:0 for i in range(1, m+1)}
for num in a:
d[num] += 1
n_sum = 0
for i in range(1, m+1):
n_sum += d[i]*(d[i]-1)//2
print(int(n*(n-1)/2 - n_sum))
|
Title: The Best Gift
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Emily's birthday is next week and Jack has decided to buy a present for her. He knows she loves books so he goes to the local bookshop, where there are *n* books on sale from one of *m* genres.
In the bookshop, Jack decides to buy two books of different genres.
Based on the genre of books on sale in the shop, find the number of options available to Jack for choosing two books of different genres for Emily. Options are considered different if they differ in at least one book.
The books are given by indices of their genres. The genres are numbered from 1 to *m*.
Input Specification:
The first line contains two positive integers *n* and *m* (2<=≤<=*n*<=≤<=2·105,<=2<=≤<=*m*<=≤<=10) — the number of books in the bookstore and the number of genres.
The second line contains a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (1<=≤<=*a**i*<=≤<=*m*) equals the genre of the *i*-th book.
It is guaranteed that for each genre there is at least one book of that genre.
Output Specification:
Print the only integer — the number of ways in which Jack can choose books.
It is guaranteed that the answer doesn't exceed the value 2·109.
Demo Input:
['4 3\n2 1 3 1\n', '7 4\n4 2 3 1 2 4 3\n']
Demo Output:
['5\n', '18\n']
Note:
The answer to the first test sample equals 5 as Sasha can choose:
1. the first and second books, 1. the first and third books, 1. the first and fourth books, 1. the second and third books, 1. the third and fourth books.
|
```python
n, m = map(int, input().split())
a = list(map(int, input().split()))
d = {i:0 for i in range(1, m+1)}
for num in a:
d[num] += 1
n_sum = 0
for i in range(1, m+1):
n_sum += d[i]*(d[i]-1)//2
print(int(n*(n-1)/2 - n_sum))
```
| 3
|
|
281
|
A
|
Word Capitalization
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
|
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
|
Output the given word after capitalization.
|
[
"ApPLe\n",
"konjac\n"
] |
[
"ApPLe\n",
"Konjac\n"
] |
none
| 500
|
[
{
"input": "ApPLe",
"output": "ApPLe"
},
{
"input": "konjac",
"output": "Konjac"
},
{
"input": "a",
"output": "A"
},
{
"input": "A",
"output": "A"
},
{
"input": "z",
"output": "Z"
},
{
"input": "ABACABA",
"output": "ABACABA"
},
{
"input": "xYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX",
"output": "XYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX"
},
{
"input": "rZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO",
"output": "RZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO"
},
{
"input": "hDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD",
"output": "HDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD"
},
{
"input": "qUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW",
"output": "QUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW"
},
{
"input": "kHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL",
"output": "KHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL"
},
{
"input": "aHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC",
"output": "AHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC"
},
{
"input": "sLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN",
"output": "SLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN"
},
{
"input": "iRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE",
"output": "IRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE"
},
{
"input": "cRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP",
"output": "CRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP"
},
{
"input": "wVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG",
"output": "WVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG"
},
{
"input": "kEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV",
"output": "KEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV"
},
{
"input": "eIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI",
"output": "EIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI"
},
{
"input": "uOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX",
"output": "UOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX"
},
{
"input": "lZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ",
"output": "LZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ"
},
{
"input": "P",
"output": "P"
},
{
"input": "Xyzzy",
"output": "Xyzzy"
},
{
"input": "Zzz",
"output": "Zzz"
},
{
"input": "Zp",
"output": "Zp"
}
] | 1,697,301,636
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 92
| 0
|
s=str(input())
alphabets_upper='ABCDEFGHIJKLMNOPQRSTUVWXYZ'
alphabets_lower='abcdefghijklmnopqrstuvwxyz'
new_str=''
if s[0] in alphabets_upper:
print(s)
else:
index=alphabets_lower.index(s[0])
new_=alphabets_upper[index]
new_str = new_
for i in range (1,len(s)):
new_str+=s[i]
print(new_str)
|
Title: Word Capitalization
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
Input Specification:
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
Output Specification:
Output the given word after capitalization.
Demo Input:
['ApPLe\n', 'konjac\n']
Demo Output:
['ApPLe\n', 'Konjac\n']
Note:
none
|
```python
s=str(input())
alphabets_upper='ABCDEFGHIJKLMNOPQRSTUVWXYZ'
alphabets_lower='abcdefghijklmnopqrstuvwxyz'
new_str=''
if s[0] in alphabets_upper:
print(s)
else:
index=alphabets_lower.index(s[0])
new_=alphabets_upper[index]
new_str = new_
for i in range (1,len(s)):
new_str+=s[i]
print(new_str)
```
| 3
|
|
75
|
C
|
Modified GCD
|
PROGRAMMING
| 1,600
|
[
"binary search",
"number theory"
] |
C. Modified GCD
|
2
|
256
|
Well, here is another math class task. In mathematics, GCD is the greatest common divisor, and it's an easy task to calculate the GCD between two positive integers.
A common divisor for two positive numbers is a number which both numbers are divisible by.
But your teacher wants to give you a harder task, in this task you have to find the greatest common divisor *d* between two integers *a* and *b* that is in a given range from *low* to *high* (inclusive), i.e. *low*<=≤<=*d*<=≤<=*high*. It is possible that there is no common divisor in the given range.
You will be given the two integers *a* and *b*, then *n* queries. Each query is a range from *low* to *high* and you have to answer each query.
|
The first line contains two integers *a* and *b*, the two integers as described above (1<=≤<=*a*,<=*b*<=≤<=109). The second line contains one integer *n*, the number of queries (1<=≤<=*n*<=≤<=104). Then *n* lines follow, each line contains one query consisting of two integers, *low* and *high* (1<=≤<=*low*<=≤<=*high*<=≤<=109).
|
Print *n* lines. The *i*-th of them should contain the result of the *i*-th query in the input. If there is no common divisor in the given range for any query, you should print -1 as a result for this query.
|
[
"9 27\n3\n1 5\n10 11\n9 11\n"
] |
[
"3\n-1\n9\n"
] |
none
| 1,500
|
[
{
"input": "9 27\n3\n1 5\n10 11\n9 11",
"output": "3\n-1\n9"
},
{
"input": "48 72\n2\n8 29\n29 37",
"output": "24\n-1"
},
{
"input": "90 100\n10\n51 61\n6 72\n1 84\n33 63\n37 69\n18 21\n9 54\n49 90\n14 87\n37 90",
"output": "-1\n10\n10\n-1\n-1\n-1\n10\n-1\n-1\n-1"
},
{
"input": "84 36\n1\n18 32",
"output": "-1"
},
{
"input": "90 36\n16\n13 15\n5 28\n11 30\n26 35\n2 8\n19 36\n3 17\n5 14\n4 26\n22 33\n16 33\n18 27\n4 17\n1 2\n29 31\n18 36",
"output": "-1\n18\n18\n-1\n6\n-1\n9\n9\n18\n-1\n18\n18\n9\n2\n-1\n18"
},
{
"input": "84 90\n18\n10 75\n2 40\n30 56\n49 62\n19 33\n5 79\n61 83\n13 56\n73 78\n1 18\n23 35\n14 72\n22 33\n1 21\n8 38\n54 82\n6 80\n57 75",
"output": "-1\n6\n-1\n-1\n-1\n6\n-1\n-1\n-1\n6\n-1\n-1\n-1\n6\n-1\n-1\n6\n-1"
},
{
"input": "84 100\n16\n10 64\n3 61\n19 51\n42 67\n51 68\n12 40\n10 47\n52 53\n37 67\n2 26\n23 47\n17 75\n49 52\n3 83\n63 81\n8 43",
"output": "-1\n4\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n4\n-1\n-1\n-1\n4\n-1\n-1"
},
{
"input": "36 60\n2\n17 25\n16 20",
"output": "-1\n-1"
},
{
"input": "90 100\n8\n55 75\n46 68\n44 60\n32 71\n43 75\n23 79\n47 86\n11 57",
"output": "-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1"
},
{
"input": "90 36\n8\n1 19\n10 12\n14 28\n21 24\n8 8\n33 34\n10 26\n15 21",
"output": "18\n-1\n18\n-1\n-1\n-1\n18\n18"
},
{
"input": "48 80\n19\n1 1\n16 16\n1 16\n16 48\n16 80\n16 1000000000\n1000000000 1000000000\n1 1000000000\n500000000 1000000000\n15 17\n17 17\n15 15\n8 8\n8 15\n8 16\n8 17\n7 17\n7 15\n9 15",
"output": "1\n16\n16\n16\n16\n16\n-1\n16\n-1\n16\n-1\n-1\n8\n8\n16\n16\n16\n8\n-1"
},
{
"input": "31607 999002449\n18\n31607 31607\n31606 31608\n31607 31608\n31606 31607\n31606 31606\n31608 31608\n1 31607\n1 31606\n1 31608\n1 1000000000\n31607 1000000000\n31606 1000000000\n31608 1000000000\n1000000000 1000000000\n1 1\n2 31606\n2 31607\n2 31608",
"output": "31607\n31607\n31607\n31607\n-1\n-1\n31607\n1\n31607\n31607\n31607\n31607\n-1\n-1\n1\n-1\n31607\n31607"
},
{
"input": "999999937 999999929\n12\n999999929 999999937\n1 1\n1 1000000000\n2 1000000000\n1 2\n999999937 999999937\n999999929 999999929\n2 2\n3 3\n1 100\n1 999999937\n1 999999929",
"output": "-1\n1\n1\n-1\n1\n-1\n-1\n-1\n-1\n1\n1\n1"
}
] | 1,654,298,957
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 1
| 92
| 512,000
|
# 2022-06-04T08:16:23Z
"""
Input
The first line contains two integers a and b, the two integers as described above (1 ≤ a, b ≤ 109). The second line contains one integer n, the number of queries (1 ≤ n ≤ 104). Then n lines follow, each line contains one query consisting of two integers, low and high (1 ≤ low ≤ high ≤ 109).
Output
Print n lines. The i-th of them should contain the result of the i-th query in the input. If there is no common divisor in the given range for any query, you should print -1 as a result for this query.
"""
from math import gcd
a, b = map(int, input().split())
g = gcd(a, b)
def factorize(v):
factors = []
for i in range(3, v):
if v % i == 0:
factors.append(i)
return factors
factors = factorize(g)
n = int(input())
for _ in range(n):
low, high = map(int, input().split())
candidates = []
for f in factors:
if high - low < f - 1:
continue
else:
candidates.append(high // f * f)
print(max(candidates) if candidates else -1)
|
Title: Modified GCD
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Well, here is another math class task. In mathematics, GCD is the greatest common divisor, and it's an easy task to calculate the GCD between two positive integers.
A common divisor for two positive numbers is a number which both numbers are divisible by.
But your teacher wants to give you a harder task, in this task you have to find the greatest common divisor *d* between two integers *a* and *b* that is in a given range from *low* to *high* (inclusive), i.e. *low*<=≤<=*d*<=≤<=*high*. It is possible that there is no common divisor in the given range.
You will be given the two integers *a* and *b*, then *n* queries. Each query is a range from *low* to *high* and you have to answer each query.
Input Specification:
The first line contains two integers *a* and *b*, the two integers as described above (1<=≤<=*a*,<=*b*<=≤<=109). The second line contains one integer *n*, the number of queries (1<=≤<=*n*<=≤<=104). Then *n* lines follow, each line contains one query consisting of two integers, *low* and *high* (1<=≤<=*low*<=≤<=*high*<=≤<=109).
Output Specification:
Print *n* lines. The *i*-th of them should contain the result of the *i*-th query in the input. If there is no common divisor in the given range for any query, you should print -1 as a result for this query.
Demo Input:
['9 27\n3\n1 5\n10 11\n9 11\n']
Demo Output:
['3\n-1\n9\n']
Note:
none
|
```python
# 2022-06-04T08:16:23Z
"""
Input
The first line contains two integers a and b, the two integers as described above (1 ≤ a, b ≤ 109). The second line contains one integer n, the number of queries (1 ≤ n ≤ 104). Then n lines follow, each line contains one query consisting of two integers, low and high (1 ≤ low ≤ high ≤ 109).
Output
Print n lines. The i-th of them should contain the result of the i-th query in the input. If there is no common divisor in the given range for any query, you should print -1 as a result for this query.
"""
from math import gcd
a, b = map(int, input().split())
g = gcd(a, b)
def factorize(v):
factors = []
for i in range(3, v):
if v % i == 0:
factors.append(i)
return factors
factors = factorize(g)
n = int(input())
for _ in range(n):
low, high = map(int, input().split())
candidates = []
for f in factors:
if high - low < f - 1:
continue
else:
candidates.append(high // f * f)
print(max(candidates) if candidates else -1)
```
| 0
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,506,201,951
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 124
| 0
|
s=input()
print([s.lower(),s.upper()][sum(map(str.isupper,s))>len(s)/2])
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
s=input()
print([s.lower(),s.upper()][sum(map(str.isupper,s))>len(s)/2])
```
| 3.969
|
12
|
A
|
Super Agent
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Super Agent
|
2
|
256
|
There is a very secret base in Potatoland where potato mash is made according to a special recipe. The neighbours from Porridgia decided to seize this recipe and to sell it to Pilauland. For this mission they have been preparing special agent Pearlo for many years. When, finally, Pearlo learned all secrets of espionage, he penetrated into the Potatoland territory and reached the secret base.
Now he is standing at the entrance, but to get inside he need to pass combination lock. Minute ago one of the workers entered the password on the terminal and opened the door. The terminal is a square digital keyboard 3<=×<=3 with digits from 1 to 9.
Pearlo knows that the password consists from distinct digits and is probably symmetric with respect to the central button of the terminal. He has heat sensor which allowed him to detect the digits which the worker pressed. Now he wants to check whether the password entered by the worker is symmetric with respect to the central button of the terminal. This fact can Help Pearlo to reduce the number of different possible password combinations.
|
Input contains the matrix of three rows of three symbols each. Symbol «X» means that the corresponding button was pressed, and «.» means that is was not pressed. The matrix may contain no «X», also it may contain no «.».
|
Print YES if the password is symmetric with respect to the central button of the terminal and NO otherwise.
|
[
"XX.\n...\n.XX\n",
"X.X\nX..\n...\n"
] |
[
"YES\n",
"NO\n"
] |
If you are not familiar with the term «central symmetry», you may look into http://en.wikipedia.org/wiki/Central_symmetry
| 0
|
[
{
"input": "XX.\n...\n.XX",
"output": "YES"
},
{
"input": ".X.\n.X.\n.X.",
"output": "YES"
},
{
"input": "XXX\nXXX\nXXX",
"output": "YES"
},
{
"input": "XXX\nX.X\nXXX",
"output": "YES"
},
{
"input": "X..\n.X.\n..X",
"output": "YES"
},
{
"input": "...\nX.X\nX..",
"output": "NO"
},
{
"input": ".X.\nX.X\n.X.",
"output": "YES"
},
{
"input": "X.X\n.X.\nX.X",
"output": "YES"
},
{
"input": "...\n...\n..X",
"output": "NO"
},
{
"input": "XXX\n...\nXXX",
"output": "YES"
},
{
"input": "..X\nX..\n..X",
"output": "NO"
},
{
"input": ".X.\n...\nX.X",
"output": "NO"
},
{
"input": "X.X\nX.X\nX.X",
"output": "YES"
},
{
"input": ".X.\nX.X\nXX.",
"output": "NO"
},
{
"input": "...\nXXX\nXXX",
"output": "NO"
},
{
"input": "XXX\n..X\nXXX",
"output": "NO"
},
{
"input": "X..\nX.X\n.X.",
"output": "NO"
},
{
"input": "...\n..X\nXXX",
"output": "NO"
},
{
"input": "..X\nX.X\nX..",
"output": "YES"
},
{
"input": "..X\n..X\nXXX",
"output": "NO"
},
{
"input": "X..\nX..\nX..",
"output": "NO"
},
{
"input": "XXX\n.X.\nXXX",
"output": "YES"
},
{
"input": "..X\n...\nX..",
"output": "YES"
},
{
"input": "...\n...\nX..",
"output": "NO"
},
{
"input": "...\n...\n.X.",
"output": "NO"
},
{
"input": "...\n...\n..X",
"output": "NO"
},
{
"input": "...\n.X.\nX..",
"output": "NO"
}
] | 1,644,297,530
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 40
| 154
| 0
|
a=input()
b=input()
c=input()
if a==c[::-1] and b==b[::-1]:print("YES")
else:print("NO")
|
Title: Super Agent
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There is a very secret base in Potatoland where potato mash is made according to a special recipe. The neighbours from Porridgia decided to seize this recipe and to sell it to Pilauland. For this mission they have been preparing special agent Pearlo for many years. When, finally, Pearlo learned all secrets of espionage, he penetrated into the Potatoland territory and reached the secret base.
Now he is standing at the entrance, but to get inside he need to pass combination lock. Minute ago one of the workers entered the password on the terminal and opened the door. The terminal is a square digital keyboard 3<=×<=3 with digits from 1 to 9.
Pearlo knows that the password consists from distinct digits and is probably symmetric with respect to the central button of the terminal. He has heat sensor which allowed him to detect the digits which the worker pressed. Now he wants to check whether the password entered by the worker is symmetric with respect to the central button of the terminal. This fact can Help Pearlo to reduce the number of different possible password combinations.
Input Specification:
Input contains the matrix of three rows of three symbols each. Symbol «X» means that the corresponding button was pressed, and «.» means that is was not pressed. The matrix may contain no «X», also it may contain no «.».
Output Specification:
Print YES if the password is symmetric with respect to the central button of the terminal and NO otherwise.
Demo Input:
['XX.\n...\n.XX\n', 'X.X\nX..\n...\n']
Demo Output:
['YES\n', 'NO\n']
Note:
If you are not familiar with the term «central symmetry», you may look into http://en.wikipedia.org/wiki/Central_symmetry
|
```python
a=input()
b=input()
c=input()
if a==c[::-1] and b==b[::-1]:print("YES")
else:print("NO")
```
| 3.9615
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,696,429,382
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 92
| 0
|
def find_odd_one_out(n, numbers):
even_count = 0
odd_count = 0
even_index = -1
odd_index = -1
for i, num in enumerate(numbers):
if num % 2 == 0:
even_count += 1
even_index = i
else:
odd_count += 1
odd_index = i
if even_count > 1 and odd_count == 1:
return odd_index + 1
elif odd_count > 1 and even_count == 1:
return even_index + 1
# Read input
n = int(input())
numbers = list(map(int, input().split()))
# Find the number that differs in evenness
result = find_odd_one_out(n, numbers)
# Print the result
print(result)
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
def find_odd_one_out(n, numbers):
even_count = 0
odd_count = 0
even_index = -1
odd_index = -1
for i, num in enumerate(numbers):
if num % 2 == 0:
even_count += 1
even_index = i
else:
odd_count += 1
odd_index = i
if even_count > 1 and odd_count == 1:
return odd_index + 1
elif odd_count > 1 and even_count == 1:
return even_index + 1
# Read input
n = int(input())
numbers = list(map(int, input().split()))
# Find the number that differs in evenness
result = find_odd_one_out(n, numbers)
# Print the result
print(result)
```
| 3.977
|
378
|
A
|
Playing with Dice
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
|
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
|
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
|
[
"2 5\n",
"2 4\n"
] |
[
"3 0 3\n",
"2 1 3\n"
] |
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|.
| 500
|
[
{
"input": "2 5",
"output": "3 0 3"
},
{
"input": "2 4",
"output": "2 1 3"
},
{
"input": "5 3",
"output": "2 1 3"
},
{
"input": "1 6",
"output": "3 0 3"
},
{
"input": "5 1",
"output": "3 1 2"
},
{
"input": "6 3",
"output": "2 0 4"
},
{
"input": "2 3",
"output": "2 0 4"
},
{
"input": "5 6",
"output": "5 0 1"
},
{
"input": "4 4",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
},
{
"input": "6 4",
"output": "1 1 4"
},
{
"input": "1 4",
"output": "2 0 4"
},
{
"input": "5 5",
"output": "0 6 0"
},
{
"input": "4 5",
"output": "4 0 2"
},
{
"input": "4 3",
"output": "3 0 3"
},
{
"input": "1 5",
"output": "2 1 3"
},
{
"input": "6 5",
"output": "1 0 5"
},
{
"input": "2 2",
"output": "0 6 0"
},
{
"input": "1 3",
"output": "1 1 4"
},
{
"input": "3 6",
"output": "4 0 2"
},
{
"input": "3 1",
"output": "4 1 1"
},
{
"input": "3 2",
"output": "4 0 2"
},
{
"input": "3 5",
"output": "3 1 2"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "6 2",
"output": "2 1 3"
},
{
"input": "4 1",
"output": "4 0 2"
},
{
"input": "5 2",
"output": "3 0 3"
},
{
"input": "4 2",
"output": "3 1 2"
},
{
"input": "2 1",
"output": "5 0 1"
},
{
"input": "6 1",
"output": "3 0 3"
},
{
"input": "4 6",
"output": "4 1 1"
},
{
"input": "2 6",
"output": "3 1 2"
},
{
"input": "3 4",
"output": "3 0 3"
},
{
"input": "1 2",
"output": "1 0 5"
},
{
"input": "6 6",
"output": "0 6 0"
},
{
"input": "5 4",
"output": "2 0 4"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
}
] | 1,680,781,751
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 38
| 62
| 0
|
s = input()
a,b = map(int,s.split())
ca = 0
cb = 0
cd = 0
for x in range(1,7):
an = abs(a-x)
bn = abs(b-x)
if(an<bn):
ca += 1
elif(an>bn):
cb += 1
else:
cd += 1
print(ca," ",cd," ",cb)
|
Title: Playing with Dice
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
Input Specification:
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
Output Specification:
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
Demo Input:
['2 5\n', '2 4\n']
Demo Output:
['3 0 3\n', '2 1 3\n']
Note:
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|.
|
```python
s = input()
a,b = map(int,s.split())
ca = 0
cb = 0
cd = 0
for x in range(1,7):
an = abs(a-x)
bn = abs(b-x)
if(an<bn):
ca += 1
elif(an>bn):
cb += 1
else:
cd += 1
print(ca," ",cd," ",cb)
```
| 3
|
|
789
|
B
|
Masha and geometric depression
|
PROGRAMMING
| 1,700
|
[
"brute force",
"implementation",
"math"
] | null | null |
Masha really loves algebra. On the last lesson, her strict teacher Dvastan gave she new exercise.
You are given geometric progression *b* defined by two integers *b*1 and *q*. Remind that a geometric progression is a sequence of integers *b*1,<=*b*2,<=*b*3,<=..., where for each *i*<=><=1 the respective term satisfies the condition *b**i*<==<=*b**i*<=-<=1·*q*, where *q* is called the common ratio of the progression. Progressions in Uzhlyandia are unusual: both *b*1 and *q* can equal 0. Also, Dvastan gave Masha *m* "bad" integers *a*1,<=*a*2,<=...,<=*a**m*, and an integer *l*.
Masha writes all progression terms one by one onto the board (including repetitive) while condition |*b**i*|<=≤<=*l* is satisfied (|*x*| means absolute value of *x*). There is an exception: if a term equals one of the "bad" integers, Masha skips it (doesn't write onto the board) and moves forward to the next term.
But the lesson is going to end soon, so Masha has to calculate how many integers will be written on the board. In order not to get into depression, Masha asked you for help: help her calculate how many numbers she will write, or print "inf" in case she needs to write infinitely many integers.
|
The first line of input contains four integers *b*1, *q*, *l*, *m* (-109<=≤<=*b*1,<=*q*<=≤<=109, 1<=≤<=*l*<=≤<=109, 1<=≤<=*m*<=≤<=105) — the initial term and the common ratio of progression, absolute value of maximal number that can be written on the board and the number of "bad" integers, respectively.
The second line contains *m* distinct integers *a*1,<=*a*2,<=...,<=*a**m* (-109<=≤<=*a**i*<=≤<=109) — numbers that will never be written on the board.
|
Print the only integer, meaning the number of progression terms that will be written on the board if it is finite, or "inf" (without quotes) otherwise.
|
[
"3 2 30 4\n6 14 25 48\n",
"123 1 2143435 4\n123 11 -5453 141245\n",
"123 1 2143435 4\n54343 -13 6 124\n"
] |
[
"3",
"0",
"inf"
] |
In the first sample case, Masha will write integers 3, 12, 24. Progression term 6 will be skipped because it is a "bad" integer. Terms bigger than 24 won't be written because they exceed *l* by absolute value.
In the second case, Masha won't write any number because all terms are equal 123 and this is a "bad" integer.
In the third case, Masha will write infinitely integers 123.
| 1,000
|
[
{
"input": "3 2 30 4\n6 14 25 48",
"output": "3"
},
{
"input": "123 1 2143435 4\n123 11 -5453 141245",
"output": "0"
},
{
"input": "123 1 2143435 4\n54343 -13 6 124",
"output": "inf"
},
{
"input": "3 2 25 2\n379195692 -69874783",
"output": "4"
},
{
"input": "3 2 30 3\n-691070108 -934106649 -220744807",
"output": "4"
},
{
"input": "3 3 104 17\n9 -73896485 -290898562 5254410 409659728 -916522518 -435516126 94354167 262981034 -375897180 -80186684 -173062070 -288705544 -699097793 -11447747 320434295 503414250",
"output": "3"
},
{
"input": "-1000000000 -1000000000 1 1\n232512888",
"output": "0"
},
{
"input": "11 0 228 5\n-1 0 1 5 -11245",
"output": "1"
},
{
"input": "11 0 228 5\n-1 -17 1 5 -11245",
"output": "inf"
},
{
"input": "0 0 2143435 5\n-1 -153 1 5 -11245",
"output": "inf"
},
{
"input": "123 0 2143435 4\n5433 0 123 -645",
"output": "0"
},
{
"input": "123 -1 2143435 5\n-123 0 12 5 -11245",
"output": "inf"
},
{
"input": "123 0 21 4\n543453 -123 6 1424",
"output": "0"
},
{
"input": "3 2 115 16\n24 48 12 96 3 720031148 -367712651 -838596957 558177735 -963046495 -313322487 -465018432 -618984128 -607173835 144854086 178041956",
"output": "1"
},
{
"input": "-3 0 92055 36\n-92974174 -486557474 -663622151 695596393 177960746 -563227474 -364263320 -676254242 -614140218 71456762 -764104225 705056581 -106398436 332755134 -199942822 -732751692 658942664 677739866 886535704 183687802 -784248291 -22550621 -938674499 637055091 -704750213 780395802 778342470 -999059668 -794361783 796469192 215667969 354336794 -60195289 -885080928 -290279020 201221317",
"output": "inf"
},
{
"input": "0 -3 2143435 5\n-1 0 1 5 -11245",
"output": "0"
},
{
"input": "123 -1 2143435 5\n-123 0 123 -5453 141245",
"output": "0"
},
{
"input": "123 0 2143435 4\n5433 0 -123 -645",
"output": "1"
},
{
"input": "11 0 2 5\n-1 0 1 5 -11245",
"output": "0"
},
{
"input": "2 2 4 1\n2",
"output": "1"
},
{
"input": "1 -2 1000000000 1\n0",
"output": "30"
},
{
"input": "0 8 10 1\n5",
"output": "inf"
},
{
"input": "-1000 0 10 1\n5",
"output": "0"
},
{
"input": "0 2 2143435 4\n54343 -13 6 124",
"output": "inf"
},
{
"input": "0 8 5 1\n9",
"output": "inf"
},
{
"input": "-10 1 5 1\n100",
"output": "0"
},
{
"input": "123 -1 2143435 4\n54343 -13 6 123",
"output": "inf"
},
{
"input": "-5 -1 10 1\n-5",
"output": "inf"
},
{
"input": "2 0 1 1\n2",
"output": "0"
},
{
"input": "0 5 8 1\n10",
"output": "inf"
},
{
"input": "0 5 100 2\n34 56",
"output": "inf"
},
{
"input": "15 -1 15 4\n15 -15 1 2",
"output": "0"
},
{
"input": "10 -1 2 1\n1",
"output": "0"
},
{
"input": "2 0 2 1\n2",
"output": "inf"
},
{
"input": "4 0 4 1\n0",
"output": "1"
},
{
"input": "10 10 10 1\n123",
"output": "1"
},
{
"input": "2 2 4 1\n3",
"output": "2"
},
{
"input": "0 1 1 1\n0",
"output": "0"
},
{
"input": "3 2 30 1\n3",
"output": "3"
},
{
"input": "1000000000 100000 1000000000 4\n5433 13 6 0",
"output": "1"
},
{
"input": "-2 0 1 1\n1",
"output": "0"
},
{
"input": "2 -1 10 1\n2",
"output": "inf"
},
{
"input": "1 -1 2 1\n1",
"output": "inf"
},
{
"input": "0 10 10 1\n2",
"output": "inf"
},
{
"input": "0 35 2 1\n3",
"output": "inf"
},
{
"input": "3 1 3 1\n5",
"output": "inf"
},
{
"input": "3 2 3 4\n6 14 25 48",
"output": "1"
},
{
"input": "0 69 12 1\n1",
"output": "inf"
},
{
"input": "100 0 100000 1\n100",
"output": "inf"
},
{
"input": "0 4 1000 3\n5 6 7",
"output": "inf"
},
{
"input": "0 2 100 1\n5",
"output": "inf"
},
{
"input": "3 2 24 4\n6 14 25 48",
"output": "3"
},
{
"input": "0 4 1 1\n2",
"output": "inf"
},
{
"input": "1 5 10000 1\n125",
"output": "5"
},
{
"input": "2 -1 1 1\n1",
"output": "0"
},
{
"input": "0 3 100 1\n5",
"output": "inf"
},
{
"input": "0 3 3 1\n1",
"output": "inf"
},
{
"input": "0 2 5 1\n1",
"output": "inf"
},
{
"input": "5 -1 100 1\n5",
"output": "inf"
},
{
"input": "-20 0 10 1\n0",
"output": "0"
},
{
"input": "3 0 1 1\n3",
"output": "0"
},
{
"input": "2 -1 3 1\n2",
"output": "inf"
},
{
"input": "1 1 1000000000 1\n100",
"output": "inf"
},
{
"input": "5 -1 3 1\n0",
"output": "0"
},
{
"input": "0 5 10 1\n2",
"output": "inf"
},
{
"input": "123 0 125 1\n123",
"output": "inf"
},
{
"input": "2 -1 100 1\n2",
"output": "inf"
},
{
"input": "5 2 100 1\n5",
"output": "4"
},
{
"input": "-5 0 1 1\n1",
"output": "0"
},
{
"input": "-3 0 1 1\n-3",
"output": "0"
},
{
"input": "2 -2 10 1\n1",
"output": "3"
},
{
"input": "0 2 30 4\n6 14 25 48",
"output": "inf"
},
{
"input": "1 -1 1 1\n1",
"output": "inf"
},
{
"input": "2 -1 6 1\n2",
"output": "inf"
},
{
"input": "-3 1 100 1\n-3",
"output": "0"
},
{
"input": "1 0 2 1\n1",
"output": "inf"
},
{
"input": "1000000000 999999998 1000000000 1\n0",
"output": "1"
},
{
"input": "1 0 2143435 4\n1 -123 -5453 141245",
"output": "inf"
},
{
"input": "-1000 0 100 1\n-1000",
"output": "0"
},
{
"input": "100 10 2 1\n100",
"output": "0"
},
{
"input": "-3 1 100 1\n3",
"output": "inf"
},
{
"input": "123 -1 10000 1\n123",
"output": "inf"
},
{
"input": "1 -1 2143435 4\n1 -123 -5453 141245",
"output": "inf"
},
{
"input": "5 1 5 5\n1 2 3 4 0",
"output": "inf"
},
{
"input": "-100 -1 1 1\n1",
"output": "0"
},
{
"input": "10 -1 3 2\n10 8",
"output": "0"
},
{
"input": "-10 0 5 1\n0",
"output": "0"
},
{
"input": "3 0 3 1\n0",
"output": "1"
},
{
"input": "2 0 2 1\n-1",
"output": "inf"
},
{
"input": "5 0 20 1\n5",
"output": "inf"
},
{
"input": "-4 1 1 1\n0",
"output": "0"
},
{
"input": "11 0 1111 1\n11",
"output": "inf"
},
{
"input": "2 0 3 1\n2",
"output": "inf"
},
{
"input": "-1 -1 2143435 4\n-1 -123 -5453 141245",
"output": "inf"
},
{
"input": "-100 0 50 1\n0",
"output": "0"
},
{
"input": "5 1 2 1\n2",
"output": "0"
},
{
"input": "3 0 3 1\n4",
"output": "inf"
},
{
"input": "0 23 3 1\n3",
"output": "inf"
},
{
"input": "-1000 0 100 1\n2",
"output": "0"
},
{
"input": "1 -1 10 1\n1",
"output": "inf"
}
] | 1,492,004,316
| 1,416
|
Python 3
|
OK
|
TESTS
| 116
| 93
| 15,667,200
|
def main():
b1, q, l, m = map(int, input().split())
a = set(map(int, input().split()))
if b1 == 0:
if 0 in a:
return 0
else:
return 'inf'
if q == 0:
if abs(b1) > l:
return 0
if b1 in a:
if 0 in a:
return 0
else:
return 'inf'
else:
if 0 in a:
return 1
else:
return 'inf'
if q == 1:
if abs(b1) > l or b1 in a:
return 0
else:
return 'inf'
if q == -1:
if abs(b1) > l or b1 in a and -b1 in a:
return 0
else:
return 'inf'
result = 0
b = b1
while True:
if abs(b) > l:
break
if b not in a:
result += 1
b *= q
return result
if __name__ == '__main__':
# import sys
# sys.stdin = open("B.txt")
print(main())
|
Title: Masha and geometric depression
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Masha really loves algebra. On the last lesson, her strict teacher Dvastan gave she new exercise.
You are given geometric progression *b* defined by two integers *b*1 and *q*. Remind that a geometric progression is a sequence of integers *b*1,<=*b*2,<=*b*3,<=..., where for each *i*<=><=1 the respective term satisfies the condition *b**i*<==<=*b**i*<=-<=1·*q*, where *q* is called the common ratio of the progression. Progressions in Uzhlyandia are unusual: both *b*1 and *q* can equal 0. Also, Dvastan gave Masha *m* "bad" integers *a*1,<=*a*2,<=...,<=*a**m*, and an integer *l*.
Masha writes all progression terms one by one onto the board (including repetitive) while condition |*b**i*|<=≤<=*l* is satisfied (|*x*| means absolute value of *x*). There is an exception: if a term equals one of the "bad" integers, Masha skips it (doesn't write onto the board) and moves forward to the next term.
But the lesson is going to end soon, so Masha has to calculate how many integers will be written on the board. In order not to get into depression, Masha asked you for help: help her calculate how many numbers she will write, or print "inf" in case she needs to write infinitely many integers.
Input Specification:
The first line of input contains four integers *b*1, *q*, *l*, *m* (-109<=≤<=*b*1,<=*q*<=≤<=109, 1<=≤<=*l*<=≤<=109, 1<=≤<=*m*<=≤<=105) — the initial term and the common ratio of progression, absolute value of maximal number that can be written on the board and the number of "bad" integers, respectively.
The second line contains *m* distinct integers *a*1,<=*a*2,<=...,<=*a**m* (-109<=≤<=*a**i*<=≤<=109) — numbers that will never be written on the board.
Output Specification:
Print the only integer, meaning the number of progression terms that will be written on the board if it is finite, or "inf" (without quotes) otherwise.
Demo Input:
['3 2 30 4\n6 14 25 48\n', '123 1 2143435 4\n123 11 -5453 141245\n', '123 1 2143435 4\n54343 -13 6 124\n']
Demo Output:
['3', '0', 'inf']
Note:
In the first sample case, Masha will write integers 3, 12, 24. Progression term 6 will be skipped because it is a "bad" integer. Terms bigger than 24 won't be written because they exceed *l* by absolute value.
In the second case, Masha won't write any number because all terms are equal 123 and this is a "bad" integer.
In the third case, Masha will write infinitely integers 123.
|
```python
def main():
b1, q, l, m = map(int, input().split())
a = set(map(int, input().split()))
if b1 == 0:
if 0 in a:
return 0
else:
return 'inf'
if q == 0:
if abs(b1) > l:
return 0
if b1 in a:
if 0 in a:
return 0
else:
return 'inf'
else:
if 0 in a:
return 1
else:
return 'inf'
if q == 1:
if abs(b1) > l or b1 in a:
return 0
else:
return 'inf'
if q == -1:
if abs(b1) > l or b1 in a and -b1 in a:
return 0
else:
return 'inf'
result = 0
b = b1
while True:
if abs(b) > l:
break
if b not in a:
result += 1
b *= q
return result
if __name__ == '__main__':
# import sys
# sys.stdin = open("B.txt")
print(main())
```
| 3
|
|
656
|
A
|
Da Vinci Powers
|
PROGRAMMING
| 1,900
|
[
"*special"
] | null | null |
The input contains a single integer *a* (0<=≤<=*a*<=≤<=35).
Output a single integer.
|
The input contains a single integer *a* (0<=≤<=*a*<=≤<=35).
|
Output a single integer.
|
[
"3\n",
"10\n"
] |
[
"8\n",
"1024\n"
] |
none
| 0
|
[
{
"input": "3",
"output": "8"
},
{
"input": "10",
"output": "1024"
},
{
"input": "35",
"output": "33940307968"
},
{
"input": "0",
"output": "1"
},
{
"input": "1",
"output": "2"
},
{
"input": "2",
"output": "4"
},
{
"input": "4",
"output": "16"
},
{
"input": "5",
"output": "32"
},
{
"input": "6",
"output": "64"
},
{
"input": "7",
"output": "128"
},
{
"input": "8",
"output": "256"
},
{
"input": "9",
"output": "512"
},
{
"input": "11",
"output": "2048"
},
{
"input": "12",
"output": "4096"
},
{
"input": "13",
"output": "8092"
},
{
"input": "14",
"output": "16184"
},
{
"input": "15",
"output": "32368"
},
{
"input": "16",
"output": "64736"
},
{
"input": "17",
"output": "129472"
},
{
"input": "18",
"output": "258944"
},
{
"input": "19",
"output": "517888"
},
{
"input": "20",
"output": "1035776"
},
{
"input": "21",
"output": "2071552"
},
{
"input": "22",
"output": "4143104"
},
{
"input": "23",
"output": "8286208"
},
{
"input": "24",
"output": "16572416"
},
{
"input": "25",
"output": "33144832"
},
{
"input": "26",
"output": "66289664"
},
{
"input": "27",
"output": "132579328"
},
{
"input": "28",
"output": "265158656"
},
{
"input": "29",
"output": "530317312"
},
{
"input": "30",
"output": "1060634624"
},
{
"input": "31",
"output": "2121269248"
},
{
"input": "32",
"output": "4242538496"
},
{
"input": "33",
"output": "8485076992"
},
{
"input": "34",
"output": "16970153984"
}
] | 1,550,087,500
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 93
| 0
|
n = int(input())
ans = 2**n
print(ans)
|
Title: Da Vinci Powers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The input contains a single integer *a* (0<=≤<=*a*<=≤<=35).
Output a single integer.
Input Specification:
The input contains a single integer *a* (0<=≤<=*a*<=≤<=35).
Output Specification:
Output a single integer.
Demo Input:
['3\n', '10\n']
Demo Output:
['8\n', '1024\n']
Note:
none
|
```python
n = int(input())
ans = 2**n
print(ans)
```
| 0
|
|
41
|
A
|
Translation
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Translation
|
2
|
256
|
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
|
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
|
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
|
[
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,595,650,140
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 40
| 280
| 20,172,800
|
import sys
def input(): return sys.stdin.readline().strip()
def iinput(): return int(input())
def rinput(): return map(int, sys.stdin.readline().strip().split())
def get_list(): return list(map(int, sys.stdin.readline().strip().split()))
n=input()
m=input()
l=list(n)
s=[]
for i in range(len(n)-1,-1,-1):
s.append(n[i])
k="".join(s)
if(m==k):
print("YES")
else:
print("NO")
|
Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
import sys
def input(): return sys.stdin.readline().strip()
def iinput(): return int(input())
def rinput(): return map(int, sys.stdin.readline().strip().split())
def get_list(): return list(map(int, sys.stdin.readline().strip().split()))
n=input()
m=input()
l=list(n)
s=[]
for i in range(len(n)-1,-1,-1):
s.append(n[i])
k="".join(s)
if(m==k):
print("YES")
else:
print("NO")
```
| 3.892425
|
992
|
D
|
Nastya and a Game
|
PROGRAMMING
| 2,100
|
[
"brute force",
"implementation",
"math"
] | null | null |
Nastya received one more array on her birthday, this array can be used to play a traditional Byteland game on it. However, to play the game the players should first select such a subsegment of the array that , where *p* is the product of all integers on the given array, *s* is their sum, and *k* is a given constant for all subsegments.
Nastya wonders how many subsegments of the array fit the described conditions. A subsegment of an array is several consecutive integers of the array.
|
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=2·105, 1<=≤<=*k*<=≤<=105), where *n* is the length of the array and *k* is the constant described above.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=108) — the elements of the array.
|
In the only line print the number of subsegments such that the ratio between the product and the sum on them is equal to *k*.
|
[
"1 1\n1\n",
"4 2\n6 3 8 1\n"
] |
[
"1\n",
"2\n"
] |
In the first example the only subsegment is [1]. The sum equals 1, the product equals 1, so it suits us because <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/627b2899a459d42fe3b2ca04fc812d4132b5f2ca.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
There are two suitable subsegments in the second example — [6, 3] and [3, 8, 1]. Subsegment [6, 3] has sum 9 and product 18, so it suits us because <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/107ecd38fde9817d6565e2059ccd064562470543.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Subsegment [3, 8, 1] has sum 12 and product 24, so it suits us because <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/8abc1793efa3061313ddd52d670a94b430133564.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
| 2,000
|
[
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "4 2\n6 3 8 1",
"output": "2"
},
{
"input": "94 58\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 29 58 1 1 1 29 58 58 1 1 29 1 1 1 1 2 1 58 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 29 1 1 1 1 1 58 1 29 1 1 1 1 1 1 1 1 1 1 1 1 58 1 1 1 1 1 2 1 1 1",
"output": "5"
},
{
"input": "6 76\n1 38 1 1 1 1",
"output": "0"
},
{
"input": "16 53\n53 1 1 1 1 1 53 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "13 16\n2 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "90 45\n15 1 1 1 1 3 1 1 5 3 5 1 1 15 15 3 1 15 1 1 1 15 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 15 1 1 1 1 1 1 1 1 1 15 1 1 1 1 5 1 1 1 1 15 1 1 1 15 1 1 1 1 1 1 1 1 3 1 1 15 3 1 1 1 15 15 1 1 1 1 15",
"output": "5"
},
{
"input": "9 209\n2 7 31 673 853 1669 5821 7621 16677",
"output": "0"
},
{
"input": "8 27\n8 3 9 8 3 10 7 1",
"output": "0"
},
{
"input": "50 5\n1 5 11 10 3 6 9 3 9 6 1 1 4 7 8 6 11 2 6 10 4 1 8 11 5 6 5 6 7 2 2 3 1 10 8 8 2 10 7 3 8 10 11 7 3 2 10 11 7 4",
"output": "0"
},
{
"input": "16 1\n2 6 1 11 5 9 5 9 7 5 8 5 3 2 7 2",
"output": "16"
},
{
"input": "13 38\n1 10 4 1 5 5 4 4 8 4 11 1 9",
"output": "0"
},
{
"input": "5 15\n10 9 5 2 2",
"output": "0"
},
{
"input": "10 2\n1 1 1 1 10 3 1 1 1 1",
"output": "3"
}
] | 1,636,908,620
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 109
| 2,150,400
|
def process(A, k):
n = len(A)
S = [0]
P = [1]
p_index = 0
last_one = 0
answer = 0
for i in range(n):
S.append(S[-1]+A[i])
#sum of this subsegment is between A[i] and S[-1]
#desired product is between k*A[i] and k*S[-1]
while P[-1]*A[i] > k*S[-1]:
last_one = p_index
P[-1] = P[-1]//P[p_index]
P[p_index] = 1
p_index+=1
P.append(P[-1]*A[i])
if P[-1] % k==0:
for j in range(last_one, len(P)):
if (P[-1]//P[j]) % k==0:
target_sum = P[-1]//(k*P[j])
if S[-1]-S[j]==target_sum:
answer+=1
return answer
n, k = [int(x) for x in input().split()]
A = [int(x) for x in input().split()]
print(process(A))
|
Title: Nastya and a Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nastya received one more array on her birthday, this array can be used to play a traditional Byteland game on it. However, to play the game the players should first select such a subsegment of the array that , where *p* is the product of all integers on the given array, *s* is their sum, and *k* is a given constant for all subsegments.
Nastya wonders how many subsegments of the array fit the described conditions. A subsegment of an array is several consecutive integers of the array.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=2·105, 1<=≤<=*k*<=≤<=105), where *n* is the length of the array and *k* is the constant described above.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=108) — the elements of the array.
Output Specification:
In the only line print the number of subsegments such that the ratio between the product and the sum on them is equal to *k*.
Demo Input:
['1 1\n1\n', '4 2\n6 3 8 1\n']
Demo Output:
['1\n', '2\n']
Note:
In the first example the only subsegment is [1]. The sum equals 1, the product equals 1, so it suits us because <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/627b2899a459d42fe3b2ca04fc812d4132b5f2ca.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
There are two suitable subsegments in the second example — [6, 3] and [3, 8, 1]. Subsegment [6, 3] has sum 9 and product 18, so it suits us because <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/107ecd38fde9817d6565e2059ccd064562470543.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Subsegment [3, 8, 1] has sum 12 and product 24, so it suits us because <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/8abc1793efa3061313ddd52d670a94b430133564.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
|
```python
def process(A, k):
n = len(A)
S = [0]
P = [1]
p_index = 0
last_one = 0
answer = 0
for i in range(n):
S.append(S[-1]+A[i])
#sum of this subsegment is between A[i] and S[-1]
#desired product is between k*A[i] and k*S[-1]
while P[-1]*A[i] > k*S[-1]:
last_one = p_index
P[-1] = P[-1]//P[p_index]
P[p_index] = 1
p_index+=1
P.append(P[-1]*A[i])
if P[-1] % k==0:
for j in range(last_one, len(P)):
if (P[-1]//P[j]) % k==0:
target_sum = P[-1]//(k*P[j])
if S[-1]-S[j]==target_sum:
answer+=1
return answer
n, k = [int(x) for x in input().split()]
A = [int(x) for x in input().split()]
print(process(A))
```
| -1
|
|
1,003
|
A
|
Polycarp's Pockets
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket.
For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$.
Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that.
|
The first line of the input contains one integer $n$ ($1 \le n \le 100$) — the number of coins.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) — values of coins.
|
Print only one integer — the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket.
|
[
"6\n1 2 4 3 3 2\n",
"1\n100\n"
] |
[
"2\n",
"1\n"
] |
none
| 0
|
[
{
"input": "6\n1 2 4 3 3 2",
"output": "2"
},
{
"input": "1\n100",
"output": "1"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "100\n59 47 39 47 47 71 47 28 58 47 35 79 58 47 38 47 47 47 47 27 47 43 29 95 47 49 46 71 47 74 79 47 47 32 45 67 47 47 30 37 47 47 16 67 22 76 47 86 84 10 5 47 47 47 47 47 1 51 47 54 47 8 47 47 9 47 47 47 47 28 47 47 26 47 47 47 47 47 47 92 47 47 77 47 47 24 45 47 10 47 47 89 47 27 47 89 47 67 24 71",
"output": "51"
},
{
"input": "100\n45 99 10 27 16 85 39 38 17 32 15 23 67 48 50 97 42 70 62 30 44 81 64 73 34 22 46 5 83 52 58 60 33 74 47 88 18 61 78 53 25 95 94 31 3 75 1 57 20 54 59 9 68 7 77 43 21 87 86 24 4 80 11 49 2 72 36 84 71 8 65 55 79 100 41 14 35 89 66 69 93 37 56 82 90 91 51 19 26 92 6 96 13 98 12 28 76 40 63 29",
"output": "1"
},
{
"input": "100\n45 29 5 2 6 50 22 36 14 15 9 48 46 20 8 37 7 47 12 50 21 38 18 27 33 19 40 10 5 49 38 42 34 37 27 30 35 24 10 3 40 49 41 3 4 44 13 25 28 31 46 36 23 1 1 23 7 22 35 26 21 16 48 42 32 8 11 16 34 11 39 32 47 28 43 41 39 4 14 19 26 45 13 18 15 25 2 44 17 29 17 33 43 6 12 30 9 20 31 24",
"output": "2"
},
{
"input": "50\n7 7 3 3 7 4 5 6 4 3 7 5 6 4 5 4 4 5 6 7 7 7 4 5 5 5 3 7 6 3 4 6 3 6 4 4 5 4 6 6 3 5 6 3 5 3 3 7 7 6",
"output": "10"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "99"
},
{
"input": "7\n1 2 3 3 3 1 2",
"output": "3"
},
{
"input": "5\n1 2 3 4 5",
"output": "1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "1"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "1"
},
{
"input": "9\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "1"
},
{
"input": "3\n2 1 1",
"output": "2"
},
{
"input": "11\n1 2 3 4 5 6 7 8 9 1 1",
"output": "3"
},
{
"input": "12\n1 2 1 1 1 1 1 1 1 1 1 1",
"output": "11"
},
{
"input": "13\n1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "13"
},
{
"input": "14\n1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "14"
},
{
"input": "15\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "15"
},
{
"input": "16\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "16"
},
{
"input": "3\n1 1 1",
"output": "3"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "10\n1 1 1 1 2 2 1 1 9 10",
"output": "6"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "56\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "56"
},
{
"input": "99\n35 96 73 72 70 83 22 93 98 75 45 32 81 82 45 54 25 7 53 72 29 2 94 19 21 98 34 28 39 99 55 85 44 23 6 47 98 2 33 34 19 57 49 35 67 4 60 4 4 23 55 6 57 66 16 68 34 45 84 79 48 63 4 9 46 88 98 13 19 27 83 12 4 63 57 22 44 77 44 62 28 52 44 64 9 24 55 22 48 4 2 9 80 76 45 1 56 22 92",
"output": "6"
},
{
"input": "10\n1 2 2 3 3 3 4 4 4 4",
"output": "4"
},
{
"input": "99\n97 44 33 56 42 10 61 85 64 26 40 39 82 34 75 9 51 51 39 73 58 38 74 31 13 99 58 1 28 89 76 19 52 7 40 56 12 27 72 72 67 75 62 46 22 55 35 16 18 39 60 63 92 42 85 69 34 61 73 50 57 95 30 4 45 63 76 58 32 35 48 81 10 78 95 79 55 97 21 21 22 94 30 17 78 57 89 93 100 44 16 89 68 55 19 46 42 73 21",
"output": "3"
},
{
"input": "5\n5 5 5 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 5 2 6",
"output": "3"
},
{
"input": "3\n58 59 58",
"output": "2"
},
{
"input": "9\n1 2 3 4 5 6 7 8 8",
"output": "2"
},
{
"input": "97\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "97"
},
{
"input": "3\n95 95 4",
"output": "2"
},
{
"input": "3\n2 2 5",
"output": "2"
}
] | 1,599,927,183
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 37
| 156
| 0
|
n = input()
arr = list(map(int,input().split()))
new_arr = list(set(arr))
maxx = 0
for i in new_arr:
ans = arr.count(i)
if ans>=maxx:
maxx = ans
print(maxx)
|
Title: Polycarp's Pockets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket.
For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$.
Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that.
Input Specification:
The first line of the input contains one integer $n$ ($1 \le n \le 100$) — the number of coins.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) — values of coins.
Output Specification:
Print only one integer — the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket.
Demo Input:
['6\n1 2 4 3 3 2\n', '1\n100\n']
Demo Output:
['2\n', '1\n']
Note:
none
|
```python
n = input()
arr = list(map(int,input().split()))
new_arr = list(set(arr))
maxx = 0
for i in new_arr:
ans = arr.count(i)
if ans>=maxx:
maxx = ans
print(maxx)
```
| 3
|
|
177
|
A1
|
Good Matrix Elements
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
The Smart Beaver from ABBYY got hooked on square matrices. Now he is busy studying an *n*<=×<=*n* size matrix, where *n* is odd. The Smart Beaver considers the following matrix elements good:
- Elements of the main diagonal. - Elements of the secondary diagonal. - Elements of the "middle" row — the row which has exactly rows above it and the same number of rows below it. - Elements of the "middle" column — the column that has exactly columns to the left of it and the same number of columns to the right of it.
Help the Smart Beaver count the sum of good elements of the given matrix.
|
The first line of input data contains a single odd integer *n*. Each of the next *n* lines contains *n* integers *a**ij* (0<=≤<=*a**ij*<=≤<=100) separated by single spaces — the elements of the given matrix.
The input limitations for getting 30 points are:
- 1<=≤<=*n*<=≤<=5
The input limitations for getting 100 points are:
- 1<=≤<=*n*<=≤<=101
|
Print a single integer — the sum of good matrix elements.
|
[
"3\n1 2 3\n4 5 6\n7 8 9\n",
"5\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n"
] |
[
"45\n",
"17\n"
] |
In the first sample all matrix elements will be good. Good elements in the second sample are shown on the figure.
| 30
|
[
{
"input": "3\n1 2 3\n4 5 6\n7 8 9",
"output": "45"
},
{
"input": "5\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1",
"output": "17"
},
{
"input": "1\n3",
"output": "3"
},
{
"input": "5\n27 7 3 11 72\n19 49 68 19 59\n41 25 37 64 65\n8 39 96 62 90\n13 37 43 26 33",
"output": "756"
},
{
"input": "3\n19 7 16\n12 15 5\n15 15 5",
"output": "109"
},
{
"input": "3\n36 4 33\n11 46 32\n20 49 34",
"output": "265"
},
{
"input": "3\n79 91 74\n33 82 22\n18 28 54",
"output": "481"
},
{
"input": "5\n7 0 8 1 7\n5 1 1 0 4\n4 2 8 1 6\n1 2 3 2 7\n6 0 1 9 6",
"output": "65"
},
{
"input": "5\n27 20 28 11 17\n25 21 1 20 14\n14 22 28 1 6\n1 2 23 2 7\n6 0 1 29 6",
"output": "225"
},
{
"input": "5\n57 50 58 41 17\n25 21 1 50 44\n44 22 28 31 36\n31 32 23 32 37\n6 0 31 59 6",
"output": "495"
},
{
"input": "5\n57 80 28 41 47\n85 51 61 50 74\n44 82 28 31 36\n31 32 23 32 37\n66 60 31 59 6",
"output": "705"
},
{
"input": "5\n13 58 10 17 43\n61 73 100 0 9\n52 38 16 22 96\n11 4 14 67 62\n70 89 7 98 83",
"output": "708"
},
{
"input": "5\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "0"
},
{
"input": "5\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0",
"output": "0"
},
{
"input": "5\n0 1 0 1 0\n0 0 0 0 1\n0 0 5 0 0\n0 0 0 0 1\n0 0 0 0 0",
"output": "5"
},
{
"input": "5\n0 0 0 0 1\n0 1 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 1 0 0 0",
"output": "3"
},
{
"input": "3\n0 0 0\n0 0 0\n0 0 0",
"output": "0"
}
] | 1,587,566,760
| 2,147,483,647
|
Python 3
|
OK
|
TESTS1
| 17
| 186
| 307,200
|
# matrix dimensions
n = int(input())
matrix = []
for mr in range(0, n):
matrix.append(list(map(int, input().split())))
# get middle row (no need for + 1 since index starts with 0)
# good matrix points
gmp = sum(matrix[(n//2)])
matrix[n//2] = [0] * n
# get middle column
gmp += sum([row[n//2] for row in matrix])
for x in range(0, n):
matrix[x][n//2] = 0
# get main and secondary diagonal
# since all elements already counted for middle row
# and middle column are already 0
# there's no need to worry about [n/2][n/2] now
for y in range(0, n):
gmp += matrix[y][y] + matrix[-1 - y][y]
print(gmp)
# middle row: 15
# middle column: 25
|
Title: Good Matrix Elements
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Smart Beaver from ABBYY got hooked on square matrices. Now he is busy studying an *n*<=×<=*n* size matrix, where *n* is odd. The Smart Beaver considers the following matrix elements good:
- Elements of the main diagonal. - Elements of the secondary diagonal. - Elements of the "middle" row — the row which has exactly rows above it and the same number of rows below it. - Elements of the "middle" column — the column that has exactly columns to the left of it and the same number of columns to the right of it.
Help the Smart Beaver count the sum of good elements of the given matrix.
Input Specification:
The first line of input data contains a single odd integer *n*. Each of the next *n* lines contains *n* integers *a**ij* (0<=≤<=*a**ij*<=≤<=100) separated by single spaces — the elements of the given matrix.
The input limitations for getting 30 points are:
- 1<=≤<=*n*<=≤<=5
The input limitations for getting 100 points are:
- 1<=≤<=*n*<=≤<=101
Output Specification:
Print a single integer — the sum of good matrix elements.
Demo Input:
['3\n1 2 3\n4 5 6\n7 8 9\n', '5\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n']
Demo Output:
['45\n', '17\n']
Note:
In the first sample all matrix elements will be good. Good elements in the second sample are shown on the figure.
|
```python
# matrix dimensions
n = int(input())
matrix = []
for mr in range(0, n):
matrix.append(list(map(int, input().split())))
# get middle row (no need for + 1 since index starts with 0)
# good matrix points
gmp = sum(matrix[(n//2)])
matrix[n//2] = [0] * n
# get middle column
gmp += sum([row[n//2] for row in matrix])
for x in range(0, n):
matrix[x][n//2] = 0
# get main and secondary diagonal
# since all elements already counted for middle row
# and middle column are already 0
# there's no need to worry about [n/2][n/2] now
for y in range(0, n):
gmp += matrix[y][y] + matrix[-1 - y][y]
print(gmp)
# middle row: 15
# middle column: 25
```
| 3
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,593,326,793
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 108
| 6,656,000
|
msg="hello"
s=input()
i=0
for c in s:
if i==len(msg):
print("YES")
break
if c==msg[i]:
i+=1
else:
print("NO")
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
msg="hello"
s=input()
i=0
for c in s:
if i==len(msg):
print("YES")
break
if c==msg[i]:
i+=1
else:
print("NO")
```
| 0
|
272
|
A
|
Dima and Friends
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
|
In a single line print the answer to the problem.
|
[
"1\n1\n",
"1\n2\n",
"2\n3 5\n"
] |
[
"3\n",
"2\n",
"3\n"
] |
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
| 500
|
[
{
"input": "1\n1",
"output": "3"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "1\n5",
"output": "3"
},
{
"input": "5\n4 4 3 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 2 1 3",
"output": "4"
},
{
"input": "8\n2 2 5 3 4 3 3 2",
"output": "4"
},
{
"input": "7\n4 1 3 2 2 4 5",
"output": "4"
},
{
"input": "3\n3 5 1",
"output": "4"
},
{
"input": "95\n4 2 3 4 4 5 2 2 4 4 3 5 3 3 3 5 4 2 5 4 2 1 1 3 4 2 1 3 5 4 2 1 1 5 1 1 2 2 4 4 5 4 5 5 2 1 2 2 2 4 5 5 2 4 3 4 4 3 5 2 4 1 5 4 5 1 3 2 4 2 2 1 5 3 1 5 3 4 3 3 2 1 2 2 1 3 1 5 2 3 1 1 2 5 2",
"output": "5"
},
{
"input": "31\n3 2 3 3 3 3 4 4 1 5 5 4 2 4 3 2 2 1 4 4 1 2 3 1 1 5 5 3 4 4 1",
"output": "4"
},
{
"input": "42\n3 1 2 2 5 1 2 2 4 5 4 5 2 5 4 5 4 4 1 4 3 3 4 4 4 4 3 2 1 3 4 5 5 2 1 2 1 5 5 2 4 4",
"output": "5"
},
{
"input": "25\n4 5 5 5 3 1 1 4 4 4 3 5 4 4 1 4 4 1 2 4 2 5 4 5 3",
"output": "5"
},
{
"input": "73\n3 4 3 4 5 1 3 4 2 1 4 2 2 3 5 3 1 4 2 3 2 1 4 5 3 5 2 2 4 3 2 2 5 3 2 3 5 1 3 1 1 4 5 2 4 2 5 1 4 3 1 3 1 4 2 3 3 3 3 5 5 2 5 2 5 4 3 1 1 5 5 2 3",
"output": "4"
},
{
"input": "46\n1 4 4 5 4 5 2 3 5 5 3 2 5 4 1 3 2 2 1 4 3 1 5 5 2 2 2 2 4 4 1 1 4 3 4 3 1 4 2 2 4 2 3 2 5 2",
"output": "4"
},
{
"input": "23\n5 2 1 1 4 2 5 5 3 5 4 5 5 1 1 5 2 4 5 3 4 4 3",
"output": "5"
},
{
"input": "6\n4 2 3 1 3 5",
"output": "4"
},
{
"input": "15\n5 5 5 3 5 4 1 3 3 4 3 4 1 4 4",
"output": "5"
},
{
"input": "93\n1 3 1 4 3 3 5 3 1 4 5 4 3 2 2 4 3 1 4 1 2 3 3 3 2 5 1 3 1 4 5 1 1 1 4 2 1 2 3 1 1 1 5 1 5 5 1 2 5 4 3 2 2 4 4 2 5 4 5 5 3 1 3 1 2 1 3 1 1 2 3 4 4 5 5 3 2 1 3 3 5 1 3 5 4 4 1 3 3 4 2 3 2",
"output": "5"
},
{
"input": "96\n1 5 1 3 2 1 2 2 2 2 3 4 1 1 5 4 4 1 2 3 5 1 4 4 4 1 3 3 1 4 5 4 1 3 5 3 4 4 3 2 1 1 4 4 5 1 1 2 5 1 2 3 1 4 1 2 2 2 3 2 3 3 2 5 2 2 3 3 3 3 2 1 2 4 5 5 1 5 3 2 1 4 3 5 5 5 3 3 5 3 4 3 4 2 1 3",
"output": "5"
},
{
"input": "49\n1 4 4 3 5 2 2 1 5 1 2 1 2 5 1 4 1 4 5 2 4 5 3 5 2 4 2 1 3 4 2 1 4 2 1 1 3 3 2 3 5 4 3 4 2 4 1 4 1",
"output": "5"
},
{
"input": "73\n4 1 3 3 3 1 5 2 1 4 1 1 3 5 1 1 4 5 2 1 5 4 1 5 3 1 5 2 4 5 1 4 3 3 5 2 2 3 3 2 5 1 4 5 2 3 1 4 4 3 5 2 3 5 1 4 3 5 1 2 4 1 3 3 5 4 2 4 2 4 1 2 5",
"output": "5"
},
{
"input": "41\n5 3 5 4 2 5 4 3 1 1 1 5 4 3 4 3 5 4 2 5 4 1 1 3 2 4 5 3 5 1 5 5 1 1 1 4 4 1 2 4 3",
"output": "5"
},
{
"input": "100\n3 3 1 4 2 4 4 3 1 5 1 1 4 4 3 4 4 3 5 4 5 2 4 3 4 1 2 4 5 4 2 1 5 4 1 1 4 3 2 4 1 2 1 4 4 5 5 4 4 5 3 2 5 1 4 2 2 1 1 2 5 2 5 1 5 3 1 4 3 2 4 3 2 2 4 5 5 1 2 3 1 4 1 2 2 2 5 5 2 3 2 4 3 1 1 2 1 2 1 2",
"output": "5"
},
{
"input": "100\n2 1 1 3 5 4 4 2 3 4 3 4 5 4 5 4 2 4 5 3 4 5 4 1 1 4 4 1 1 2 5 4 2 4 5 3 2 5 4 3 4 5 1 3 4 2 5 4 5 4 5 2 4 1 2 5 3 1 4 4 5 3 4 3 1 2 5 4 2 5 4 1 5 3 5 4 1 2 5 3 1 1 1 1 5 3 4 3 5 1 1 5 5 1 1 2 2 1 5 1",
"output": "5"
},
{
"input": "100\n4 4 3 3 2 5 4 4 2 1 4 4 4 5 4 1 2 1 5 2 4 3 4 1 4 1 2 5 1 4 5 4 2 1 2 5 3 4 5 5 2 1 2 2 2 2 2 3 2 5 1 2 2 3 2 5 5 1 3 4 5 2 1 3 4 2 2 4 4 3 3 3 2 3 2 1 5 5 5 2 1 4 2 3 5 1 4 4 2 3 2 5 5 4 3 5 1 3 5 5",
"output": "5"
},
{
"input": "100\n4 4 2 5 4 2 2 3 4 4 3 2 3 3 1 3 4 3 3 4 1 3 1 4 5 3 4 3 1 1 1 3 3 2 3 4 3 4 2 2 1 5 1 4 5 1 1 1 3 3 1 1 3 2 5 4 2 5 2 4 5 4 4 1 1 2 1 1 4 5 1 1 5 3 3 2 5 5 5 1 4 1 4 1 1 3 2 3 4 4 2 5 5 2 5 1 1 3 5 3",
"output": "5"
},
{
"input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "4"
},
{
"input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5",
"output": "5"
}
] | 1,573,135,123
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 216
| 0
|
def arr_inp():
return [int(x) for x in input().split()]
import math as m
n, arr = int(input()), arr_inp()
sum = 0
for i in range(n):
if(arr[i]%2==0):
sum+=4//arr[i]
else:
sum+=m.ceil(6/(arr[i]+1))
print(sum)
|
Title: Dima and Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
Output Specification:
In a single line print the answer to the problem.
Demo Input:
['1\n1\n', '1\n2\n', '2\n3 5\n']
Demo Output:
['3\n', '2\n', '3\n']
Note:
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
|
```python
def arr_inp():
return [int(x) for x in input().split()]
import math as m
n, arr = int(input()), arr_inp()
sum = 0
for i in range(n):
if(arr[i]%2==0):
sum+=4//arr[i]
else:
sum+=m.ceil(6/(arr[i]+1))
print(sum)
```
| 0
|
|
844
|
A
|
Diversity
|
PROGRAMMING
| 1,000
|
[
"greedy",
"implementation",
"strings"
] | null | null |
Calculate the minimum number of characters you need to change in the string *s*, so that it contains at least *k* different letters, or print that it is impossible.
String *s* consists only of lowercase Latin letters, and it is allowed to change characters only to lowercase Latin letters too.
|
First line of input contains string *s*, consisting only of lowercase Latin letters (1<=≤<=|*s*|<=≤<=1000, |*s*| denotes the length of *s*).
Second line of input contains integer *k* (1<=≤<=*k*<=≤<=26).
|
Print single line with a minimum number of necessary changes, or the word «impossible» (without quotes) if it is impossible.
|
[
"yandex\n6\n",
"yahoo\n5\n",
"google\n7\n"
] |
[
"0\n",
"1\n",
"impossible\n"
] |
In the first test case string contains 6 different letters, so we don't need to change anything.
In the second test case string contains 4 different letters: {'*a*', '*h*', '*o*', '*y*'}. To get 5 different letters it is necessary to change one occurrence of '*o*' to some letter, which doesn't occur in the string, for example, {'*b*'}.
In the third test case, it is impossible to make 7 different letters because the length of the string is 6.
| 500
|
[
{
"input": "yandex\n6",
"output": "0"
},
{
"input": "yahoo\n5",
"output": "1"
},
{
"input": "google\n7",
"output": "impossible"
},
{
"input": "a\n1",
"output": "0"
},
{
"input": "z\n2",
"output": "impossible"
},
{
"input": "fwgfrwgkuwghfiruhewgirueguhergiqrbvgrgf\n26",
"output": "14"
},
{
"input": "nfevghreuoghrueighoqghbnebvnejbvnbgneluqe\n26",
"output": "12"
},
{
"input": "a\n3",
"output": "impossible"
},
{
"input": "smaxpqplaqqbxuqxalqmbmmgubbpspxhawbxsuqhhegpmmpebqmqpbbeplwaepxmsahuepuhuhwxeqmmlgqubuaxehwuwasgxpqmugbmuawuhwqlswllssueglbxepbmwgs\n1",
"output": "0"
},
{
"input": "cuguccgcugcugucgggggcgcgucgucugcuuuccccuugccg\n4",
"output": "1"
},
{
"input": "fcfccfcfccfcfcffcffffffcfccfccfcffccccfcffffccfccfcffcfcccccffcfffcccffcfccfffffcccfccffffffccfccccf\n20",
"output": "18"
},
{
"input": "swmkwaruyv\n5",
"output": "0"
},
{
"input": "tnbqpsuhkczmejirvyfdolxwga\n22",
"output": "0"
},
{
"input": "abcde\n3",
"output": "0"
},
{
"input": "abb\n1",
"output": "0"
},
{
"input": "aaaa\n1",
"output": "0"
},
{
"input": "abcde\n2",
"output": "0"
},
{
"input": "yandex\n4",
"output": "0"
},
{
"input": "aaabbbccc\n1",
"output": "0"
},
{
"input": "abcd\n2",
"output": "0"
},
{
"input": "asdfgh\n2",
"output": "0"
},
{
"input": "aab\n1",
"output": "0"
},
{
"input": "mynameissako\n5",
"output": "0"
},
{
"input": "abcde\n1",
"output": "0"
},
{
"input": "abcd\n3",
"output": "0"
},
{
"input": "abcdef\n2",
"output": "0"
},
{
"input": "abcdefg\n4",
"output": "0"
},
{
"input": "abc\n1",
"output": "0"
},
{
"input": "asdafjsgljdllgjdgkl\n5",
"output": "0"
},
{
"input": "yaay\n3",
"output": "1"
},
{
"input": "yaay\n4",
"output": "2"
},
{
"input": "zzzzzz\n2",
"output": "1"
}
] | 1,620,840,618
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 61
| 6,656,000
|
s=input()
k=int(input())
p=0
for i in s:
n=s.count(i)
if n>1:
p+=1
break
if k>len(s):
print("impossible")
else:
print(p)
|
Title: Diversity
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Calculate the minimum number of characters you need to change in the string *s*, so that it contains at least *k* different letters, or print that it is impossible.
String *s* consists only of lowercase Latin letters, and it is allowed to change characters only to lowercase Latin letters too.
Input Specification:
First line of input contains string *s*, consisting only of lowercase Latin letters (1<=≤<=|*s*|<=≤<=1000, |*s*| denotes the length of *s*).
Second line of input contains integer *k* (1<=≤<=*k*<=≤<=26).
Output Specification:
Print single line with a minimum number of necessary changes, or the word «impossible» (without quotes) if it is impossible.
Demo Input:
['yandex\n6\n', 'yahoo\n5\n', 'google\n7\n']
Demo Output:
['0\n', '1\n', 'impossible\n']
Note:
In the first test case string contains 6 different letters, so we don't need to change anything.
In the second test case string contains 4 different letters: {'*a*', '*h*', '*o*', '*y*'}. To get 5 different letters it is necessary to change one occurrence of '*o*' to some letter, which doesn't occur in the string, for example, {'*b*'}.
In the third test case, it is impossible to make 7 different letters because the length of the string is 6.
|
```python
s=input()
k=int(input())
p=0
for i in s:
n=s.count(i)
if n>1:
p+=1
break
if k>len(s):
print("impossible")
else:
print(p)
```
| 0
|
|
767
|
A
|
Snacktower
|
PROGRAMMING
| 1,100
|
[
"data structures",
"implementation"
] | null | null |
According to an old legeng, a long time ago Ankh-Morpork residents did something wrong to miss Fortune, and she cursed them. She said that at some time *n* snacks of distinct sizes will fall on the city, and the residents should build a Snacktower of them by placing snacks one on another. Of course, big snacks should be at the bottom of the tower, while small snacks should be at the top.
Years passed, and once different snacks started to fall onto the city, and the residents began to build the Snacktower.
However, they faced some troubles. Each day exactly one snack fell onto the city, but their order was strange. So, at some days the residents weren't able to put the new stack on the top of the Snacktower: they had to wait until all the bigger snacks fell. Of course, in order to not to anger miss Fortune again, the residents placed each snack on the top of the tower immediately as they could do it.
Write a program that models the behavior of Ankh-Morpork residents.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the total number of snacks.
The second line contains *n* integers, the *i*-th of them equals the size of the snack which fell on the *i*-th day. Sizes are distinct integers from 1 to *n*.
|
Print *n* lines. On the *i*-th of them print the sizes of the snacks which the residents placed on the top of the Snacktower on the *i*-th day in the order they will do that. If no snack is placed on some day, leave the corresponding line empty.
|
[
"3\n3 1 2\n",
"5\n4 5 1 2 3\n"
] |
[
"3\n \n2 1",
"5 4\n \n \n3 2 1\n"
] |
In the example a snack of size 3 fell on the first day, and the residents immediately placed it. On the second day a snack of size 1 fell, and the residents weren't able to place it because they were missing the snack of size 2. On the third day a snack of size 2 fell, and the residents immediately placed it. Right after that they placed the snack of size 1 which had fallen before.
| 500
|
[
{
"input": "3\n3 1 2",
"output": "3 \n\n2 1 "
},
{
"input": "5\n4 5 1 2 3",
"output": "5 4 \n\n\n3 2 1 "
},
{
"input": "1\n1",
"output": "1 "
},
{
"input": "2\n1 2",
"output": "2 1 "
},
{
"input": "10\n5 1 6 2 8 3 4 10 9 7",
"output": "10 \n9 8 \n7 6 5 4 3 2 1 "
},
{
"input": "30\n16 10 4 29 5 28 12 21 11 30 18 6 14 3 17 22 20 15 9 1 27 19 24 26 13 25 2 23 8 7",
"output": "30 29 28 \n\n\n\n\n\n\n\n\n\n\n27 \n\n\n26 \n\n25 24 \n\n23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 \n8 \n7 6 5 4 3 2 1 "
},
{
"input": "100\n98 52 63 2 18 96 31 58 84 40 41 45 66 100 46 71 26 48 81 20 73 91 68 76 13 93 17 29 64 95 79 21 55 75 19 85 54 51 89 78 15 87 43 59 36 1 90 35 65 56 62 28 86 5 82 49 3 99 33 9 92 32 74 69 27 22 77 16 44 94 34 6 57 70 23 12 61 25 8 11 67 47 83 88 10 14 30 7 97 60 42 37 24 38 53 50 4 80 72 39",
"output": "100 \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n99 98 \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 \n\n\n\n\n\n\n\n\n80 79 78 77 76 75 74 73 \n72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 \n39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "2\n2 1",
"output": "2 \n1 "
}
] | 1,688,930,132
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 30
| 0
|
n = int(input())
arr = list(map(int, input().split()))
s = []
m = n
for i in range(n):
if arr[i] == m:
print(arr[i], *s)
if len(s) == 0:
m = arr[i]-1
else:
m = min(s)-1
s = []
else:
s.append(arr[i])
print()
|
Title: Snacktower
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
According to an old legeng, a long time ago Ankh-Morpork residents did something wrong to miss Fortune, and she cursed them. She said that at some time *n* snacks of distinct sizes will fall on the city, and the residents should build a Snacktower of them by placing snacks one on another. Of course, big snacks should be at the bottom of the tower, while small snacks should be at the top.
Years passed, and once different snacks started to fall onto the city, and the residents began to build the Snacktower.
However, they faced some troubles. Each day exactly one snack fell onto the city, but their order was strange. So, at some days the residents weren't able to put the new stack on the top of the Snacktower: they had to wait until all the bigger snacks fell. Of course, in order to not to anger miss Fortune again, the residents placed each snack on the top of the tower immediately as they could do it.
Write a program that models the behavior of Ankh-Morpork residents.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the total number of snacks.
The second line contains *n* integers, the *i*-th of them equals the size of the snack which fell on the *i*-th day. Sizes are distinct integers from 1 to *n*.
Output Specification:
Print *n* lines. On the *i*-th of them print the sizes of the snacks which the residents placed on the top of the Snacktower on the *i*-th day in the order they will do that. If no snack is placed on some day, leave the corresponding line empty.
Demo Input:
['3\n3 1 2\n', '5\n4 5 1 2 3\n']
Demo Output:
['3\n\xa0\n2 1', '5 4\n\xa0\n\xa0\n3 2 1\n']
Note:
In the example a snack of size 3 fell on the first day, and the residents immediately placed it. On the second day a snack of size 1 fell, and the residents weren't able to place it because they were missing the snack of size 2. On the third day a snack of size 2 fell, and the residents immediately placed it. Right after that they placed the snack of size 1 which had fallen before.
|
```python
n = int(input())
arr = list(map(int, input().split()))
s = []
m = n
for i in range(n):
if arr[i] == m:
print(arr[i], *s)
if len(s) == 0:
m = arr[i]-1
else:
m = min(s)-1
s = []
else:
s.append(arr[i])
print()
```
| 0
|
|
801
|
B
|
Valued Keys
|
PROGRAMMING
| 900
|
[
"constructive algorithms",
"greedy",
"strings"
] | null | null |
You found a mysterious function *f*. The function takes two strings *s*1 and *s*2. These strings must consist only of lowercase English letters, and must be the same length.
The output of the function *f* is another string of the same length. The *i*-th character of the output is equal to the minimum of the *i*-th character of *s*1 and the *i*-th character of *s*2.
For example, *f*("ab", "ba") = "aa", and *f*("nzwzl", "zizez") = "niwel".
You found two strings *x* and *y* of the same length and consisting of only lowercase English letters. Find any string *z* such that *f*(*x*,<=*z*)<==<=*y*, or print -1 if no such string *z* exists.
|
The first line of input contains the string *x*.
The second line of input contains the string *y*.
Both *x* and *y* consist only of lowercase English letters, *x* and *y* have same length and this length is between 1 and 100.
|
If there is no string *z* such that *f*(*x*,<=*z*)<==<=*y*, print -1.
Otherwise, print a string *z* such that *f*(*x*,<=*z*)<==<=*y*. If there are multiple possible answers, print any of them. The string *z* should be the same length as *x* and *y* and consist only of lowercase English letters.
|
[
"ab\naa\n",
"nzwzl\nniwel\n",
"ab\nba\n"
] |
[
"ba\n",
"xiyez\n",
"-1\n"
] |
The first case is from the statement.
Another solution for the second case is "zizez"
There is no solution for the third case. That is, there is no *z* such that *f*("ab", *z*) = "ba".
| 1,000
|
[
{
"input": "ab\naa",
"output": "ba"
},
{
"input": "nzwzl\nniwel",
"output": "xiyez"
},
{
"input": "ab\nba",
"output": "-1"
},
{
"input": "r\nl",
"output": "l"
},
{
"input": "d\ny",
"output": "-1"
},
{
"input": "yvowz\ncajav",
"output": "cajav"
},
{
"input": "lwzjp\ninjit",
"output": "-1"
},
{
"input": "epqnlxmiicdidyscjaxqznwur\neodnlemiicdedmkcgavqbnqmm",
"output": "eodnlemiicdedmkcgavqbnqmm"
},
{
"input": "qqdabbsxiibnnjgsgxllfvdqj\nuxmypqtwfdezewdxfgplannrs",
"output": "-1"
},
{
"input": "aanerbaqslfmqmuciqbxyznkevukvznpkmxlcorpmrenwxhzfgbmlfpxtkqpxdrmcqcmbf\naanebbaqkgfiimcciqbaoznkeqqkrgapdillccrfeienwbcvfgbmlfbimkqchcrmclcmbf",
"output": "aanebbaqkgfiimcciqbaoznkeqqkrgapdillccrfeienwbcvfgbmlfbimkqchcrmclcmbf"
},
{
"input": "mbyrkhjctrcrayisflptgfudwgrtegidhqicsjqafvdloritbjhciyxuwavxknezwwudnk\nvvixsutlbdewqoabqhpuerfkzrddcqptfwmxdlxwbvsaqfjoxztlddvwgflcteqbwaiaen",
"output": "-1"
},
{
"input": "eufycwztywhbjrpqobvknwfqmnboqcfdiahkagykeibbsqpljcghhmsgfmswwsanzyiwtvuirwmppfivtekaywkzskyydfvkjgxb\necfwavookadbcilfobojnweqinbcpcfdiahkabwkeibbacpljcghhksgfajgmianfnivmhfifogpffiheegayfkxkkcmdfvihgdb",
"output": "ecfwavookadbcilfobojnweqinbcpcfdiahkabwkeibbacpljcghhksgfajgmianfnivmhfifogpffiheegayfkxkkcmdfvihgdb"
},
{
"input": "qvpltcffyeghtbdhjyhfteojezyzziardduzrbwuxmzzkkoehfnxecafizxglboauhynfbawlfxenmykquyhrxswhjuovvogntok\nchvkcvzxptbcepdjfezcpuvtehewbnvqeoezlcnzhpfwujbmhafoeqmjhtwisnobauinkzyigrvahpuetkgpdjfgbzficsmuqnym",
"output": "-1"
},
{
"input": "nmuwjdihouqrnsuahimssnrbxdpwvxiyqtenahtrlshjkmnfuttnpqhgcagoptinnaptxaccptparldzrhpgbyrzedghudtsswxi\nnilhbdghosqnbebafimconrbvdodjsipqmekahhrllhjkemeketapfhgcagopfidnahtlaccpfpafedqicpcbvfgedghudhddwib",
"output": "nilhbdghosqnbebafimconrbvdodjsipqmekahhrllhjkemeketapfhgcagopfidnahtlaccpfpafedqicpcbvfgedghudhddwib"
},
{
"input": "dyxgwupoauwqtcfoyfjdotzirwztdfrueqiypxoqvkmhiehdppwtdoxrbfvtairdbuvlqohjflznggjpifhwjrshcrfbjtklpykx\ngzqlnoizhxolnditjdhlhptjsbczehicudoybzilwnshmywozwnwuipcgirgzldtvtowdsokfeafggwserzdazkxyddjttiopeew",
"output": "-1"
},
{
"input": "hbgwuqzougqzlxemvyjpeizjfwhgugrfnhbrlxkmkdalikfyunppwgdzmalbwewybnjzqsohwhjkdcyhhzmysflambvhpsjilsyv\nfbdjdqjojdafarakvcjpeipjfehgfgrfehbolxkmkdagikflunnpvadocalbkedibhbflmohnhjkdcthhaigsfjaibqhbcjelirv",
"output": "fbdjdqjojdafarakvcjpeipjfehgfgrfehbolxkmkdagikflunnpvadocalbkedibhbflmohnhjkdcthhaigsfjaibqhbcjelirv"
},
{
"input": "xnjjhjfuhgyxqhpzmvgbaohqarugdoaczcfecofltwemieyxolswkcwhlfagfrgmoiqrgftokbqwtxgxzweozzlikrvafiabivlk\npjfosalbsitcnqiazhmepfifjxvmazvdgffcnozmnqubhonwjldmpdsjagmamniylzjdbklcyrzivjyzgnogahobpkwpwpvraqns",
"output": "-1"
},
{
"input": "zrvzedssbsrfldqvjpgmsefrmsatspzoitwvymahiptphiystjlsauzquzqqbmljobdhijcpdvatorwmyojqgnezvzlgjibxepcf\npesoedmqbmffldqsjggmhefkadaesijointrkmahapaahiysfjdiaupqujngbjhjobdhiecadeatgjvelojjgnepvajgeibfepaf",
"output": "pesoedmqbmffldqsjggmhefkadaesijointrkmahapaahiysfjdiaupqujngbjhjobdhiecadeatgjvelojjgnepvajgeibfepaf"
},
{
"input": "pdvkuwyzntzfqpblzmbynknyhlnqbxijuqaincviugxohcsrofozrrsategwkbwxcvkyzxhurokefpbdnmcfogfhsojayysqbrow\nbvxruombdrywlcjkrltyayaazwpauuhbtgwfzdrmfwwucgffucwelzvpsdgtapogchblzahsrfymjlaghkbmbssghrpxalkslcvp",
"output": "-1"
},
{
"input": "tgharsjyihroiiahwgbjezlxvlterxivdhtzjcqegzmtigqmrehvhiyjeywegxaseoyoacouijudbiruoghgxvxadwzgdxtnxlds\ntghaksjsdhkoiiahegbjexlfrctercipdhmvjbgegxdtggqdpbhvhiseehhegnaseoooacnsijubbirjnghgsvpadhaadrtimfdp",
"output": "tghaksjsdhkoiiahegbjexlfrctercipdhmvjbgegxdtggqdpbhvhiseehhegnaseoooacnsijubbirjnghgsvpadhaadrtimfdp"
},
{
"input": "jsinejpfwhzloulxndzvzftgogfdagrsscxmatldssqsgaknnbkcvhptebjjpkjhrjegrotzwcdosezkedzxeoyibmyzunkguoqj\nkfmvybobocdpipiripysioruqvloopvbggpjksgmwzyqwyxnesmvhsawnbbmntulspvsysfkjqwpvoelliopbaukyagedextzoej",
"output": "-1"
},
{
"input": "nttdcfceptruiomtmwzestrfchnqpgqeztpcvthzelfyggjgqadylzubpvbrlgndrcsursczpxlnoyoadxezncqalupfzmjeqihe\nkttdcfceohrjiaahmoldanpfchnfpgheqpdahqhxecfpbgigqadrkjubjfbrlgndbcgcgmcjpeleinaadretncqaiqpfkmjeqihe",
"output": "kttdcfceohrjiaahmoldanpfchnfpgheqpdahqhxecfpbgigqadrkjubjfbrlgndbcgcgmcjpeleinaadretncqaiqpfkmjeqihe"
},
{
"input": "diuopwglduasnaxgduwslbzoyayoypzznqspljcyqehweydhlwifcvnjmaowuvyqfwynjghecqvxdvuquuwpvwrjljozocaxnktv\ntrdydprdzmjhgbhzytelrfjpgsebijicsigmwhynmcyjtqrvojcndodchzxfcvyqjxqzwibccdvsjqhsnectdjyrrhzkeamukang",
"output": "-1"
},
{
"input": "ftfr\nftfr",
"output": "ftfr"
},
{
"input": "ftr\nftr",
"output": "ftr"
},
{
"input": "shftr\nshftr",
"output": "shftr"
},
{
"input": "vkvkkv\nvkvkkv",
"output": "vkvkkv"
},
{
"input": "ftrd\nftrd",
"output": "ftrd"
},
{
"input": "fztr\nfztr",
"output": "fztr"
},
{
"input": "frtr\nfrtr",
"output": "frtr"
},
{
"input": "shdftr\nshdftr",
"output": "shdftr"
},
{
"input": "zzz\nzzz",
"output": "zzz"
},
{
"input": "shtr\nshtr",
"output": "shtr"
},
{
"input": "aaaaa\nzzzzz",
"output": "-1"
},
{
"input": "efr\nefr",
"output": "efr"
}
] | 1,492,704,847
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 62
| 5,529,600
|
#!/usr/local/bin/python3
def solve(x, y):
return -1 if any(x[i] < y[i] for i in range(len(x))) else y
def f(x, y):
return ''.join([min(x[i], y[i]) for i in range(len(x))])
if __name__ == '__main__':
print(solve(input(), input()))
|
Title: Valued Keys
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You found a mysterious function *f*. The function takes two strings *s*1 and *s*2. These strings must consist only of lowercase English letters, and must be the same length.
The output of the function *f* is another string of the same length. The *i*-th character of the output is equal to the minimum of the *i*-th character of *s*1 and the *i*-th character of *s*2.
For example, *f*("ab", "ba") = "aa", and *f*("nzwzl", "zizez") = "niwel".
You found two strings *x* and *y* of the same length and consisting of only lowercase English letters. Find any string *z* such that *f*(*x*,<=*z*)<==<=*y*, or print -1 if no such string *z* exists.
Input Specification:
The first line of input contains the string *x*.
The second line of input contains the string *y*.
Both *x* and *y* consist only of lowercase English letters, *x* and *y* have same length and this length is between 1 and 100.
Output Specification:
If there is no string *z* such that *f*(*x*,<=*z*)<==<=*y*, print -1.
Otherwise, print a string *z* such that *f*(*x*,<=*z*)<==<=*y*. If there are multiple possible answers, print any of them. The string *z* should be the same length as *x* and *y* and consist only of lowercase English letters.
Demo Input:
['ab\naa\n', 'nzwzl\nniwel\n', 'ab\nba\n']
Demo Output:
['ba\n', 'xiyez\n', '-1\n']
Note:
The first case is from the statement.
Another solution for the second case is "zizez"
There is no solution for the third case. That is, there is no *z* such that *f*("ab", *z*) = "ba".
|
```python
#!/usr/local/bin/python3
def solve(x, y):
return -1 if any(x[i] < y[i] for i in range(len(x))) else y
def f(x, y):
return ''.join([min(x[i], y[i]) for i in range(len(x))])
if __name__ == '__main__':
print(solve(input(), input()))
```
| 3
|
|
588
|
A
|
Duff and Meat
|
PROGRAMMING
| 900
|
[
"greedy"
] | null | null |
Duff is addicted to meat! Malek wants to keep her happy for *n* days. In order to be happy in *i*-th day, she needs to eat exactly *a**i* kilograms of meat.
There is a big shop uptown and Malek wants to buy meat for her from there. In *i*-th day, they sell meat for *p**i* dollars per kilogram. Malek knows all numbers *a*1,<=...,<=*a**n* and *p*1,<=...,<=*p**n*. In each day, he can buy arbitrary amount of meat, also he can keep some meat he has for the future.
Malek is a little tired from cooking meat, so he asked for your help. Help him to minimize the total money he spends to keep Duff happy for *n* days.
|
The first line of input contains integer *n* (1<=≤<=*n*<=≤<=105), the number of days.
In the next *n* lines, *i*-th line contains two integers *a**i* and *p**i* (1<=≤<=*a**i*,<=*p**i*<=≤<=100), the amount of meat Duff needs and the cost of meat in that day.
|
Print the minimum money needed to keep Duff happy for *n* days, in one line.
|
[
"3\n1 3\n2 2\n3 1\n",
"3\n1 3\n2 1\n3 2\n"
] |
[
"10\n",
"8\n"
] |
In the first sample case: An optimal way would be to buy 1 kg on the first day, 2 kg on the second day and 3 kg on the third day.
In the second sample case: An optimal way would be to buy 1 kg on the first day and 5 kg (needed meat for the second and third day) on the second day.
| 750
|
[
{
"input": "3\n1 3\n2 2\n3 1",
"output": "10"
},
{
"input": "3\n1 3\n2 1\n3 2",
"output": "8"
},
{
"input": "1\n39 52",
"output": "2028"
},
{
"input": "2\n25 56\n94 17",
"output": "2998"
},
{
"input": "5\n39 21\n95 89\n73 90\n9 55\n85 32",
"output": "6321"
},
{
"input": "12\n70 11\n74 27\n32 11\n26 83\n57 18\n97 28\n75 43\n75 21\n84 29\n16 2\n89 63\n21 88",
"output": "6742"
},
{
"input": "2\n100 68\n38 80",
"output": "9384"
}
] | 1,612,613,574
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 30
| 795
| 10,956,800
|
a = []
p = []
n = int(input())
for i in range(n):
_a, _p = map(int, input().split())
a.append(_a)
p.append(_p)
p_min = []
m = float("inf")
for x in p:
m = min(x, m)
p_min.append(m)
s = 0
for _a, _p in zip(a, p_min):
s += _a * _p
print(s)
|
Title: Duff and Meat
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Duff is addicted to meat! Malek wants to keep her happy for *n* days. In order to be happy in *i*-th day, she needs to eat exactly *a**i* kilograms of meat.
There is a big shop uptown and Malek wants to buy meat for her from there. In *i*-th day, they sell meat for *p**i* dollars per kilogram. Malek knows all numbers *a*1,<=...,<=*a**n* and *p*1,<=...,<=*p**n*. In each day, he can buy arbitrary amount of meat, also he can keep some meat he has for the future.
Malek is a little tired from cooking meat, so he asked for your help. Help him to minimize the total money he spends to keep Duff happy for *n* days.
Input Specification:
The first line of input contains integer *n* (1<=≤<=*n*<=≤<=105), the number of days.
In the next *n* lines, *i*-th line contains two integers *a**i* and *p**i* (1<=≤<=*a**i*,<=*p**i*<=≤<=100), the amount of meat Duff needs and the cost of meat in that day.
Output Specification:
Print the minimum money needed to keep Duff happy for *n* days, in one line.
Demo Input:
['3\n1 3\n2 2\n3 1\n', '3\n1 3\n2 1\n3 2\n']
Demo Output:
['10\n', '8\n']
Note:
In the first sample case: An optimal way would be to buy 1 kg on the first day, 2 kg on the second day and 3 kg on the third day.
In the second sample case: An optimal way would be to buy 1 kg on the first day and 5 kg (needed meat for the second and third day) on the second day.
|
```python
a = []
p = []
n = int(input())
for i in range(n):
_a, _p = map(int, input().split())
a.append(_a)
p.append(_p)
p_min = []
m = float("inf")
for x in p:
m = min(x, m)
p_min.append(m)
s = 0
for _a, _p in zip(a, p_min):
s += _a * _p
print(s)
```
| 3
|
|
116
|
A
|
Tram
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty.
Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
|
The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops.
Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement.
- The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
|
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
|
[
"4\n0 3\n2 5\n4 2\n4 0\n"
] |
[
"6\n"
] |
For the first example, a capacity of 6 is sufficient:
- At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints.
Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
| 500
|
[
{
"input": "4\n0 3\n2 5\n4 2\n4 0",
"output": "6"
},
{
"input": "5\n0 4\n4 6\n6 5\n5 4\n4 0",
"output": "6"
},
{
"input": "10\n0 5\n1 7\n10 8\n5 3\n0 5\n3 3\n8 8\n0 6\n10 1\n9 0",
"output": "18"
},
{
"input": "3\n0 1\n1 1\n1 0",
"output": "1"
},
{
"input": "4\n0 1\n0 1\n1 0\n1 0",
"output": "2"
},
{
"input": "3\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "3\n0 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "5\n0 73\n73 189\n189 766\n766 0\n0 0",
"output": "766"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 1\n1 0",
"output": "1"
},
{
"input": "5\n0 917\n917 923\n904 992\n1000 0\n11 0",
"output": "1011"
},
{
"input": "5\n0 1\n1 2\n2 1\n1 2\n2 0",
"output": "2"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "20\n0 7\n2 1\n2 2\n5 7\n2 6\n6 10\n2 4\n0 4\n7 4\n8 0\n10 6\n2 1\n6 1\n1 7\n0 3\n8 7\n6 3\n6 3\n1 1\n3 0",
"output": "22"
},
{
"input": "5\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "10\n0 592\n258 598\n389 203\n249 836\n196 635\n478 482\n994 987\n1000 0\n769 0\n0 0",
"output": "1776"
},
{
"input": "10\n0 1\n1 0\n0 0\n0 0\n0 0\n0 1\n1 1\n0 1\n1 0\n1 0",
"output": "2"
},
{
"input": "10\n0 926\n926 938\n938 931\n931 964\n937 989\n983 936\n908 949\n997 932\n945 988\n988 0",
"output": "1016"
},
{
"input": "10\n0 1\n1 2\n1 2\n2 2\n2 2\n2 2\n1 1\n1 1\n2 1\n2 0",
"output": "3"
},
{
"input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "10\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "50\n0 332\n332 268\n268 56\n56 711\n420 180\n160 834\n149 341\n373 777\n763 93\n994 407\n86 803\n700 132\n471 608\n429 467\n75 5\n638 305\n405 853\n316 478\n643 163\n18 131\n648 241\n241 766\n316 847\n640 380\n923 759\n789 41\n125 421\n421 9\n9 388\n388 829\n408 108\n462 856\n816 411\n518 688\n290 7\n405 912\n397 772\n396 652\n394 146\n27 648\n462 617\n514 433\n780 35\n710 705\n460 390\n194 508\n643 56\n172 469\n1000 0\n194 0",
"output": "2071"
},
{
"input": "50\n0 0\n0 1\n1 1\n0 1\n0 0\n1 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 1\n1 0\n0 1\n0 0\n1 1\n1 0\n0 1\n0 0\n1 1\n0 1\n1 0\n1 1\n1 0\n0 0\n1 1\n1 0\n0 1\n0 0\n0 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 0\n0 1\n1 0\n0 0\n0 1\n1 1\n1 1\n0 1\n0 0\n1 0\n1 0",
"output": "3"
},
{
"input": "50\n0 926\n926 971\n915 980\n920 965\n954 944\n928 952\n955 980\n916 980\n906 935\n944 913\n905 923\n912 922\n965 934\n912 900\n946 930\n931 983\n979 905\n925 969\n924 926\n910 914\n921 977\n934 979\n962 986\n942 909\n976 903\n982 982\n991 941\n954 929\n902 980\n947 983\n919 924\n917 943\n916 905\n907 913\n964 977\n984 904\n905 999\n950 970\n986 906\n993 970\n960 994\n963 983\n918 986\n980 900\n931 986\n993 997\n941 909\n907 909\n1000 0\n278 0",
"output": "1329"
},
{
"input": "2\n0 863\n863 0",
"output": "863"
},
{
"input": "50\n0 1\n1 2\n2 2\n1 1\n1 1\n1 2\n1 2\n1 1\n1 2\n1 1\n1 1\n1 2\n1 2\n1 1\n2 1\n2 2\n1 2\n2 2\n1 2\n2 1\n2 1\n2 2\n2 1\n1 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n2 2\n2 1\n1 2\n2 2\n1 2\n1 1\n1 1\n2 1\n2 1\n2 2\n2 1\n2 1\n1 2\n1 2\n1 2\n1 2\n2 0\n2 0\n2 0\n0 0",
"output": "8"
},
{
"input": "50\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "100\n0 1\n0 0\n0 0\n1 0\n0 0\n0 1\n0 1\n1 1\n0 0\n0 0\n1 1\n0 0\n1 1\n0 1\n1 1\n0 1\n1 1\n1 0\n1 0\n0 0\n1 0\n0 1\n1 0\n0 0\n0 0\n1 1\n1 1\n0 1\n0 0\n1 0\n1 1\n0 1\n1 0\n1 1\n0 1\n1 1\n1 0\n0 0\n0 0\n0 1\n0 0\n0 1\n1 1\n0 0\n1 1\n1 1\n0 0\n0 1\n1 0\n0 1\n0 0\n0 1\n0 1\n1 1\n1 1\n1 1\n0 0\n0 0\n1 1\n0 1\n0 1\n1 0\n0 0\n0 0\n1 1\n0 1\n0 1\n1 1\n1 1\n0 1\n1 1\n1 1\n0 0\n1 0\n0 1\n0 0\n0 0\n1 1\n1 1\n1 1\n1 1\n0 1\n1 0\n1 0\n1 0\n1 0\n1 0\n0 0\n1 0\n1 0\n0 0\n1 0\n0 0\n0 1\n1 0\n0 1\n1 0\n1 0\n1 0\n1 0",
"output": "11"
},
{
"input": "100\n0 2\n1 2\n2 1\n1 2\n1 2\n2 1\n2 2\n1 1\n1 1\n2 1\n1 2\n2 1\n1 2\n2 2\n2 2\n2 2\n1 2\n2 2\n2 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 2\n1 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n1 1\n2 2\n2 1\n1 2\n1 1\n1 2\n2 1\n2 2\n1 1\n2 1\n1 1\n2 1\n1 1\n1 2\n2 2\n2 2\n1 1\n2 2\n1 2\n2 1\n2 1\n1 1\n1 1\n1 2\n1 2\n1 1\n1 1\n2 1\n1 2\n1 2\n2 1\n2 2\n2 2\n2 2\n2 1\n2 2\n1 1\n1 2\n1 2\n1 1\n2 2\n2 2\n1 1\n2 1\n1 1\n1 2\n1 2\n1 2\n1 1\n1 1\n2 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 1\n2 2\n1 2\n2 0\n2 0\n2 0\n1 0",
"output": "7"
},
{
"input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "2\n0 1\n1 0",
"output": "1"
},
{
"input": "2\n0 900\n900 0",
"output": "900"
},
{
"input": "2\n0 1\n1 0",
"output": "1"
},
{
"input": "2\n0 0\n0 0",
"output": "0"
},
{
"input": "2\n0 1000\n1000 0",
"output": "1000"
},
{
"input": "3\n0 802\n175 188\n815 0",
"output": "815"
},
{
"input": "3\n0 910\n910 976\n976 0",
"output": "976"
},
{
"input": "3\n0 2\n2 1\n1 0",
"output": "2"
}
] | 1,687,356,229
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 71
| 92
| 0
|
n = int(input())
total = 0
ans = 0
for i in range(n):
a, b = map(int, input().split())
total += (b-a)
if total > ans:
ans = total
print(ans)
|
Title: Tram
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty.
Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
Input Specification:
The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops.
Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement.
- The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
Output Specification:
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
Demo Input:
['4\n0 3\n2 5\n4 2\n4 0\n']
Demo Output:
['6\n']
Note:
For the first example, a capacity of 6 is sufficient:
- At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints.
Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
|
```python
n = int(input())
total = 0
ans = 0
for i in range(n):
a, b = map(int, input().split())
total += (b-a)
if total > ans:
ans = total
print(ans)
```
| 3
|
|
80
|
A
|
Panoramix's Prediction
|
PROGRAMMING
| 800
|
[
"brute force"
] |
A. Panoramix's Prediction
|
2
|
256
|
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
|
The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4.
|
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
|
[
"3 5\n",
"7 11\n",
"7 9\n"
] |
[
"YES",
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "3 5",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "7 9",
"output": "NO"
},
{
"input": "2 3",
"output": "YES"
},
{
"input": "2 4",
"output": "NO"
},
{
"input": "3 4",
"output": "NO"
},
{
"input": "3 5",
"output": "YES"
},
{
"input": "5 7",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "11 13",
"output": "YES"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "17 19",
"output": "YES"
},
{
"input": "19 23",
"output": "YES"
},
{
"input": "23 29",
"output": "YES"
},
{
"input": "29 31",
"output": "YES"
},
{
"input": "31 37",
"output": "YES"
},
{
"input": "37 41",
"output": "YES"
},
{
"input": "41 43",
"output": "YES"
},
{
"input": "43 47",
"output": "YES"
},
{
"input": "2 5",
"output": "NO"
},
{
"input": "2 7",
"output": "NO"
},
{
"input": "2 6",
"output": "NO"
},
{
"input": "2 11",
"output": "NO"
},
{
"input": "3 6",
"output": "NO"
},
{
"input": "3 7",
"output": "NO"
},
{
"input": "3 9",
"output": "NO"
},
{
"input": "5 6",
"output": "NO"
},
{
"input": "5 9",
"output": "NO"
},
{
"input": "5 11",
"output": "NO"
},
{
"input": "5 13",
"output": "NO"
},
{
"input": "5 15",
"output": "NO"
},
{
"input": "7 8",
"output": "NO"
},
{
"input": "7 13",
"output": "NO"
},
{
"input": "13 15",
"output": "NO"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "19 21",
"output": "NO"
},
{
"input": "13 20",
"output": "NO"
},
{
"input": "41 49",
"output": "NO"
},
{
"input": "43 49",
"output": "NO"
},
{
"input": "47 50",
"output": "NO"
},
{
"input": "47 49",
"output": "NO"
},
{
"input": "47 48",
"output": "NO"
},
{
"input": "23 25",
"output": "NO"
},
{
"input": "2 50",
"output": "NO"
},
{
"input": "31 33",
"output": "NO"
}
] | 1,627,496,963
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 19
| 186
| 20,172,800
|
n,m = map(int, input().split())
p = (2**(m-1))%m
if p == 1 and m>n:
print("YES")
else:
print("NO")
|
Title: Panoramix's Prediction
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
Input Specification:
The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4.
Output Specification:
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
Demo Input:
['3 5\n', '7 11\n', '7 9\n']
Demo Output:
['YES', 'YES', 'NO']
Note:
none
|
```python
n,m = map(int, input().split())
p = (2**(m-1))%m
if p == 1 and m>n:
print("YES")
else:
print("NO")
```
| 0
|
250
|
A
|
Paper Work
|
PROGRAMMING
| 1,000
|
[
"greedy"
] | null | null |
Polycarpus has been working in the analytic department of the "F.R.A.U.D." company for as much as *n* days. Right now his task is to make a series of reports about the company's performance for the last *n* days. We know that the main information in a day report is value *a**i*, the company's profit on the *i*-th day. If *a**i* is negative, then the company suffered losses on the *i*-th day.
Polycarpus should sort the daily reports into folders. Each folder should include data on the company's performance for several consecutive days. Of course, the information on each of the *n* days should be exactly in one folder. Thus, Polycarpus puts information on the first few days in the first folder. The information on the several following days goes to the second folder, and so on.
It is known that the boss reads one daily report folder per day. If one folder has three or more reports for the days in which the company suffered losses (*a**i*<=<<=0), he loses his temper and his wrath is terrible.
Therefore, Polycarpus wants to prepare the folders so that none of them contains information on three or more days with the loss, and the number of folders is minimal.
Write a program that, given sequence *a**i*, will print the minimum number of folders.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100), *n* is the number of days. The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=100), where *a**i* means the company profit on the *i*-th day. It is possible that the company has no days with the negative *a**i*.
|
Print an integer *k* — the required minimum number of folders. In the second line print a sequence of integers *b*1, *b*2, ..., *b**k*, where *b**j* is the number of day reports in the *j*-th folder.
If there are multiple ways to sort the reports into *k* days, print any of them.
|
[
"11\n1 2 3 -4 -5 -6 5 -5 -6 -7 6\n",
"5\n0 -1 100 -1 0\n"
] |
[
"3\n5 3 3 ",
"1\n5 "
] |
Here goes a way to sort the reports from the first sample into three folders:
In the second sample you can put all five reports in one folder.
| 500
|
[
{
"input": "11\n1 2 3 -4 -5 -6 5 -5 -6 -7 6",
"output": "3\n5 3 3 "
},
{
"input": "5\n0 -1 100 -1 0",
"output": "1\n5 "
},
{
"input": "1\n0",
"output": "1\n1 "
},
{
"input": "1\n-1",
"output": "1\n1 "
},
{
"input": "2\n0 0",
"output": "1\n2 "
},
{
"input": "2\n-2 2",
"output": "1\n2 "
},
{
"input": "2\n-2 -1",
"output": "1\n2 "
},
{
"input": "12\n1 -12 -5 -8 0 -8 -1 -1 -6 12 -9 12",
"output": "4\n3 3 2 4 "
},
{
"input": "4\n1 2 0 3",
"output": "1\n4 "
},
{
"input": "4\n4 -3 3 3",
"output": "1\n4 "
},
{
"input": "4\n0 -3 4 -3",
"output": "1\n4 "
},
{
"input": "4\n-3 -2 4 -3",
"output": "2\n1 3 "
},
{
"input": "4\n-3 -2 -1 -4",
"output": "2\n2 2 "
},
{
"input": "5\n-2 -2 4 0 -1",
"output": "2\n1 4 "
},
{
"input": "5\n-5 -3 -1 2 -1",
"output": "2\n2 3 "
},
{
"input": "5\n-3 -2 -3 -2 -3",
"output": "3\n1 2 2 "
},
{
"input": "10\n0 5 2 3 10 9 4 9 9 3",
"output": "1\n10 "
},
{
"input": "10\n10 2 1 2 9 10 7 4 -4 5",
"output": "1\n10 "
},
{
"input": "10\n1 -3 1 10 -7 -6 7 0 -5 3",
"output": "2\n5 5 "
},
{
"input": "10\n6 5 -10 -4 -3 -7 5 -2 -6 -10",
"output": "4\n3 2 3 2 "
},
{
"input": "10\n-2 -4 -1 -6 -5 -5 -7 0 -7 -8",
"output": "5\n1 2 2 2 3 "
},
{
"input": "100\n48 36 10 85 15 57 100 70 14 82 15 75 67 44 40 83 12 94 80 77 92 40 39 80 11 10 2 22 71 31 93 51 22 29 98 90 33 91 66 64 87 70 46 86 62 13 85 15 37 3 49 11 21 57 26 14 5 80 33 82 9 75 26 76 50 32 48 100 62 11 97 47 67 81 86 80 51 51 44 97 2 22 18 52 43 54 65 91 94 54 22 80 23 63 44 7 52 98 80 69",
"output": "1\n100 "
},
{
"input": "100\n7 51 31 14 17 0 72 29 77 6 32 94 70 94 1 64 85 29 67 66 56 -90 38 85 51 5 69 36 62 99 99 43 43 40 68 88 62 39 45 75 50 95 51 96 69 60 65 27 63 89 23 43 49 39 92 90 1 49 22 78 13 90 97 87 5 100 60 82 50 49 0 11 87 34 67 7 35 65 20 92 89 29 73 48 41 8 14 76 91 34 13 18 42 75 36 14 78 80 74 9",
"output": "1\n100 "
},
{
"input": "100\n83 71 43 50 61 54 -45 44 36 35 44 21 34 65 23 32 73 36 70 17 46 47 10 30 48 25 84 58 63 96 44 88 24 93 26 24 70 69 90 75 20 42 63 11 0 41 54 23 95 99 17 27 43 20 46 100 65 -79 15 72 78 0 13 94 76 72 69 35 61 3 65 83 28 12 27 48 8 37 30 37 40 87 30 76 81 78 71 44 79 92 10 60 5 7 9 33 79 31 86 51",
"output": "1\n100 "
},
{
"input": "100\n78 96 4 24 -66 42 28 16 42 -48 89 0 74 19 12 86 75 21 42 100 2 43 11 -76 85 24 12 51 26 48 22 74 68 73 22 39 53 42 37 -78 100 5 9 58 10 63 19 89 76 42 10 -96 76 49 67 59 86 37 13 66 75 92 48 80 37 59 49 -4 83 1 82 25 0 31 73 40 52 3 -47 17 68 94 51 84 47 76 73 -65 83 72 56 50 62 -5 40 12 81 75 84 -6",
"output": "5\n10 30 28 20 12 "
},
{
"input": "100\n-63 20 79 73 18 82 23 -93 55 8 -31 37 33 24 30 41 70 77 14 34 84 79 -94 88 54 81 7 90 74 35 29 3 75 71 14 28 -61 63 90 79 71 97 -90 74 -33 10 27 34 46 31 9 90 100 -73 58 2 73 51 5 46 -27 -9 30 65 73 28 15 14 1 59 96 21 100 78 12 97 72 37 -28 52 12 0 -42 84 88 8 88 8 -48 39 13 -78 20 56 38 82 32 -87 45 39",
"output": "8\n1 10 26 8 16 18 10 11 "
},
{
"input": "100\n21 40 60 28 85 10 15 -3 -27 -7 26 26 9 93 -3 -65 70 88 68 -85 24 75 24 -69 53 56 44 -53 -15 -74 12 22 37 22 77 90 9 95 40 15 -76 7 -81 65 83 51 -57 59 19 78 34 40 11 17 99 75 56 67 -81 39 22 86 -78 61 19 25 53 13 -91 91 17 71 45 39 63 32 -57 83 70 26 100 -53 7 95 67 -47 84 84 28 56 94 72 48 58 21 -89 91 73 16 93",
"output": "10\n9 6 5 8 2 13 16 10 13 18 "
},
{
"input": "100\n39 -70 7 7 11 27 88 16 -3 94 94 -2 23 91 41 49 69 61 53 -99 98 54 87 44 48 73 62 80 86 -33 34 -87 56 48 4 18 92 14 -37 84 7 42 9 70 0 -78 17 68 54 -82 65 -21 59 90 72 -19 -81 8 92 88 -68 65 -42 -60 98 -39 -2 2 88 24 9 -95 17 75 12 -32 -9 85 7 88 59 14 90 69 19 -88 -73 1 2 72 15 -83 65 18 26 25 -71 3 -51 95",
"output": "13\n2 10 18 9 11 6 5 3 3 9 10 6 8 "
},
{
"input": "100\n-47 -28 -90 -35 28 32 63 77 88 3 -48 18 48 22 47 47 89 2 88 46 25 60 65 44 100 28 73 71 19 -55 44 47 30 -25 50 15 -98 5 73 -56 61 15 15 77 67 59 -64 22 17 70 67 -12 26 -81 -58 -20 1 22 34 52 -45 56 78 29 47 -11 -10 70 -57 -2 62 85 -84 -54 -67 67 85 23 6 -65 -6 -79 -13 -1 12 68 1 71 73 77 48 -48 90 70 52 100 45 38 -43 -93",
"output": "15\n2 2 26 7 10 7 2 10 3 4 2 6 2 9 8 "
},
{
"input": "100\n-34 -61 96 14 87 33 29 64 -76 7 47 -41 54 60 79 -28 -18 88 95 29 -89 -29 52 39 8 13 68 13 15 46 -34 -49 78 -73 64 -56 83 -16 45 17 40 11 -86 55 56 -35 91 81 38 -77 -41 67 16 -37 -56 -84 -42 99 -83 45 46 -56 -14 -15 79 77 -48 -87 94 46 77 18 -32 16 -18 47 67 35 89 95 36 -32 51 46 40 78 0 58 81 -47 41 5 -48 65 89 6 -79 -56 -25 74",
"output": "18\n1 8 7 5 10 3 4 8 5 4 2 5 2 4 7 15 7 3 "
},
{
"input": "100\n14 36 94 -66 24 -24 14 -87 86 94 44 88 -68 59 4 -27 -74 12 -75 92 -31 29 18 -69 -47 45 -85 67 95 -77 7 -56 -80 -46 -40 73 40 71 41 -86 50 87 94 16 43 -96 96 -63 66 24 3 90 16 42 50 41 15 -45 72 32 -94 -93 91 -31 -30 -73 -88 33 45 9 71 18 37 -26 43 -82 87 67 62 -9 29 -70 -34 99 -30 -25 -86 -91 -70 -48 24 51 53 25 90 69 -17 -53 87 -62",
"output": "20\n6 7 4 4 4 5 3 2 11 12 4 3 2 9 6 3 2 2 8 3 "
},
{
"input": "100\n-40 87 -68 72 -49 48 -62 73 95 27 80 53 76 33 -95 -53 31 18 -61 -75 84 40 35 -82 49 47 -13 22 -81 -65 -17 47 -61 21 9 -12 52 67 31 -86 -63 42 18 -25 70 45 -3 -18 94 -62 -28 16 -100 36 -96 -73 83 -65 9 -51 83 36 65 -24 77 38 81 -84 32 -34 75 -50 -92 11 -73 -17 81 -66 -61 33 -47 -50 -72 -95 -58 54 68 -46 -41 8 76 28 58 87 88 100 61 -61 75 -1",
"output": "23\n1 4 10 4 5 5 2 5 5 6 3 3 3 4 8 4 3 3 3 2 2 4 11 "
},
{
"input": "100\n-61 56 1 -37 61 -77 -6 -5 28 36 27 -32 -10 -44 -89 -26 67 100 -94 80 -18 -5 -92 94 81 -38 -76 4 -77 2 79 55 -93 54 -19 10 -35 -12 -42 -32 -23 -67 -95 -62 -16 23 -25 41 -16 -51 3 -45 -1 53 20 0 0 21 87 28 15 62 64 -21 6 45 -19 95 -23 87 15 -35 21 -88 47 -81 89 68 66 -65 95 54 18 -97 65 -7 75 -58 -54 -3 99 -95 -57 -84 98 -6 33 44 81 -56",
"output": "25\n4 3 5 2 2 5 2 4 6 4 2 2 2 2 4 3 12 5 5 6 6 3 3 2 6 "
},
{
"input": "100\n-21 61 -52 47 -25 -42 -48 -46 58 -13 75 -65 52 88 -59 68 -12 -25 33 14 -2 78 32 -41 -79 17 0 85 -39 -80 61 30 -27 -92 -100 66 -53 -11 -59 65 -5 92 -2 -85 87 -72 19 -50 -24 32 -27 -92 -100 14 72 13 67 -22 -27 -56 -84 -90 -74 -70 44 -92 70 -49 -50 11 57 -73 23 68 65 99 82 -18 -93 -34 85 45 89 -58 -80 5 -57 -98 -11 -96 28 30 29 -71 47 50 -15 30 -96 -53",
"output": "28\n1 4 2 3 5 3 6 5 4 2 3 3 3 4 3 2 6 2 2 3 3 9 2 5 3 2 7 3 "
},
{
"input": "100\n-61 15 -88 52 -75 -71 -36 29 93 99 -73 -97 -69 39 -78 80 -28 -20 -36 -89 88 -82 56 -37 -13 33 2 -6 -88 -9 8 -24 40 5 8 -33 -83 -90 -48 55 69 -12 -49 -41 -4 92 42 57 -17 -68 -41 -68 77 -17 -45 -64 -39 24 -78 -3 -49 77 3 -23 84 -36 -19 -16 -72 74 -19 -81 65 -79 -57 64 89 -29 49 69 88 -18 16 26 -86 -58 -91 69 -43 -28 86 6 -87 47 -71 18 81 -55 -42 -30",
"output": "30\n3 3 5 2 4 2 3 3 4 3 5 2 4 2 5 2 3 2 3 4 3 2 3 3 7 4 3 4 5 2 "
},
{
"input": "100\n-21 -98 -66 26 3 -5 86 99 96 -22 78 -16 20 -3 93 22 -67 -37 -27 12 -97 43 -46 -48 -58 -4 -19 26 -87 -61 67 -76 -42 57 -87 -50 -24 -79 -6 43 -68 -42 13 -1 -82 81 -32 -88 -6 -99 46 42 19 -17 89 14 -98 -24 34 -37 -17 49 76 81 -61 23 -46 -79 -48 -5 87 14 -97 -67 -31 94 -77 15 -44 38 -44 -67 -69 -84 -58 -59 -17 -54 3 -15 79 -28 -10 -26 34 -73 -37 -57 -42 -44",
"output": "33\n1 2 7 4 4 3 3 2 3 3 3 2 2 3 3 3 2 7 3 5 3 2 4 3 4 2 2 2 3 3 3 2 2 "
},
{
"input": "100\n-63 -62 -88 -14 -58 -75 -28 19 -71 60 -38 77 98 95 -49 -64 -87 -97 2 -37 -37 -41 -47 -96 -58 -42 -88 12 -90 -65 0 52 -59 87 -79 -68 -66 -90 -19 -4 86 -65 -49 -94 67 93 -61 100 68 -40 -35 -67 -4 -100 -90 -86 15 -3 -75 57 65 -91 -80 -57 51 -88 -61 -54 -13 -46 -64 53 -87 -54 -69 29 -67 -23 -96 -93 -3 -77 -10 85 55 -44 17 24 -78 -82 -33 14 85 79 84 -91 -81 54 -89 -86",
"output": "35\n2 2 2 3 6 2 3 2 2 2 3 4 3 2 2 3 4 4 2 2 3 4 2 3 2 2 3 3 2 2 2 6 2 6 3 "
},
{
"input": "100\n30 -47 -87 -49 -4 -58 -10 -10 -37 -15 -12 -85 4 24 -3 -2 57 57 -60 94 -21 82 1 -54 -39 -98 -72 57 84 -6 -41 82 93 -81 -61 -30 18 -68 -88 17 87 -6 43 -26 72 -14 -40 -75 -69 60 -91 -70 -26 -62 -13 -19 -97 -14 -59 -17 -44 -15 -65 60 -60 74 26 -6 12 -83 -49 82 -76 -96 -31 -98 -100 49 -50 -42 -43 92 -56 -79 -38 -86 -99 -37 -75 -26 -79 -12 -9 -87 -63 -62 -25 -3 -5 -92",
"output": "38\n2 2 2 2 2 2 4 5 4 2 4 4 3 4 4 2 3 2 2 2 2 2 2 5 3 3 2 3 2 3 2 2 2 2 2 2 2 2 "
},
{
"input": "100\n-58 -18 -94 -96 -18 -2 -35 -49 47 69 96 -46 -88 -91 -9 -95 -12 -46 -12 16 44 -53 -96 71 -11 -98 -62 -27 -89 -88 -28 -11 -14 -47 67 -69 -33 -64 15 -24 67 53 -93 -10 -75 -98 -8 -97 -62 67 -52 -59 -9 -89 -39 -23 -37 -61 -83 -89 23 -47 -67 18 -38 -63 -73 -98 -65 -70 -20 13 -33 -46 -50 -30 -33 85 -93 -42 -37 48 -8 -11 -32 0 -58 -70 -27 -79 -52 82 22 -62 -100 -12 -5 -82 88 -74",
"output": "40\n2 2 2 2 5 2 2 2 4 3 2 2 2 2 3 3 4 2 2 3 2 2 2 2 3 3 2 2 2 3 2 3 2 3 3 2 2 4 2 3 "
},
{
"input": "100\n-60 -62 -19 -42 -50 -22 -90 -82 -56 40 87 -1 -30 -76 -8 -32 -57 38 -14 -39 84 -60 -28 -82 -62 -83 -37 -59 -61 -86 -13 48 18 -8 50 -27 -47 -100 -42 -88 -19 -45 30 -93 -46 3 -26 -80 -61 -13 -20 76 -95 -51 -26 -1 39 -92 -41 -76 -67 26 -23 30 79 -26 -51 -40 -29 -14 -2 -43 -30 -19 -62 -65 -1 -90 -66 -38 -50 89 -17 -53 -6 -13 -41 -54 -1 -23 -31 -88 -59 -44 -67 -11 -83 -16 -23 -71",
"output": "43\n1 2 2 2 2 4 2 2 3 3 2 2 2 2 5 2 2 2 3 3 2 3 2 3 2 3 4 2 2 2 2 2 2 2 3 2 2 2 2 2 2 2 2 "
},
{
"input": "100\n-1 -65 76 -28 -58 -63 -86 -54 -62 -66 -39 -3 -62 -35 -2 -86 -6 -16 -85 -30 -6 -41 -88 38 -8 -78 -6 -73 -83 -12 40 -99 -78 -51 -97 -15 81 -76 -1 -78 -38 -14 -24 -2 -70 -80 -24 -28 -51 -50 61 -64 -81 -32 -59 -60 -58 -10 -24 -81 -42 -7 58 -23 -11 -14 -84 -27 -45 2 -31 -32 -20 -72 -2 -81 -31 -6 -8 -91 55 -76 -93 -65 -94 -8 -57 -20 -75 -20 -27 -37 -82 97 -37 -8 -16 49 -90 -3",
"output": "45\n2 3 2 2 2 2 2 2 2 2 2 3 2 2 3 2 3 2 2 2 2 2 2 3 2 2 2 2 3 2 2 3 2 2 2 2 3 2 2 2 2 2 3 2 3 "
},
{
"input": "100\n-75 -29 -14 -2 99 -94 -75 82 -17 -19 -61 -18 -14 -94 -17 16 -16 -4 -41 -8 -81 -26 -65 24 -7 -87 -85 -22 -74 -21 46 -31 -39 -82 -88 -20 -2 -13 -46 -1 -78 -66 -83 -50 -13 -15 -60 -56 36 -79 -99 -52 -96 -80 -97 -74 80 -90 -52 -33 -1 -78 73 -45 -3 -77 62 -4 -85 -44 -62 -74 -33 -35 -44 -14 -80 -20 -17 -83 -32 -40 -74 -13 -90 -62 -15 -16 -59 -15 -40 -50 -98 -33 -73 -25 -86 -35 -84 -41",
"output": "46\n1 2 3 3 2 2 2 3 2 2 3 2 2 3 2 2 2 2 2 2 2 2 3 2 2 3 2 2 3 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "100\n-43 -90 -65 -70 -7 -49 -90 -93 -43 -80 -2 -47 -13 -5 -70 -42 -71 -68 -60 -71 -27 -84 82 -74 -75 -65 -32 -32 -50 -74 62 -96 -85 -95 -65 -51 -69 49 3 -19 -92 -61 -33 -7 -70 -51 -3 -1 -48 -48 -64 -7 -4 -46 -11 -36 -80 -69 -67 -1 -39 -40 66 -9 -40 -8 -58 -74 -27 66 -52 -26 -62 -72 -48 -25 -41 -13 -65 -82 -50 -68 -94 -52 -77 -91 -37 -18 -8 -51 -19 -22 -52 -95 35 -32 59 -41 -54 -88",
"output": "46\n2 2 2 2 2 2 2 2 2 2 2 3 2 2 3 2 2 4 2 2 2 2 2 2 2 2 2 2 2 3 2 2 3 2 2 2 2 2 2 2 2 2 2 2 4 2 "
},
{
"input": "100\n-67 -100 -7 -13 -9 -78 -55 -68 -31 -18 -92 -23 -4 -99 -54 -97 -45 -24 -33 -95 -42 -20 -63 -24 -89 -25 -55 -35 -84 -30 -1 57 -88 -94 -67 -27 -91 -14 -13 -20 -7 -8 -33 -95 -1 -75 -80 -49 -15 -64 -73 -49 -87 -19 -44 -50 -19 -10 -90 -51 -74 90 -42 -18 -93 -99 -43 51 -96 95 -97 -36 -21 -13 -73 -37 -33 -22 -83 -33 -44 -84 -20 -78 -34 -70 -83 -83 -85 -17 -36 62 83 -73 -6 51 -77 -82 -83 -68",
"output": "47\n1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 2 2 2 2 2 2 2 2 2 2 2 2 2 3 2 2 4 2 2 2 2 2 2 2 2 2 2 4 3 2 "
},
{
"input": "100\n-30 -40 -64 -50 -13 -69 -87 -54 -7 -32 -38 30 -79 -31 57 -50 -3 -6 -13 -94 -28 -57 -95 -67 -82 -49 -83 -39 -41 -12 -73 -20 -17 -46 -92 -31 -36 -31 -80 -47 -37 -67 -41 -65 -7 -95 -85 -53 -87 -18 -52 -61 -98 -85 -6 -80 -96 -95 -72 -9 -19 -49 74 84 -60 -69 -64 -39 -82 -28 -24 -82 -13 -7 -15 -28 -26 -48 -88 -9 -36 -38 -75 -1 9 -15 -12 -47 -11 -45 -3 -10 -60 -62 -54 -60 45 -8 -43 -89",
"output": "47\n2 2 2 2 2 3 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 4 2 2 2 2 2 2 2 2 2 3 2 2 2 2 3 2 "
},
{
"input": "100\n-78 -77 -84 -29 -99 -15 -60 97 -56 -9 -19 -21 -5 -29 -20 -41 -56 -15 -77 -22 -87 -75 -56 -96 -46 -24 -35 -64 63 -5 -16 -27 34 -77 84 -30 -9 -73 -58 -93 -20 -20 -69 -16 -42 -40 -44 -66 -42 -90 -47 -35 -87 -55 -37 -48 -34 -3 -40 -3 -46 -25 -80 -55 -12 -62 -46 -99 -38 -33 -72 -60 -18 -12 -52 -3 -75 -5 -48 -30 -59 -56 99 -52 -59 -72 -41 -15 -19 -19 -26 -28 -16 -23 -46 -93 -92 -38 -12 -75",
"output": "48\n1 2 2 2 3 2 2 2 2 2 2 2 2 2 3 3 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 2 2 2 2 2 2 2 2 "
},
{
"input": "100\n22 -83 -95 -61 -100 -53 -50 -19 -24 -85 -45 -43 -3 -74 -6 -24 -78 -54 -58 -52 -42 -16 -18 -56 -93 -45 -97 -67 -88 -27 83 -7 -72 -85 -24 -45 -22 -82 -83 -94 -75 -79 -22 -44 -22 -44 -42 -44 -61 85 -11 -16 -91 -12 -15 -3 -15 -82 -1 -2 -28 -24 -68 -22 -25 -46 -40 -21 -67 -90 -31 -33 -54 -83 -91 -74 -56 -67 -87 -36 -8 -100 -76 -88 -90 -45 -64 -25 -55 -15 -84 -67 -57 -73 -78 86 -28 -41 -63 -57",
"output": "48\n3 2 2 2 2 2 2 2 2 2 2 2 2 2 3 2 2 2 2 2 2 2 2 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 2 "
},
{
"input": "100\n-13 -43 -95 -61 -62 -94 -97 -48 -16 -88 -96 -74 -26 -58 -79 -44 -72 -22 -18 -66 -8 85 -98 -3 -36 -17 -80 -82 -77 -41 -24 -86 -62 -1 -22 -29 -30 -18 -25 -90 -66 -58 -86 -81 -34 -76 -67 -72 -77 -29 -66 -67 -34 3 -16 -90 -9 -14 -28 -60 -26 -99 75 -74 -94 -55 -54 -23 -30 -34 -4 -92 -88 -46 -52 -63 -98 -6 -89 -99 -80 -100 -97 -62 -70 -97 -75 -85 -22 -2 -32 -47 -85 -44 -23 -4 -21 -30 -6 -34",
"output": "49\n1 2 2 2 2 2 2 2 2 2 2 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 2 2 2 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "100\n-5 -37 -22 -85 -63 -46 -44 -43 -23 -77 -75 -64 -84 -46 -78 -94 -67 -19 -5 -59 -32 -92 -10 -92 -58 -73 -72 -16 99 -58 -94 -49 -60 -3 -60 -74 -12 -8 -32 -94 -63 -53 -24 -29 -6 -46 -30 -32 -87 -41 -58 -70 -53 -20 -73 -42 -54 -5 -84 -45 -11 -9 -84 -7 -68 -100 -11 -2 -87 -27 -65 -45 -17 -33 -88 -55 90 -58 -89 -13 -66 -1 -46 -90 -69 -74 -84 -90 -50 -32 -62 -37 -44 -51 -25 -94 -73 -43 -1 -44",
"output": "49\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "100\n-76 -48 -63 -62 -94 -37 -54 -67 -9 -52 -83 -1 -87 -36 -94 -10 -19 -55 -93 -23 -2 -87 -15 -59 -60 -87 -63 -18 -62 -92 -10 -61 -12 -89 -85 -38 -37 -3 -71 -22 -94 -96 -100 -47 -20 -93 -28 77 -35 -74 -50 -72 -38 -29 -58 -80 -24 -9 -59 -4 -93 -65 -31 -47 -36 -13 -89 -96 -99 -83 -99 -36 -45 -58 -22 -93 -51 -26 -93 -36 -85 -72 -49 -27 -69 -29 -51 -84 -35 -26 -41 -43 -45 -87 -65 -100 -45 -69 -69 -73",
"output": "50\n1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "100\n-77 -6 -71 -86 -42 -1 -40 -41 -31 -67 -75 -49 -62 -21 -2 -40 -2 -82 -90 -42 -43 -14 -72 -50 -33 -37 -58 -51 -67 -96 -63 -39 -56 -22 -17 -69 -88 -60 -18 -47 -16 -41 -32 -59 -82 -48 -22 -46 -29 -69 -21 -2 -41 -52 -83 -3 -49 -39 -31 -78 -60 -100 -12 -64 -28 -72 -43 -68 -60 -98 -21 -29 -72 -82 -5 -4 -65 -76 -60 -40 -37 -17 -77 -21 -19 -98 -39 -67 -49 -75 -7 -45 -11 -13 -45 -19 -83 -38 -14 -89",
"output": "50\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "4\n1 2 3 4",
"output": "1\n4 "
},
{
"input": "4\n1 2 3 -4",
"output": "1\n4 "
},
{
"input": "4\n-4 2 1 2",
"output": "1\n4 "
},
{
"input": "1\n-1",
"output": "1\n1 "
},
{
"input": "2\n2 -1",
"output": "1\n2 "
},
{
"input": "2\n-100 100",
"output": "1\n2 "
},
{
"input": "3\n-100 0 -100",
"output": "1\n3 "
},
{
"input": "5\n1 2 3 -1 -1",
"output": "1\n5 "
},
{
"input": "5\n-1 -1 2 3 4",
"output": "1\n5 "
},
{
"input": "3\n-3 -4 -5",
"output": "2\n1 2 "
},
{
"input": "4\n-3 -4 1 -3",
"output": "2\n1 3 "
},
{
"input": "1\n-1",
"output": "1\n1 "
},
{
"input": "2\n-1 0",
"output": "1\n2 "
},
{
"input": "4\n0 0 0 0",
"output": "1\n4 "
},
{
"input": "3\n-1 -1 -1",
"output": "2\n1 2 "
},
{
"input": "6\n-1 -1 0 -1 -1 -1",
"output": "3\n1 3 2 "
},
{
"input": "2\n0 0",
"output": "1\n2 "
},
{
"input": "6\n0 0 -1 -1 -1 0",
"output": "2\n3 3 "
}
] | 1,623,801,730
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 154
| 0
|
# https://codeforces.com/problemset/problem/250/A
import sys
input = sys.stdin.readline
############ ---- Input Functions ---- ############
def inp_int():
return (int(input()))
def inp_int_list():
return (list(map(int, input().split())))
def inp_str():
s = input()
return (list(s[:len(s) - 1]))
def invr():
return (map(int, input().split()))
def folder_generator(_profit_list):
folder_list = []
threshold = 2
cnt = 0
for i in range(len(_profit_list)):
if _profit_list[i]<0:
if threshold == 0:
folder_list.append(str(cnt))
threshold = 2
cnt = 0
threshold -= 1
cnt +=1
if i == len(_profit_list)-1:
folder_list.append(str(cnt))
return folder_list
return folder_list
if __name__ == '__main__':
day_num = inp_int()
profit_list = inp_int_list()
print(profit_list)
result = folder_generator(profit_list)
print(len(result))
print(' '.join(result))
|
Title: Paper Work
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus has been working in the analytic department of the "F.R.A.U.D." company for as much as *n* days. Right now his task is to make a series of reports about the company's performance for the last *n* days. We know that the main information in a day report is value *a**i*, the company's profit on the *i*-th day. If *a**i* is negative, then the company suffered losses on the *i*-th day.
Polycarpus should sort the daily reports into folders. Each folder should include data on the company's performance for several consecutive days. Of course, the information on each of the *n* days should be exactly in one folder. Thus, Polycarpus puts information on the first few days in the first folder. The information on the several following days goes to the second folder, and so on.
It is known that the boss reads one daily report folder per day. If one folder has three or more reports for the days in which the company suffered losses (*a**i*<=<<=0), he loses his temper and his wrath is terrible.
Therefore, Polycarpus wants to prepare the folders so that none of them contains information on three or more days with the loss, and the number of folders is minimal.
Write a program that, given sequence *a**i*, will print the minimum number of folders.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100), *n* is the number of days. The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=100), where *a**i* means the company profit on the *i*-th day. It is possible that the company has no days with the negative *a**i*.
Output Specification:
Print an integer *k* — the required minimum number of folders. In the second line print a sequence of integers *b*1, *b*2, ..., *b**k*, where *b**j* is the number of day reports in the *j*-th folder.
If there are multiple ways to sort the reports into *k* days, print any of them.
Demo Input:
['11\n1 2 3 -4 -5 -6 5 -5 -6 -7 6\n', '5\n0 -1 100 -1 0\n']
Demo Output:
['3\n5 3 3 ', '1\n5 ']
Note:
Here goes a way to sort the reports from the first sample into three folders:
In the second sample you can put all five reports in one folder.
|
```python
# https://codeforces.com/problemset/problem/250/A
import sys
input = sys.stdin.readline
############ ---- Input Functions ---- ############
def inp_int():
return (int(input()))
def inp_int_list():
return (list(map(int, input().split())))
def inp_str():
s = input()
return (list(s[:len(s) - 1]))
def invr():
return (map(int, input().split()))
def folder_generator(_profit_list):
folder_list = []
threshold = 2
cnt = 0
for i in range(len(_profit_list)):
if _profit_list[i]<0:
if threshold == 0:
folder_list.append(str(cnt))
threshold = 2
cnt = 0
threshold -= 1
cnt +=1
if i == len(_profit_list)-1:
folder_list.append(str(cnt))
return folder_list
return folder_list
if __name__ == '__main__':
day_num = inp_int()
profit_list = inp_int_list()
print(profit_list)
result = folder_generator(profit_list)
print(len(result))
print(' '.join(result))
```
| 0
|
|
34
|
A
|
Reconnaissance 2
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Reconnaissance 2
|
2
|
256
|
*n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit.
|
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction.
|
Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle.
|
[
"5\n10 12 13 15 10\n",
"4\n10 20 30 40\n"
] |
[
"5 1\n",
"1 2\n"
] |
none
| 500
|
[
{
"input": "5\n10 12 13 15 10",
"output": "5 1"
},
{
"input": "4\n10 20 30 40",
"output": "1 2"
},
{
"input": "6\n744 359 230 586 944 442",
"output": "2 3"
},
{
"input": "5\n826 747 849 687 437",
"output": "1 2"
},
{
"input": "5\n999 999 993 969 999",
"output": "1 2"
},
{
"input": "5\n4 24 6 1 15",
"output": "3 4"
},
{
"input": "2\n511 32",
"output": "1 2"
},
{
"input": "3\n907 452 355",
"output": "2 3"
},
{
"input": "4\n303 872 764 401",
"output": "4 1"
},
{
"input": "10\n684 698 429 694 956 812 594 170 937 764",
"output": "1 2"
},
{
"input": "20\n646 840 437 946 640 564 936 917 487 752 844 734 468 969 674 646 728 642 514 695",
"output": "7 8"
},
{
"input": "30\n996 999 998 984 989 1000 996 993 1000 983 992 999 999 1000 979 992 987 1000 996 1000 1000 989 981 996 995 999 999 989 999 1000",
"output": "12 13"
},
{
"input": "50\n93 27 28 4 5 78 59 24 19 134 31 128 118 36 90 32 32 1 44 32 33 13 31 10 12 25 38 50 25 12 4 22 28 53 48 83 4 25 57 31 71 24 8 7 28 86 23 80 101 58",
"output": "16 17"
},
{
"input": "88\n1000 1000 1000 1000 1000 998 998 1000 1000 1000 1000 999 999 1000 1000 1000 999 1000 997 999 997 1000 999 998 1000 999 1000 1000 1000 999 1000 999 999 1000 1000 999 1000 999 1000 1000 998 1000 1000 1000 998 998 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 999 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 998 1000 1000 998 1000 999 1000 1000 1000 1000",
"output": "1 2"
},
{
"input": "99\n4 4 21 6 5 3 13 2 6 1 3 4 1 3 1 9 11 1 6 17 4 5 20 4 1 9 5 11 3 4 14 1 3 3 1 4 3 5 27 1 1 2 10 7 11 4 19 7 11 6 11 13 3 1 10 7 2 1 16 1 9 4 29 13 2 12 14 2 21 1 9 8 26 12 12 5 2 14 7 8 8 8 9 4 12 2 6 6 7 16 8 14 2 10 20 15 3 7 4",
"output": "1 2"
},
{
"input": "100\n713 572 318 890 577 657 646 146 373 783 392 229 455 871 20 593 573 336 26 381 280 916 907 732 820 713 111 840 570 446 184 711 481 399 788 647 492 15 40 530 549 506 719 782 126 20 778 996 712 761 9 74 812 418 488 175 103 585 900 3 604 521 109 513 145 708 990 361 682 827 791 22 596 780 596 385 450 643 158 496 876 975 319 783 654 895 891 361 397 81 682 899 347 623 809 557 435 279 513 438",
"output": "86 87"
},
{
"input": "100\n31 75 86 68 111 27 22 22 26 30 54 163 107 75 160 122 14 23 17 26 27 20 43 58 59 71 21 148 9 32 43 91 133 286 132 70 90 156 84 14 77 93 23 18 13 72 18 131 33 28 72 175 30 86 249 20 14 208 28 57 63 199 6 10 24 30 62 267 43 479 60 28 138 1 45 3 19 47 7 166 116 117 50 140 28 14 95 85 93 43 61 15 2 70 10 51 7 95 9 25",
"output": "7 8"
},
{
"input": "100\n896 898 967 979 973 709 961 968 806 967 896 967 826 975 936 903 986 856 851 931 852 971 786 837 949 978 686 936 952 909 965 749 908 916 943 973 983 975 939 886 964 928 960 976 907 788 994 773 949 871 947 980 945 985 726 981 887 943 907 990 931 874 840 867 948 951 961 904 888 901 976 967 994 921 828 970 972 722 755 970 860 855 914 869 714 899 969 978 898 862 642 939 904 936 819 934 884 983 955 964",
"output": "1 2"
},
{
"input": "100\n994 927 872 970 815 986 952 996 965 1000 877 986 978 999 950 990 936 997 993 960 921 860 895 869 943 998 983 968 973 953 999 990 995 871 853 979 973 963 953 938 997 989 993 964 960 973 946 975 1000 962 920 746 989 957 904 965 920 979 966 961 1000 993 975 952 846 971 991 979 985 969 984 973 956 1000 952 778 983 974 956 927 995 997 980 997 1000 970 960 970 988 983 947 904 935 972 1000 863 992 996 932 967",
"output": "81 82"
},
{
"input": "100\n48 108 63 21 27 8 49 21 75 8 24 42 149 18 8 28 21 18 25 35 59 70 59 33 40 1 67 34 120 82 4 115 72 87 3 15 15 63 37 12 40 27 83 14 38 20 14 58 93 10 31 3 39 6 197 77 54 16 31 146 9 49 14 8 77 82 5 11 80 116 8 61 50 24 7 103 29 11 3 3 1 12 46 24 21 131 39 29 36 2 107 40 16 99 31 41 29 48 17 17",
"output": "36 37"
}
] | 1,629,199,230
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 20
| 184
| 20,172,800
|
n = int(input())
s = list(map(int,input().split(' ')))
m = float('inf')
for i in range(n):
temp = abs(s[i%n]-s[(i+1)%n])
if temp < m:
m = temp
idx = str((i)%n+1) + ' ' + str((i+1)%n+1)
print(idx)
|
Title: Reconnaissance 2
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
*n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit.
Input Specification:
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction.
Output Specification:
Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle.
Demo Input:
['5\n10 12 13 15 10\n', '4\n10 20 30 40\n']
Demo Output:
['5 1\n', '1 2\n']
Note:
none
|
```python
n = int(input())
s = list(map(int,input().split(' ')))
m = float('inf')
for i in range(n):
temp = abs(s[i%n]-s[(i+1)%n])
if temp < m:
m = temp
idx = str((i)%n+1) + ' ' + str((i+1)%n+1)
print(idx)
```
| 3.916425
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,593,946,230
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 156
| 6,656,000
|
t=int(input())
a=[int(a) for a in input().split()]
odd=0
even=0
for i in range(2):
if a[i]%2==0:
even+=1
else:
odd+=1
if odd>even:
for u in a:
if u%2==0:
print(u)
else:
for u in a:
if u%2==1:
print(u)
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
t=int(input())
a=[int(a) for a in input().split()]
odd=0
even=0
for i in range(2):
if a[i]%2==0:
even+=1
else:
odd+=1
if odd>even:
for u in a:
if u%2==0:
print(u)
else:
for u in a:
if u%2==1:
print(u)
```
| 0
|
20
|
B
|
Equation
|
PROGRAMMING
| 2,000
|
[
"math"
] |
B. Equation
|
1
|
256
|
You are given an equation:
Your task is to find the number of distinct roots of the equation and print all of them in ascending order.
|
The first line contains three integer numbers *A*,<=*B* and *C* (<=-<=105<=≤<=*A*,<=*B*,<=*C*<=≤<=105). Any coefficient may be equal to 0.
|
In case of infinite root count print the only integer -1. In case of no roots print the only integer 0. In other cases print the number of root on the first line and the roots on the following lines in the ascending order. Print roots with at least 5 digits after the decimal point.
|
[
"1 -5 6\n"
] |
[
"2\n2.0000000000\n3.0000000000"
] |
none
| 1,000
|
[
{
"input": "1 -5 6",
"output": "2\n2.0000000000\n3.0000000000"
},
{
"input": "1 1 1",
"output": "0"
},
{
"input": "1 2 1",
"output": "1\n-1.0000000000"
},
{
"input": "0 0 0",
"output": "-1"
},
{
"input": "0 -2 1",
"output": "1\n0.5000000000"
},
{
"input": "0 -2 0",
"output": "1\n0.0000000000"
},
{
"input": "0 0 1",
"output": "0"
},
{
"input": "0 0 -100000",
"output": "0"
},
{
"input": "0 10000 -100000",
"output": "1\n10.0000000000"
},
{
"input": "1 100000 -100000",
"output": "2\n-100000.9999900002\n0.9999900002"
},
{
"input": "0 3431 43123",
"output": "1\n-12.5686388808"
},
{
"input": "100 200 100",
"output": "1\n-1.0000000000"
},
{
"input": "50000 100000 50000",
"output": "1\n-1.0000000000"
},
{
"input": "-1 10 20",
"output": "2\n-1.7082039325\n11.7082039325"
},
{
"input": "-50000 100000 -50000",
"output": "1\n1.0000000000"
},
{
"input": "1 -2 1",
"output": "1\n1.0000000000"
},
{
"input": "1000 -5000 6000",
"output": "2\n2.0000000000\n3.0000000000"
},
{
"input": "0 -100000 0",
"output": "1\n0.0000000000"
},
{
"input": "1 -100000 0",
"output": "2\n0.0000000000\n100000.0000000000"
},
{
"input": "1223 -23532 1232",
"output": "2\n0.0524974745\n19.1887126645"
},
{
"input": "-1 -2 -1",
"output": "1\n-1.0000000000"
},
{
"input": "1 0 0",
"output": "1\n0.0000000000"
},
{
"input": "0 1 0",
"output": "1\n-0.0000000000"
},
{
"input": "0 0 1",
"output": "0"
},
{
"input": "0 1 -1",
"output": "1\n1.0000000000"
},
{
"input": "5 0 5",
"output": "0"
},
{
"input": "-2 -5 0",
"output": "2\n-2.5000000000\n-0.0000000000"
},
{
"input": "-2 -4 0",
"output": "2\n-2.0000000000\n-0.0000000000"
},
{
"input": "-2 0 0",
"output": "1\n-0.0000000000"
},
{
"input": "0 -4 -4",
"output": "1\n-1.0000000000"
},
{
"input": "1 1 0",
"output": "2\n-1.0000000000\n0.0000000000"
},
{
"input": "1 0 1",
"output": "0"
},
{
"input": "1 1 1",
"output": "0"
},
{
"input": "0 0 0",
"output": "-1"
}
] | 1,664,522,698
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 46
| 0
|
A=float(input())
B=float(input())
C=float(input())
if B*B-4*A*C>=0:
X1=-float(B+(B*B-4*A*C)**0.5)
X2=float(X1/2*A)
Y1=-float(B-(B*B-4*A*C)**0.5)
Y2=float(Y1/2*A)
print(X2,Y2)
else:
print("0")
|
Title: Equation
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given an equation:
Your task is to find the number of distinct roots of the equation and print all of them in ascending order.
Input Specification:
The first line contains three integer numbers *A*,<=*B* and *C* (<=-<=105<=≤<=*A*,<=*B*,<=*C*<=≤<=105). Any coefficient may be equal to 0.
Output Specification:
In case of infinite root count print the only integer -1. In case of no roots print the only integer 0. In other cases print the number of root on the first line and the roots on the following lines in the ascending order. Print roots with at least 5 digits after the decimal point.
Demo Input:
['1 -5 6\n']
Demo Output:
['2\n2.0000000000\n3.0000000000']
Note:
none
|
```python
A=float(input())
B=float(input())
C=float(input())
if B*B-4*A*C>=0:
X1=-float(B+(B*B-4*A*C)**0.5)
X2=float(X1/2*A)
Y1=-float(B-(B*B-4*A*C)**0.5)
Y2=float(Y1/2*A)
print(X2,Y2)
else:
print("0")
```
| -1
|
949
|
A
|
Zebras
|
PROGRAMMING
| 1,600
|
[
"greedy"
] | null | null |
Oleg writes down the history of the days he lived. For each day he decides if it was good or bad. Oleg calls a non-empty sequence of days a zebra, if it starts with a bad day, ends with a bad day, and good and bad days are alternating in it. Let us denote bad days as 0 and good days as 1. Then, for example, sequences of days 0, 010, 01010 are zebras, while sequences 1, 0110, 0101 are not.
Oleg tells you the story of days he lived in chronological order in form of string consisting of 0 and 1. Now you are interested if it is possible to divide Oleg's life history into several subsequences, each of which is a zebra, and the way it can be done. Each day must belong to exactly one of the subsequences. For each of the subsequences, days forming it must be ordered chronologically. Note that subsequence does not have to be a group of consecutive days.
|
In the only line of input data there is a non-empty string *s* consisting of characters 0 and 1, which describes the history of Oleg's life. Its length (denoted as |*s*|) does not exceed 200<=000 characters.
|
If there is a way to divide history into zebra subsequences, in the first line of output you should print an integer *k* (1<=≤<=*k*<=≤<=|*s*|), the resulting number of subsequences. In the *i*-th of following *k* lines first print the integer *l**i* (1<=≤<=*l**i*<=≤<=|*s*|), which is the length of the *i*-th subsequence, and then *l**i* indices of days forming the subsequence. Indices must follow in ascending order. Days are numbered starting from 1. Each index from 1 to *n* must belong to exactly one subsequence. If there is no way to divide day history into zebra subsequences, print -1.
Subsequences may be printed in any order. If there are several solutions, you may print any of them. You do not have to minimize nor maximize the value of *k*.
|
[
"0010100\n",
"111\n"
] |
[
"3\n3 1 3 4\n3 2 5 6\n1 7\n",
"-1\n"
] |
none
| 500
|
[
{
"input": "0010100",
"output": "3\n1 1\n5 2 3 4 5 6\n1 7"
},
{
"input": "111",
"output": "-1"
},
{
"input": "0",
"output": "1\n1 1"
},
{
"input": "1",
"output": "-1"
},
{
"input": "0101010101",
"output": "-1"
},
{
"input": "010100001",
"output": "-1"
},
{
"input": "000111000",
"output": "3\n3 1 6 7\n3 2 5 8\n3 3 4 9"
},
{
"input": "0101001000",
"output": "4\n5 1 2 3 4 5\n3 6 7 8\n1 9\n1 10"
},
{
"input": "0000001000",
"output": "8\n1 1\n1 2\n1 3\n1 4\n1 5\n3 6 7 8\n1 9\n1 10"
},
{
"input": "0101",
"output": "-1"
},
{
"input": "000101110",
"output": "-1"
},
{
"input": "010101010",
"output": "1\n9 1 2 3 4 5 6 7 8 9"
},
{
"input": "0101001010",
"output": "2\n5 1 2 3 4 5\n5 6 7 8 9 10"
},
{
"input": "0100101100",
"output": "2\n5 1 2 3 8 9\n5 4 5 6 7 10"
},
{
"input": "0110100000",
"output": "-1"
},
{
"input": "0000000000",
"output": "10\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10"
},
{
"input": "1111111111",
"output": "-1"
},
{
"input": "0010101100",
"output": "2\n3 1 8 9\n7 2 3 4 5 6 7 10"
},
{
"input": "1010000",
"output": "-1"
},
{
"input": "0001110",
"output": "-1"
},
{
"input": "0000000000011001100011110101000101000010010111000100110110000011010011110110001100100001001001010010",
"output": "22\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n7 9 24 25 26 27 28 29\n7 10 13 14 17 18 23 30\n11 11 12 15 16 19 22 31 32 33 34 35\n3 20 21 36\n3 37 46 47\n9 38 39 40 45 48 57 58 75 76\n17 41 42 43 44 49 50 51 54 55 56 59 72 73 74 77 80 81\n9 52 53 60 71 78 79 82 83 84\n7 61 64 65 66 67 70 85\n5 62 63 68 69 86\n3 87 88 89\n3 90 91 92\n5 93 94 95 96 97\n3 98 99 100"
},
{
"input": "01010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010",
"output": "1\n245 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "0010011100000000",
"output": "8\n3 1 8 9\n5 2 3 4 7 10\n3 5 6 11\n1 12\n1 13\n1 14\n1 15\n1 16"
}
] | 1,620,883,000
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 61
| 20,172,800
|
import sys
input=sys.stdin.readline
s=list(input().rstrip())
n=len(s)
for i in range(n):
s[i]=int(s[i])
end0=[]
end1=[]
for i in range(n):
if s[i]==1:
if len(end0)==0:
print(-1)
exit()
else:
arr=end0.pop()+[i+1]
end1.append(arr)
else:
if len(end1)>0:
arr=end1.pop()+[i+1]
end0.append(arr)
else:
end0.append([i+1])
if len(end1)>0:
print(-1)
else:
print(len(end0))
for x in end0:
print(*x)
|
Title: Zebras
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Oleg writes down the history of the days he lived. For each day he decides if it was good or bad. Oleg calls a non-empty sequence of days a zebra, if it starts with a bad day, ends with a bad day, and good and bad days are alternating in it. Let us denote bad days as 0 and good days as 1. Then, for example, sequences of days 0, 010, 01010 are zebras, while sequences 1, 0110, 0101 are not.
Oleg tells you the story of days he lived in chronological order in form of string consisting of 0 and 1. Now you are interested if it is possible to divide Oleg's life history into several subsequences, each of which is a zebra, and the way it can be done. Each day must belong to exactly one of the subsequences. For each of the subsequences, days forming it must be ordered chronologically. Note that subsequence does not have to be a group of consecutive days.
Input Specification:
In the only line of input data there is a non-empty string *s* consisting of characters 0 and 1, which describes the history of Oleg's life. Its length (denoted as |*s*|) does not exceed 200<=000 characters.
Output Specification:
If there is a way to divide history into zebra subsequences, in the first line of output you should print an integer *k* (1<=≤<=*k*<=≤<=|*s*|), the resulting number of subsequences. In the *i*-th of following *k* lines first print the integer *l**i* (1<=≤<=*l**i*<=≤<=|*s*|), which is the length of the *i*-th subsequence, and then *l**i* indices of days forming the subsequence. Indices must follow in ascending order. Days are numbered starting from 1. Each index from 1 to *n* must belong to exactly one subsequence. If there is no way to divide day history into zebra subsequences, print -1.
Subsequences may be printed in any order. If there are several solutions, you may print any of them. You do not have to minimize nor maximize the value of *k*.
Demo Input:
['0010100\n', '111\n']
Demo Output:
['3\n3 1 3 4\n3 2 5 6\n1 7\n', '-1\n']
Note:
none
|
```python
import sys
input=sys.stdin.readline
s=list(input().rstrip())
n=len(s)
for i in range(n):
s[i]=int(s[i])
end0=[]
end1=[]
for i in range(n):
if s[i]==1:
if len(end0)==0:
print(-1)
exit()
else:
arr=end0.pop()+[i+1]
end1.append(arr)
else:
if len(end1)>0:
arr=end1.pop()+[i+1]
end0.append(arr)
else:
end0.append([i+1])
if len(end1)>0:
print(-1)
else:
print(len(end0))
for x in end0:
print(*x)
```
| 0
|
|
219
|
A
|
k-String
|
PROGRAMMING
| 1,000
|
[
"implementation",
"strings"
] | null | null |
A string is called a *k*-string if it can be represented as *k* concatenated copies of some string. For example, the string "aabaabaabaab" is at the same time a 1-string, a 2-string and a 4-string, but it is not a 3-string, a 5-string, or a 6-string and so on. Obviously any string is a 1-string.
You are given a string *s*, consisting of lowercase English letters and a positive integer *k*. Your task is to reorder the letters in the string *s* in such a way that the resulting string is a *k*-string.
|
The first input line contains integer *k* (1<=≤<=*k*<=≤<=1000). The second line contains *s*, all characters in *s* are lowercase English letters. The string length *s* satisfies the inequality 1<=≤<=|*s*|<=≤<=1000, where |*s*| is the length of string *s*.
|
Rearrange the letters in string *s* in such a way that the result is a *k*-string. Print the result on a single output line. If there are multiple solutions, print any of them.
If the solution doesn't exist, print "-1" (without quotes).
|
[
"2\naazz\n",
"3\nabcabcabz\n"
] |
[
"azaz\n",
"-1\n"
] |
none
| 500
|
[
{
"input": "2\naazz",
"output": "azaz"
},
{
"input": "3\nabcabcabz",
"output": "-1"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "2\nabba",
"output": "abab"
},
{
"input": "2\naaab",
"output": "-1"
},
{
"input": "7\nabacaba",
"output": "-1"
},
{
"input": "5\naaaaa",
"output": "aaaaa"
},
{
"input": "3\naabaaaaabb",
"output": "-1"
},
{
"input": "2\naaab",
"output": "-1"
},
{
"input": "2\nbabac",
"output": "-1"
},
{
"input": "3\nbbbccc",
"output": "bcbcbc"
},
{
"input": "2\naa",
"output": "aa"
},
{
"input": "250\ncececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececece",
"output": "cececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececece"
},
{
"input": "15\nabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaa",
"output": "aaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbc"
},
{
"input": "1\naaa",
"output": "aaa"
},
{
"input": "1\naabaab",
"output": "aaaabb"
},
{
"input": "2\naabbbbccccccdddddddd",
"output": "abbcccddddabbcccdddd"
},
{
"input": "3\naaaaaaaaacccdddddd",
"output": "aaacddaaacddaaacdd"
},
{
"input": "3\naaaaaaaaacccbbbbbb",
"output": "aaabbcaaabbcaaabbc"
},
{
"input": "2\naazzzz",
"output": "azzazz"
},
{
"input": "2\naaaa",
"output": "aaaa"
},
{
"input": "2\naaaazz",
"output": "aazaaz"
},
{
"input": "2\naaaabb",
"output": "aabaab"
},
{
"input": "2\naabbbb",
"output": "abbabb"
},
{
"input": "2\naaaazzzz",
"output": "aazzaazz"
},
{
"input": "2\naaazz",
"output": "-1"
},
{
"input": "2\nbbbbaa",
"output": "abbabb"
},
{
"input": "2\naaaaaabbbb",
"output": "aaabbaaabb"
},
{
"input": "2\naaaaaazz",
"output": "aaazaaaz"
},
{
"input": "2\naaaabbbb",
"output": "aabbaabb"
},
{
"input": "2\naabaab",
"output": "aabaab"
},
{
"input": "1\naaaaa",
"output": "aaaaa"
},
{
"input": "2\nbbaaaa",
"output": "aabaab"
},
{
"input": "2\nacaccc",
"output": "accacc"
}
] | 1,665,211,396
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 92
| 0
|
n = int(input())
s = sorted(input())
t = s[::n]*n
print("".join(t) if sorted(t) == s else -1)
|
Title: k-String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A string is called a *k*-string if it can be represented as *k* concatenated copies of some string. For example, the string "aabaabaabaab" is at the same time a 1-string, a 2-string and a 4-string, but it is not a 3-string, a 5-string, or a 6-string and so on. Obviously any string is a 1-string.
You are given a string *s*, consisting of lowercase English letters and a positive integer *k*. Your task is to reorder the letters in the string *s* in such a way that the resulting string is a *k*-string.
Input Specification:
The first input line contains integer *k* (1<=≤<=*k*<=≤<=1000). The second line contains *s*, all characters in *s* are lowercase English letters. The string length *s* satisfies the inequality 1<=≤<=|*s*|<=≤<=1000, where |*s*| is the length of string *s*.
Output Specification:
Rearrange the letters in string *s* in such a way that the result is a *k*-string. Print the result on a single output line. If there are multiple solutions, print any of them.
If the solution doesn't exist, print "-1" (without quotes).
Demo Input:
['2\naazz\n', '3\nabcabcabz\n']
Demo Output:
['azaz\n', '-1\n']
Note:
none
|
```python
n = int(input())
s = sorted(input())
t = s[::n]*n
print("".join(t) if sorted(t) == s else -1)
```
| 3
|
|
765
|
A
|
Neverending competitions
|
PROGRAMMING
| 900
|
[
"implementation",
"math"
] | null | null |
There are literally dozens of snooker competitions held each year, and team Jinotega tries to attend them all (for some reason they prefer name "snookah")! When a competition takes place somewhere far from their hometown, Ivan, Artsem and Konstantin take a flight to the contest and back.
Jinotega's best friends, team Base have found a list of their itinerary receipts with information about departure and arrival airports. Now they wonder, where is Jinotega now: at home or at some competition far away? They know that:
- this list contains all Jinotega's flights in this year (in arbitrary order), - Jinotega has only flown from his hometown to a snooker contest and back, - after each competition Jinotega flies back home (though they may attend a competition in one place several times), - and finally, at the beginning of the year Jinotega was at home.
Please help them to determine Jinotega's location!
|
In the first line of input there is a single integer *n*: the number of Jinotega's flights (1<=≤<=*n*<=≤<=100). In the second line there is a string of 3 capital Latin letters: the name of Jinotega's home airport. In the next *n* lines there is flight information, one flight per line, in form "XXX->YYY", where "XXX" is the name of departure airport "YYY" is the name of arrival airport. Exactly one of these airports is Jinotega's home airport.
It is guaranteed that flights information is consistent with the knowledge of Jinotega's friends, which is described in the main part of the statement.
|
If Jinotega is now at home, print "home" (without quotes), otherwise print "contest".
|
[
"4\nSVO\nSVO->CDG\nLHR->SVO\nSVO->LHR\nCDG->SVO\n",
"3\nSVO\nSVO->HKT\nHKT->SVO\nSVO->RAP\n"
] |
[
"home\n",
"contest\n"
] |
In the first sample Jinotega might first fly from SVO to CDG and back, and then from SVO to LHR and back, so now they should be at home. In the second sample Jinotega must now be at RAP because a flight from RAP back to SVO is not on the list.
| 500
|
[
{
"input": "4\nSVO\nSVO->CDG\nLHR->SVO\nSVO->LHR\nCDG->SVO",
"output": "home"
},
{
"input": "3\nSVO\nSVO->HKT\nHKT->SVO\nSVO->RAP",
"output": "contest"
},
{
"input": "1\nESJ\nESJ->TSJ",
"output": "contest"
},
{
"input": "2\nXMR\nFAJ->XMR\nXMR->FAJ",
"output": "home"
},
{
"input": "3\nZIZ\nDWJ->ZIZ\nZIZ->DWJ\nZIZ->DWJ",
"output": "contest"
},
{
"input": "10\nPVO\nDMN->PVO\nDMN->PVO\nPVO->DMN\nDMN->PVO\nPVO->DMN\nPVO->DMN\nPVO->DMN\nDMN->PVO\nPVO->DMN\nDMN->PVO",
"output": "home"
},
{
"input": "11\nIAU\nIAU->RUQ\nIAU->RUQ\nRUQ->IAU\nRUQ->IAU\nIAU->RUQ\nRUQ->IAU\nIAU->RUQ\nRUQ->IAU\nIAU->RUQ\nIAU->RUQ\nRUQ->IAU",
"output": "contest"
},
{
"input": "10\nHPN\nDFI->HPN\nHPN->KAB\nHPN->DFI\nVSO->HPN\nHPN->KZX\nHPN->VSO\nKZX->HPN\nLDW->HPN\nKAB->HPN\nHPN->LDW",
"output": "home"
},
{
"input": "11\nFGH\nFGH->BRZ\nUBK->FGH\nQRE->FGH\nFGH->KQK\nFGH->QRE\nKQK->FGH\nFGH->UBK\nBRZ->FGH\nFGH->ALX\nALX->FGH\nFGH->KQK",
"output": "contest"
},
{
"input": "50\nPFH\nJFV->PFH\nBVP->PFH\nPFH->BVP\nPFH->JFV\nPFH->ETQ\nPFH->LQJ\nZTO->PFH\nPFH->BVP\nPFH->RXO\nPFH->ZTO\nHWL->PFH\nPFH->HIV\nPFH->AFP\nPFH->HWL\nOBB->PFH\nHIV->PFH\nPFH->LSR\nAFP->PFH\nLQJ->PFH\nHWL->PFH\nETQ->PFH\nPFH->HWL\nLSR->PFH\nWBR->PFH\nBNZ->PFH\nHQR->PFH\nZTO->PFH\nPFH->WBR\nPFH->BYJ\nRXO->PFH\nFHZ->PFH\nFHZ->PFH\nPFN->PFH\nPFH->GMB\nPFH->JFV\nJFV->PFH\nGNZ->PFH\nPFH->BNZ\nPFH->GNZ\nPFH->HQR\nBYJ->PFH\nGMB->PFH\nPFH->FHZ\nPFH->FHZ\nPFH->ZTO\nPFH->UGD\nBVP->PFH\nUGD->PFH\nPFH->PFN\nPFH->OBB",
"output": "home"
},
{
"input": "1\nAAK\nAAK->ABA",
"output": "contest"
},
{
"input": "1\nXYZ\nXYZ->XYR",
"output": "contest"
}
] | 1,632,923,380
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 5
| 92
| 20,275,200
|
from collections import defaultdict
def solve(h,d):
if(len(d[h])==len(d)-1):
return "home"
return "contest"
n = int(input())
h = input()
d = defaultdict(list)
for i in range(n):
l = input().split("->")
d[l[0]].append(l[-1])
print(solve(h,d))
|
Title: Neverending competitions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are literally dozens of snooker competitions held each year, and team Jinotega tries to attend them all (for some reason they prefer name "snookah")! When a competition takes place somewhere far from their hometown, Ivan, Artsem and Konstantin take a flight to the contest and back.
Jinotega's best friends, team Base have found a list of their itinerary receipts with information about departure and arrival airports. Now they wonder, where is Jinotega now: at home or at some competition far away? They know that:
- this list contains all Jinotega's flights in this year (in arbitrary order), - Jinotega has only flown from his hometown to a snooker contest and back, - after each competition Jinotega flies back home (though they may attend a competition in one place several times), - and finally, at the beginning of the year Jinotega was at home.
Please help them to determine Jinotega's location!
Input Specification:
In the first line of input there is a single integer *n*: the number of Jinotega's flights (1<=≤<=*n*<=≤<=100). In the second line there is a string of 3 capital Latin letters: the name of Jinotega's home airport. In the next *n* lines there is flight information, one flight per line, in form "XXX->YYY", where "XXX" is the name of departure airport "YYY" is the name of arrival airport. Exactly one of these airports is Jinotega's home airport.
It is guaranteed that flights information is consistent with the knowledge of Jinotega's friends, which is described in the main part of the statement.
Output Specification:
If Jinotega is now at home, print "home" (without quotes), otherwise print "contest".
Demo Input:
['4\nSVO\nSVO->CDG\nLHR->SVO\nSVO->LHR\nCDG->SVO\n', '3\nSVO\nSVO->HKT\nHKT->SVO\nSVO->RAP\n']
Demo Output:
['home\n', 'contest\n']
Note:
In the first sample Jinotega might first fly from SVO to CDG and back, and then from SVO to LHR and back, so now they should be at home. In the second sample Jinotega must now be at RAP because a flight from RAP back to SVO is not on the list.
|
```python
from collections import defaultdict
def solve(h,d):
if(len(d[h])==len(d)-1):
return "home"
return "contest"
n = int(input())
h = input()
d = defaultdict(list)
for i in range(n):
l = input().split("->")
d[l[0]].append(l[-1])
print(solve(h,d))
```
| 0
|
|
320
|
A
|
Magic Numbers
|
PROGRAMMING
| 900
|
[
"brute force",
"greedy"
] | null | null |
A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not.
You're given a number. Determine if it is a magic number or not.
|
The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros.
|
Print "YES" if *n* is a magic number or print "NO" if it's not.
|
[
"114114\n",
"1111\n",
"441231\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "114114",
"output": "YES"
},
{
"input": "1111",
"output": "YES"
},
{
"input": "441231",
"output": "NO"
},
{
"input": "1",
"output": "YES"
},
{
"input": "14",
"output": "YES"
},
{
"input": "114",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "414",
"output": "NO"
},
{
"input": "1000000000",
"output": "NO"
},
{
"input": "144144144",
"output": "YES"
},
{
"input": "1444",
"output": "NO"
},
{
"input": "11",
"output": "YES"
},
{
"input": "141414141",
"output": "YES"
},
{
"input": "11110111",
"output": "NO"
},
{
"input": "114114144",
"output": "YES"
},
{
"input": "444",
"output": "NO"
},
{
"input": "9999",
"output": "NO"
},
{
"input": "111444",
"output": "NO"
},
{
"input": "11114",
"output": "YES"
},
{
"input": "41111",
"output": "NO"
},
{
"input": "114414441",
"output": "NO"
},
{
"input": "144414441",
"output": "NO"
},
{
"input": "144244144",
"output": "NO"
},
{
"input": "111111111",
"output": "YES"
},
{
"input": "144444444",
"output": "NO"
},
{
"input": "444444444",
"output": "NO"
},
{
"input": "141441441",
"output": "YES"
},
{
"input": "441",
"output": "NO"
},
{
"input": "15",
"output": "NO"
},
{
"input": "14444",
"output": "NO"
},
{
"input": "11444",
"output": "NO"
},
{
"input": "144",
"output": "YES"
},
{
"input": "1414414",
"output": "YES"
},
{
"input": "141444",
"output": "NO"
},
{
"input": "14144",
"output": "YES"
},
{
"input": "4",
"output": "NO"
},
{
"input": "1144",
"output": "YES"
},
{
"input": "141111444",
"output": "NO"
},
{
"input": "14414414",
"output": "YES"
},
{
"input": "141414144",
"output": "YES"
},
{
"input": "1414",
"output": "YES"
},
{
"input": "1441",
"output": "YES"
},
{
"input": "12",
"output": "NO"
},
{
"input": "144144141",
"output": "YES"
},
{
"input": "144144",
"output": "YES"
},
{
"input": "14414411",
"output": "YES"
},
{
"input": "14414",
"output": "YES"
}
] | 1,648,450,122
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 92
| 0
|
s = input()
flag = 1
p = ''
if(s[0] != '1'):
print('NO')
else:
for i in range(len(s)):
if( s[i] == '4' and ((i>=1 and s[i-1] != '1') and (i>=2 and s[i-2:i] != '14'))):
flag = 0
break
if(s[i] != '4' and s[i] != '1'):
flag = 0
break
if(flag == 1):
print('YES')
else:
print('NO')
|
Title: Magic Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not.
You're given a number. Determine if it is a magic number or not.
Input Specification:
The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros.
Output Specification:
Print "YES" if *n* is a magic number or print "NO" if it's not.
Demo Input:
['114114\n', '1111\n', '441231\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
none
|
```python
s = input()
flag = 1
p = ''
if(s[0] != '1'):
print('NO')
else:
for i in range(len(s)):
if( s[i] == '4' and ((i>=1 and s[i-1] != '1') and (i>=2 and s[i-2:i] != '14'))):
flag = 0
break
if(s[i] != '4' and s[i] != '1'):
flag = 0
break
if(flag == 1):
print('YES')
else:
print('NO')
```
| 3
|
|
868
|
A
|
Bark to Unlock
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"strings"
] | null | null |
As technologies develop, manufacturers are making the process of unlocking a phone as user-friendly as possible. To unlock its new phone, Arkady's pet dog Mu-mu has to bark the password once. The phone represents a password as a string of two lowercase English letters.
Mu-mu's enemy Kashtanka wants to unlock Mu-mu's phone to steal some sensible information, but it can only bark *n* distinct words, each of which can be represented as a string of two lowercase English letters. Kashtanka wants to bark several words (not necessarily distinct) one after another to pronounce a string containing the password as a substring. Tell if it's possible to unlock the phone in this way, or not.
|
The first line contains two lowercase English letters — the password on the phone.
The second line contains single integer *n* (1<=≤<=*n*<=≤<=100) — the number of words Kashtanka knows.
The next *n* lines contain two lowercase English letters each, representing the words Kashtanka knows. The words are guaranteed to be distinct.
|
Print "YES" if Kashtanka can bark several words in a line forming a string containing the password, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower).
|
[
"ya\n4\nah\noy\nto\nha\n",
"hp\n2\nht\ntp\n",
"ah\n1\nha\n"
] |
[
"YES\n",
"NO\n",
"YES\n"
] |
In the first example the password is "ya", and Kashtanka can bark "oy" and then "ah", and then "ha" to form the string "oyahha" which contains the password. So, the answer is "YES".
In the second example Kashtanka can't produce a string containing password as a substring. Note that it can bark "ht" and then "tp" producing "http", but it doesn't contain the password "hp" as a substring.
In the third example the string "hahahaha" contains "ah" as a substring.
| 250
|
[
{
"input": "ya\n4\nah\noy\nto\nha",
"output": "YES"
},
{
"input": "hp\n2\nht\ntp",
"output": "NO"
},
{
"input": "ah\n1\nha",
"output": "YES"
},
{
"input": "bb\n4\nba\nab\naa\nbb",
"output": "YES"
},
{
"input": "bc\n4\nca\nba\nbb\ncc",
"output": "YES"
},
{
"input": "ba\n4\ncd\nad\ncc\ncb",
"output": "YES"
},
{
"input": "pg\n4\nzl\nxs\ndi\nxn",
"output": "NO"
},
{
"input": "bn\n100\ndf\nyb\nze\nml\nyr\nof\nnw\nfm\ndw\nlv\nzr\nhu\nzt\nlw\nld\nmo\nxz\ntp\nmr\nou\nme\npx\nvp\nes\nxi\nnr\nbx\nqc\ngm\njs\nkn\ntw\nrq\nkz\nuc\nvc\nqr\nab\nna\nro\nya\nqy\ngu\nvk\nqk\ngs\nyq\nop\nhw\nrj\neo\nlz\nbh\nkr\nkb\nma\nrd\nza\nuf\nhq\nmc\nmn\nti\nwn\nsh\nax\nsi\nnd\ntz\ndu\nfj\nkl\nws\now\nnf\nvr\nye\nzc\niw\nfv\nkv\noo\nsm\nbc\nrs\nau\nuz\nuv\ngh\nsu\njn\ndz\nrl\nwj\nbk\nzl\nas\nms\nit\nwu",
"output": "YES"
},
{
"input": "bb\n1\naa",
"output": "NO"
},
{
"input": "qm\n25\nqw\nwe\ner\nrt\nty\nyu\nui\nio\nop\npa\nas\nsd\ndf\nfg\ngh\nhj\njk\nkl\nlz\nzx\nxc\ncv\nvb\nbn\nnm",
"output": "NO"
},
{
"input": "mq\n25\nqw\nwe\ner\nrt\nty\nyu\nui\nio\nop\npa\nas\nsd\ndf\nfg\ngh\nhj\njk\nkl\nlz\nzx\nxc\ncv\nvb\nbn\nnm",
"output": "YES"
},
{
"input": "aa\n1\naa",
"output": "YES"
},
{
"input": "bb\n1\nbb",
"output": "YES"
},
{
"input": "ba\n1\ncc",
"output": "NO"
},
{
"input": "ha\n1\nha",
"output": "YES"
},
{
"input": "aa\n1\naa",
"output": "YES"
},
{
"input": "ez\n1\njl",
"output": "NO"
},
{
"input": "aa\n2\nab\nba",
"output": "YES"
},
{
"input": "aa\n2\nca\ncc",
"output": "NO"
},
{
"input": "dd\n2\nac\ndc",
"output": "NO"
},
{
"input": "qc\n2\nyc\nkr",
"output": "NO"
},
{
"input": "aa\n3\nba\nbb\nab",
"output": "YES"
},
{
"input": "ca\n3\naa\nbb\nab",
"output": "NO"
},
{
"input": "ca\n3\nbc\nbd\nca",
"output": "YES"
},
{
"input": "dd\n3\nmt\nrg\nxl",
"output": "NO"
},
{
"input": "be\n20\nad\ncd\ncb\ndb\ndd\naa\nab\nca\nae\ned\ndc\nbb\nba\nda\nee\nea\ncc\nac\nec\neb",
"output": "YES"
},
{
"input": "fc\n20\nca\nbb\nce\nfd\nde\nfa\ncc\nec\nfb\nfc\nff\nbe\ncf\nba\ndb\ned\naf\nae\nda\nef",
"output": "YES"
},
{
"input": "ca\n20\ndc\naf\ndf\neg\naa\nbc\nea\nbd\nab\ndb\ngc\nfb\nba\nbe\nee\ngf\ncf\nag\nga\nca",
"output": "YES"
},
{
"input": "ke\n20\nzk\nra\nbq\nqz\nwt\nzg\nmz\nuk\nge\nuv\nud\nfd\neh\ndm\nsk\nki\nfv\ntp\nat\nfb",
"output": "YES"
},
{
"input": "hh\n50\nag\nhg\ndg\nfh\neg\ngh\ngd\nda\nbh\nab\nhf\ndc\nhb\nfe\nad\nec\nac\nfd\nca\naf\ncg\nhd\neb\nce\nhe\nha\ngb\nea\nae\nfb\nff\nbe\nch\nhh\nee\nde\nge\ngf\naa\ngg\neh\ned\nbf\nfc\nah\nga\nbd\ncb\nbg\nbc",
"output": "YES"
},
{
"input": "id\n50\nhi\ndc\nfg\nee\ngi\nhc\nac\nih\ndg\nfc\nde\ned\nie\neb\nic\ncf\nib\nfa\ngc\nba\nbe\nga\nha\nhg\nia\ndf\nab\nei\neh\nad\nii\nci\ndh\nec\nif\ndi\nbg\nag\nhe\neg\nca\nae\ndb\naa\nid\nfh\nhh\ncc\nfb\ngb",
"output": "YES"
},
{
"input": "fe\n50\nje\nbi\nbg\ngc\nfb\nig\ndf\nji\ndg\nfe\nfc\ncf\ngf\nai\nhe\nac\nch\nja\ngh\njf\nge\ncb\nij\ngb\ncg\naf\neh\nee\nhd\njd\njb\nii\nca\nci\nga\nab\nhi\nag\nfj\nej\nfi\nie\ndj\nfg\nef\njc\njg\njh\nhf\nha",
"output": "YES"
},
{
"input": "rn\n50\nba\nec\nwg\nao\nlk\nmz\njj\ncf\nfa\njk\ndy\nsz\njs\nzr\nqv\ntx\nwv\nrd\nqw\nls\nrr\nvt\nrx\nkc\neh\nnj\niq\nyi\nkh\nue\nnv\nkz\nrn\nes\nua\nzf\nvu\nll\neg\nmj\ncz\nzj\nxz\net\neb\nci\nih\nig\nam\nvd",
"output": "YES"
},
{
"input": "ee\n100\nah\nfb\ncd\nbi\nii\nai\nid\nag\nie\nha\ndi\nec\nae\nce\njb\ndg\njg\ngd\ngf\nda\nih\nbd\nhj\ngg\nhb\ndf\ned\nfh\naf\nja\nci\nfc\nic\nji\nac\nhi\nfj\nch\nbc\njd\naa\nff\nad\ngj\nej\nde\nee\nhe\ncf\nga\nia\ncg\nbb\nhc\nbe\ngi\njf\nbg\naj\njj\nbh\nfe\ndj\nef\ngb\nge\ndb\nig\ncj\ndc\nij\njh\nei\ndd\nib\nhf\neg\nbf\nfg\nab\ngc\nfd\nhd\ngh\neh\njc\neb\nhh\nca\nje\nbj\nif\nea\nhg\nfa\ncc\nba\ndh\ncb\nfi",
"output": "YES"
},
{
"input": "if\n100\njd\nbc\nje\nhi\nga\nde\nkb\nfc\ncd\ngd\naj\ncb\nei\nbf\ncf\ndk\ndb\ncg\nki\ngg\nkg\nfa\nkj\nii\njf\njg\ngb\nbh\nbg\neh\nhj\nhb\ndg\ndj\njc\njb\nce\ndi\nig\nci\ndf\nji\nhc\nfk\naf\nac\ngk\nhd\nae\nkd\nec\nkc\neb\nfh\nij\nie\nca\nhh\nkf\nha\ndd\nif\nef\nih\nhg\nej\nfe\njk\nea\nib\nck\nhf\nak\ngi\nch\ndc\nba\nke\nad\nka\neg\njh\nja\ngc\nfd\ncc\nab\ngj\nik\nfg\nbj\nhe\nfj\nge\ngh\nhk\nbk\ned\nid\nfi",
"output": "YES"
},
{
"input": "kd\n100\nek\nea\nha\nkf\nkj\ngh\ndl\nfj\nal\nga\nlj\nik\ngd\nid\ncb\nfh\ndk\nif\nbh\nkb\nhc\nej\nhk\ngc\ngb\nef\nkk\nll\nlf\nkh\ncl\nlh\njj\nil\nhh\nci\ndb\ndf\ngk\njg\nch\nbd\ncg\nfg\nda\neb\nlg\ndg\nbk\nje\nbg\nbl\njl\ncj\nhb\nei\naa\ngl\nka\nfa\nfi\naf\nkc\nla\ngi\nij\nib\nle\ndi\nck\nag\nlc\nca\nge\nie\nlb\nke\nii\nae\nig\nic\nhe\ncf\nhd\nak\nfb\nhi\ngf\nad\nba\nhg\nbi\nkl\nac\ngg\ngj\nbe\nlk\nld\naj",
"output": "YES"
},
{
"input": "ab\n1\nab",
"output": "YES"
},
{
"input": "ya\n1\nya",
"output": "YES"
},
{
"input": "ay\n1\nyb",
"output": "NO"
},
{
"input": "ax\n2\nii\nxa",
"output": "YES"
},
{
"input": "hi\n1\nhi",
"output": "YES"
},
{
"input": "ag\n1\nag",
"output": "YES"
},
{
"input": "th\n1\nth",
"output": "YES"
},
{
"input": "sb\n1\nsb",
"output": "YES"
},
{
"input": "hp\n1\nhp",
"output": "YES"
},
{
"input": "ah\n1\nah",
"output": "YES"
},
{
"input": "ta\n1\nta",
"output": "YES"
},
{
"input": "tb\n1\ntb",
"output": "YES"
},
{
"input": "ab\n5\nca\nda\nea\nfa\nka",
"output": "NO"
},
{
"input": "ac\n1\nac",
"output": "YES"
},
{
"input": "ha\n2\nha\nzz",
"output": "YES"
},
{
"input": "ok\n1\nok",
"output": "YES"
},
{
"input": "bc\n1\nbc",
"output": "YES"
},
{
"input": "az\n1\nzz",
"output": "NO"
},
{
"input": "ab\n2\nba\ntt",
"output": "YES"
},
{
"input": "ah\n2\nap\nhp",
"output": "NO"
},
{
"input": "sh\n1\nsh",
"output": "YES"
},
{
"input": "az\n1\nby",
"output": "NO"
},
{
"input": "as\n1\nas",
"output": "YES"
},
{
"input": "ab\n2\nab\ncd",
"output": "YES"
},
{
"input": "ab\n2\nxa\nza",
"output": "NO"
},
{
"input": "ab\n2\net\nab",
"output": "YES"
},
{
"input": "ab\n1\naa",
"output": "NO"
},
{
"input": "ab\n2\nab\nde",
"output": "YES"
},
{
"input": "ah\n2\nba\nha",
"output": "YES"
},
{
"input": "ha\n3\ndd\ncc\nha",
"output": "YES"
},
{
"input": "oo\n1\nox",
"output": "NO"
},
{
"input": "ab\n2\nax\nbx",
"output": "NO"
},
{
"input": "ww\n4\nuw\now\npo\nko",
"output": "NO"
},
{
"input": "ay\n1\nay",
"output": "YES"
},
{
"input": "yo\n1\nyo",
"output": "YES"
},
{
"input": "ba\n1\nba",
"output": "YES"
},
{
"input": "qw\n1\nqw",
"output": "YES"
},
{
"input": "la\n1\nla",
"output": "YES"
},
{
"input": "ab\n2\nbb\nbc",
"output": "NO"
},
{
"input": "aa\n2\nab\nac",
"output": "NO"
},
{
"input": "ah\n2\nbb\nha",
"output": "YES"
},
{
"input": "ya\n42\nab\nac\nad\nae\naf\nag\nah\nai\nak\naj\nba\nbc\nbd\nbe\nbf\nbg\nbh\nbi\nbk\nbj\ncb\nca\ncd\nce\ncf\ncg\nch\nci\nck\ncj\ndb\ndc\nda\nde\ndf\ndg\ndh\ndi\ndk\ndj\nef\nek",
"output": "NO"
},
{
"input": "ab\n3\nab\nxx\nyy",
"output": "YES"
},
{
"input": "ab\n2\nab\ncc",
"output": "YES"
},
{
"input": "sa\n2\nxx\nas",
"output": "YES"
},
{
"input": "ma\n1\nma",
"output": "YES"
},
{
"input": "ba\n1\nbb",
"output": "NO"
},
{
"input": "bc\n1\nab",
"output": "NO"
},
{
"input": "fa\n1\nfa",
"output": "YES"
},
{
"input": "ap\n1\nap",
"output": "YES"
},
{
"input": "ab\n1\nbb",
"output": "NO"
},
{
"input": "bk\n1\nbk",
"output": "YES"
},
{
"input": "xy\n2\nxy\naa",
"output": "YES"
},
{
"input": "ab\n2\nza\nbz",
"output": "YES"
}
] | 1,603,475,062
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 2
| 124
| 0
|
from itertools import permutations
s=input()
n=int(input())
p=[]
for x in range(n):
k=input()
p.append(k)
l=list(permutations(p,n))
for x in l:
x=''.join(x)
if s in x:
print('YES')
break
else:print('NO')
|
Title: Bark to Unlock
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As technologies develop, manufacturers are making the process of unlocking a phone as user-friendly as possible. To unlock its new phone, Arkady's pet dog Mu-mu has to bark the password once. The phone represents a password as a string of two lowercase English letters.
Mu-mu's enemy Kashtanka wants to unlock Mu-mu's phone to steal some sensible information, but it can only bark *n* distinct words, each of which can be represented as a string of two lowercase English letters. Kashtanka wants to bark several words (not necessarily distinct) one after another to pronounce a string containing the password as a substring. Tell if it's possible to unlock the phone in this way, or not.
Input Specification:
The first line contains two lowercase English letters — the password on the phone.
The second line contains single integer *n* (1<=≤<=*n*<=≤<=100) — the number of words Kashtanka knows.
The next *n* lines contain two lowercase English letters each, representing the words Kashtanka knows. The words are guaranteed to be distinct.
Output Specification:
Print "YES" if Kashtanka can bark several words in a line forming a string containing the password, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower).
Demo Input:
['ya\n4\nah\noy\nto\nha\n', 'hp\n2\nht\ntp\n', 'ah\n1\nha\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
In the first example the password is "ya", and Kashtanka can bark "oy" and then "ah", and then "ha" to form the string "oyahha" which contains the password. So, the answer is "YES".
In the second example Kashtanka can't produce a string containing password as a substring. Note that it can bark "ht" and then "tp" producing "http", but it doesn't contain the password "hp" as a substring.
In the third example the string "hahahaha" contains "ah" as a substring.
|
```python
from itertools import permutations
s=input()
n=int(input())
p=[]
for x in range(n):
k=input()
p.append(k)
l=list(permutations(p,n))
for x in l:
x=''.join(x)
if s in x:
print('YES')
break
else:print('NO')
```
| 0
|
|
595
|
A
|
Vitaly and Night
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment.
Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on.
Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping.
|
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively.
Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'.
|
Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping.
|
[
"2 2\n0 0 0 1\n1 0 1 1\n",
"1 3\n1 1 0 1 0 0\n"
] |
[
"3\n",
"2\n"
] |
In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off.
In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.
| 500
|
[
{
"input": "2 2\n0 0 0 1\n1 0 1 1",
"output": "3"
},
{
"input": "1 3\n1 1 0 1 0 0",
"output": "2"
},
{
"input": "3 3\n1 1 1 1 1 1\n1 1 0 1 1 0\n1 0 0 0 1 1",
"output": "8"
},
{
"input": "1 5\n1 0 1 1 1 0 1 1 1 1",
"output": "5"
},
{
"input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 0 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "99"
},
{
"input": "1 100\n0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "6"
},
{
"input": "1 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "100"
},
{
"input": "100 1\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0",
"output": "8"
},
{
"input": "100 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "1 1\n0 0",
"output": "0"
},
{
"input": "1 1\n0 1",
"output": "1"
},
{
"input": "1 1\n1 0",
"output": "1"
},
{
"input": "1 1\n1 1",
"output": "1"
}
] | 1,586,273,269
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 109
| 307,200
|
# cook your dish here
n,m = list(map(int,input().split()))
m=2*m
count=0
while(n>0):
tag=0
n-=1
list1=list(map(int,input().split()))
for i in range(0,m,2):
#print(list1[i]+list1[i+1])
if(list1[i]+list1[i+1] >=1):
count+=1
print(count)
|
Title: Vitaly and Night
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment.
Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on.
Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively.
Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'.
Output Specification:
Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping.
Demo Input:
['2 2\n0 0 0 1\n1 0 1 1\n', '1 3\n1 1 0 1 0 0\n']
Demo Output:
['3\n', '2\n']
Note:
In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off.
In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.
|
```python
# cook your dish here
n,m = list(map(int,input().split()))
m=2*m
count=0
while(n>0):
tag=0
n-=1
list1=list(map(int,input().split()))
for i in range(0,m,2):
#print(list1[i]+list1[i+1])
if(list1[i]+list1[i+1] >=1):
count+=1
print(count)
```
| 3
|
|
433
|
A
|
Kitahara Haruki's Gift
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation"
] | null | null |
Kitahara Haruki has bought *n* apples for Touma Kazusa and Ogiso Setsuna. Now he wants to divide all the apples between the friends.
Each apple weights 100 grams or 200 grams. Of course Kitahara Haruki doesn't want to offend any of his friend. Therefore the total weight of the apples given to Touma Kazusa must be equal to the total weight of the apples given to Ogiso Setsuna.
But unfortunately Kitahara Haruki doesn't have a knife right now, so he cannot split any apple into some parts. Please, tell him: is it possible to divide all the apples in a fair way between his friends?
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of apples. The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (*w**i*<==<=100 or *w**i*<==<=200), where *w**i* is the weight of the *i*-th apple.
|
In a single line print "YES" (without the quotes) if it is possible to divide all the apples between his friends. Otherwise print "NO" (without the quotes).
|
[
"3\n100 200 100\n",
"4\n100 100 100 200\n"
] |
[
"YES\n",
"NO\n"
] |
In the first test sample Kitahara Haruki can give the first and the last apple to Ogiso Setsuna and the middle apple to Touma Kazusa.
| 500
|
[
{
"input": "3\n100 200 100",
"output": "YES"
},
{
"input": "4\n100 100 100 200",
"output": "NO"
},
{
"input": "1\n100",
"output": "NO"
},
{
"input": "1\n200",
"output": "NO"
},
{
"input": "2\n100 100",
"output": "YES"
},
{
"input": "2\n200 200",
"output": "YES"
},
{
"input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "YES"
},
{
"input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "NO"
},
{
"input": "52\n200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 100 200 100 200 200 200 100 200 200",
"output": "YES"
},
{
"input": "2\n100 200",
"output": "NO"
},
{
"input": "2\n200 100",
"output": "NO"
},
{
"input": "3\n100 100 100",
"output": "NO"
},
{
"input": "3\n200 200 200",
"output": "NO"
},
{
"input": "3\n200 100 200",
"output": "NO"
},
{
"input": "4\n100 100 100 100",
"output": "YES"
},
{
"input": "4\n200 200 200 200",
"output": "YES"
},
{
"input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "YES"
},
{
"input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 100 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "NO"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "YES"
},
{
"input": "100\n100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "NO"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "YES"
},
{
"input": "100\n100 100 100 100 100 100 100 100 200 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "NO"
},
{
"input": "99\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "NO"
},
{
"input": "99\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "NO"
},
{
"input": "99\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "YES"
},
{
"input": "99\n200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "NO"
},
{
"input": "99\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "NO"
},
{
"input": "99\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "YES"
},
{
"input": "99\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "NO"
},
{
"input": "100\n100 100 200 100 100 200 200 200 200 100 200 100 100 100 200 100 100 100 100 200 100 100 100 100 100 100 200 100 100 200 200 100 100 100 200 200 200 100 200 200 100 200 100 100 200 100 200 200 100 200 200 100 100 200 200 100 200 200 100 100 200 100 200 100 200 200 200 200 200 100 200 200 200 200 200 200 100 100 200 200 200 100 100 100 200 100 100 200 100 100 100 200 200 100 100 200 200 200 200 100",
"output": "YES"
},
{
"input": "100\n100 100 200 200 100 200 100 100 100 100 100 100 200 100 200 200 200 100 100 200 200 200 200 200 100 200 100 200 100 100 100 200 100 100 200 100 200 100 100 100 200 200 100 100 100 200 200 200 200 200 100 200 200 100 100 100 100 200 100 100 200 100 100 100 100 200 200 200 100 200 100 200 200 200 100 100 200 200 200 200 100 200 100 200 200 100 200 100 200 200 200 200 200 200 100 100 100 200 200 100",
"output": "NO"
},
{
"input": "100\n100 200 100 100 200 200 200 200 100 200 200 200 200 200 200 200 200 200 100 100 100 200 200 200 200 200 100 200 200 200 200 100 200 200 100 100 200 100 100 100 200 100 100 100 200 100 200 100 200 200 200 100 100 200 100 200 100 200 100 100 100 200 100 200 100 100 100 100 200 200 200 200 100 200 200 100 200 100 100 100 200 100 100 100 100 100 200 100 100 100 200 200 200 100 200 100 100 100 200 200",
"output": "YES"
},
{
"input": "99\n100 200 200 200 100 200 100 200 200 100 100 100 100 200 100 100 200 100 200 100 100 200 100 100 200 200 100 100 100 100 200 200 200 200 200 100 100 200 200 100 100 100 100 200 200 100 100 100 100 100 200 200 200 100 100 100 200 200 200 100 200 100 100 100 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 100 200 100 200 200 200 200 100 200 100 100 100 100 100 100 100 100 100",
"output": "YES"
},
{
"input": "99\n100 200 100 100 100 100 200 200 100 200 100 100 200 100 100 100 100 100 100 200 100 100 100 100 100 100 100 200 100 200 100 100 100 100 100 100 100 200 200 200 200 200 200 200 100 200 100 200 100 200 100 200 100 100 200 200 200 100 200 200 200 200 100 200 100 200 200 200 200 100 200 100 200 200 100 200 200 200 200 200 100 100 200 100 100 100 100 200 200 200 100 100 200 200 200 200 200 200 200",
"output": "NO"
},
{
"input": "99\n200 100 100 100 200 200 200 100 100 100 100 100 100 100 100 100 200 200 100 200 200 100 200 100 100 200 200 200 100 200 100 200 200 100 200 100 200 200 200 100 100 200 200 200 200 100 100 100 100 200 200 200 200 100 200 200 200 100 100 100 200 200 200 100 200 100 200 100 100 100 200 100 200 200 100 200 200 200 100 100 100 200 200 200 100 200 200 200 100 100 100 200 100 200 100 100 100 200 200",
"output": "YES"
},
{
"input": "56\n100 200 200 200 200 200 100 200 100 100 200 100 100 100 100 100 200 200 200 100 200 100 100 200 200 200 100 200 100 200 200 100 100 100 100 100 200 100 200 100 200 200 200 100 100 200 200 200 200 200 200 200 200 200 200 100",
"output": "YES"
},
{
"input": "72\n200 100 200 200 200 100 100 200 200 100 100 100 100 200 100 200 100 100 100 100 200 100 200 100 100 200 100 100 200 100 200 100 100 200 100 200 100 100 200 200 200 200 200 100 100 200 200 200 200 100 100 100 200 200 100 100 100 100 100 200 100 100 200 100 100 200 200 100 100 200 100 200",
"output": "YES"
},
{
"input": "32\n200 200 200 100 100 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200",
"output": "YES"
},
{
"input": "48\n200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 100 200 200 200 200 200 200",
"output": "NO"
},
{
"input": "60\n100 100 200 200 100 200 100 200 100 100 100 100 100 100 200 100 100 100 200 100 200 100 100 100 100 100 200 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100",
"output": "YES"
},
{
"input": "24\n200 200 100 100 200 100 200 200 100 200 200 200 200 200 100 200 200 200 200 200 200 200 200 100",
"output": "YES"
},
{
"input": "40\n100 100 200 200 200 200 100 100 100 200 100 100 200 200 100 100 100 100 100 200 100 200 200 100 200 200 200 100 100 100 100 100 200 200 100 200 100 100 200 100",
"output": "NO"
},
{
"input": "5\n200 200 200 200 200",
"output": "NO"
},
{
"input": "9\n100 100 100 200 100 100 200 100 200",
"output": "YES"
},
{
"input": "1\n200",
"output": "NO"
},
{
"input": "7\n200 200 200 100 200 200 200",
"output": "NO"
},
{
"input": "4\n100 100 200 200",
"output": "YES"
},
{
"input": "6\n100 100 100 200 200 200",
"output": "NO"
},
{
"input": "4\n200 100 100 200",
"output": "YES"
},
{
"input": "5\n100 100 100 100 200",
"output": "YES"
}
] | 1,631,461,128
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 61
| 6,758,400
|
n = int(input())
arr = list(map(int,input().split()))
s = int(str(sum(arr))[0])
if (s % 2 == 0):
print("YES")
else:
print("NO")
|
Title: Kitahara Haruki's Gift
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kitahara Haruki has bought *n* apples for Touma Kazusa and Ogiso Setsuna. Now he wants to divide all the apples between the friends.
Each apple weights 100 grams or 200 grams. Of course Kitahara Haruki doesn't want to offend any of his friend. Therefore the total weight of the apples given to Touma Kazusa must be equal to the total weight of the apples given to Ogiso Setsuna.
But unfortunately Kitahara Haruki doesn't have a knife right now, so he cannot split any apple into some parts. Please, tell him: is it possible to divide all the apples in a fair way between his friends?
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of apples. The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (*w**i*<==<=100 or *w**i*<==<=200), where *w**i* is the weight of the *i*-th apple.
Output Specification:
In a single line print "YES" (without the quotes) if it is possible to divide all the apples between his friends. Otherwise print "NO" (without the quotes).
Demo Input:
['3\n100 200 100\n', '4\n100 100 100 200\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first test sample Kitahara Haruki can give the first and the last apple to Ogiso Setsuna and the middle apple to Touma Kazusa.
|
```python
n = int(input())
arr = list(map(int,input().split()))
s = int(str(sum(arr))[0])
if (s % 2 == 0):
print("YES")
else:
print("NO")
```
| 0
|
|
1
|
B
|
Spreadsheet
|
PROGRAMMING
| 1,600
|
[
"implementation",
"math"
] |
B. Spreadsheets
|
10
|
64
|
In the popular spreadsheets systems (for example, in Excel) the following numeration of columns is used. The first column has number A, the second — number B, etc. till column 26 that is marked by Z. Then there are two-letter numbers: column 27 has number AA, 28 — AB, column 52 is marked by AZ. After ZZ there follow three-letter numbers, etc.
The rows are marked by integer numbers starting with 1. The cell name is the concatenation of the column and the row numbers. For example, BC23 is the name for the cell that is in column 55, row 23.
Sometimes another numeration system is used: RXCY, where X and Y are integer numbers, showing the column and the row numbers respectfully. For instance, R23C55 is the cell from the previous example.
Your task is to write a program that reads the given sequence of cell coordinates and produce each item written according to the rules of another numeration system.
|
The first line of the input contains integer number *n* (1<=≤<=*n*<=≤<=105), the number of coordinates in the test. Then there follow *n* lines, each of them contains coordinates. All the coordinates are correct, there are no cells with the column and/or the row numbers larger than 106 .
|
Write *n* lines, each line should contain a cell coordinates in the other numeration system.
|
[
"2\nR23C55\nBC23\n"
] |
[
"BC23\nR23C55\n"
] |
none
| 0
|
[
{
"input": "2\nR23C55\nBC23",
"output": "BC23\nR23C55"
},
{
"input": "1\nA1",
"output": "R1C1"
},
{
"input": "5\nR8C3\nD1\nR7C2\nR8C9\nR8C9",
"output": "C8\nR1C4\nB7\nI8\nI8"
},
{
"input": "4\nR4C25\nR90C35\nAP55\nX83",
"output": "Y4\nAI90\nR55C42\nR83C24"
},
{
"input": "10\nR50C12\nR23C47\nY96\nR44C13\nR19C21\nR95C73\nBK12\nR51C74\nAY34\nR63C25",
"output": "L50\nAU23\nR96C25\nM44\nU19\nBU95\nR12C63\nBV51\nR34C51\nY63"
}
] | 1,659,152,567
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 1
| 60
| 0
|
n=input()
a=[]
p=0
q=0
g=0
k=1
for i in range(int(n)):
list1=list(input())
if ord(list1[0])!=ord('R'):
while(q<len(list1) and list1[q].isalpha()):
q=q+1
for d in range(q-1):
g=g+(ord(list1[d])-ord('A')+1)*26
g=g+ord(list1[d+1])-ord('A')+1
list4=list1[q:]
p='R'+"".join(list4)+'C'+str(g)
a.append(p)
else:
while(ord(list1[k])!=ord('C')):
k=k+1
list2=list1[k+1:]
list2=[str(i) for i in list2]
list3=list1[1:k]
p=chr(int(int("".join(list2))/26)+ord('A')-1)+chr(int("".join(list2))%26-1+ord('A'))+"".join(list3)
a.append(p)
for i in range(int(n)):
print(a[i])
|
Title: Spreadsheet
Time Limit: 10 seconds
Memory Limit: 64 megabytes
Problem Description:
In the popular spreadsheets systems (for example, in Excel) the following numeration of columns is used. The first column has number A, the second — number B, etc. till column 26 that is marked by Z. Then there are two-letter numbers: column 27 has number AA, 28 — AB, column 52 is marked by AZ. After ZZ there follow three-letter numbers, etc.
The rows are marked by integer numbers starting with 1. The cell name is the concatenation of the column and the row numbers. For example, BC23 is the name for the cell that is in column 55, row 23.
Sometimes another numeration system is used: RXCY, where X and Y are integer numbers, showing the column and the row numbers respectfully. For instance, R23C55 is the cell from the previous example.
Your task is to write a program that reads the given sequence of cell coordinates and produce each item written according to the rules of another numeration system.
Input Specification:
The first line of the input contains integer number *n* (1<=≤<=*n*<=≤<=105), the number of coordinates in the test. Then there follow *n* lines, each of them contains coordinates. All the coordinates are correct, there are no cells with the column and/or the row numbers larger than 106 .
Output Specification:
Write *n* lines, each line should contain a cell coordinates in the other numeration system.
Demo Input:
['2\nR23C55\nBC23\n']
Demo Output:
['BC23\nR23C55\n']
Note:
none
|
```python
n=input()
a=[]
p=0
q=0
g=0
k=1
for i in range(int(n)):
list1=list(input())
if ord(list1[0])!=ord('R'):
while(q<len(list1) and list1[q].isalpha()):
q=q+1
for d in range(q-1):
g=g+(ord(list1[d])-ord('A')+1)*26
g=g+ord(list1[d+1])-ord('A')+1
list4=list1[q:]
p='R'+"".join(list4)+'C'+str(g)
a.append(p)
else:
while(ord(list1[k])!=ord('C')):
k=k+1
list2=list1[k+1:]
list2=[str(i) for i in list2]
list3=list1[1:k]
p=chr(int(int("".join(list2))/26)+ord('A')-1)+chr(int("".join(list2))%26-1+ord('A'))+"".join(list3)
a.append(p)
for i in range(int(n)):
print(a[i])
```
| -1
|
518
|
B
|
Tanya and Postcard
|
PROGRAMMING
| 1,400
|
[
"greedy",
"implementation",
"strings"
] | null | null |
Little Tanya decided to present her dad a postcard on his Birthday. She has already created a message — string *s* of length *n*, consisting of uppercase and lowercase English letters. Tanya can't write yet, so she found a newspaper and decided to cut out the letters and glue them into the postcard to achieve string *s*. The newspaper contains string *t*, consisting of uppercase and lowercase English letters. We know that the length of string *t* greater or equal to the length of the string *s*.
The newspaper may possibly have too few of some letters needed to make the text and too many of some other letters. That's why Tanya wants to cut some *n* letters out of the newspaper and make a message of length exactly *n*, so that it looked as much as possible like *s*. If the letter in some position has correct value and correct letter case (in the string *s* and in the string that Tanya will make), then she shouts joyfully "YAY!", and if the letter in the given position has only the correct value but it is in the wrong case, then the girl says "WHOOPS".
Tanya wants to make such message that lets her shout "YAY!" as much as possible. If there are multiple ways to do this, then her second priority is to maximize the number of times she says "WHOOPS". Your task is to help Tanya make the message.
|
The first line contains line *s* (1<=≤<=|*s*|<=≤<=2·105), consisting of uppercase and lowercase English letters — the text of Tanya's message.
The second line contains line *t* (|*s*|<=≤<=|*t*|<=≤<=2·105), consisting of uppercase and lowercase English letters — the text written in the newspaper.
Here |*a*| means the length of the string *a*.
|
Print two integers separated by a space:
- the first number is the number of times Tanya shouts "YAY!" while making the message, - the second number is the number of times Tanya says "WHOOPS" while making the message.
|
[
"AbC\nDCbA\n",
"ABC\nabc\n",
"abacaba\nAbaCaBA\n"
] |
[
"3 0\n",
"0 3\n",
"3 4\n"
] |
none
| 1,000
|
[
{
"input": "AbC\nDCbA",
"output": "3 0"
},
{
"input": "ABC\nabc",
"output": "0 3"
},
{
"input": "abacaba\nAbaCaBA",
"output": "3 4"
},
{
"input": "zzzzz\nZZZZZ",
"output": "0 5"
},
{
"input": "zzzZZZ\nZZZzzZ",
"output": "5 1"
},
{
"input": "abcdefghijklmnopqrstuvwxyz\nABCDEFGHIJKLMNOPQRSTUVWXYZ",
"output": "0 26"
},
{
"input": "abcdefghijklmnopqrstuvwxyz\nqrsimtabuvzhnwcdefgjklxyop",
"output": "26 0"
},
{
"input": "l\nFPbAVjsMpPDTLkfwNYFmBDHPTDSWSOUlrBHYJHPM",
"output": "1 0"
},
{
"input": "ncMeXssLHS\nuwyeMcaFatpInZVdEYpwJQSnVxLK",
"output": "6 1"
},
{
"input": "DpiNBmCRFWxpdbfGOzvvOcemjructoAdEwegTvbVbfWWRPGyEAxGdDRWVlqNyGWMWHMrHAIZpyxvgaflrsVZhhZRouvpxrKXFZam\nwwPLFtNfPtJXvMLuHjKfYyaRhreNSWSzOvDpqHCGcqllACNPGHxReeFUCmAqIKXYytsSQwIxJzNiiUtgebVuwRmWpRALLyKAzyDPvgIGxALSaeeTIqm",
"output": "66 12"
},
{
"input": "CCAE\ndcecc",
"output": "0 3"
},
{
"input": "Dccb\nbeeeb",
"output": "1 0"
},
{
"input": "Adc\neadeabcad",
"output": "2 1"
},
{
"input": "DBAdeb\ndeeabcddadaa",
"output": "3 2"
},
{
"input": "EDCED\neebeacdba",
"output": "0 4"
},
{
"input": "CdAbD\ndecbde",
"output": "2 2"
},
{
"input": "a\nB",
"output": "0 0"
},
{
"input": "r\nqA",
"output": "0 0"
}
] | 1,584,502,059
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 7
| 202
| 7,270,400
|
from collections import defaultdict
s = input()
t = input()
cntS = defaultdict(int)
for c in s:
cntS[c] += 1
cntT = defaultdict(int)
for c in t:
cntT[c] += 1
nHas = 0
for c in set(s):
nHas += min(cntS[c], cntT[c])
print('%d %d' % (nHas, len(s) - nHas))
|
Title: Tanya and Postcard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Tanya decided to present her dad a postcard on his Birthday. She has already created a message — string *s* of length *n*, consisting of uppercase and lowercase English letters. Tanya can't write yet, so she found a newspaper and decided to cut out the letters and glue them into the postcard to achieve string *s*. The newspaper contains string *t*, consisting of uppercase and lowercase English letters. We know that the length of string *t* greater or equal to the length of the string *s*.
The newspaper may possibly have too few of some letters needed to make the text and too many of some other letters. That's why Tanya wants to cut some *n* letters out of the newspaper and make a message of length exactly *n*, so that it looked as much as possible like *s*. If the letter in some position has correct value and correct letter case (in the string *s* and in the string that Tanya will make), then she shouts joyfully "YAY!", and if the letter in the given position has only the correct value but it is in the wrong case, then the girl says "WHOOPS".
Tanya wants to make such message that lets her shout "YAY!" as much as possible. If there are multiple ways to do this, then her second priority is to maximize the number of times she says "WHOOPS". Your task is to help Tanya make the message.
Input Specification:
The first line contains line *s* (1<=≤<=|*s*|<=≤<=2·105), consisting of uppercase and lowercase English letters — the text of Tanya's message.
The second line contains line *t* (|*s*|<=≤<=|*t*|<=≤<=2·105), consisting of uppercase and lowercase English letters — the text written in the newspaper.
Here |*a*| means the length of the string *a*.
Output Specification:
Print two integers separated by a space:
- the first number is the number of times Tanya shouts "YAY!" while making the message, - the second number is the number of times Tanya says "WHOOPS" while making the message.
Demo Input:
['AbC\nDCbA\n', 'ABC\nabc\n', 'abacaba\nAbaCaBA\n']
Demo Output:
['3 0\n', '0 3\n', '3 4\n']
Note:
none
|
```python
from collections import defaultdict
s = input()
t = input()
cntS = defaultdict(int)
for c in s:
cntS[c] += 1
cntT = defaultdict(int)
for c in t:
cntT[c] += 1
nHas = 0
for c in set(s):
nHas += min(cntS[c], cntT[c])
print('%d %d' % (nHas, len(s) - nHas))
```
| 0
|
|
914
|
D
|
Bash and a Tough Math Puzzle
|
PROGRAMMING
| 1,900
|
[
"data structures",
"number theory"
] | null | null |
Bash likes playing with arrays. He has an array *a*1,<=*a*2,<=... *a**n* of *n* integers. He likes to guess the greatest common divisor (gcd) of different segments of the array. Of course, sometimes the guess is not correct. However, Bash will be satisfied if his guess is almost correct.
Suppose he guesses that the gcd of the elements in the range [*l*,<=*r*] of *a* is *x*. He considers the guess to be almost correct if he can change at most one element in the segment such that the gcd of the segment is *x* after making the change. Note that when he guesses, he doesn't actually change the array — he just wonders if the gcd of the segment can be made *x*. Apart from this, he also sometimes makes changes to the array itself.
Since he can't figure it out himself, Bash wants you to tell him which of his guesses are almost correct. Formally, you have to process *q* queries of one of the following forms:
- 1<=*l*<=*r*<=*x* — Bash guesses that the gcd of the range [*l*,<=*r*] is *x*. Report if this guess is almost correct. - 2<=*i*<=*y* — Bash sets *a**i* to *y*.
Note: The array is 1-indexed.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=5·105) — the size of the array.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array.
The third line contains an integer *q* (1<=≤<=*q*<=≤<=4·105) — the number of queries.
The next *q* lines describe the queries and may have one of the following forms:
- 1<=*l*<=*r*<=*x* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*,<=1<=≤<=*x*<=≤<=109). - 2<=*i*<=*y* (1<=≤<=*i*<=≤<=*n*,<=1<=≤<=*y*<=≤<=109).
Guaranteed, that there is at least one query of first type.
|
For each query of first type, output "YES" (without quotes) if Bash's guess is almost correct and "NO" (without quotes) otherwise.
|
[
"3\n2 6 3\n4\n1 1 2 2\n1 1 3 3\n2 1 9\n1 1 3 2\n",
"5\n1 2 3 4 5\n6\n1 1 4 2\n2 3 6\n1 1 4 2\n1 1 5 2\n2 5 10\n1 1 5 2\n"
] |
[
"YES\nYES\nNO\n",
"NO\nYES\nNO\nYES\n"
] |
In the first sample, the array initially is {2, 6, 3}.
For query 1, the first two numbers already have their gcd as 2.
For query 2, we can achieve a gcd of 3 by changing the first element of the array to 3. Note that the changes made during queries of type 1 are temporary and do not get reflected in the array.
After query 3, the array is now {9, 6, 3}.
For query 4, no matter which element you change, you cannot get the gcd of the range to be 2.
| 2,000
|
[
{
"input": "3\n2 6 3\n4\n1 1 2 2\n1 1 3 3\n2 1 9\n1 1 3 2",
"output": "YES\nYES\nNO"
},
{
"input": "5\n1 2 3 4 5\n6\n1 1 4 2\n2 3 6\n1 1 4 2\n1 1 5 2\n2 5 10\n1 1 5 2",
"output": "NO\nYES\nNO\nYES"
},
{
"input": "1\n1000000000\n1\n1 1 1 1000000000",
"output": "YES"
},
{
"input": "4\n3 3 7 7\n1\n1 1 4 3",
"output": "NO"
}
] | 1,699,742,919
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 2
| 61
| 1,843,200
|
import sys
input = sys.stdin.buffer.readline
def gcd(a, b):
while b:
a,b = b,a%b
return a
n = int(input())
A = [int(x) for x in input().split()]
B = [0] * n + A
for i in range(n, 2 * n):
B[i // 2] = gcd(B[i], B[i // 2])
q = int(input())
for _ in range(q):
S = [int(x) for x in input().split()]
if S[0] == 1:
_,l,r,x = S
l -= 1
count = 0
ind = 3 * n
l += n
r += n
while l < r:
if l & 1 and B[l] % x:
ind = l
count += 1
if r & 1 and B[r - 1] % x:
ind = r - 1
count += 1
l += 1
l //= 2
r //= 2
while ind < n:
ind1 = 2 * ind
ind2 = 2 * ind + 1
if B[ind1] % x:
count += B[ind2] % x
ind = ind1
else:
count += B[ind1] % x
ind = ind2
if count <= 1:
print('YES')
else:
print('NO')
else:
_,i,y = S
i -= 1
i += n
B[i] = y
i //= 2
while i:
B[i] = gcd(B[2 * i], B[2 * i + 1])
i //= 2
|
Title: Bash and a Tough Math Puzzle
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bash likes playing with arrays. He has an array *a*1,<=*a*2,<=... *a**n* of *n* integers. He likes to guess the greatest common divisor (gcd) of different segments of the array. Of course, sometimes the guess is not correct. However, Bash will be satisfied if his guess is almost correct.
Suppose he guesses that the gcd of the elements in the range [*l*,<=*r*] of *a* is *x*. He considers the guess to be almost correct if he can change at most one element in the segment such that the gcd of the segment is *x* after making the change. Note that when he guesses, he doesn't actually change the array — he just wonders if the gcd of the segment can be made *x*. Apart from this, he also sometimes makes changes to the array itself.
Since he can't figure it out himself, Bash wants you to tell him which of his guesses are almost correct. Formally, you have to process *q* queries of one of the following forms:
- 1<=*l*<=*r*<=*x* — Bash guesses that the gcd of the range [*l*,<=*r*] is *x*. Report if this guess is almost correct. - 2<=*i*<=*y* — Bash sets *a**i* to *y*.
Note: The array is 1-indexed.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=5·105) — the size of the array.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array.
The third line contains an integer *q* (1<=≤<=*q*<=≤<=4·105) — the number of queries.
The next *q* lines describe the queries and may have one of the following forms:
- 1<=*l*<=*r*<=*x* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*,<=1<=≤<=*x*<=≤<=109). - 2<=*i*<=*y* (1<=≤<=*i*<=≤<=*n*,<=1<=≤<=*y*<=≤<=109).
Guaranteed, that there is at least one query of first type.
Output Specification:
For each query of first type, output "YES" (without quotes) if Bash's guess is almost correct and "NO" (without quotes) otherwise.
Demo Input:
['3\n2 6 3\n4\n1 1 2 2\n1 1 3 3\n2 1 9\n1 1 3 2\n', '5\n1 2 3 4 5\n6\n1 1 4 2\n2 3 6\n1 1 4 2\n1 1 5 2\n2 5 10\n1 1 5 2\n']
Demo Output:
['YES\nYES\nNO\n', 'NO\nYES\nNO\nYES\n']
Note:
In the first sample, the array initially is {2, 6, 3}.
For query 1, the first two numbers already have their gcd as 2.
For query 2, we can achieve a gcd of 3 by changing the first element of the array to 3. Note that the changes made during queries of type 1 are temporary and do not get reflected in the array.
After query 3, the array is now {9, 6, 3}.
For query 4, no matter which element you change, you cannot get the gcd of the range to be 2.
|
```python
import sys
input = sys.stdin.buffer.readline
def gcd(a, b):
while b:
a,b = b,a%b
return a
n = int(input())
A = [int(x) for x in input().split()]
B = [0] * n + A
for i in range(n, 2 * n):
B[i // 2] = gcd(B[i], B[i // 2])
q = int(input())
for _ in range(q):
S = [int(x) for x in input().split()]
if S[0] == 1:
_,l,r,x = S
l -= 1
count = 0
ind = 3 * n
l += n
r += n
while l < r:
if l & 1 and B[l] % x:
ind = l
count += 1
if r & 1 and B[r - 1] % x:
ind = r - 1
count += 1
l += 1
l //= 2
r //= 2
while ind < n:
ind1 = 2 * ind
ind2 = 2 * ind + 1
if B[ind1] % x:
count += B[ind2] % x
ind = ind1
else:
count += B[ind1] % x
ind = ind2
if count <= 1:
print('YES')
else:
print('NO')
else:
_,i,y = S
i -= 1
i += n
B[i] = y
i //= 2
while i:
B[i] = gcd(B[2 * i], B[2 * i + 1])
i //= 2
```
| 0
|
|
225
|
A
|
Dice Tower
|
PROGRAMMING
| 1,100
|
[
"constructive algorithms",
"greedy"
] | null | null |
A dice is a cube, its faces contain distinct integers from 1 to 6 as black points. The sum of numbers at the opposite dice faces always equals 7. Please note that there are only two dice (these dices are mirror of each other) that satisfy the given constraints (both of them are shown on the picture on the left).
Alice and Bob play dice. Alice has built a tower from *n* dice. We know that in this tower the adjacent dice contact with faces with distinct numbers. Bob wants to uniquely identify the numbers written on the faces of all dice, from which the tower is built. Unfortunately, Bob is looking at the tower from the face, and so he does not see all the numbers on the faces. Bob sees the number on the top of the tower and the numbers on the two adjacent sides (on the right side of the picture shown what Bob sees).
Help Bob, tell whether it is possible to uniquely identify the numbers on the faces of all the dice in the tower, or not.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of dice in the tower.
The second line contains an integer *x* (1<=≤<=*x*<=≤<=6) — the number Bob sees at the top of the tower. Next *n* lines contain two space-separated integers each: the *i*-th line contains numbers *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=6; *a**i*<=≠<=*b**i*) — the numbers Bob sees on the two sidelong faces of the *i*-th dice in the tower.
Consider the dice in the tower indexed from top to bottom from 1 to *n*. That is, the topmost dice has index 1 (the dice whose top face Bob can see). It is guaranteed that it is possible to make a dice tower that will look as described in the input.
|
Print "YES" (without the quotes), if it is possible to to uniquely identify the numbers on the faces of all the dice in the tower. If it is impossible, print "NO" (without the quotes).
|
[
"3\n6\n3 2\n5 4\n2 4\n",
"3\n3\n2 6\n4 1\n5 3\n"
] |
[
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "3\n6\n3 2\n5 4\n2 4",
"output": "YES"
},
{
"input": "3\n3\n2 6\n4 1\n5 3",
"output": "NO"
},
{
"input": "1\n3\n2 1",
"output": "YES"
},
{
"input": "2\n2\n3 1\n1 5",
"output": "NO"
},
{
"input": "3\n2\n1 4\n5 3\n6 4",
"output": "NO"
},
{
"input": "4\n3\n5 6\n1 3\n1 5\n4 1",
"output": "NO"
},
{
"input": "2\n2\n3 1\n1 3",
"output": "YES"
},
{
"input": "3\n2\n1 4\n3 1\n4 6",
"output": "YES"
},
{
"input": "4\n3\n5 6\n1 5\n5 1\n1 5",
"output": "YES"
},
{
"input": "5\n1\n2 3\n5 3\n5 4\n5 1\n3 5",
"output": "NO"
},
{
"input": "10\n5\n1 3\n2 3\n6 5\n6 5\n4 5\n1 3\n1 2\n3 2\n4 2\n1 2",
"output": "NO"
},
{
"input": "15\n4\n2 1\n2 4\n6 4\n5 3\n4 1\n4 2\n6 3\n4 5\n3 5\n2 6\n5 6\n1 5\n3 5\n6 4\n3 2",
"output": "NO"
},
{
"input": "20\n6\n3 2\n4 6\n3 6\n6 4\n5 1\n1 5\n2 6\n1 2\n1 4\n5 3\n2 3\n6 2\n5 4\n2 6\n1 3\n4 6\n4 5\n6 3\n3 1\n6 2",
"output": "NO"
},
{
"input": "25\n4\n1 2\n4 1\n3 5\n2 1\n3 5\n6 5\n3 5\n5 6\n1 2\n2 4\n6 2\n2 3\n2 4\n6 5\n2 3\n6 3\n2 3\n1 3\n2 1\n3 1\n5 6\n3 1\n6 4\n3 6\n2 3",
"output": "NO"
},
{
"input": "100\n3\n6 5\n5 1\n3 2\n1 5\n3 6\n5 4\n2 6\n4 1\n6 3\n4 5\n1 5\n1 4\n4 2\n2 6\n5 4\n4 1\n1 3\n6 5\n5 1\n2 1\n2 4\n2 1\n3 6\n4 1\n6 3\n2 3\n5 1\n2 6\n6 4\n3 5\n4 1\n6 5\n1 5\n1 5\n2 3\n4 1\n5 3\n6 4\n1 3\n5 3\n4 1\n1 4\n2 1\n6 2\n1 5\n6 2\n6 2\n4 5\n4 2\n5 6\n6 3\n1 3\n2 3\n5 4\n6 5\n3 1\n1 2\n4 1\n1 3\n1 3\n6 5\n4 6\n3 1\n2 1\n2 3\n3 2\n4 1\n1 5\n4 1\n6 3\n1 5\n4 5\n4 2\n4 5\n2 6\n2 1\n3 5\n4 6\n4 2\n4 5\n2 4\n3 1\n6 4\n5 6\n3 1\n1 4\n4 5\n6 3\n6 3\n2 1\n5 1\n3 6\n3 5\n2 1\n4 6\n4 2\n5 6\n3 1\n3 5\n3 6",
"output": "NO"
},
{
"input": "99\n3\n2 1\n6 2\n3 6\n1 3\n5 1\n2 6\n4 6\n6 4\n6 4\n6 5\n3 6\n2 6\n1 5\n2 3\n4 6\n1 4\n4 1\n2 3\n4 5\n4 1\n5 1\n1 2\n6 5\n4 6\n6 5\n6 2\n3 6\n6 4\n2 1\n3 1\n2 1\n6 2\n3 5\n4 1\n5 3\n3 1\n1 5\n3 6\n6 2\n1 5\n2 1\n5 1\n4 1\n2 6\n5 4\n4 2\n2 1\n1 5\n1 3\n4 6\n4 6\n4 5\n2 3\n6 2\n3 2\n2 1\n4 6\n6 2\n3 5\n3 6\n3 1\n2 3\n2 1\n3 6\n6 5\n6 3\n1 2\n5 1\n1 4\n6 2\n5 3\n1 3\n5 4\n2 3\n6 3\n1 5\n1 2\n2 6\n5 6\n5 6\n3 5\n3 1\n4 6\n3 1\n4 5\n4 2\n3 5\n6 2\n2 4\n4 6\n6 2\n4 2\n2 3\n2 4\n1 5\n1 4\n3 5\n1 2\n4 5",
"output": "NO"
},
{
"input": "98\n6\n4 2\n1 2\n3 2\n2 1\n2 1\n3 2\n2 3\n6 5\n4 6\n1 5\n4 5\n5 1\n6 5\n1 4\n1 2\n2 4\n6 5\n4 5\n4 6\n3 1\n2 3\n4 1\n4 2\n6 5\n3 2\n4 2\n5 1\n2 4\n1 3\n4 5\n3 2\n1 2\n3 1\n3 2\n3 6\n6 4\n3 6\n3 5\n4 6\n6 5\n3 5\n3 2\n4 2\n6 4\n1 3\n2 4\n5 3\n2 3\n1 3\n5 6\n5 3\n5 3\n4 6\n4 6\n3 6\n4 1\n6 5\n6 2\n1 5\n2 1\n6 2\n5 4\n6 3\n1 5\n2 3\n2 6\n5 6\n2 6\n5 1\n3 2\n6 2\n6 2\n1 2\n2 1\n3 5\n2 1\n4 6\n1 4\n4 5\n3 2\n3 2\n5 4\n1 3\n5 1\n2 3\n6 2\n2 6\n1 5\n5 1\n5 4\n5 1\n5 4\n2 1\n6 5\n1 4\n6 5\n1 2\n3 5",
"output": "NO"
},
{
"input": "97\n3\n2 1\n6 5\n4 1\n6 5\n3 2\n1 2\n6 3\n6 4\n6 3\n1 3\n1 3\n3 1\n3 6\n3 2\n5 6\n4 2\n3 6\n1 5\n2 6\n3 2\n6 2\n2 1\n2 4\n1 3\n3 1\n2 6\n3 6\n4 6\n6 2\n5 1\n6 3\n2 6\n3 6\n2 4\n4 5\n6 5\n4 1\n5 6\n6 2\n5 4\n5 1\n6 5\n1 4\n2 1\n4 5\n4 5\n4 1\n5 4\n1 4\n2 6\n2 6\n1 5\n5 6\n3 2\n2 3\n1 4\n4 1\n3 6\n6 2\n5 3\n6 2\n4 5\n6 2\n2 6\n6 5\n1 4\n2 6\n3 5\n2 6\n4 1\n4 5\n1 3\n4 2\n3 2\n1 2\n5 6\n1 5\n3 5\n2 1\n1 2\n1 2\n6 4\n5 1\n1 2\n2 4\n6 3\n4 5\n1 5\n4 2\n5 1\n3 1\n6 4\n4 2\n1 5\n4 6\n2 1\n2 6",
"output": "NO"
},
{
"input": "96\n4\n1 5\n1 5\n4 6\n1 2\n4 2\n3 2\n4 6\n6 4\n6 3\n6 2\n4 1\n6 4\n5 1\n2 4\n5 6\n6 5\n3 2\n6 2\n3 1\n1 4\n3 2\n6 2\n2 4\n1 3\n5 4\n1 3\n6 2\n6 2\n5 6\n1 4\n4 2\n6 2\n3 1\n6 5\n3 1\n4 2\n6 3\n3 2\n3 6\n1 3\n5 6\n6 4\n1 4\n5 4\n2 6\n3 5\n5 4\n5 1\n2 4\n1 5\n1 3\n1 2\n1 3\n6 4\n6 3\n4 5\n4 1\n3 6\n1 2\n6 4\n1 2\n2 3\n2 1\n4 6\n1 3\n5 1\n4 5\n5 4\n6 3\n2 6\n5 1\n6 2\n3 1\n3 1\n5 4\n3 1\n5 6\n2 6\n5 6\n4 2\n6 5\n3 2\n6 5\n2 3\n6 4\n6 2\n1 2\n4 1\n1 2\n6 3\n2 1\n5 1\n6 5\n5 4\n4 5\n1 2",
"output": "NO"
},
{
"input": "5\n1\n2 3\n3 5\n4 5\n5 4\n5 3",
"output": "YES"
},
{
"input": "10\n5\n1 3\n3 1\n6 3\n6 3\n4 6\n3 1\n1 4\n3 1\n4 6\n1 3",
"output": "YES"
},
{
"input": "15\n4\n2 1\n2 6\n6 5\n5 1\n1 5\n2 1\n6 5\n5 1\n5 1\n6 2\n6 5\n5 1\n5 1\n6 5\n2 6",
"output": "YES"
},
{
"input": "20\n6\n3 2\n4 2\n3 5\n4 2\n5 3\n5 4\n2 3\n2 3\n4 5\n3 5\n3 2\n2 4\n4 5\n2 4\n3 2\n4 2\n5 4\n3 2\n3 5\n2 4",
"output": "YES"
},
{
"input": "25\n4\n1 2\n1 5\n5 6\n1 2\n5 1\n5 6\n5 1\n6 5\n2 1\n2 6\n2 6\n2 6\n2 6\n5 6\n2 6\n6 5\n2 1\n1 5\n1 2\n1 2\n6 5\n1 2\n6 5\n6 2\n2 6",
"output": "YES"
},
{
"input": "100\n3\n6 5\n1 5\n2 1\n5 1\n6 5\n5 1\n6 2\n1 2\n6 5\n5 1\n5 1\n1 5\n2 6\n6 2\n5 6\n1 2\n1 5\n5 6\n1 5\n1 2\n2 6\n1 2\n6 2\n1 5\n6 2\n2 6\n1 5\n6 2\n6 5\n5 6\n1 5\n5 6\n5 1\n5 1\n2 1\n1 2\n5 6\n6 5\n1 5\n5 1\n1 2\n1 5\n1 2\n2 6\n5 1\n2 6\n2 6\n5 6\n2 6\n6 5\n6 5\n1 5\n2 1\n5 6\n5 6\n1 2\n2 1\n1 2\n1 2\n1 2\n5 6\n6 2\n1 5\n1 2\n2 1\n2 6\n1 2\n5 1\n1 5\n6 5\n5 1\n5 1\n2 6\n5 6\n6 2\n1 2\n5 1\n6 2\n2 1\n5 6\n2 1\n1 5\n6 5\n6 5\n1 2\n1 2\n5 1\n6 2\n6 2\n1 2\n1 5\n6 5\n5 6\n1 2\n6 5\n2 1\n6 5\n1 5\n5 6\n6 5",
"output": "YES"
},
{
"input": "99\n3\n2 1\n2 6\n6 2\n1 5\n1 5\n6 2\n6 5\n6 5\n6 2\n5 6\n6 5\n6 2\n5 1\n2 6\n6 5\n1 5\n1 5\n2 6\n5 1\n1 5\n1 5\n2 1\n5 6\n6 5\n5 6\n2 6\n6 2\n6 5\n1 2\n1 2\n1 2\n2 6\n5 6\n1 2\n5 6\n1 2\n5 1\n6 5\n2 6\n5 1\n1 2\n1 5\n1 5\n6 2\n5 1\n2 6\n1 2\n5 1\n1 5\n6 5\n6 5\n5 6\n2 1\n2 6\n2 6\n1 2\n6 2\n2 6\n5 6\n6 5\n1 5\n2 1\n1 2\n6 2\n5 6\n6 5\n2 1\n1 5\n1 5\n2 6\n5 1\n1 2\n5 6\n2 1\n6 5\n5 1\n2 1\n6 2\n6 5\n6 5\n5 6\n1 2\n6 5\n1 2\n5 1\n2 1\n5 1\n2 6\n2 1\n6 2\n2 6\n2 6\n2 1\n2 1\n5 1\n1 5\n5 6\n2 1\n5 6",
"output": "YES"
},
{
"input": "98\n6\n4 2\n2 3\n2 3\n2 3\n2 3\n2 3\n3 2\n5 4\n4 2\n5 4\n5 4\n5 4\n5 3\n4 5\n2 3\n4 2\n5 3\n5 4\n4 5\n3 5\n3 2\n4 2\n2 4\n5 4\n2 3\n2 4\n5 4\n4 2\n3 5\n5 4\n2 3\n2 4\n3 5\n2 3\n3 5\n4 2\n3 5\n5 3\n4 2\n5 3\n5 3\n2 3\n2 4\n4 5\n3 2\n4 2\n3 5\n3 2\n3 5\n5 4\n3 5\n3 5\n4 2\n4 2\n3 2\n4 5\n5 4\n2 3\n5 4\n2 4\n2 3\n4 5\n3 5\n5 4\n3 2\n2 3\n5 3\n2 3\n5 3\n2 3\n2 3\n2 4\n2 3\n2 3\n5 3\n2 3\n4 2\n4 2\n5 4\n2 3\n2 3\n4 5\n3 2\n5 3\n3 2\n2 4\n2 4\n5 3\n5 4\n4 5\n5 3\n4 5\n2 4\n5 3\n4 2\n5 4\n2 4\n5 3",
"output": "YES"
},
{
"input": "97\n3\n2 1\n5 6\n1 2\n5 6\n2 6\n2 1\n6 2\n6 5\n6 2\n1 5\n1 2\n1 2\n6 2\n2 6\n6 5\n2 6\n6 5\n5 1\n6 2\n2 6\n2 6\n1 2\n2 6\n1 2\n1 5\n6 2\n6 5\n6 5\n2 6\n1 5\n6 5\n6 2\n6 2\n2 6\n5 6\n5 6\n1 5\n6 5\n2 6\n5 6\n1 5\n5 6\n1 5\n1 2\n5 1\n5 1\n1 5\n5 1\n1 5\n6 2\n6 2\n5 1\n6 5\n2 1\n2 6\n1 5\n1 5\n6 2\n2 6\n5 6\n2 6\n5 6\n2 6\n6 2\n5 6\n1 2\n6 2\n5 6\n6 2\n1 5\n5 6\n1 5\n2 6\n2 6\n2 1\n6 5\n5 1\n5 1\n1 2\n2 1\n2 1\n6 2\n1 5\n2 1\n2 1\n6 2\n5 1\n5 1\n2 6\n1 5\n1 2\n6 2\n2 6\n5 1\n6 5\n1 2\n6 2",
"output": "YES"
},
{
"input": "96\n4\n1 5\n5 1\n6 5\n2 1\n2 1\n2 6\n6 5\n6 5\n6 2\n2 6\n1 5\n6 5\n1 5\n2 6\n6 5\n5 6\n2 1\n2 6\n1 2\n1 5\n2 6\n2 6\n2 1\n1 5\n5 1\n1 2\n2 6\n2 6\n6 5\n1 5\n2 1\n2 6\n1 2\n5 6\n1 5\n2 6\n6 2\n2 6\n6 5\n1 5\n6 5\n6 5\n1 5\n5 1\n6 2\n5 1\n5 1\n1 5\n2 6\n5 1\n1 5\n2 1\n1 2\n6 2\n6 2\n5 6\n1 5\n6 5\n2 1\n6 5\n2 1\n2 1\n1 2\n6 2\n1 2\n1 5\n5 1\n5 6\n6 5\n6 2\n1 5\n2 6\n1 2\n1 2\n5 1\n1 5\n6 5\n6 2\n6 5\n2 6\n5 6\n2 1\n5 6\n2 1\n6 5\n2 6\n2 1\n1 5\n2 1\n6 2\n1 2\n1 5\n5 6\n5 1\n5 6\n2 1",
"output": "YES"
},
{
"input": "3\n6\n3 2\n5 4\n2 6",
"output": "NO"
},
{
"input": "4\n1\n2 3\n2 3\n2 3\n1 3",
"output": "NO"
},
{
"input": "2\n6\n3 2\n6 4",
"output": "NO"
},
{
"input": "3\n6\n3 2\n5 6\n2 4",
"output": "NO"
},
{
"input": "2\n5\n6 3\n4 5",
"output": "NO"
},
{
"input": "2\n6\n3 2\n6 5",
"output": "NO"
},
{
"input": "2\n1\n3 2\n1 2",
"output": "NO"
},
{
"input": "2\n3\n5 1\n3 5",
"output": "NO"
},
{
"input": "2\n1\n2 3\n1 2",
"output": "NO"
},
{
"input": "2\n1\n2 3\n2 1",
"output": "NO"
},
{
"input": "3\n1\n4 5\n4 1\n4 5",
"output": "NO"
},
{
"input": "2\n4\n2 6\n5 4",
"output": "NO"
},
{
"input": "2\n6\n3 2\n6 2",
"output": "NO"
},
{
"input": "2\n3\n2 1\n3 5",
"output": "NO"
},
{
"input": "2\n3\n1 2\n3 1",
"output": "NO"
},
{
"input": "2\n3\n2 6\n5 3",
"output": "NO"
},
{
"input": "3\n3\n1 2\n3 2\n3 1",
"output": "NO"
},
{
"input": "3\n5\n3 1\n1 3\n2 3",
"output": "NO"
},
{
"input": "2\n6\n2 4\n6 5",
"output": "NO"
},
{
"input": "2\n6\n4 5\n6 5",
"output": "NO"
},
{
"input": "2\n6\n3 5\n3 6",
"output": "NO"
},
{
"input": "2\n4\n1 2\n4 5",
"output": "NO"
},
{
"input": "2\n3\n2 6\n3 1",
"output": "NO"
}
] | 1,684,062,677
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 62
| 0
|
#all those moments will be lost in time , like tears in rain
n=int(input())
x=int(input())
for i in range (n):
a,b=map(int,input().split())
if a==x or a==7-x or b==x or b==7-x:
print("NO")
break
print("YES")
|
Title: Dice Tower
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A dice is a cube, its faces contain distinct integers from 1 to 6 as black points. The sum of numbers at the opposite dice faces always equals 7. Please note that there are only two dice (these dices are mirror of each other) that satisfy the given constraints (both of them are shown on the picture on the left).
Alice and Bob play dice. Alice has built a tower from *n* dice. We know that in this tower the adjacent dice contact with faces with distinct numbers. Bob wants to uniquely identify the numbers written on the faces of all dice, from which the tower is built. Unfortunately, Bob is looking at the tower from the face, and so he does not see all the numbers on the faces. Bob sees the number on the top of the tower and the numbers on the two adjacent sides (on the right side of the picture shown what Bob sees).
Help Bob, tell whether it is possible to uniquely identify the numbers on the faces of all the dice in the tower, or not.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of dice in the tower.
The second line contains an integer *x* (1<=≤<=*x*<=≤<=6) — the number Bob sees at the top of the tower. Next *n* lines contain two space-separated integers each: the *i*-th line contains numbers *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=6; *a**i*<=≠<=*b**i*) — the numbers Bob sees on the two sidelong faces of the *i*-th dice in the tower.
Consider the dice in the tower indexed from top to bottom from 1 to *n*. That is, the topmost dice has index 1 (the dice whose top face Bob can see). It is guaranteed that it is possible to make a dice tower that will look as described in the input.
Output Specification:
Print "YES" (without the quotes), if it is possible to to uniquely identify the numbers on the faces of all the dice in the tower. If it is impossible, print "NO" (without the quotes).
Demo Input:
['3\n6\n3 2\n5 4\n2 4\n', '3\n3\n2 6\n4 1\n5 3\n']
Demo Output:
['YES', 'NO']
Note:
none
|
```python
#all those moments will be lost in time , like tears in rain
n=int(input())
x=int(input())
for i in range (n):
a,b=map(int,input().split())
if a==x or a==7-x or b==x or b==7-x:
print("NO")
break
print("YES")
```
| 0
|
|
404
|
A
|
Valera and X
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet.
Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if:
- on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals.
Help Valera, write the program that completes the described task for him.
|
The first line contains integer *n* (3<=≤<=*n*<=<<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper.
|
Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes.
|
[
"5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n",
"3\nwsw\nsws\nwsw\n",
"3\nxpx\npxp\nxpe\n"
] |
[
"NO\n",
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox",
"output": "NO"
},
{
"input": "3\nwsw\nsws\nwsw",
"output": "YES"
},
{
"input": "3\nxpx\npxp\nxpe",
"output": "NO"
},
{
"input": "5\nliiil\nilili\niilii\nilili\nliiil",
"output": "YES"
},
{
"input": "7\nbwccccb\nckcccbj\nccbcbcc\ncccbccc\nccbcbcc\ncbcccbc\nbccccdt",
"output": "NO"
},
{
"input": "13\nsooooooooooos\nosoooooooooso\noosooooooosoo\nooosooooosooo\noooosooosoooo\nooooososooooo\noooooosoooooo\nooooososooooo\noooosooosoooo\nooosooooosooo\noosooooooosoo\nosoooooooooso\nsooooooooooos",
"output": "YES"
},
{
"input": "3\naaa\naaa\naaa",
"output": "NO"
},
{
"input": "3\naca\noec\nzba",
"output": "NO"
},
{
"input": "15\nrxeeeeeeeeeeeer\nereeeeeeeeeeere\needeeeeeeeeeoee\neeereeeeeeeewee\neeeereeeeebeeee\nqeeeereeejedyee\neeeeeerereeeeee\neeeeeeereeeeeee\neeeeeerereeeeze\neeeeereeereeeee\neeeereeeeegeeee\neeereeeeeeereee\neereeeeeeqeeved\ncreeeeeeceeeere\nreeerneeeeeeeer",
"output": "NO"
},
{
"input": "5\nxxxxx\nxxxxx\nxxxxx\nxxxxx\nxxxxx",
"output": "NO"
},
{
"input": "5\nxxxxx\nxxxxx\nxoxxx\nxxxxx\nxxxxx",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxxxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxoox\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxaxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\noxoxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "3\nxxx\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxx\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxxx",
"output": "NO"
},
{
"input": "3\nxax\nxxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naaa\nxax",
"output": "NO"
},
{
"input": "3\naax\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxaa\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\naax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxaa",
"output": "NO"
},
{
"input": "3\nxfx\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\nafa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxaf",
"output": "NO"
},
{
"input": "3\nxox\nxxx\nxxx",
"output": "NO"
},
{
"input": "3\naxa\naax\nxxa",
"output": "NO"
},
{
"input": "3\nxox\noxx\nxox",
"output": "NO"
},
{
"input": "3\nxox\nooo\nxox",
"output": "NO"
},
{
"input": "3\naaa\naab\nbbb",
"output": "NO"
},
{
"input": "3\nxxx\nsxs\nxsx",
"output": "NO"
},
{
"input": "5\nabbba\nbabab\nbbbbb\nbaaab\nabbba",
"output": "NO"
},
{
"input": "5\nabaaa\nbbbbb\nbbabb\nbabab\nabbba",
"output": "NO"
},
{
"input": "5\nxoxox\noxoxo\nooxoo\noxoxo\nxooox",
"output": "NO"
},
{
"input": "3\nxox\noxx\nxxx",
"output": "NO"
},
{
"input": "5\nxoooo\noxooo\nooxoo\noooxo\noooox",
"output": "NO"
},
{
"input": "5\nxoooo\noxoxx\nooxoo\noxoxo\noxoox",
"output": "NO"
},
{
"input": "3\naaa\nbab\naba",
"output": "NO"
}
] | 1,632,168,155
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 6
| 62
| 6,963,200
|
n=int(input())
l=[]
f=0
for i in range(n):
st=input()
l.append(st)
if i==0:
diag = st[0]
normal = st[1]
for j in range(n):
if j==i or j==n-1-i:
if st[j]!=diag:
print("NO")
f=1
break
else:
if st[j]!=normal:
print("NO")
f=1
break
if f==1:
break
else:
print("YES")
|
Title: Valera and X
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet.
Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if:
- on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals.
Help Valera, write the program that completes the described task for him.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=<<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper.
Output Specification:
Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes.
Demo Input:
['5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n', '3\nwsw\nsws\nwsw\n', '3\nxpx\npxp\nxpe\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
none
|
```python
n=int(input())
l=[]
f=0
for i in range(n):
st=input()
l.append(st)
if i==0:
diag = st[0]
normal = st[1]
for j in range(n):
if j==i or j==n-1-i:
if st[j]!=diag:
print("NO")
f=1
break
else:
if st[j]!=normal:
print("NO")
f=1
break
if f==1:
break
else:
print("YES")
```
| 0
|
|
509
|
A
|
Maximum in Table
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
|
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
|
Print a single line containing a positive integer *m* — the maximum value in the table.
|
[
"1\n",
"5\n"
] |
[
"1",
"70"
] |
In the second test the rows of the table look as follows:
| 0
|
[
{
"input": "1",
"output": "1"
},
{
"input": "5",
"output": "70"
},
{
"input": "2",
"output": "2"
},
{
"input": "3",
"output": "6"
},
{
"input": "4",
"output": "20"
},
{
"input": "6",
"output": "252"
},
{
"input": "7",
"output": "924"
},
{
"input": "9",
"output": "12870"
},
{
"input": "10",
"output": "48620"
},
{
"input": "8",
"output": "3432"
}
] | 1,604,398,286
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 10
| 140
| 0
|
def fact(n):
if n == 0:
return 1
else:
return n * fact(n-1)
n=int(input())
a=2*(n-1)
b=a//2
if n==1:
print(1)
else:
print(fact(a)//(fact(b)*fact(a-b)))
|
Title: Maximum in Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
Input Specification:
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
Output Specification:
Print a single line containing a positive integer *m* — the maximum value in the table.
Demo Input:
['1\n', '5\n']
Demo Output:
['1', '70']
Note:
In the second test the rows of the table look as follows:
|
```python
def fact(n):
if n == 0:
return 1
else:
return n * fact(n-1)
n=int(input())
a=2*(n-1)
b=a//2
if n==1:
print(1)
else:
print(fact(a)//(fact(b)*fact(a-b)))
```
| 3
|
|
350
|
B
|
Resort
|
PROGRAMMING
| 1,500
|
[
"graphs"
] | null | null |
Valera's finally decided to go on holiday! He packed up and headed for a ski resort.
Valera's fancied a ski trip but he soon realized that he could get lost in this new place. Somebody gave him a useful hint: the resort has *n* objects (we will consider the objects indexed in some way by integers from 1 to *n*), each object is either a hotel or a mountain.
Valera has also found out that the ski resort had multiple ski tracks. Specifically, for each object *v*, the resort has at most one object *u*, such that there is a ski track built from object *u* to object *v*. We also know that no hotel has got a ski track leading from the hotel to some object.
Valera is afraid of getting lost on the resort. So he wants you to come up with a path he would walk along. The path must consist of objects *v*1,<=*v*2,<=...,<=*v**k* (*k*<=≥<=1) and meet the following conditions:
1. Objects with numbers *v*1,<=*v*2,<=...,<=*v**k*<=-<=1 are mountains and the object with number *v**k* is the hotel. 1. For any integer *i* (1<=≤<=*i*<=<<=*k*), there is exactly one ski track leading from object *v**i*. This track goes to object *v**i*<=+<=1. 1. The path contains as many objects as possible (*k* is maximal).
Help Valera. Find such path that meets all the criteria of our hero!
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of objects.
The second line contains *n* space-separated integers *type*1,<=*type*2,<=...,<=*type**n* — the types of the objects. If *type**i* equals zero, then the *i*-th object is the mountain. If *type**i* equals one, then the *i*-th object is the hotel. It is guaranteed that at least one object is a hotel.
The third line of the input contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=*n*) — the description of the ski tracks. If number *a**i* equals zero, then there is no such object *v*, that has a ski track built from *v* to *i*. If number *a**i* doesn't equal zero, that means that there is a track built from object *a**i* to object *i*.
|
In the first line print *k* — the maximum possible path length for Valera. In the second line print *k* integers *v*1,<=*v*2,<=...,<=*v**k* — the path. If there are multiple solutions, you can print any of them.
|
[
"5\n0 0 0 0 1\n0 1 2 3 4\n",
"5\n0 0 1 0 1\n0 1 2 2 4\n",
"4\n1 0 0 0\n2 3 4 2\n"
] |
[
"5\n1 2 3 4 5\n",
"2\n4 5\n",
"1\n1\n"
] |
none
| 1,000
|
[
{
"input": "5\n0 0 0 0 1\n0 1 2 3 4",
"output": "5\n1 2 3 4 5"
},
{
"input": "5\n0 0 1 0 1\n0 1 2 2 4",
"output": "2\n4 5"
},
{
"input": "4\n1 0 0 0\n2 3 4 2",
"output": "1\n1"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 1\n4 0 8 4 7 8 5 5 7 2",
"output": "2\n2 10"
},
{
"input": "50\n0 0 0 0 0 0 0 0 0 0 1 0 1 0 0 1 1 0 0 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 1 0 0 1 1 0 0 0 1 0\n28 4 33 22 4 35 36 31 42 25 50 33 25 36 18 23 23 28 43 3 18 31 1 2 15 22 40 43 29 32 28 35 18 27 48 40 14 36 27 50 40 5 48 14 36 24 32 33 26 50",
"output": "2\n3 20"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 1 0 0 0 0 1 0 0 0 0 1 0 0 0 0 0\n86 12 47 46 45 31 20 47 58 79 23 70 35 72 37 20 16 64 46 87 57 7 84 72 70 3 14 40 17 42 30 99 12 20 38 98 14 40 4 83 10 15 47 30 83 58 12 7 97 46 17 6 41 13 87 37 36 12 7 25 26 35 69 13 18 5 9 53 72 28 13 51 5 57 14 64 28 25 91 96 57 69 9 12 97 7 56 42 31 15 88 16 41 88 86 13 89 81 3 42",
"output": "1\n44"
},
{
"input": "10\n1 0 0 0 0 0 0 0 0 0\n6 2 7 8 2 9 0 5 4 2",
"output": "6\n5 8 4 9 6 1"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n38 2 49 55 6 42 12 100 25 69 85 76 13 22 78 73 37 64 5 21 0 23 61 87 4 16 44 3 98 54 1 91 18 26 82 24 18 50 95 21 75 97 51 9 67 73 51 19 63 92 27 82 8 7 20 84 2 93 40 11 39 80 58 85 74 48 72 78 34 33 31 65 46 71 32 36 33 88 47 4 66 84 16 27 16 14 90 16 79 41 99 30 57 73 28 89 45 81 86 29",
"output": "52\n57 93 58 63 49 3 28 95 39 61 23 22 14 86 99 91 32 75 41 90 87 24 36 76 12 7 54 30 92 50 38 1 31 71 74 65 72 67 45 97 42 6 5 19 48 66 81 98 29 100 8 53"
},
{
"input": "2\n1 1\n0 0",
"output": "1\n1"
},
{
"input": "1\n1\n0",
"output": "1\n1"
}
] | 1,695,378,585
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 36
| 340
| 19,660,800
|
def solve():
n = int(input())
arr = list(map(int,input().split()))
parent = list(map(int,input().split()))
degree = [0]*n
for i in range(n):
parent[i] -=1
if parent[i]!=-1:
degree[parent[i]]+=1
ans = []
visited = [False]*n
for i in range(n):
if arr[i]==1:
s = i
tmp = []
while parent[s]!=-1 and degree[parent[s]]<=1:
tmp.append(s)
s = parent[s]
tmp.append(s)
if len(tmp)>len(ans):
ans = tmp
ans = ans[::-1]
print(len(ans))
for i in ans:
print(i+1,end=' ')
# number of test cases
t = 1
#t = int(input())
for i in range(t):
solve()
|
Title: Resort
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera's finally decided to go on holiday! He packed up and headed for a ski resort.
Valera's fancied a ski trip but he soon realized that he could get lost in this new place. Somebody gave him a useful hint: the resort has *n* objects (we will consider the objects indexed in some way by integers from 1 to *n*), each object is either a hotel or a mountain.
Valera has also found out that the ski resort had multiple ski tracks. Specifically, for each object *v*, the resort has at most one object *u*, such that there is a ski track built from object *u* to object *v*. We also know that no hotel has got a ski track leading from the hotel to some object.
Valera is afraid of getting lost on the resort. So he wants you to come up with a path he would walk along. The path must consist of objects *v*1,<=*v*2,<=...,<=*v**k* (*k*<=≥<=1) and meet the following conditions:
1. Objects with numbers *v*1,<=*v*2,<=...,<=*v**k*<=-<=1 are mountains and the object with number *v**k* is the hotel. 1. For any integer *i* (1<=≤<=*i*<=<<=*k*), there is exactly one ski track leading from object *v**i*. This track goes to object *v**i*<=+<=1. 1. The path contains as many objects as possible (*k* is maximal).
Help Valera. Find such path that meets all the criteria of our hero!
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of objects.
The second line contains *n* space-separated integers *type*1,<=*type*2,<=...,<=*type**n* — the types of the objects. If *type**i* equals zero, then the *i*-th object is the mountain. If *type**i* equals one, then the *i*-th object is the hotel. It is guaranteed that at least one object is a hotel.
The third line of the input contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=*n*) — the description of the ski tracks. If number *a**i* equals zero, then there is no such object *v*, that has a ski track built from *v* to *i*. If number *a**i* doesn't equal zero, that means that there is a track built from object *a**i* to object *i*.
Output Specification:
In the first line print *k* — the maximum possible path length for Valera. In the second line print *k* integers *v*1,<=*v*2,<=...,<=*v**k* — the path. If there are multiple solutions, you can print any of them.
Demo Input:
['5\n0 0 0 0 1\n0 1 2 3 4\n', '5\n0 0 1 0 1\n0 1 2 2 4\n', '4\n1 0 0 0\n2 3 4 2\n']
Demo Output:
['5\n1 2 3 4 5\n', '2\n4 5\n', '1\n1\n']
Note:
none
|
```python
def solve():
n = int(input())
arr = list(map(int,input().split()))
parent = list(map(int,input().split()))
degree = [0]*n
for i in range(n):
parent[i] -=1
if parent[i]!=-1:
degree[parent[i]]+=1
ans = []
visited = [False]*n
for i in range(n):
if arr[i]==1:
s = i
tmp = []
while parent[s]!=-1 and degree[parent[s]]<=1:
tmp.append(s)
s = parent[s]
tmp.append(s)
if len(tmp)>len(ans):
ans = tmp
ans = ans[::-1]
print(len(ans))
for i in ans:
print(i+1,end=' ')
# number of test cases
t = 1
#t = int(input())
for i in range(t):
solve()
```
| 3
|
|
115
|
A
|
Party
|
PROGRAMMING
| 900
|
[
"dfs and similar",
"graphs",
"trees"
] | null | null |
A company has *n* employees numbered from 1 to *n*. Each employee either has no immediate manager or exactly one immediate manager, who is another employee with a different number. An employee *A* is said to be the superior of another employee *B* if at least one of the following is true:
- Employee *A* is the immediate manager of employee *B* - Employee *B* has an immediate manager employee *C* such that employee *A* is the superior of employee *C*.
The company will not have a managerial cycle. That is, there will not exist an employee who is the superior of his/her own immediate manager.
Today the company is going to arrange a party. This involves dividing all *n* employees into several groups: every employee must belong to exactly one group. Furthermore, within any single group, there must not be two employees *A* and *B* such that *A* is the superior of *B*.
What is the minimum number of groups that must be formed?
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of employees.
The next *n* lines contain the integers *p**i* (1<=≤<=*p**i*<=≤<=*n* or *p**i*<==<=-1). Every *p**i* denotes the immediate manager for the *i*-th employee. If *p**i* is -1, that means that the *i*-th employee does not have an immediate manager.
It is guaranteed, that no employee will be the immediate manager of him/herself (*p**i*<=≠<=*i*). Also, there will be no managerial cycles.
|
Print a single integer denoting the minimum number of groups that will be formed in the party.
|
[
"5\n-1\n1\n2\n1\n-1\n"
] |
[
"3\n"
] |
For the first example, three groups are sufficient, for example:
- Employee 1 - Employees 2 and 4 - Employees 3 and 5
| 500
|
[
{
"input": "5\n-1\n1\n2\n1\n-1",
"output": "3"
},
{
"input": "4\n-1\n1\n2\n3",
"output": "4"
},
{
"input": "12\n-1\n1\n2\n3\n-1\n5\n6\n7\n-1\n9\n10\n11",
"output": "4"
},
{
"input": "6\n-1\n-1\n2\n3\n1\n1",
"output": "3"
},
{
"input": "3\n-1\n1\n1",
"output": "2"
},
{
"input": "1\n-1",
"output": "1"
},
{
"input": "2\n2\n-1",
"output": "2"
},
{
"input": "2\n-1\n-1",
"output": "1"
},
{
"input": "3\n2\n-1\n1",
"output": "3"
},
{
"input": "3\n-1\n-1\n-1",
"output": "1"
},
{
"input": "5\n4\n5\n1\n-1\n4",
"output": "3"
},
{
"input": "12\n-1\n1\n1\n1\n1\n1\n3\n4\n3\n3\n4\n7",
"output": "4"
},
{
"input": "12\n-1\n-1\n1\n-1\n1\n1\n5\n11\n8\n6\n6\n4",
"output": "5"
},
{
"input": "12\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n2\n-1\n-1\n-1",
"output": "2"
},
{
"input": "12\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1",
"output": "1"
},
{
"input": "12\n3\n4\n2\n8\n7\n1\n10\n12\n5\n-1\n9\n11",
"output": "12"
},
{
"input": "12\n5\n6\n7\n1\n-1\n9\n12\n4\n8\n-1\n3\n2",
"output": "11"
},
{
"input": "12\n-1\n9\n11\n6\n6\n-1\n6\n3\n8\n6\n1\n6",
"output": "6"
},
{
"input": "12\n7\n8\n4\n12\n7\n9\n-1\n-1\n-1\n8\n6\n-1",
"output": "3"
},
{
"input": "12\n-1\n10\n-1\n1\n-1\n5\n9\n12\n-1\n-1\n3\n-1",
"output": "2"
},
{
"input": "12\n-1\n7\n9\n12\n1\n7\n-1\n-1\n8\n5\n4\n-1",
"output": "3"
},
{
"input": "12\n11\n11\n8\n9\n1\n1\n2\n-1\n10\n3\n-1\n8",
"output": "5"
},
{
"input": "12\n-1\n8\n9\n-1\n4\n2\n11\n1\n-1\n6\n-1\n10",
"output": "6"
},
{
"input": "12\n7\n4\n4\n-1\n6\n7\n9\n7\n-1\n7\n4\n1",
"output": "4"
},
{
"input": "12\n-1\n6\n10\n6\n1\n11\n5\n9\n11\n5\n1\n9",
"output": "4"
},
{
"input": "12\n8\n6\n6\n8\n6\n-1\n6\n6\n8\n6\n8\n8",
"output": "3"
},
{
"input": "12\n3\n8\n9\n12\n2\n8\n11\n12\n2\n9\n-1\n11",
"output": "7"
},
{
"input": "7\n7\n6\n-1\n-1\n4\n4\n-1",
"output": "3"
},
{
"input": "77\n53\n-1\n48\n-1\n51\n-1\n54\n43\n70\n19\n64\n31\n45\n58\n6\n61\n41\n56\n34\n-1\n54\n-1\n66\n65\n74\n16\n38\n1\n2\n61\n-1\n34\n-1\n-1\n7\n19\n57\n13\n61\n42\n-1\n34\n65\n16\n31\n61\n6\n5\n34\n15\n-1\n13\n4\n22\n74\n7\n-1\n70\n38\n61\n45\n53\n46\n22\n-1\n65\n34\n19\n43\n48\n33\n58\n36\n-1\n47\n24\n34",
"output": "6"
},
{
"input": "5\n2\n3\n4\n5\n-1",
"output": "5"
}
] | 1,678,390,766
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 60
| 0
|
n = int(input()) # number of employees
graph = [[] for _ in range(n+1)]
for i in range(1, n+1):
supervisor = int(input())
if supervisor != -1:
graph[supervisor].append(i)
print(graph)
def dfs(node, depth):
max_depth = depth
print (depth)
for child in graph[node]:
max_depth = max(max_depth, dfs(child, depth+1))
return max_depth
ans = 0
for i in range(1, n+1):
ans = max(ans, dfs(i, 1))
print(ans)
|
Title: Party
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A company has *n* employees numbered from 1 to *n*. Each employee either has no immediate manager or exactly one immediate manager, who is another employee with a different number. An employee *A* is said to be the superior of another employee *B* if at least one of the following is true:
- Employee *A* is the immediate manager of employee *B* - Employee *B* has an immediate manager employee *C* such that employee *A* is the superior of employee *C*.
The company will not have a managerial cycle. That is, there will not exist an employee who is the superior of his/her own immediate manager.
Today the company is going to arrange a party. This involves dividing all *n* employees into several groups: every employee must belong to exactly one group. Furthermore, within any single group, there must not be two employees *A* and *B* such that *A* is the superior of *B*.
What is the minimum number of groups that must be formed?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of employees.
The next *n* lines contain the integers *p**i* (1<=≤<=*p**i*<=≤<=*n* or *p**i*<==<=-1). Every *p**i* denotes the immediate manager for the *i*-th employee. If *p**i* is -1, that means that the *i*-th employee does not have an immediate manager.
It is guaranteed, that no employee will be the immediate manager of him/herself (*p**i*<=≠<=*i*). Also, there will be no managerial cycles.
Output Specification:
Print a single integer denoting the minimum number of groups that will be formed in the party.
Demo Input:
['5\n-1\n1\n2\n1\n-1\n']
Demo Output:
['3\n']
Note:
For the first example, three groups are sufficient, for example:
- Employee 1 - Employees 2 and 4 - Employees 3 and 5
|
```python
n = int(input()) # number of employees
graph = [[] for _ in range(n+1)]
for i in range(1, n+1):
supervisor = int(input())
if supervisor != -1:
graph[supervisor].append(i)
print(graph)
def dfs(node, depth):
max_depth = depth
print (depth)
for child in graph[node]:
max_depth = max(max_depth, dfs(child, depth+1))
return max_depth
ans = 0
for i in range(1, n+1):
ans = max(ans, dfs(i, 1))
print(ans)
```
| 0
|
|
331
|
C1
|
The Great Julya Calendar
|
PROGRAMMING
| 1,100
|
[
"dp"
] | null | null |
Yet another Armageddon is coming! This time the culprit is the Julya tribe calendar.
The beavers in this tribe knew math very well. Smart Beaver, an archaeologist, got a sacred plate with a magic integer on it. The translation from Old Beaverish is as follows:
"May the Great Beaver bless you! May your chacres open and may your third eye never turn blind from beholding the Truth! Take the magic number, subtract a digit from it (the digit must occur in the number) and get a new magic number. Repeat this operation until a magic number equals zero. The Earth will stand on Three Beavers for the time, equal to the number of subtractions you perform!"
Distinct subtraction sequences can obviously get you different number of operations. But the Smart Beaver is ready to face the worst and is asking you to count the minimum number of operations he needs to reduce the magic number to zero.
|
The single line contains the magic integer *n*, 0<=≤<=*n*.
- to get 20 points, you need to solve the problem with constraints: *n*<=≤<=106 (subproblem C1); - to get 40 points, you need to solve the problem with constraints: *n*<=≤<=1012 (subproblems C1+C2); - to get 100 points, you need to solve the problem with constraints: *n*<=≤<=1018 (subproblems C1+C2+C3).
|
Print a single integer — the minimum number of subtractions that turns the magic number to a zero.
|
[
"24\n"
] |
[
"5"
] |
In the first test sample the minimum number of operations can be reached by the following sequence of subtractions:
| 20
|
[
{
"input": "24",
"output": "5"
},
{
"input": "0",
"output": "0"
},
{
"input": "3",
"output": "1"
},
{
"input": "8",
"output": "1"
},
{
"input": "9",
"output": "1"
},
{
"input": "10",
"output": "2"
},
{
"input": "31",
"output": "6"
},
{
"input": "701",
"output": "116"
},
{
"input": "222",
"output": "39"
},
{
"input": "156",
"output": "28"
},
{
"input": "12343",
"output": "1778"
},
{
"input": "7984",
"output": "1178"
},
{
"input": "1000000",
"output": "128207"
},
{
"input": "1",
"output": "1"
},
{
"input": "3",
"output": "1"
},
{
"input": "5",
"output": "1"
},
{
"input": "11",
"output": "3"
},
{
"input": "77",
"output": "14"
},
{
"input": "216",
"output": "37"
},
{
"input": "1468",
"output": "233"
},
{
"input": "1995",
"output": "305"
},
{
"input": "11010",
"output": "1568"
},
{
"input": "47320",
"output": "6746"
},
{
"input": "258634",
"output": "35024"
}
] | 1,600,409,701
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS1
| 1
| 186
| 0
|
n=int(input())
dp = [0]*(n)
i=1
while n!=0:
l=sorted(str(n))
m=int(l[-1])
n = int(n)-m
dp[i]=dp[i-1]+1
i+=1
print(max(dp))
|
Title: The Great Julya Calendar
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Yet another Armageddon is coming! This time the culprit is the Julya tribe calendar.
The beavers in this tribe knew math very well. Smart Beaver, an archaeologist, got a sacred plate with a magic integer on it. The translation from Old Beaverish is as follows:
"May the Great Beaver bless you! May your chacres open and may your third eye never turn blind from beholding the Truth! Take the magic number, subtract a digit from it (the digit must occur in the number) and get a new magic number. Repeat this operation until a magic number equals zero. The Earth will stand on Three Beavers for the time, equal to the number of subtractions you perform!"
Distinct subtraction sequences can obviously get you different number of operations. But the Smart Beaver is ready to face the worst and is asking you to count the minimum number of operations he needs to reduce the magic number to zero.
Input Specification:
The single line contains the magic integer *n*, 0<=≤<=*n*.
- to get 20 points, you need to solve the problem with constraints: *n*<=≤<=106 (subproblem C1); - to get 40 points, you need to solve the problem with constraints: *n*<=≤<=1012 (subproblems C1+C2); - to get 100 points, you need to solve the problem with constraints: *n*<=≤<=1018 (subproblems C1+C2+C3).
Output Specification:
Print a single integer — the minimum number of subtractions that turns the magic number to a zero.
Demo Input:
['24\n']
Demo Output:
['5']
Note:
In the first test sample the minimum number of operations can be reached by the following sequence of subtractions:
|
```python
n=int(input())
dp = [0]*(n)
i=1
while n!=0:
l=sorted(str(n))
m=int(l[-1])
n = int(n)-m
dp[i]=dp[i-1]+1
i+=1
print(max(dp))
```
| -1
|
|
534
|
A
|
Exam
|
PROGRAMMING
| 1,100
|
[
"constructive algorithms",
"implementation",
"math"
] | null | null |
An exam for *n* students will take place in a long and narrow room, so the students will sit in a line in some order. The teacher suspects that students with adjacent numbers (*i* and *i*<=+<=1) always studied side by side and became friends and if they take an exam sitting next to each other, they will help each other for sure.
Your task is to choose the maximum number of students and make such an arrangement of students in the room that no two students with adjacent numbers sit side by side.
|
A single line contains integer *n* (1<=≤<=*n*<=≤<=5000) — the number of students at an exam.
|
In the first line print integer *k* — the maximum number of students who can be seated so that no two students with adjacent numbers sit next to each other.
In the second line print *k* distinct integers *a*1,<=*a*2,<=...,<=*a**k* (1<=≤<=*a**i*<=≤<=*n*), where *a**i* is the number of the student on the *i*-th position. The students on adjacent positions mustn't have adjacent numbers. Formally, the following should be true: |*a**i*<=-<=*a**i*<=+<=1|<=≠<=1 for all *i* from 1 to *k*<=-<=1.
If there are several possible answers, output any of them.
|
[
"6",
"3\n"
] |
[
"6\n1 5 3 6 2 4",
"2\n1 3"
] |
none
| 500
|
[
{
"input": "6",
"output": "6\n5 3 1 6 4 2 "
},
{
"input": "3",
"output": "2\n1 3"
},
{
"input": "1",
"output": "1\n1 "
},
{
"input": "2",
"output": "1\n1"
},
{
"input": "4",
"output": "4\n3 1 4 2 "
},
{
"input": "5",
"output": "5\n5 3 1 4 2 "
},
{
"input": "7",
"output": "7\n7 5 3 1 6 4 2 "
},
{
"input": "8",
"output": "8\n7 5 3 1 8 6 4 2 "
},
{
"input": "9",
"output": "9\n9 7 5 3 1 8 6 4 2 "
},
{
"input": "10",
"output": "10\n9 7 5 3 1 10 8 6 4 2 "
},
{
"input": "13",
"output": "13\n13 11 9 7 5 3 1 12 10 8 6 4 2 "
},
{
"input": "16",
"output": "16\n15 13 11 9 7 5 3 1 16 14 12 10 8 6 4 2 "
},
{
"input": "25",
"output": "25\n25 23 21 19 17 15 13 11 9 7 5 3 1 24 22 20 18 16 14 12 10 8 6 4 2 "
},
{
"input": "29",
"output": "29\n29 27 25 23 21 19 17 15 13 11 9 7 5 3 1 28 26 24 22 20 18 16 14 12 10 8 6 4 2 "
},
{
"input": "120",
"output": "120\n119 117 115 113 111 109 107 105 103 101 99 97 95 93 91 89 87 85 83 81 79 77 75 73 71 69 67 65 63 61 59 57 55 53 51 49 47 45 43 41 39 37 35 33 31 29 27 25 23 21 19 17 15 13 11 9 7 5 3 1 120 118 116 114 112 110 108 106 104 102 100 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 "
},
{
"input": "128",
"output": "128\n127 125 123 121 119 117 115 113 111 109 107 105 103 101 99 97 95 93 91 89 87 85 83 81 79 77 75 73 71 69 67 65 63 61 59 57 55 53 51 49 47 45 43 41 39 37 35 33 31 29 27 25 23 21 19 17 15 13 11 9 7 5 3 1 128 126 124 122 120 118 116 114 112 110 108 106 104 102 100 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 "
},
{
"input": "216",
"output": "216\n215 213 211 209 207 205 203 201 199 197 195 193 191 189 187 185 183 181 179 177 175 173 171 169 167 165 163 161 159 157 155 153 151 149 147 145 143 141 139 137 135 133 131 129 127 125 123 121 119 117 115 113 111 109 107 105 103 101 99 97 95 93 91 89 87 85 83 81 79 77 75 73 71 69 67 65 63 61 59 57 55 53 51 49 47 45 43 41 39 37 35 33 31 29 27 25 23 21 19 17 15 13 11 9 7 5 3 1 216 214 212 210 208 206 204 202 200 198 196 194 192 190 188 186 184 182 180 178 176 174 172 170 168 166 164 162 160 158 156 154 1..."
},
{
"input": "729",
"output": "729\n729 727 725 723 721 719 717 715 713 711 709 707 705 703 701 699 697 695 693 691 689 687 685 683 681 679 677 675 673 671 669 667 665 663 661 659 657 655 653 651 649 647 645 643 641 639 637 635 633 631 629 627 625 623 621 619 617 615 613 611 609 607 605 603 601 599 597 595 593 591 589 587 585 583 581 579 577 575 573 571 569 567 565 563 561 559 557 555 553 551 549 547 545 543 541 539 537 535 533 531 529 527 525 523 521 519 517 515 513 511 509 507 505 503 501 499 497 495 493 491 489 487 485 483 481 479 47..."
},
{
"input": "1111",
"output": "1111\n1111 1109 1107 1105 1103 1101 1099 1097 1095 1093 1091 1089 1087 1085 1083 1081 1079 1077 1075 1073 1071 1069 1067 1065 1063 1061 1059 1057 1055 1053 1051 1049 1047 1045 1043 1041 1039 1037 1035 1033 1031 1029 1027 1025 1023 1021 1019 1017 1015 1013 1011 1009 1007 1005 1003 1001 999 997 995 993 991 989 987 985 983 981 979 977 975 973 971 969 967 965 963 961 959 957 955 953 951 949 947 945 943 941 939 937 935 933 931 929 927 925 923 921 919 917 915 913 911 909 907 905 903 901 899 897 895 893 891 889 8..."
},
{
"input": "1597",
"output": "1597\n1597 1595 1593 1591 1589 1587 1585 1583 1581 1579 1577 1575 1573 1571 1569 1567 1565 1563 1561 1559 1557 1555 1553 1551 1549 1547 1545 1543 1541 1539 1537 1535 1533 1531 1529 1527 1525 1523 1521 1519 1517 1515 1513 1511 1509 1507 1505 1503 1501 1499 1497 1495 1493 1491 1489 1487 1485 1483 1481 1479 1477 1475 1473 1471 1469 1467 1465 1463 1461 1459 1457 1455 1453 1451 1449 1447 1445 1443 1441 1439 1437 1435 1433 1431 1429 1427 1425 1423 1421 1419 1417 1415 1413 1411 1409 1407 1405 1403 1401 1399 1397 ..."
},
{
"input": "1777",
"output": "1777\n1777 1775 1773 1771 1769 1767 1765 1763 1761 1759 1757 1755 1753 1751 1749 1747 1745 1743 1741 1739 1737 1735 1733 1731 1729 1727 1725 1723 1721 1719 1717 1715 1713 1711 1709 1707 1705 1703 1701 1699 1697 1695 1693 1691 1689 1687 1685 1683 1681 1679 1677 1675 1673 1671 1669 1667 1665 1663 1661 1659 1657 1655 1653 1651 1649 1647 1645 1643 1641 1639 1637 1635 1633 1631 1629 1627 1625 1623 1621 1619 1617 1615 1613 1611 1609 1607 1605 1603 1601 1599 1597 1595 1593 1591 1589 1587 1585 1583 1581 1579 1577 ..."
},
{
"input": "2048",
"output": "2048\n2047 2045 2043 2041 2039 2037 2035 2033 2031 2029 2027 2025 2023 2021 2019 2017 2015 2013 2011 2009 2007 2005 2003 2001 1999 1997 1995 1993 1991 1989 1987 1985 1983 1981 1979 1977 1975 1973 1971 1969 1967 1965 1963 1961 1959 1957 1955 1953 1951 1949 1947 1945 1943 1941 1939 1937 1935 1933 1931 1929 1927 1925 1923 1921 1919 1917 1915 1913 1911 1909 1907 1905 1903 1901 1899 1897 1895 1893 1891 1889 1887 1885 1883 1881 1879 1877 1875 1873 1871 1869 1867 1865 1863 1861 1859 1857 1855 1853 1851 1849 1847 ..."
},
{
"input": "2999",
"output": "2999\n2999 2997 2995 2993 2991 2989 2987 2985 2983 2981 2979 2977 2975 2973 2971 2969 2967 2965 2963 2961 2959 2957 2955 2953 2951 2949 2947 2945 2943 2941 2939 2937 2935 2933 2931 2929 2927 2925 2923 2921 2919 2917 2915 2913 2911 2909 2907 2905 2903 2901 2899 2897 2895 2893 2891 2889 2887 2885 2883 2881 2879 2877 2875 2873 2871 2869 2867 2865 2863 2861 2859 2857 2855 2853 2851 2849 2847 2845 2843 2841 2839 2837 2835 2833 2831 2829 2827 2825 2823 2821 2819 2817 2815 2813 2811 2809 2807 2805 2803 2801 2799 ..."
},
{
"input": "3001",
"output": "3001\n3001 2999 2997 2995 2993 2991 2989 2987 2985 2983 2981 2979 2977 2975 2973 2971 2969 2967 2965 2963 2961 2959 2957 2955 2953 2951 2949 2947 2945 2943 2941 2939 2937 2935 2933 2931 2929 2927 2925 2923 2921 2919 2917 2915 2913 2911 2909 2907 2905 2903 2901 2899 2897 2895 2893 2891 2889 2887 2885 2883 2881 2879 2877 2875 2873 2871 2869 2867 2865 2863 2861 2859 2857 2855 2853 2851 2849 2847 2845 2843 2841 2839 2837 2835 2833 2831 2829 2827 2825 2823 2821 2819 2817 2815 2813 2811 2809 2807 2805 2803 2801 ..."
},
{
"input": "4181",
"output": "4181\n4181 4179 4177 4175 4173 4171 4169 4167 4165 4163 4161 4159 4157 4155 4153 4151 4149 4147 4145 4143 4141 4139 4137 4135 4133 4131 4129 4127 4125 4123 4121 4119 4117 4115 4113 4111 4109 4107 4105 4103 4101 4099 4097 4095 4093 4091 4089 4087 4085 4083 4081 4079 4077 4075 4073 4071 4069 4067 4065 4063 4061 4059 4057 4055 4053 4051 4049 4047 4045 4043 4041 4039 4037 4035 4033 4031 4029 4027 4025 4023 4021 4019 4017 4015 4013 4011 4009 4007 4005 4003 4001 3999 3997 3995 3993 3991 3989 3987 3985 3983 3981 ..."
},
{
"input": "4990",
"output": "4990\n4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 4795 4793 4791 4789 ..."
},
{
"input": "4991",
"output": "4991\n4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 4795 4793 4791 ..."
},
{
"input": "4992",
"output": "4992\n4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 4795 4793 4791 ..."
},
{
"input": "4993",
"output": "4993\n4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 4795 4793 ..."
},
{
"input": "4994",
"output": "4994\n4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 4795 4793 ..."
},
{
"input": "4995",
"output": "4995\n4995 4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 4795 ..."
},
{
"input": "4996",
"output": "4996\n4995 4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 4795 ..."
},
{
"input": "4997",
"output": "4997\n4997 4995 4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 ..."
},
{
"input": "4998",
"output": "4998\n4997 4995 4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 ..."
},
{
"input": "4999",
"output": "4999\n4999 4997 4995 4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 ..."
},
{
"input": "5000",
"output": "5000\n4999 4997 4995 4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 ..."
}
] | 1,593,343,717
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 109
| 6,963,200
|
n = int(input())
res = []
odds = []
evens = []
if n == 1:
res = [1]
else:
for i in range(1, n+1):
if i % 2 == 0:
evens.append(i)
else:
odds.append(i)
if odds[-1] - evens[0] > 1:
res = odds + evens
else:
if odds[0] - evens[-1] > 1:
res = evens + odds
else:
if len(odds) > len(evens):
res = odds
else:
res = evens
res_str = []
for i in res:
res_str.append(str(i))
print(len(res))
print(' '.join(res_str))
|
Title: Exam
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An exam for *n* students will take place in a long and narrow room, so the students will sit in a line in some order. The teacher suspects that students with adjacent numbers (*i* and *i*<=+<=1) always studied side by side and became friends and if they take an exam sitting next to each other, they will help each other for sure.
Your task is to choose the maximum number of students and make such an arrangement of students in the room that no two students with adjacent numbers sit side by side.
Input Specification:
A single line contains integer *n* (1<=≤<=*n*<=≤<=5000) — the number of students at an exam.
Output Specification:
In the first line print integer *k* — the maximum number of students who can be seated so that no two students with adjacent numbers sit next to each other.
In the second line print *k* distinct integers *a*1,<=*a*2,<=...,<=*a**k* (1<=≤<=*a**i*<=≤<=*n*), where *a**i* is the number of the student on the *i*-th position. The students on adjacent positions mustn't have adjacent numbers. Formally, the following should be true: |*a**i*<=-<=*a**i*<=+<=1|<=≠<=1 for all *i* from 1 to *k*<=-<=1.
If there are several possible answers, output any of them.
Demo Input:
['6', '3\n']
Demo Output:
['6\n1 5 3 6 2 4', '2\n1 3']
Note:
none
|
```python
n = int(input())
res = []
odds = []
evens = []
if n == 1:
res = [1]
else:
for i in range(1, n+1):
if i % 2 == 0:
evens.append(i)
else:
odds.append(i)
if odds[-1] - evens[0] > 1:
res = odds + evens
else:
if odds[0] - evens[-1] > 1:
res = evens + odds
else:
if len(odds) > len(evens):
res = odds
else:
res = evens
res_str = []
for i in res:
res_str.append(str(i))
print(len(res))
print(' '.join(res_str))
```
| 0
|
|
733
|
A
|
Grasshopper And the String
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
One day, the Grasshopper was jumping on the lawn and found a piece of paper with a string. Grasshopper became interested what is the minimum jump ability he should have in order to be able to reach the far end of the string, jumping only on vowels of the English alphabet. Jump ability is the maximum possible length of his jump.
Formally, consider that at the begginning the Grasshopper is located directly in front of the leftmost character of the string. His goal is to reach the position right after the rightmost character of the string. In one jump the Grasshopper could jump to the right any distance from 1 to the value of his jump ability.
The following letters are vowels: 'A', 'E', 'I', 'O', 'U' and 'Y'.
|
The first line contains non-empty string consisting of capital English letters. It is guaranteed that the length of the string does not exceed 100.
|
Print single integer *a* — the minimum jump ability of the Grasshopper (in the number of symbols) that is needed to overcome the given string, jumping only on vowels.
|
[
"ABABBBACFEYUKOTT\n",
"AAA\n"
] |
[
"4",
"1"
] |
none
| 500
|
[
{
"input": "ABABBBACFEYUKOTT",
"output": "4"
},
{
"input": "AAA",
"output": "1"
},
{
"input": "A",
"output": "1"
},
{
"input": "B",
"output": "2"
},
{
"input": "AEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOIKLMJNHGTRWSDZXCVBNMHGFDSXVWRTPPPLKMNBXIUOIUOIUOIUOOIU",
"output": "39"
},
{
"input": "AEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOIAEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOI",
"output": "1"
},
{
"input": "KMLPTGFHNBVCDRFGHNMBVXWSQFDCVBNHTJKLPMNFVCKMLPTGFHNBVCDRFGHNMBVXWSQFDCVBNHTJKLPMNFVC",
"output": "85"
},
{
"input": "QWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZ",
"output": "18"
},
{
"input": "PKLKBWTXVJ",
"output": "11"
},
{
"input": "CFHFPTGMOKXVLJJZJDQW",
"output": "12"
},
{
"input": "TXULTFSBUBFLRNQORMMULWNVLPWTYJXZBPBGAWNX",
"output": "9"
},
{
"input": "DAIUSEAUEUYUWEIOOEIOUYVYYOPEEWEBZOOOAOXUOIEUKYYOJOYAUYUUIYUXOUJLGIYEIIYUOCUAACRY",
"output": "4"
},
{
"input": "VRPHBNWNWVWBWMFJJDCTJQJDJBKSJRZLVQRVVFLTZFSGCGDXCWQVWWWMFVCQHPKXXVRKTGWGPSMQTPKNDQJHNSKLXPCXDJDQDZZD",
"output": "101"
},
{
"input": "SGDDFCDRDWGPNNFBBZZJSPXFYMZKPRXTCHVJSJJBWZXXQMDZBNKDHRGSRLGLRKPMWXNSXJPNJLDPXBSRCQMHJKPZNTPNTZXNPCJC",
"output": "76"
},
{
"input": "NVTQVNLGWFDBCBKSDLTBGWBMNQZWZQJWNGVCTCQBGWNTYJRDBPZJHXCXFMIXNRGSTXHQPCHNFQPCMDZWJGLJZWMRRFCVLBKDTDSC",
"output": "45"
},
{
"input": "SREZXQFVPQCLRCQGMKXCBRWKYZKWKRMZGXPMKWNMFZTRDPHJFCSXVPPXWKZMZTBFXGNLPLHZIPLFXNRRQFDTLFPKBGCXKTMCFKKT",
"output": "48"
},
{
"input": "ICKJKMVPDNZPLKDSLTPZNRLSQSGHQJQQPJJSNHNWVDLJRLZEJSXZDPHYXGGWXHLCTVQSKWNWGTLJMOZVJNZPVXGVPJKHFVZTGCCX",
"output": "47"
},
{
"input": "XXFPZDRPXLNHGDVCBDKJMKLGUQZXLLWYLOKFZVGXVNPJWZZZNRMQBRJCZTSDRHSNCVDMHKVXCXPCRBWSJCJWDRDPVZZLCZRTDRYA",
"output": "65"
},
{
"input": "HDDRZDKCHHHEDKHZMXQSNQGSGNNSCCPVJFGXGNCEKJMRKSGKAPQWPCWXXWHLSMRGSJWEHWQCSJJSGLQJXGVTBYALWMLKTTJMFPFS",
"output": "28"
},
{
"input": "PXVKJHXVDPWGLHWFWMJPMCCNHCKSHCPZXGIHHNMYNFQBUCKJJTXXJGKRNVRTQFDFMLLGPQKFOVNNLTNDIEXSARRJKGSCZKGGJCBW",
"output": "35"
},
{
"input": "EXNMTTFPJLDHXDQBJJRDRYBZVFFHUDCHCPNFZWXSMZXNFVJGHZWXVBRQFNUIDVLZOVPXQNVMFNBTJDSCKRLNGXPSADTGCAHCBJKL",
"output": "30"
},
{
"input": "NRNLSQQJGIJBCZFTNKJCXMGPARGWXPSHZXOBNSFOLDQVXTVAGJZNLXULHBRDGMNQKQGWMRRDPYCSNFVPUFTFBUBRXVJGNGSPJKLL",
"output": "19"
},
{
"input": "SRHOKCHQQMVZKTCVQXJJCFGYFXGMBZSZFNAFETXILZHPGHBWZRZQFMGSEYRUDVMCIQTXTBTSGFTHRRNGNTHHWWHCTDFHSVARMCMB",
"output": "30"
},
{
"input": "HBSVZHDKGNIRQUBYKYHUPJCEETGFMVBZJTHYHFQPFBVBSMQACYAVWZXSBGNKWXFNMQJFMSCHJVWBZXZGSNBRUHTHAJKVLEXFBOFB",
"output": "34"
},
{
"input": "NXKMUGOPTUQNSRYTKUKSCWCRQSZKKFPYUMDIBJAHJCEKZJVWZAWOLOEFBFXLQDDPNNZKCQHUPBFVDSXSUCVLMZXQROYQYIKPQPWR",
"output": "17"
},
{
"input": "TEHJDICFNOLQVQOAREVAGUAWODOCXJXIHYXFAEPEXRHPKEIIRCRIVASKNTVYUYDMUQKSTSSBYCDVZKDDHTSDWJWACPCLYYOXGCLT",
"output": "15"
},
{
"input": "LCJJUZZFEIUTMSEXEYNOOAIZMORQDOANAMUCYTFRARDCYHOYOPHGGYUNOGNXUAOYSEMXAZOOOFAVHQUBRNGORSPNQWZJYQQUNPEB",
"output": "9"
},
{
"input": "UUOKAOOJBXUTSMOLOOOOSUYYFTAVBNUXYFVOOGCGZYQEOYISIYOUULUAIJUYVVOENJDOCLHOSOHIHDEJOIGZNIXEMEGZACHUAQFW",
"output": "5"
},
{
"input": "OUUBEHXOOURMOAIAEHXCUOIYHUJEVAWYRCIIAGDRIPUIPAIUYAIWJEVYEYYUYBYOGVYESUJCFOJNUAHIOOKBUUHEJFEWPOEOUHYA",
"output": "4"
},
{
"input": "EMNOYEEUIOUHEWZITIAEZNCJUOUAOQEAUYEIHYUSUYUUUIAEDIOOERAEIRBOJIEVOMECOGAIAIUIYYUWYIHIOWVIJEYUEAFYULSE",
"output": "5"
},
{
"input": "BVOYEAYOIEYOREJUYEUOEOYIISYAEOUYAAOIOEOYOOOIEFUAEAAESUOOIIEUAAGAEISIAPYAHOOEYUJHUECGOYEIDAIRTBHOYOYA",
"output": "5"
},
{
"input": "GOIEOAYIEYYOOEOAIAEOOUWYEIOTNYAANAYOOXEEOEAVIOIAAIEOIAUIAIAAUEUAOIAEUOUUZYIYAIEUEGOOOOUEIYAEOSYAEYIO",
"output": "3"
},
{
"input": "AUEAOAYIAOYYIUIOAULIOEUEYAIEYYIUOEOEIEYRIYAYEYAEIIMMAAEAYAAAAEOUICAUAYOUIAOUIAIUOYEOEEYAEYEYAAEAOYIY",
"output": "3"
},
{
"input": "OAIIYEYYAOOEIUOEEIOUOIAEFIOAYETUYIOAAAEYYOYEYOEAUIIUEYAYYIIAOIEEYGYIEAAOOWYAIEYYYIAOUUOAIAYAYYOEUEOY",
"output": "2"
},
{
"input": "EEEAOEOEEIOUUUEUEAAOEOIUYJEYAIYIEIYYEAUOIIYIUOOEUCYEOOOYYYIUUAYIAOEUEIEAOUOIAACAOOUAUIYYEAAAOOUYIAAE",
"output": "2"
},
{
"input": "AYEYIIEUIYOYAYEUEIIIEUYUUAUEUIYAIAAUYONIEYIUIAEUUOUOYYOUUUIUIAEYEOUIIUOUUEOAIUUYAAEOAAEOYUUIYAYRAIII",
"output": "2"
},
{
"input": "YOOAAUUAAAYEUYIUIUYIUOUAEIEEIAUEOAUIIAAIUYEUUOYUIYEAYAAAYUEEOEEAEOEEYYOUAEUYEEAIIYEUEYJOIIYUIOIUOIEE",
"output": "2"
},
{
"input": "UYOIIIAYOOAIUUOOEEUYIOUAEOOEIOUIAIEYOAEAIOOEOOOIUYYUYIAAUIOUYYOOUAUIEYYUOAAUUEAAIEUIAUEUUIAUUOYOAYIU",
"output": "1"
},
{
"input": "ABBABBB",
"output": "4"
},
{
"input": "ABCD",
"output": "4"
},
{
"input": "XXYC",
"output": "3"
},
{
"input": "YYY",
"output": "1"
},
{
"input": "ABABBBBBBB",
"output": "8"
},
{
"input": "YYYY",
"output": "1"
},
{
"input": "YYYYY",
"output": "1"
},
{
"input": "AXXX",
"output": "4"
},
{
"input": "YYYYYYY",
"output": "1"
},
{
"input": "BYYBBB",
"output": "4"
},
{
"input": "YYYYYYYYY",
"output": "1"
},
{
"input": "CAAAAA",
"output": "2"
},
{
"input": "CCCACCCC",
"output": "5"
},
{
"input": "ABABBBACFEYUKOTTTT",
"output": "5"
},
{
"input": "AABBYYYYYYYY",
"output": "3"
},
{
"input": "BYBACYC",
"output": "2"
},
{
"input": "Y",
"output": "1"
},
{
"input": "ABBBBBB",
"output": "7"
},
{
"input": "BACDYDI",
"output": "3"
},
{
"input": "XEXXXXXXXXXXXXXXX",
"output": "16"
},
{
"input": "TTYTT",
"output": "3"
},
{
"input": "AAYBC",
"output": "3"
},
{
"input": "ABABBBACFEYUKOTTTTT",
"output": "6"
},
{
"input": "YYAYY",
"output": "1"
},
{
"input": "YZZY",
"output": "3"
},
{
"input": "YY",
"output": "1"
},
{
"input": "ZZYZZ",
"output": "3"
},
{
"input": "YBBBY",
"output": "4"
},
{
"input": "BBBACCCCCCC",
"output": "8"
},
{
"input": "YBBBBY",
"output": "5"
},
{
"input": "YYYYYYYYYY",
"output": "1"
},
{
"input": "ABABBBBBBBBBBBB",
"output": "13"
}
] | 1,590,038,848
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 9
| 93
| 0
|
s = '0'+input()+'1'
l = 'AEIOUY'
i, k, mx, p, ls = 0, 0, 0, 0, 0
while i<len(s):
if s[i] in l:
k=(i-p)
p = i
if mx<k:
mx = k
ls = 1
i+=1
if ls==1:
print(mx)
else:
print(len(s)-1)
|
Title: Grasshopper And the String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, the Grasshopper was jumping on the lawn and found a piece of paper with a string. Grasshopper became interested what is the minimum jump ability he should have in order to be able to reach the far end of the string, jumping only on vowels of the English alphabet. Jump ability is the maximum possible length of his jump.
Formally, consider that at the begginning the Grasshopper is located directly in front of the leftmost character of the string. His goal is to reach the position right after the rightmost character of the string. In one jump the Grasshopper could jump to the right any distance from 1 to the value of his jump ability.
The following letters are vowels: 'A', 'E', 'I', 'O', 'U' and 'Y'.
Input Specification:
The first line contains non-empty string consisting of capital English letters. It is guaranteed that the length of the string does not exceed 100.
Output Specification:
Print single integer *a* — the minimum jump ability of the Grasshopper (in the number of symbols) that is needed to overcome the given string, jumping only on vowels.
Demo Input:
['ABABBBACFEYUKOTT\n', 'AAA\n']
Demo Output:
['4', '1']
Note:
none
|
```python
s = '0'+input()+'1'
l = 'AEIOUY'
i, k, mx, p, ls = 0, 0, 0, 0, 0
while i<len(s):
if s[i] in l:
k=(i-p)
p = i
if mx<k:
mx = k
ls = 1
i+=1
if ls==1:
print(mx)
else:
print(len(s)-1)
```
| 0
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,622,382,592
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 60
| 0
|
n=int(input())
l=list(map(int,input().split()))
d={"eve":0,"odd":0}
c=0
for i in range(n):
if l[i]%2==0:
d['eve']+=1
if d['eve']==1:
c=l[i]
else:
d['odd']+=1
if d['odd']==1:
c=l[i]
print(c)
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
n=int(input())
l=list(map(int,input().split()))
d={"eve":0,"odd":0}
c=0
for i in range(n):
if l[i]%2==0:
d['eve']+=1
if d['eve']==1:
c=l[i]
else:
d['odd']+=1
if d['odd']==1:
c=l[i]
print(c)
```
| 0
|
567
|
A
|
Lineland Mail
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
All cities of Lineland are located on the *Ox* coordinate axis. Thus, each city is associated with its position *x**i* — a coordinate on the *Ox* axis. No two cities are located at a single point.
Lineland residents love to send letters to each other. A person may send a letter only if the recipient lives in another city (because if they live in the same city, then it is easier to drop in).
Strange but true, the cost of sending the letter is exactly equal to the distance between the sender's city and the recipient's city.
For each city calculate two values *min**i* and *max**i*, where *min**i* is the minimum cost of sending a letter from the *i*-th city to some other city, and *max**i* is the the maximum cost of sending a letter from the *i*-th city to some other city
|
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=105) — the number of cities in Lineland. The second line contains the sequence of *n* distinct integers *x*1,<=*x*2,<=...,<=*x**n* (<=-<=109<=≤<=*x**i*<=≤<=109), where *x**i* is the *x*-coordinate of the *i*-th city. All the *x**i*'s are distinct and follow in ascending order.
|
Print *n* lines, the *i*-th line must contain two integers *min**i*,<=*max**i*, separated by a space, where *min**i* is the minimum cost of sending a letter from the *i*-th city, and *max**i* is the maximum cost of sending a letter from the *i*-th city.
|
[
"4\n-5 -2 2 7\n",
"2\n-1 1\n"
] |
[
"3 12\n3 9\n4 7\n5 12\n",
"2 2\n2 2\n"
] |
none
| 500
|
[
{
"input": "4\n-5 -2 2 7",
"output": "3 12\n3 9\n4 7\n5 12"
},
{
"input": "2\n-1 1",
"output": "2 2\n2 2"
},
{
"input": "3\n-1 0 1",
"output": "1 2\n1 1\n1 2"
},
{
"input": "4\n-1 0 1 3",
"output": "1 4\n1 3\n1 2\n2 4"
},
{
"input": "3\n-1000000000 0 1000000000",
"output": "1000000000 2000000000\n1000000000 1000000000\n1000000000 2000000000"
},
{
"input": "2\n-1000000000 1000000000",
"output": "2000000000 2000000000\n2000000000 2000000000"
},
{
"input": "10\n1 10 12 15 59 68 130 912 1239 9123",
"output": "9 9122\n2 9113\n2 9111\n3 9108\n9 9064\n9 9055\n62 8993\n327 8211\n327 7884\n7884 9122"
},
{
"input": "5\n-2 -1 0 1 2",
"output": "1 4\n1 3\n1 2\n1 3\n1 4"
},
{
"input": "5\n-2 -1 0 1 3",
"output": "1 5\n1 4\n1 3\n1 3\n2 5"
},
{
"input": "3\n-10000 1 10000",
"output": "10001 20000\n9999 10001\n9999 20000"
},
{
"input": "5\n-1000000000 -999999999 -999999998 -999999997 -999999996",
"output": "1 4\n1 3\n1 2\n1 3\n1 4"
},
{
"input": "10\n-857422304 -529223472 82412729 145077145 188538640 265299215 527377039 588634631 592896147 702473706",
"output": "328198832 1559896010\n328198832 1231697178\n62664416 939835033\n43461495 1002499449\n43461495 1045960944\n76760575 1122721519\n61257592 1384799343\n4261516 1446056935\n4261516 1450318451\n109577559 1559896010"
},
{
"input": "10\n-876779400 -829849659 -781819137 -570920213 18428128 25280705 121178189 219147240 528386329 923854124",
"output": "46929741 1800633524\n46929741 1753703783\n48030522 1705673261\n210898924 1494774337\n6852577 905425996\n6852577 902060105\n95897484 997957589\n97969051 1095926640\n309239089 1405165729\n395467795 1800633524"
},
{
"input": "30\n-15 1 21 25 30 40 59 60 77 81 97 100 103 123 139 141 157 158 173 183 200 215 226 231 244 256 267 279 289 292",
"output": "16 307\n16 291\n4 271\n4 267\n5 262\n10 252\n1 233\n1 232\n4 215\n4 211\n3 195\n3 192\n3 189\n16 169\n2 154\n2 156\n1 172\n1 173\n10 188\n10 198\n15 215\n11 230\n5 241\n5 246\n12 259\n11 271\n11 282\n10 294\n3 304\n3 307"
},
{
"input": "10\n-1000000000 -999999999 -999999997 -999999996 -999999995 -999999994 -999999992 -999999990 -999999988 -999999986",
"output": "1 14\n1 13\n1 11\n1 10\n1 9\n1 8\n2 8\n2 10\n2 12\n2 14"
},
{
"input": "50\n-50000 -49459 -48875 -48456 -48411 -48096 -47901 -47500 -47150 -46808 -46687 -46679 -46337 -45747 -45604 -45194 -44752 -44242 -44231 -44122 -43636 -43274 -42916 -42881 -42386 -42095 -41830 -41618 -41145 -40897 -40534 -40007 -39761 -39389 -39104 -38909 -38630 -38561 -38364 -38255 -38214 -38084 -37959 -37607 -37202 -36890 -36681 -36136 -36123 -35886",
"output": "541 14114\n541 13573\n419 12989\n45 12570\n45 12525\n195 12210\n195 12015\n350 11614\n342 11264\n121 10922\n8 10801\n8 10793\n342 10451\n143 9861\n143 9718\n410 9308\n442 8866\n11 8356\n11 8345\n109 8236\n362 7750\n358 7388\n35 7084\n35 7119\n291 7614\n265 7905\n212 8170\n212 8382\n248 8855\n248 9103\n363 9466\n246 9993\n246 10239\n285 10611\n195 10896\n195 11091\n69 11370\n69 11439\n109 11636\n41 11745\n41 11786\n125 11916\n125 12041\n352 12393\n312 12798\n209 13110\n209 13319\n13 13864\n13 13877\n237 141..."
},
{
"input": "3\n-1000000000 999999999 1000000000",
"output": "1999999999 2000000000\n1 1999999999\n1 2000000000"
}
] | 1,613,584,879
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 10
| 3,000
| 7,065,600
|
n = int(input())
arr = [int(x) for x in input().split()]
arr = [int(abs(min(arr))+x) for x in arr]
for i in range(len(arr)):
mn = 0
mx = 0
if i == 0:
mn = abs(arr[i+1]-arr[0])
mx = abs(arr[-1] - arr[i])
print(mn,mx)
continue
if i == len(arr)-1:
mn = abs(arr[-2] - arr[i])
mx = abs(arr[0] - arr[i])
print(mn,mx)
continue
mn = abs(arr[i] - arr[i-1]) if abs(arr[i-1]-arr[i]) < abs(arr[i+1]-arr[i]) else abs(arr[i+1]-arr[i])
mx = abs(arr[i] - arr[0]) if abs(arr[i]-arr[0]) > abs(arr[-1]-arr[i]) else abs(arr[-1] - arr[i])
print(mn,mx)
|
Title: Lineland Mail
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
All cities of Lineland are located on the *Ox* coordinate axis. Thus, each city is associated with its position *x**i* — a coordinate on the *Ox* axis. No two cities are located at a single point.
Lineland residents love to send letters to each other. A person may send a letter only if the recipient lives in another city (because if they live in the same city, then it is easier to drop in).
Strange but true, the cost of sending the letter is exactly equal to the distance between the sender's city and the recipient's city.
For each city calculate two values *min**i* and *max**i*, where *min**i* is the minimum cost of sending a letter from the *i*-th city to some other city, and *max**i* is the the maximum cost of sending a letter from the *i*-th city to some other city
Input Specification:
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=105) — the number of cities in Lineland. The second line contains the sequence of *n* distinct integers *x*1,<=*x*2,<=...,<=*x**n* (<=-<=109<=≤<=*x**i*<=≤<=109), where *x**i* is the *x*-coordinate of the *i*-th city. All the *x**i*'s are distinct and follow in ascending order.
Output Specification:
Print *n* lines, the *i*-th line must contain two integers *min**i*,<=*max**i*, separated by a space, where *min**i* is the minimum cost of sending a letter from the *i*-th city, and *max**i* is the maximum cost of sending a letter from the *i*-th city.
Demo Input:
['4\n-5 -2 2 7\n', '2\n-1 1\n']
Demo Output:
['3 12\n3 9\n4 7\n5 12\n', '2 2\n2 2\n']
Note:
none
|
```python
n = int(input())
arr = [int(x) for x in input().split()]
arr = [int(abs(min(arr))+x) for x in arr]
for i in range(len(arr)):
mn = 0
mx = 0
if i == 0:
mn = abs(arr[i+1]-arr[0])
mx = abs(arr[-1] - arr[i])
print(mn,mx)
continue
if i == len(arr)-1:
mn = abs(arr[-2] - arr[i])
mx = abs(arr[0] - arr[i])
print(mn,mx)
continue
mn = abs(arr[i] - arr[i-1]) if abs(arr[i-1]-arr[i]) < abs(arr[i+1]-arr[i]) else abs(arr[i+1]-arr[i])
mx = abs(arr[i] - arr[0]) if abs(arr[i]-arr[0]) > abs(arr[-1]-arr[i]) else abs(arr[-1] - arr[i])
print(mn,mx)
```
| 0
|
|
109
|
A
|
Lucky Sum of Digits
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation"
] |
A. Lucky Sum of Digits
|
2
|
256
|
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya wonders eagerly what minimum lucky number has the sum of digits equal to *n*. Help him cope with the task.
|
The single line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the sum of digits of the required lucky number.
|
Print on the single line the result — the minimum lucky number, whose sum of digits equals *n*. If such number does not exist, print -1.
|
[
"11\n",
"10\n"
] |
[
"47\n",
"-1\n"
] |
none
| 500
|
[
{
"input": "11",
"output": "47"
},
{
"input": "10",
"output": "-1"
},
{
"input": "64",
"output": "4477777777"
},
{
"input": "1",
"output": "-1"
},
{
"input": "4",
"output": "4"
},
{
"input": "7",
"output": "7"
},
{
"input": "12",
"output": "444"
},
{
"input": "1000000",
"output": "4477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "47",
"output": "44477777"
},
{
"input": "100",
"output": "4444777777777777"
},
{
"input": "700",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "485",
"output": "44447777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "111",
"output": "444447777777777777"
},
{
"input": "85",
"output": "4477777777777"
},
{
"input": "114",
"output": "444477777777777777"
},
{
"input": "474",
"output": "444777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "74",
"output": "47777777777"
},
{
"input": "1000",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "1024",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "4444",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "45784",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10000",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "9854",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "186",
"output": "477777777777777777777777777"
},
{
"input": "10416",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10417",
"output": "4477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "3840",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "100000",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "9876",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "99999",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "777777",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "854759",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "11000",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "18951",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999999",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "888887",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999998",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "40008",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10691",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "5",
"output": "-1"
},
{
"input": "6",
"output": "-1"
},
{
"input": "9",
"output": "-1"
},
{
"input": "8",
"output": "44"
},
{
"input": "2",
"output": "-1"
},
{
"input": "3",
"output": "-1"
},
{
"input": "999997",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999996",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999990",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999980",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "800000",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "980000",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
}
] | 1,655,050,338
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 1
| 2,000
| 0
|
def getSum(n):
return 0 if n==0 else int(n%10)+getSum(n//10)
n = int(input())
flag = 0
for i in range(10**6):
if(getSum(i)==n):
if i==4 or i==7 or i==47 or i==74:
mini = i
flag = 1
break
else:
continue
if(flag):
print(mini)
else:
print(-1)
|
Title: Lucky Sum of Digits
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya wonders eagerly what minimum lucky number has the sum of digits equal to *n*. Help him cope with the task.
Input Specification:
The single line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the sum of digits of the required lucky number.
Output Specification:
Print on the single line the result — the minimum lucky number, whose sum of digits equals *n*. If such number does not exist, print -1.
Demo Input:
['11\n', '10\n']
Demo Output:
['47\n', '-1\n']
Note:
none
|
```python
def getSum(n):
return 0 if n==0 else int(n%10)+getSum(n//10)
n = int(input())
flag = 0
for i in range(10**6):
if(getSum(i)==n):
if i==4 or i==7 or i==47 or i==74:
mini = i
flag = 1
break
else:
continue
if(flag):
print(mini)
else:
print(-1)
```
| 0
|
845
|
C
|
Two TVs
|
PROGRAMMING
| 1,500
|
[
"data structures",
"greedy",
"sortings"
] | null | null |
Polycarp is a great fan of television.
He wrote down all the TV programs he is interested in for today. His list contains *n* shows, *i*-th of them starts at moment *l**i* and ends at moment *r**i*.
Polycarp owns two TVs. He can watch two different shows simultaneously with two TVs but he can only watch one show at any given moment on a single TV. If one show ends at the same moment some other show starts then you can't watch them on a single TV.
Polycarp wants to check out all *n* shows. Are two TVs enough to do so?
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of shows.
Each of the next *n* lines contains two integers *l**i* and *r**i* (0<=≤<=*l**i*<=<<=*r**i*<=≤<=109) — starting and ending time of *i*-th show.
|
If Polycarp is able to check out all the shows using only two TVs then print "YES" (without quotes). Otherwise, print "NO" (without quotes).
|
[
"3\n1 2\n2 3\n4 5\n",
"4\n1 2\n2 3\n2 3\n1 2\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 0
|
[
{
"input": "3\n1 2\n2 3\n4 5",
"output": "YES"
},
{
"input": "4\n1 2\n2 3\n2 3\n1 2",
"output": "NO"
},
{
"input": "4\n0 1\n1 2\n2 3\n3 4",
"output": "YES"
},
{
"input": "3\n1 2\n2 3\n2 4",
"output": "NO"
},
{
"input": "3\n0 100\n0 100\n0 100",
"output": "NO"
},
{
"input": "1\n0 1000000000",
"output": "YES"
},
{
"input": "2\n0 1\n0 1",
"output": "YES"
},
{
"input": "3\n2 3\n4 5\n1 6",
"output": "YES"
},
{
"input": "5\n1 3\n1 4\n4 10\n5 8\n9 11",
"output": "YES"
},
{
"input": "3\n1 2\n1 2\n2 3",
"output": "NO"
},
{
"input": "4\n1 100\n10 15\n20 25\n30 35",
"output": "YES"
},
{
"input": "3\n1 8\n6 7\n8 11",
"output": "YES"
},
{
"input": "5\n1 2\n3 5\n4 7\n8 9\n5 10",
"output": "NO"
},
{
"input": "4\n1 7\n2 3\n4 5\n6 7",
"output": "YES"
},
{
"input": "4\n1 100\n50 51\n60 90\n51 52",
"output": "NO"
},
{
"input": "3\n1 10\n2 9\n3 8",
"output": "NO"
},
{
"input": "2\n0 4\n0 4",
"output": "YES"
},
{
"input": "2\n0 2\n0 6",
"output": "YES"
},
{
"input": "5\n3 4\n21 26\n12 17\n9 14\n15 16",
"output": "YES"
},
{
"input": "5\n1 4\n13 15\n11 12\n9 15\n2 5",
"output": "YES"
},
{
"input": "4\n16 19\n9 14\n14 15\n15 19",
"output": "YES"
},
{
"input": "5\n16 19\n23 29\n3 8\n23 26\n22 23",
"output": "NO"
},
{
"input": "5\n19 23\n12 17\n16 21\n20 23\n8 10",
"output": "NO"
},
{
"input": "5\n8 10\n4 10\n3 4\n14 15\n17 19",
"output": "YES"
},
{
"input": "3\n2 8\n5 7\n6 7",
"output": "NO"
},
{
"input": "5\n10 12\n4 6\n21 24\n9 12\n7 13",
"output": "NO"
},
{
"input": "5\n0 3\n14 16\n6 8\n5 9\n9 15",
"output": "YES"
},
{
"input": "5\n6 12\n23 25\n6 7\n19 25\n10 11",
"output": "YES"
},
{
"input": "5\n15 18\n23 24\n23 28\n22 24\n15 19",
"output": "NO"
},
{
"input": "4\n1 8\n8 9\n5 7\n1 4",
"output": "YES"
},
{
"input": "3\n6 10\n1 9\n2 5",
"output": "YES"
},
{
"input": "3\n1 8\n5 6\n6 9",
"output": "NO"
},
{
"input": "4\n2 3\n5 9\n8 10\n9 10",
"output": "NO"
},
{
"input": "4\n0 8\n6 7\n5 9\n1 4",
"output": "NO"
},
{
"input": "3\n6 9\n0 1\n0 2",
"output": "YES"
},
{
"input": "5\n0 6\n21 25\n18 19\n0 3\n6 12",
"output": "YES"
},
{
"input": "4\n1 5\n6 9\n4 8\n1 3",
"output": "YES"
},
{
"input": "2\n2 5\n0 5",
"output": "YES"
},
{
"input": "4\n5 8\n11 15\n3 7\n10 14",
"output": "YES"
},
{
"input": "3\n12 14\n0 4\n2 3",
"output": "YES"
},
{
"input": "4\n4 10\n0 1\n2 10\n0 5",
"output": "NO"
},
{
"input": "4\n0 3\n0 1\n2 4\n2 5",
"output": "NO"
}
] | 1,520,031,937
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 1,060
| 14,336,000
|
n = int(input())
starts = []
ends = []
ending_at = {}
for i in range(n):
inp = input().split()
start = int(inp[0])
end = int(inp[1])
starts.append(start)
ends.append(end)
starts.sort()
ends.sort()
tvs_in = 1
max_tvs = 1
time = starts[0]
i = 1
j = 1
while i < n and j < n:
if starts[i] <= ends[j]:
tvs_in += 1
max_tvs = max(max_tvs, tvs_in)
i += 1
else:
tvs_in -= 1
j += 1
if max_tvs <= 2:
print("YES")
else:
print("NO")
|
Title: Two TVs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is a great fan of television.
He wrote down all the TV programs he is interested in for today. His list contains *n* shows, *i*-th of them starts at moment *l**i* and ends at moment *r**i*.
Polycarp owns two TVs. He can watch two different shows simultaneously with two TVs but he can only watch one show at any given moment on a single TV. If one show ends at the same moment some other show starts then you can't watch them on a single TV.
Polycarp wants to check out all *n* shows. Are two TVs enough to do so?
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of shows.
Each of the next *n* lines contains two integers *l**i* and *r**i* (0<=≤<=*l**i*<=<<=*r**i*<=≤<=109) — starting and ending time of *i*-th show.
Output Specification:
If Polycarp is able to check out all the shows using only two TVs then print "YES" (without quotes). Otherwise, print "NO" (without quotes).
Demo Input:
['3\n1 2\n2 3\n4 5\n', '4\n1 2\n2 3\n2 3\n1 2\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
n = int(input())
starts = []
ends = []
ending_at = {}
for i in range(n):
inp = input().split()
start = int(inp[0])
end = int(inp[1])
starts.append(start)
ends.append(end)
starts.sort()
ends.sort()
tvs_in = 1
max_tvs = 1
time = starts[0]
i = 1
j = 1
while i < n and j < n:
if starts[i] <= ends[j]:
tvs_in += 1
max_tvs = max(max_tvs, tvs_in)
i += 1
else:
tvs_in -= 1
j += 1
if max_tvs <= 2:
print("YES")
else:
print("NO")
```
| 0
|
|
471
|
B
|
MUH and Important Things
|
PROGRAMMING
| 1,300
|
[
"implementation",
"sortings"
] | null | null |
It's time polar bears Menshykov and Uslada from the zoo of St. Petersburg and elephant Horace from the zoo of Kiev got down to business. In total, there are *n* tasks for the day and each animal should do each of these tasks. For each task, they have evaluated its difficulty. Also animals decided to do the tasks in order of their difficulty. Unfortunately, some tasks can have the same difficulty, so the order in which one can perform the tasks may vary.
Menshykov, Uslada and Horace ask you to deal with this nuisance and come up with individual plans for each of them. The plan is a sequence describing the order in which an animal should do all the *n* tasks. Besides, each of them wants to have its own unique plan. Therefore three plans must form three different sequences. You are to find the required plans, or otherwise deliver the sad news to them by stating that it is impossible to come up with three distinct plans for the given tasks.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of tasks. The second line contains *n* integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=2000), where *h**i* is the difficulty of the *i*-th task. The larger number *h**i* is, the more difficult the *i*-th task is.
|
In the first line print "YES" (without the quotes), if it is possible to come up with three distinct plans of doing the tasks. Otherwise print in the first line "NO" (without the quotes). If three desired plans do exist, print in the second line *n* distinct integers that represent the numbers of the tasks in the order they are done according to the first plan. In the third and fourth line print two remaining plans in the same form.
If there are multiple possible answers, you can print any of them.
|
[
"4\n1 3 3 1\n",
"5\n2 4 1 4 8\n"
] |
[
"YES\n1 4 2 3 \n4 1 2 3 \n4 1 3 2 \n",
"NO"
] |
In the first sample the difficulty of the tasks sets one limit: tasks 1 and 4 must be done before tasks 2 and 3. That gives the total of four possible sequences of doing tasks : [1, 4, 2, 3], [4, 1, 2, 3], [1, 4, 3, 2], [4, 1, 3, 2]. You can print any three of them in the answer.
In the second sample there are only two sequences of tasks that meet the conditions — [3, 1, 2, 4, 5] and [3, 1, 4, 2, 5]. Consequently, it is impossible to make three distinct sequences of tasks.
| 1,000
|
[
{
"input": "4\n1 3 3 1",
"output": "YES\n1 4 2 3 \n4 1 2 3 \n4 1 3 2 "
},
{
"input": "5\n2 4 1 4 8",
"output": "NO"
},
{
"input": "8\n1 5 4 12 7 2 10 11",
"output": "NO"
},
{
"input": "6\n5 1 2 5 2 4",
"output": "YES\n2 3 5 6 1 4 \n2 5 3 6 1 4 \n2 5 3 6 4 1 "
},
{
"input": "1\n1083",
"output": "NO"
},
{
"input": "10\n5 5 5 5 5 5 5 5 5 5",
"output": "YES\n1 2 3 4 5 6 7 8 9 10 \n2 1 3 4 5 6 7 8 9 10 \n2 3 1 4 5 6 7 8 9 10 "
},
{
"input": "6\n3 8 3 9 3 10",
"output": "YES\n1 3 5 2 4 6 \n3 1 5 2 4 6 \n3 5 1 2 4 6 "
},
{
"input": "19\n895 1302 724 952 340 952 939 1302 724 952 939 340 340 1844 770 976 435 1302 1302",
"output": "YES\n5 12 13 17 3 9 15 1 7 11 4 6 10 16 2 8 18 19 14 \n12 5 13 17 3 9 15 1 7 11 4 6 10 16 2 8 18 19 14 \n12 13 5 17 3 9 15 1 7 11 4 6 10 16 2 8 18 19 14 "
},
{
"input": "7\n766 766 1477 766 107 1774 990",
"output": "YES\n5 1 2 4 7 3 6 \n5 2 1 4 7 3 6 \n5 2 4 1 7 3 6 "
},
{
"input": "11\n1552 1010 1552 1248 1550 388 1541 1010 613 1821 388",
"output": "YES\n6 11 9 2 8 4 7 5 1 3 10 \n11 6 9 2 8 4 7 5 1 3 10 \n11 6 9 8 2 4 7 5 1 3 10 "
},
{
"input": "15\n688 848 1462 688 12 1336 1336 1113 1462 1074 659 1384 12 12 1074",
"output": "YES\n5 13 14 11 1 4 2 10 15 8 6 7 12 3 9 \n13 5 14 11 1 4 2 10 15 8 6 7 12 3 9 \n13 14 5 11 1 4 2 10 15 8 6 7 12 3 9 "
},
{
"input": "19\n65 117 159 402 117 402 65 1016 1850 1265 854 159 347 1501 117 805 854 117 1265",
"output": "YES\n1 7 2 5 15 18 3 12 13 4 6 16 11 17 8 10 19 14 9 \n7 1 2 5 15 18 3 12 13 4 6 16 11 17 8 10 19 14 9 \n7 1 5 2 15 18 3 12 13 4 6 16 11 17 8 10 19 14 9 "
},
{
"input": "3\n1282 101 420",
"output": "NO"
},
{
"input": "3\n1 1 1",
"output": "YES\n1 2 3 \n2 1 3 \n2 3 1 "
},
{
"input": "2\n1 1",
"output": "NO"
},
{
"input": "1\n1",
"output": "NO"
}
] | 1,542,645,137
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 124
| 0
|
while True:
try:
n = int(input())
tasks = list(enumerate(map(int, input().split()), 1)) # [(id, difficulty)]
tasks.sort(key = lambda x: x[1]) # sort by id
i = 0
while i < n - 1:
if tasks[i][1] == tasks[i + 1][1]:
break
i += 1
j = i + 1
while j < n - 1:
if tasks[j][1] == tasks[j + 1][1]:
break
j += 1
if j > n - 2:
print('NO')
else:
print('YES')
tasks = [str(id) for id, difficulty in tasks]
print(' '.join(tasks))
tasks[i], tasks[i + 1] = tasks[i + 1], tasks[i]
print(' '.join(tasks))
tasks[j], tasks[j + 1] = tasks[j + 1], tasks[j]
print(' '.join(tasks))
except:
break
|
Title: MUH and Important Things
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It's time polar bears Menshykov and Uslada from the zoo of St. Petersburg and elephant Horace from the zoo of Kiev got down to business. In total, there are *n* tasks for the day and each animal should do each of these tasks. For each task, they have evaluated its difficulty. Also animals decided to do the tasks in order of their difficulty. Unfortunately, some tasks can have the same difficulty, so the order in which one can perform the tasks may vary.
Menshykov, Uslada and Horace ask you to deal with this nuisance and come up with individual plans for each of them. The plan is a sequence describing the order in which an animal should do all the *n* tasks. Besides, each of them wants to have its own unique plan. Therefore three plans must form three different sequences. You are to find the required plans, or otherwise deliver the sad news to them by stating that it is impossible to come up with three distinct plans for the given tasks.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of tasks. The second line contains *n* integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=2000), where *h**i* is the difficulty of the *i*-th task. The larger number *h**i* is, the more difficult the *i*-th task is.
Output Specification:
In the first line print "YES" (without the quotes), if it is possible to come up with three distinct plans of doing the tasks. Otherwise print in the first line "NO" (without the quotes). If three desired plans do exist, print in the second line *n* distinct integers that represent the numbers of the tasks in the order they are done according to the first plan. In the third and fourth line print two remaining plans in the same form.
If there are multiple possible answers, you can print any of them.
Demo Input:
['4\n1 3 3 1\n', '5\n2 4 1 4 8\n']
Demo Output:
['YES\n1 4 2 3 \n4 1 2 3 \n4 1 3 2 \n', 'NO']
Note:
In the first sample the difficulty of the tasks sets one limit: tasks 1 and 4 must be done before tasks 2 and 3. That gives the total of four possible sequences of doing tasks : [1, 4, 2, 3], [4, 1, 2, 3], [1, 4, 3, 2], [4, 1, 3, 2]. You can print any three of them in the answer.
In the second sample there are only two sequences of tasks that meet the conditions — [3, 1, 2, 4, 5] and [3, 1, 4, 2, 5]. Consequently, it is impossible to make three distinct sequences of tasks.
|
```python
while True:
try:
n = int(input())
tasks = list(enumerate(map(int, input().split()), 1)) # [(id, difficulty)]
tasks.sort(key = lambda x: x[1]) # sort by id
i = 0
while i < n - 1:
if tasks[i][1] == tasks[i + 1][1]:
break
i += 1
j = i + 1
while j < n - 1:
if tasks[j][1] == tasks[j + 1][1]:
break
j += 1
if j > n - 2:
print('NO')
else:
print('YES')
tasks = [str(id) for id, difficulty in tasks]
print(' '.join(tasks))
tasks[i], tasks[i + 1] = tasks[i + 1], tasks[i]
print(' '.join(tasks))
tasks[j], tasks[j + 1] = tasks[j + 1], tasks[j]
print(' '.join(tasks))
except:
break
```
| 3
|
|
688
|
A
|
Opponents
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Arya has *n* opponents in the school. Each day he will fight with all opponents who are present this day. His opponents have some fighting plan that guarantees they will win, but implementing this plan requires presence of them all. That means if one day at least one of Arya's opponents is absent at the school, then Arya will beat all present opponents. Otherwise, if all opponents are present, then they will beat Arya.
For each opponent Arya knows his schedule — whether or not he is going to present on each particular day. Tell him the maximum number of consecutive days that he will beat all present opponents.
Note, that if some day there are no opponents present, Arya still considers he beats all the present opponents.
|
The first line of the input contains two integers *n* and *d* (1<=≤<=*n*,<=*d*<=≤<=100) — the number of opponents and the number of days, respectively.
The *i*-th of the following *d* lines contains a string of length *n* consisting of characters '0' and '1'. The *j*-th character of this string is '0' if the *j*-th opponent is going to be absent on the *i*-th day.
|
Print the only integer — the maximum number of consecutive days that Arya will beat all present opponents.
|
[
"2 2\n10\n00\n",
"4 1\n0100\n",
"4 5\n1101\n1111\n0110\n1011\n1111\n"
] |
[
"2\n",
"1\n",
"2\n"
] |
In the first and the second samples, Arya will beat all present opponents each of the *d* days.
In the third sample, Arya will beat his opponents on days 1, 3 and 4 and his opponents will beat him on days 2 and 5. Thus, the maximum number of consecutive winning days is 2, which happens on days 3 and 4.
| 500
|
[
{
"input": "2 2\n10\n00",
"output": "2"
},
{
"input": "4 1\n0100",
"output": "1"
},
{
"input": "4 5\n1101\n1111\n0110\n1011\n1111",
"output": "2"
},
{
"input": "3 2\n110\n110",
"output": "2"
},
{
"input": "10 6\n1111111111\n0100110101\n1111111111\n0000011010\n1111111111\n1111111111",
"output": "1"
},
{
"input": "10 10\n1111111111\n0001001000\n1111111111\n1111111111\n1111111111\n1000000100\n1111111111\n0000011100\n1111111111\n1111111111",
"output": "1"
},
{
"input": "10 10\n0000100011\n0100001111\n1111111111\n1100011111\n1111111111\n1000111000\n1111000010\n0111001001\n1101010110\n1111111111",
"output": "4"
},
{
"input": "10 10\n1100110010\n0000000001\n1011100111\n1111111111\n1111111111\n1111111111\n1100010110\n1111111111\n1001001010\n1111111111",
"output": "3"
},
{
"input": "10 7\n0000111001\n1111111111\n0110110001\n1111111111\n1111111111\n1000111100\n0110000111",
"output": "2"
},
{
"input": "5 10\n00110\n11000\n10010\n00010\n11110\n01101\n11111\n10001\n11111\n01001",
"output": "6"
},
{
"input": "5 9\n11111\n11101\n11111\n11111\n01010\n01010\n00000\n11111\n00111",
"output": "3"
},
{
"input": "5 10\n11111\n00010\n11010\n11111\n11111\n00100\n11111\n11111\n01000\n11111",
"output": "2"
},
{
"input": "5 9\n11111\n11111\n11111\n11111\n11100\n11111\n11111\n11111\n00000",
"output": "1"
},
{
"input": "5 8\n11111\n10110\n01001\n11111\n01100\n10010\n11111\n11111",
"output": "2"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "100 1\n0011001100100010000011001100000001011101110110010001110001101100110011111101001011011001000010001111",
"output": "1"
},
{
"input": "100 1\n1011011100000101000111110000110111010101110010010011110010001110100011001110110101111100100110000000",
"output": "1"
},
{
"input": "100 1\n1110000011110101010111111100011001100000101101010110100101110000011100110110110101011100110110010011",
"output": "1"
},
{
"input": "100 1\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "0"
},
{
"input": "1 100\n1\n0\n0\n0\n1\n1\n0\n0\n0\n0\n1\n1\n0\n1\n1\n0\n0\n1\n1\n1\n0\n0\n1\n1\n1\n1\n1\n0\n1\n0\n0\n0\n1\n1\n0\n1\n0\n1\n0\n0\n0\n1\n0\n1\n0\n0\n0\n1\n1\n1\n0\n1\n1\n1\n0\n1\n0\n1\n1\n1\n1\n0\n0\n0\n0\n0\n0\n1\n1\n0\n1\n1\n1\n1\n1\n0\n1\n1\n1\n1\n1\n0\n1\n0\n0\n1\n0\n0\n1\n0\n0\n1\n0\n1\n1\n1\n0\n1\n0\n0",
"output": "6"
},
{
"input": "1 100\n0\n0\n0\n0\n1\n0\n0\n0\n0\n1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "49"
},
{
"input": "1 100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "0"
},
{
"input": "1 100\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "100"
},
{
"input": "2 2\n11\n10",
"output": "1"
},
{
"input": "1 1\n0",
"output": "1"
}
] | 1,664,806,945
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 56
| 46
| 0
|
n,d=map(int,input().split())
m=0
count=0
f=1
for i in range(d):
s=input()
for j in s:
if j=='0':
f=1
break
else:
f=0
if f==1:
count+=1
else:
count=0
if count>m:
m=count
print(m)
|
Title: Opponents
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Arya has *n* opponents in the school. Each day he will fight with all opponents who are present this day. His opponents have some fighting plan that guarantees they will win, but implementing this plan requires presence of them all. That means if one day at least one of Arya's opponents is absent at the school, then Arya will beat all present opponents. Otherwise, if all opponents are present, then they will beat Arya.
For each opponent Arya knows his schedule — whether or not he is going to present on each particular day. Tell him the maximum number of consecutive days that he will beat all present opponents.
Note, that if some day there are no opponents present, Arya still considers he beats all the present opponents.
Input Specification:
The first line of the input contains two integers *n* and *d* (1<=≤<=*n*,<=*d*<=≤<=100) — the number of opponents and the number of days, respectively.
The *i*-th of the following *d* lines contains a string of length *n* consisting of characters '0' and '1'. The *j*-th character of this string is '0' if the *j*-th opponent is going to be absent on the *i*-th day.
Output Specification:
Print the only integer — the maximum number of consecutive days that Arya will beat all present opponents.
Demo Input:
['2 2\n10\n00\n', '4 1\n0100\n', '4 5\n1101\n1111\n0110\n1011\n1111\n']
Demo Output:
['2\n', '1\n', '2\n']
Note:
In the first and the second samples, Arya will beat all present opponents each of the *d* days.
In the third sample, Arya will beat his opponents on days 1, 3 and 4 and his opponents will beat him on days 2 and 5. Thus, the maximum number of consecutive winning days is 2, which happens on days 3 and 4.
|
```python
n,d=map(int,input().split())
m=0
count=0
f=1
for i in range(d):
s=input()
for j in s:
if j=='0':
f=1
break
else:
f=0
if f==1:
count+=1
else:
count=0
if count>m:
m=count
print(m)
```
| 3
|
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.