contestId
int64
0
1.01k
index
stringclasses
57 values
name
stringlengths
2
58
type
stringclasses
2 values
rating
int64
0
3.5k
tags
listlengths
0
11
title
stringclasses
522 values
time-limit
stringclasses
8 values
memory-limit
stringclasses
8 values
problem-description
stringlengths
0
7.15k
input-specification
stringlengths
0
2.05k
output-specification
stringlengths
0
1.5k
demo-input
listlengths
0
7
demo-output
listlengths
0
7
note
stringlengths
0
5.24k
points
float64
0
425k
test_cases
listlengths
0
402
creationTimeSeconds
int64
1.37B
1.7B
relativeTimeSeconds
int64
8
2.15B
programmingLanguage
stringclasses
3 values
verdict
stringclasses
14 values
testset
stringclasses
12 values
passedTestCount
int64
0
1k
timeConsumedMillis
int64
0
15k
memoryConsumedBytes
int64
0
805M
code
stringlengths
3
65.5k
prompt
stringlengths
262
8.2k
response
stringlengths
17
65.5k
score
float64
-1
3.99
228
A
Is your horseshoe on the other hoof?
PROGRAMMING
800
[ "implementation" ]
null
null
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers.
Print a single integer — the minimum number of horseshoes Valera needs to buy.
[ "1 7 3 3\n", "7 7 7 7\n" ]
[ "1\n", "3\n" ]
none
500
[ { "input": "1 7 3 3", "output": "1" }, { "input": "7 7 7 7", "output": "3" }, { "input": "81170865 673572653 756938629 995577259", "output": "0" }, { "input": "3491663 217797045 522540872 715355328", "output": "0" }, { "input": "251590420 586975278 916631563 586975278", "output": "1" }, { "input": "259504825 377489979 588153796 377489979", "output": "1" }, { "input": "652588203 931100304 931100304 652588203", "output": "2" }, { "input": "391958720 651507265 391958720 651507265", "output": "2" }, { "input": "90793237 90793237 90793237 90793237", "output": "3" }, { "input": "551651653 551651653 551651653 551651653", "output": "3" }, { "input": "156630260 609654355 668943582 973622757", "output": "0" }, { "input": "17061017 110313588 434481173 796661222", "output": "0" }, { "input": "24975422 256716298 337790533 690960249", "output": "0" }, { "input": "255635360 732742923 798648949 883146723", "output": "0" }, { "input": "133315691 265159773 734556507 265159773", "output": "1" }, { "input": "28442865 741657755 978106882 978106882", "output": "1" }, { "input": "131245479 174845575 497483467 131245479", "output": "1" }, { "input": "139159884 616215581 958341883 616215581", "output": "1" }, { "input": "147784432 947653080 947653080 947653080", "output": "2" }, { "input": "94055790 756126496 756126496 94055790", "output": "2" }, { "input": "240458500 511952208 240458500 511952208", "output": "2" }, { "input": "681828506 972810624 972810624 681828506", "output": "2" }, { "input": "454961014 454961014 454961014 454961014", "output": "3" }, { "input": "915819430 915819430 915819430 915819430", "output": "3" }, { "input": "671645142 671645142 671645142 671645142", "output": "3" }, { "input": "132503558 132503558 132503558 132503558", "output": "3" }, { "input": "5 5 999999 6", "output": "1" }, { "input": "1 1 2 5", "output": "1" }, { "input": "2 1 2 3", "output": "1" }, { "input": "1 1 3 5", "output": "1" }, { "input": "1 1 3 3", "output": "2" }, { "input": "2 2 2 1", "output": "2" }, { "input": "3 1 1 1", "output": "2" }, { "input": "1 2 2 2", "output": "2" } ]
1,690,606,761
2,147,483,647
Python 3
OK
TESTS
34
92
0
a =list(map(int,input().split())) b = set(a) print(4-len(b))
Title: Is your horseshoe on the other hoof? Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party. Input Specification: The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers. Output Specification: Print a single integer — the minimum number of horseshoes Valera needs to buy. Demo Input: ['1 7 3 3\n', '7 7 7 7\n'] Demo Output: ['1\n', '3\n'] Note: none
```python a =list(map(int,input().split())) b = set(a) print(4-len(b)) ```
3
404
A
Valera and X
PROGRAMMING
1,000
[ "implementation" ]
null
null
Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet. Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if: - on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals. Help Valera, write the program that completes the described task for him.
The first line contains integer *n* (3<=≤<=*n*<=&lt;<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper.
Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes.
[ "5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n", "3\nwsw\nsws\nwsw\n", "3\nxpx\npxp\nxpe\n" ]
[ "NO\n", "YES\n", "NO\n" ]
none
500
[ { "input": "5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox", "output": "NO" }, { "input": "3\nwsw\nsws\nwsw", "output": "YES" }, { "input": "3\nxpx\npxp\nxpe", "output": "NO" }, { "input": "5\nliiil\nilili\niilii\nilili\nliiil", "output": "YES" }, { "input": "7\nbwccccb\nckcccbj\nccbcbcc\ncccbccc\nccbcbcc\ncbcccbc\nbccccdt", "output": "NO" }, { "input": "13\nsooooooooooos\nosoooooooooso\noosooooooosoo\nooosooooosooo\noooosooosoooo\nooooososooooo\noooooosoooooo\nooooososooooo\noooosooosoooo\nooosooooosooo\noosooooooosoo\nosoooooooooso\nsooooooooooos", "output": "YES" }, { "input": "3\naaa\naaa\naaa", "output": "NO" }, { "input": "3\naca\noec\nzba", "output": "NO" }, { "input": "15\nrxeeeeeeeeeeeer\nereeeeeeeeeeere\needeeeeeeeeeoee\neeereeeeeeeewee\neeeereeeeebeeee\nqeeeereeejedyee\neeeeeerereeeeee\neeeeeeereeeeeee\neeeeeerereeeeze\neeeeereeereeeee\neeeereeeeegeeee\neeereeeeeeereee\neereeeeeeqeeved\ncreeeeeeceeeere\nreeerneeeeeeeer", "output": "NO" }, { "input": "5\nxxxxx\nxxxxx\nxxxxx\nxxxxx\nxxxxx", "output": "NO" }, { "input": "5\nxxxxx\nxxxxx\nxoxxx\nxxxxx\nxxxxx", "output": "NO" }, { "input": "5\noxxxo\nxoxox\nxxxxx\nxoxox\noxxxo", "output": "NO" }, { "input": "5\noxxxo\nxoxox\nxxoox\nxoxox\noxxxo", "output": "NO" }, { "input": "5\noxxxo\nxoxox\nxxaxx\nxoxox\noxxxo", "output": "NO" }, { "input": "5\noxxxo\nxoxox\noxoxx\nxoxox\noxxxo", "output": "NO" }, { "input": "3\nxxx\naxa\nxax", "output": "NO" }, { "input": "3\nxax\naxx\nxax", "output": "NO" }, { "input": "3\nxax\naxa\nxxx", "output": "NO" }, { "input": "3\nxax\nxxa\nxax", "output": "NO" }, { "input": "3\nxax\naaa\nxax", "output": "NO" }, { "input": "3\naax\naxa\nxax", "output": "NO" }, { "input": "3\nxaa\naxa\nxax", "output": "NO" }, { "input": "3\nxax\naxa\naax", "output": "NO" }, { "input": "3\nxax\naxa\nxaa", "output": "NO" }, { "input": "3\nxfx\naxa\nxax", "output": "NO" }, { "input": "3\nxax\nafa\nxax", "output": "NO" }, { "input": "3\nxax\naxa\nxaf", "output": "NO" }, { "input": "3\nxox\nxxx\nxxx", "output": "NO" }, { "input": "3\naxa\naax\nxxa", "output": "NO" }, { "input": "3\nxox\noxx\nxox", "output": "NO" }, { "input": "3\nxox\nooo\nxox", "output": "NO" }, { "input": "3\naaa\naab\nbbb", "output": "NO" }, { "input": "3\nxxx\nsxs\nxsx", "output": "NO" }, { "input": "5\nabbba\nbabab\nbbbbb\nbaaab\nabbba", "output": "NO" }, { "input": "5\nabaaa\nbbbbb\nbbabb\nbabab\nabbba", "output": "NO" }, { "input": "5\nxoxox\noxoxo\nooxoo\noxoxo\nxooox", "output": "NO" }, { "input": "3\nxox\noxx\nxxx", "output": "NO" }, { "input": "5\nxoooo\noxooo\nooxoo\noooxo\noooox", "output": "NO" }, { "input": "5\nxoooo\noxoxx\nooxoo\noxoxo\noxoox", "output": "NO" }, { "input": "3\naaa\nbab\naba", "output": "NO" } ]
1,595,737,257
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
6
139
20,172,800
n = int(input()) l1 = [] l2 = [] ruined=0 for x in range(n//2): l1.append(input()) center = input() for x in range(n//2): l2.append(input()) l2.reverse() poss=l1[0][0] notpos=l1[0][1] if center!=notpos*(n//2)+poss+notpos*(n//2): ruined=1 #print("HERE") else: for x in range(len(l1)): if l1[x]!=notpos*x+poss+notpos*(n-2*x-2)+poss+notpos*x: ruined=1 #print("THERE") break if l2[x]!=l1[x]: ruined=1 #print("EVERYWHERE") break if not ruined: print("YES") else: print("NO")
Title: Valera and X Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet. Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if: - on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals. Help Valera, write the program that completes the described task for him. Input Specification: The first line contains integer *n* (3<=≤<=*n*<=&lt;<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper. Output Specification: Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes. Demo Input: ['5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n', '3\nwsw\nsws\nwsw\n', '3\nxpx\npxp\nxpe\n'] Demo Output: ['NO\n', 'YES\n', 'NO\n'] Note: none
```python n = int(input()) l1 = [] l2 = [] ruined=0 for x in range(n//2): l1.append(input()) center = input() for x in range(n//2): l2.append(input()) l2.reverse() poss=l1[0][0] notpos=l1[0][1] if center!=notpos*(n//2)+poss+notpos*(n//2): ruined=1 #print("HERE") else: for x in range(len(l1)): if l1[x]!=notpos*x+poss+notpos*(n-2*x-2)+poss+notpos*x: ruined=1 #print("THERE") break if l2[x]!=l1[x]: ruined=1 #print("EVERYWHERE") break if not ruined: print("YES") else: print("NO") ```
0
486
A
Calculating Function
PROGRAMMING
800
[ "implementation", "math" ]
null
null
For a positive integer *n* let's define a function *f*: *f*(*n*)<==<=<=-<=1<=+<=2<=-<=3<=+<=..<=+<=(<=-<=1)*n**n* Your task is to calculate *f*(*n*) for a given integer *n*.
The single line contains the positive integer *n* (1<=≤<=*n*<=≤<=1015).
Print *f*(*n*) in a single line.
[ "4\n", "5\n" ]
[ "2\n", "-3\n" ]
*f*(4) =  - 1 + 2 - 3 + 4 = 2 *f*(5) =  - 1 + 2 - 3 + 4 - 5 =  - 3
500
[ { "input": "4", "output": "2" }, { "input": "5", "output": "-3" }, { "input": "1000000000", "output": "500000000" }, { "input": "1000000001", "output": "-500000001" }, { "input": "1000000000000000", "output": "500000000000000" }, { "input": "100", "output": "50" }, { "input": "101", "output": "-51" }, { "input": "102", "output": "51" }, { "input": "103", "output": "-52" }, { "input": "104", "output": "52" }, { "input": "105", "output": "-53" }, { "input": "106", "output": "53" }, { "input": "107", "output": "-54" }, { "input": "108", "output": "54" }, { "input": "109", "output": "-55" }, { "input": "208170109961052", "output": "104085054980526" }, { "input": "46017661651072", "output": "23008830825536" }, { "input": "4018154546667", "output": "-2009077273334" }, { "input": "288565475053", "output": "-144282737527" }, { "input": "3052460231", "output": "-1526230116" }, { "input": "29906716", "output": "14953358" }, { "input": "87897701693326", "output": "43948850846663" }, { "input": "8240", "output": "4120" }, { "input": "577935", "output": "-288968" }, { "input": "62", "output": "31" }, { "input": "1", "output": "-1" }, { "input": "2", "output": "1" }, { "input": "9999999999999", "output": "-5000000000000" }, { "input": "1000000000000", "output": "500000000000" }, { "input": "99999999999999", "output": "-50000000000000" }, { "input": "999999999999999", "output": "-500000000000000" }, { "input": "42191359342", "output": "21095679671" }, { "input": "100000000000000", "output": "50000000000000" }, { "input": "145645214654154", "output": "72822607327077" }, { "input": "4294967296", "output": "2147483648" }, { "input": "3037000499", "output": "-1518500250" }, { "input": "10000000000001", "output": "-5000000000001" }, { "input": "100000017040846", "output": "50000008520423" }, { "input": "98979894985999", "output": "-49489947493000" } ]
1,694,789,230
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
2
1,000
0
n = int(input()) f = 0 for i in range(1, n+1): f += ((-1)**i)*i print(f)
Title: Calculating Function Time Limit: None seconds Memory Limit: None megabytes Problem Description: For a positive integer *n* let's define a function *f*: *f*(*n*)<==<=<=-<=1<=+<=2<=-<=3<=+<=..<=+<=(<=-<=1)*n**n* Your task is to calculate *f*(*n*) for a given integer *n*. Input Specification: The single line contains the positive integer *n* (1<=≤<=*n*<=≤<=1015). Output Specification: Print *f*(*n*) in a single line. Demo Input: ['4\n', '5\n'] Demo Output: ['2\n', '-3\n'] Note: *f*(4) =  - 1 + 2 - 3 + 4 = 2 *f*(5) =  - 1 + 2 - 3 + 4 - 5 =  - 3
```python n = int(input()) f = 0 for i in range(1, n+1): f += ((-1)**i)*i print(f) ```
0
68
A
Irrational problem
PROGRAMMING
1,100
[ "implementation", "number theory" ]
A. Irrational problem
2
256
Little Petya was given this problem for homework: You are given function (here represents the operation of taking the remainder). His task is to count the number of integers *x* in range [*a*;*b*] with property *f*(*x*)<==<=*x*. It is a pity that Petya forgot the order in which the remainders should be taken and wrote down only 4 numbers. Each of 24 possible orders of taking the remainder has equal probability of being chosen. For example, if Petya has numbers 1, 2, 3, 4 then he can take remainders in that order or first take remainder modulo 4, then modulo 2, 3, 1. There also are 22 other permutations of these numbers that represent orders in which remainder can be taken. In this problem 4 numbers wrote down by Petya will be pairwise distinct. Now it is impossible for Petya to complete the task given by teacher but just for fun he decided to find the number of integers with property that probability that *f*(*x*)<==<=*x* is not less than 31.4159265352718281828459045%. In other words, Petya will pick up the number *x* if there exist at least 7 permutations of numbers *p*1,<=*p*2,<=*p*3,<=*p*4, for which *f*(*x*)<==<=*x*.
First line of the input will contain 6 integers, separated by spaces: *p*1,<=*p*2,<=*p*3,<=*p*4,<=*a*,<=*b* (1<=≤<=*p*1,<=*p*2,<=*p*3,<=*p*4<=≤<=1000,<=0<=≤<=*a*<=≤<=*b*<=≤<=31415). It is guaranteed that numbers *p*1,<=*p*2,<=*p*3,<=*p*4 will be pairwise distinct.
Output the number of integers in the given range that have the given property.
[ "2 7 1 8 2 8\n", "20 30 40 50 0 100\n", "31 41 59 26 17 43\n" ]
[ "0\n", "20\n", "9\n" ]
none
500
[ { "input": "2 7 1 8 2 8", "output": "0" }, { "input": "20 30 40 50 0 100", "output": "20" }, { "input": "31 41 59 26 17 43", "output": "9" }, { "input": "1 2 3 4 0 0", "output": "1" }, { "input": "1 2 3 4 1 1", "output": "0" }, { "input": "1 2 999 1000 30 40", "output": "0" }, { "input": "17 18 19 20 17 20", "output": "0" }, { "input": "17 18 19 20 16 20", "output": "1" }, { "input": "41 449 328 474 150 709", "output": "0" }, { "input": "467 329 936 440 117 700", "output": "212" }, { "input": "258 811 952 491 931 993", "output": "0" }, { "input": "823 431 359 590 153 899", "output": "206" }, { "input": "292 370 404 698 699 876", "output": "0" }, { "input": "442 705 757 527 868 893", "output": "0" }, { "input": "642 273 18 885 675 788", "output": "0" }, { "input": "291 303 656 660 126 704", "output": "165" }, { "input": "225 862 522 617 630 725", "output": "0" }, { "input": "17 847 715 732 502 778", "output": "0" }, { "input": "41 449 328 474 15724 19169", "output": "0" }, { "input": "467 329 936 440 5705 28145", "output": "0" }, { "input": "258 811 952 491 2995 11942", "output": "0" }, { "input": "823 431 359 590 153 3902", "output": "206" }, { "input": "292 370 404 698 19718 19895", "output": "0" }, { "input": "442 705 757 527 1869 19912", "output": "0" }, { "input": "642 273 18 885 23811 28703", "output": "0" }, { "input": "291 303 656 660 7711 15141", "output": "0" }, { "input": "225 862 522 617 1246 1341", "output": "0" }, { "input": "17 847 715 732 778 27529", "output": "0" }, { "input": "997 998 999 1000 0 31415", "output": "997" }, { "input": "1 2 3 4 0 31415", "output": "1" }, { "input": "541 931 822 948 131 193", "output": "63" }, { "input": "956 800 909 916 89 194", "output": "106" }, { "input": "735 794 942 991 419 490", "output": "72" }, { "input": "818 926 827 575 153 395", "output": "243" }, { "input": "792 858 887 679 179 356", "output": "178" }, { "input": "937 683 742 515 366 373", "output": "8" }, { "input": "616 747 501 875 146 264", "output": "119" }, { "input": "760 773 638 655 111 196", "output": "86" }, { "input": "697 855 997 589 97 192", "output": "96" }, { "input": "998 834 706 722 277 475", "output": "199" }, { "input": "100 101 102 103 10 20", "output": "11" } ]
1,596,685,665
2,147,483,647
Python 3
OK
TESTS
41
1,778
7,065,600
# cook your dish here from sys import stdin,stdout from collections import Counter from itertools import permutations I=lambda: map(int,stdin.readline().split()) I1=lambda: stdin.readline() p1,p2,p3,p4,a,b=I() l=list(permutations([p1,p2,p3,p4])) ans=0 for i in range(a,b+1): c=0 for j in range(24): a,x=list(l[j]),i for y in a: x=x%y if x==i: c+=1 if c>=7: ans+=1 print(ans)
Title: Irrational problem Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Little Petya was given this problem for homework: You are given function (here represents the operation of taking the remainder). His task is to count the number of integers *x* in range [*a*;*b*] with property *f*(*x*)<==<=*x*. It is a pity that Petya forgot the order in which the remainders should be taken and wrote down only 4 numbers. Each of 24 possible orders of taking the remainder has equal probability of being chosen. For example, if Petya has numbers 1, 2, 3, 4 then he can take remainders in that order or first take remainder modulo 4, then modulo 2, 3, 1. There also are 22 other permutations of these numbers that represent orders in which remainder can be taken. In this problem 4 numbers wrote down by Petya will be pairwise distinct. Now it is impossible for Petya to complete the task given by teacher but just for fun he decided to find the number of integers with property that probability that *f*(*x*)<==<=*x* is not less than 31.4159265352718281828459045%. In other words, Petya will pick up the number *x* if there exist at least 7 permutations of numbers *p*1,<=*p*2,<=*p*3,<=*p*4, for which *f*(*x*)<==<=*x*. Input Specification: First line of the input will contain 6 integers, separated by spaces: *p*1,<=*p*2,<=*p*3,<=*p*4,<=*a*,<=*b* (1<=≤<=*p*1,<=*p*2,<=*p*3,<=*p*4<=≤<=1000,<=0<=≤<=*a*<=≤<=*b*<=≤<=31415). It is guaranteed that numbers *p*1,<=*p*2,<=*p*3,<=*p*4 will be pairwise distinct. Output Specification: Output the number of integers in the given range that have the given property. Demo Input: ['2 7 1 8 2 8\n', '20 30 40 50 0 100\n', '31 41 59 26 17 43\n'] Demo Output: ['0\n', '20\n', '9\n'] Note: none
```python # cook your dish here from sys import stdin,stdout from collections import Counter from itertools import permutations I=lambda: map(int,stdin.readline().split()) I1=lambda: stdin.readline() p1,p2,p3,p4,a,b=I() l=list(permutations([p1,p2,p3,p4])) ans=0 for i in range(a,b+1): c=0 for j in range(24): a,x=list(l[j]),i for y in a: x=x%y if x==i: c+=1 if c>=7: ans+=1 print(ans) ```
3.542339
255
A
Greg's Workout
PROGRAMMING
800
[ "implementation" ]
null
null
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times. Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise. Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises.
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise. It is guaranteed that the input is such that the answer to the problem is unambiguous.
[ "2\n2 8\n", "3\n5 1 10\n", "7\n3 3 2 7 9 6 8\n" ]
[ "biceps\n", "back\n", "chest\n" ]
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises. In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises. In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise.
500
[ { "input": "2\n2 8", "output": "biceps" }, { "input": "3\n5 1 10", "output": "back" }, { "input": "7\n3 3 2 7 9 6 8", "output": "chest" }, { "input": "4\n5 6 6 2", "output": "chest" }, { "input": "5\n8 2 2 6 3", "output": "chest" }, { "input": "6\n8 7 2 5 3 4", "output": "chest" }, { "input": "8\n7 2 9 10 3 8 10 6", "output": "chest" }, { "input": "9\n5 4 2 3 4 4 5 2 2", "output": "chest" }, { "input": "10\n4 9 8 5 3 8 8 10 4 2", "output": "biceps" }, { "input": "11\n10 9 7 6 1 3 9 7 1 3 5", "output": "chest" }, { "input": "12\n24 22 6 16 5 21 1 7 2 19 24 5", "output": "chest" }, { "input": "13\n24 10 5 7 16 17 2 7 9 20 15 2 24", "output": "chest" }, { "input": "14\n13 14 19 8 5 17 9 16 15 9 5 6 3 7", "output": "back" }, { "input": "15\n24 12 22 21 25 23 21 5 3 24 23 13 12 16 12", "output": "chest" }, { "input": "16\n12 6 18 6 25 7 3 1 1 17 25 17 6 8 17 8", "output": "biceps" }, { "input": "17\n13 8 13 4 9 21 10 10 9 22 14 23 22 7 6 14 19", "output": "chest" }, { "input": "18\n1 17 13 6 11 10 25 13 24 9 21 17 3 1 17 12 25 21", "output": "back" }, { "input": "19\n22 22 24 25 19 10 7 10 4 25 19 14 1 14 3 18 4 19 24", "output": "chest" }, { "input": "20\n9 8 22 11 18 14 15 10 17 11 2 1 25 20 7 24 4 25 9 20", "output": "chest" }, { "input": "1\n10", "output": "chest" }, { "input": "2\n15 3", "output": "chest" }, { "input": "3\n21 11 19", "output": "chest" }, { "input": "4\n19 24 13 15", "output": "chest" }, { "input": "5\n4 24 1 9 19", "output": "biceps" }, { "input": "6\n6 22 24 7 15 24", "output": "back" }, { "input": "7\n10 8 23 23 14 18 14", "output": "chest" }, { "input": "8\n5 16 8 9 17 16 14 7", "output": "biceps" }, { "input": "9\n12 3 10 23 6 4 22 13 12", "output": "chest" }, { "input": "10\n1 9 20 18 20 17 7 24 23 2", "output": "back" }, { "input": "11\n22 25 8 2 18 15 1 13 1 11 4", "output": "biceps" }, { "input": "12\n20 12 14 2 15 6 24 3 11 8 11 14", "output": "chest" }, { "input": "13\n2 18 8 8 8 20 5 22 15 2 5 19 18", "output": "back" }, { "input": "14\n1 6 10 25 17 13 21 11 19 4 15 24 5 22", "output": "biceps" }, { "input": "15\n13 5 25 13 17 25 19 21 23 17 12 6 14 8 6", "output": "back" }, { "input": "16\n10 15 2 17 22 12 14 14 6 11 4 13 9 8 21 14", "output": "chest" }, { "input": "17\n7 22 9 22 8 7 20 22 23 5 12 11 1 24 17 20 10", "output": "biceps" }, { "input": "18\n18 15 4 25 5 11 21 25 12 14 25 23 19 19 13 6 9 17", "output": "chest" }, { "input": "19\n3 1 3 15 15 25 10 25 23 10 9 21 13 23 19 3 24 21 14", "output": "back" }, { "input": "20\n19 18 11 3 6 14 3 3 25 3 1 19 25 24 23 12 7 4 8 6", "output": "back" }, { "input": "1\n19", "output": "chest" }, { "input": "2\n1 7", "output": "biceps" }, { "input": "3\n18 18 23", "output": "back" }, { "input": "4\n12 15 1 13", "output": "chest" }, { "input": "5\n11 14 25 21 21", "output": "biceps" }, { "input": "6\n11 9 12 11 22 18", "output": "biceps" }, { "input": "7\n11 1 16 20 21 25 20", "output": "chest" }, { "input": "8\n1 2 20 9 3 22 17 4", "output": "back" }, { "input": "9\n19 2 10 19 15 20 3 1 13", "output": "back" }, { "input": "10\n11 2 11 8 21 16 2 3 19 9", "output": "back" }, { "input": "20\n25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 24", "output": "chest" }, { "input": "12\n4 24 21 3 13 24 22 13 12 21 1 15", "output": "back" }, { "input": "13\n14 14 16 2 13 5 1 14 9 4 16 8 3", "output": "biceps" }, { "input": "14\n1 9 15 4 11 8 25 3 9 14 13 2 1 11", "output": "biceps" }, { "input": "15\n4 19 10 6 16 12 5 11 7 23 1 24 11 7 17", "output": "back" }, { "input": "16\n2 8 2 8 13 22 20 12 22 23 18 13 18 22 11 17", "output": "chest" }, { "input": "17\n24 5 5 16 10 8 22 6 4 13 10 10 5 23 8 20 8", "output": "chest" }, { "input": "18\n14 8 9 12 11 18 24 1 14 24 18 5 12 17 1 10 1 22", "output": "chest" }, { "input": "19\n21 2 10 6 9 1 24 5 2 19 10 13 10 7 19 2 6 13 24", "output": "chest" }, { "input": "20\n7 1 14 17 6 6 18 13 12 3 25 4 3 19 22 24 16 14 1 23", "output": "biceps" }, { "input": "1\n19", "output": "chest" }, { "input": "20\n2 1 2 2 1 2 2 1 2 1 1 1 1 1 1 1 1 1 1 22", "output": "biceps" } ]
1,590,898,337
2,147,483,647
PyPy 3
OK
TESTS
61
280
0
n = int(input()) a = [int(i) for i in input().split()] c = [0, 0, 0] for i in range(n): c[(i+1)%3-1] += a[i] if c[0] > c[1] and c[0] > c[2]: print("chest") elif c[1] > c[0] and c[1] > c[2]: print("biceps") else: print("back")
Title: Greg's Workout Time Limit: None seconds Memory Limit: None megabytes Problem Description: Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times. Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise. Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises. Output Specification: Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise. It is guaranteed that the input is such that the answer to the problem is unambiguous. Demo Input: ['2\n2 8\n', '3\n5 1 10\n', '7\n3 3 2 7 9 6 8\n'] Demo Output: ['biceps\n', 'back\n', 'chest\n'] Note: In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises. In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises. In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise.
```python n = int(input()) a = [int(i) for i in input().split()] c = [0, 0, 0] for i in range(n): c[(i+1)%3-1] += a[i] if c[0] > c[1] and c[0] > c[2]: print("chest") elif c[1] > c[0] and c[1] > c[2]: print("biceps") else: print("back") ```
3
461
A
Appleman and Toastman
PROGRAMMING
1,200
[ "greedy", "sortings" ]
null
null
Appleman and Toastman play a game. Initially Appleman gives one group of *n* numbers to the Toastman, then they start to complete the following tasks: - Each time Toastman gets a group of numbers, he sums up all the numbers and adds this sum to the score. Then he gives the group to the Appleman. - Each time Appleman gets a group consisting of a single number, he throws this group out. Each time Appleman gets a group consisting of more than one number, he splits the group into two non-empty groups (he can do it in any way) and gives each of them to Toastman. After guys complete all the tasks they look at the score value. What is the maximum possible value of score they can get?
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=3·105). The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=106) — the initial group that is given to Toastman.
Print a single integer — the largest possible score.
[ "3\n3 1 5\n", "1\n10\n" ]
[ "26\n", "10\n" ]
Consider the following situation in the first example. Initially Toastman gets group [3, 1, 5] and adds 9 to the score, then he give the group to Appleman. Appleman splits group [3, 1, 5] into two groups: [3, 5] and [1]. Both of them should be given to Toastman. When Toastman receives group [1], he adds 1 to score and gives the group to Appleman (he will throw it out). When Toastman receives group [3, 5], he adds 8 to the score and gives the group to Appleman. Appleman splits [3, 5] in the only possible way: [5] and [3]. Then he gives both groups to Toastman. When Toastman receives [5], he adds 5 to the score and gives the group to Appleman (he will throws it out). When Toastman receives [3], he adds 3 to the score and gives the group to Appleman (he will throws it out). Finally Toastman have added 9 + 1 + 8 + 5 + 3 = 26 to the score. This is the optimal sequence of actions.
500
[ { "input": "3\n3 1 5", "output": "26" }, { "input": "1\n10", "output": "10" }, { "input": "10\n8 10 2 5 6 2 4 7 2 1", "output": "376" }, { "input": "10\n171308 397870 724672 431255 228496 892002 542924 718337 888642 161821", "output": "40204082" }, { "input": "10\n1 2 2 2 4 5 6 7 8 10", "output": "376" }, { "input": "10\n161821 171308 228496 397870 431255 542924 718337 724672 888642 892002", "output": "40204082" }, { "input": "1\n397870", "output": "397870" }, { "input": "1\n1000000", "output": "1000000" }, { "input": "10\n10 8 7 6 5 4 2 2 2 1", "output": "376" }, { "input": "10\n892002 888642 724672 718337 542924 431255 397870 228496 171308 161821", "output": "40204082" }, { "input": "10\n5 2 6 10 10 10 10 2 2 5", "output": "485" }, { "input": "10\n431255 724672 228496 397870 397870 397870 397870 724672 888642 431255", "output": "36742665" }, { "input": "10\n2 2 2 5 5 6 10 10 10 10", "output": "485" }, { "input": "10\n228496 397870 397870 397870 397870 431255 431255 724672 724672 888642", "output": "36742665" }, { "input": "10\n10 10 10 10 6 5 5 2 2 2", "output": "485" }, { "input": "10\n888642 724672 724672 431255 431255 397870 397870 397870 397870 228496", "output": "36742665" }, { "input": "10\n10 10 10 10 10 10 10 10 10 10", "output": "640" }, { "input": "10\n1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000", "output": "64000000" }, { "input": "1\n397870", "output": "397870" }, { "input": "2\n1 2", "output": "6" }, { "input": "2\n2 3", "output": "10" }, { "input": "2\n1 1", "output": "4" } ]
1,625,708,967
2,147,483,647
PyPy 3
OK
TESTS
36
373
23,756,800
n=int(input()) l=list(map(int,input().split())) l=sorted(l) ans=sum(l) r=ans for i in range(n-1): r-=l[i] ans+=l[i] ans+=r print(ans)
Title: Appleman and Toastman Time Limit: None seconds Memory Limit: None megabytes Problem Description: Appleman and Toastman play a game. Initially Appleman gives one group of *n* numbers to the Toastman, then they start to complete the following tasks: - Each time Toastman gets a group of numbers, he sums up all the numbers and adds this sum to the score. Then he gives the group to the Appleman. - Each time Appleman gets a group consisting of a single number, he throws this group out. Each time Appleman gets a group consisting of more than one number, he splits the group into two non-empty groups (he can do it in any way) and gives each of them to Toastman. After guys complete all the tasks they look at the score value. What is the maximum possible value of score they can get? Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=3·105). The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=106) — the initial group that is given to Toastman. Output Specification: Print a single integer — the largest possible score. Demo Input: ['3\n3 1 5\n', '1\n10\n'] Demo Output: ['26\n', '10\n'] Note: Consider the following situation in the first example. Initially Toastman gets group [3, 1, 5] and adds 9 to the score, then he give the group to Appleman. Appleman splits group [3, 1, 5] into two groups: [3, 5] and [1]. Both of them should be given to Toastman. When Toastman receives group [1], he adds 1 to score and gives the group to Appleman (he will throw it out). When Toastman receives group [3, 5], he adds 8 to the score and gives the group to Appleman. Appleman splits [3, 5] in the only possible way: [5] and [3]. Then he gives both groups to Toastman. When Toastman receives [5], he adds 5 to the score and gives the group to Appleman (he will throws it out). When Toastman receives [3], he adds 3 to the score and gives the group to Appleman (he will throws it out). Finally Toastman have added 9 + 1 + 8 + 5 + 3 = 26 to the score. This is the optimal sequence of actions.
```python n=int(input()) l=list(map(int,input().split())) l=sorted(l) ans=sum(l) r=ans for i in range(n-1): r-=l[i] ans+=l[i] ans+=r print(ans) ```
3
0
none
none
none
0
[ "none" ]
null
null
В Берляндском государственном университете локальная сеть между серверами не всегда работает без ошибок. При передаче двух одинаковых сообщений подряд возможна ошибка, в результате которой эти два сообщения сливаются в одно. При таком слиянии конец первого сообщения совмещается с началом второго. Конечно, совмещение может происходить только по одинаковым символам. Длина совмещения должна быть положительным числом, меньшим длины текста сообщения. Например, при передаче двух сообщений «abrakadabra» подряд возможно, что оно будет передано с ошибкой описанного вида, и тогда будет получено сообщение вида «abrakadabrabrakadabra» или «abrakadabrakadabra» (в первом случае совмещение произошло по одному символу, а во втором — по четырем). По полученному сообщению *t* определите, возможно ли, что это результат ошибки описанного вида работы локальной сети, и если возможно, определите возможное значение *s*. Не следует считать ошибкой ситуацию полного наложения друга на друга двух сообщений. К примеру, если получено сообщение «abcd», следует считать, что в нём ошибки нет. Аналогично, простое дописывание одного сообщения вслед за другим не является признаком ошибки. Например, если получено сообщение «abcabc», следует считать, что в нём ошибки нет.
В единственной строке выходных данных следует непустая строка *t*, состоящая из строчных букв латинского алфавита. Длина строки *t* не превосходит 100 символов.
Если сообщение *t* не может содержать ошибки, выведите «NO» (без кавычек) в единственную строку выходных данных. В противном случае в первой строке выведите «YES» (без кавычек), а в следующей строке выведите строку *s* — возможное сообщение, которое могло привести к ошибке. Если возможных ответов несколько, разрешается вывести любой из них.
[ "abrakadabrabrakadabra\n", "acacacaca\n", "abcabc\n", "abababab\n", "tatbt\n" ]
[ "YES\nabrakadabra\n", "YES\nacaca\n", "NO\n", "YES\nababab\n", "NO\n" ]
Во втором примере подходящим ответом также является строка acacaca.
0
[ { "input": "abrakadabrabrakadabra", "output": "YES\nabrakadabra" }, { "input": "acacacaca", "output": "YES\nacaca" }, { "input": "abcabc", "output": "NO" }, { "input": "abababab", "output": "YES\nababab" }, { "input": "tatbt", "output": "NO" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "YES\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "r", "output": "NO" }, { "input": "zaz", "output": "NO" }, { "input": "zaza", "output": "NO" }, { "input": "gg", "output": "NO" }, { "input": "gagaga", "output": "YES\ngaga" }, { "input": "hhhh", "output": "YES\nhhh" }, { "input": "sssss", "output": "YES\nsss" }, { "input": "nxnxnx", "output": "YES\nnxnx" }, { "input": "vygvygv", "output": "YES\nvygv" }, { "input": "rlrlrlrl", "output": "YES\nrlrlrl" }, { "input": "zyzyzyzyz", "output": "YES\nzyzyz" }, { "input": "jjjjjjjjjj", "output": "YES\njjjjjj" }, { "input": "kkhuskkhusk", "output": "YES\nkkhusk" }, { "input": "gzgzgzgzgzgz", "output": "YES\ngzgzgzgz" }, { "input": "vkyxvkyxvkyxv", "output": "YES\nvkyxvkyxv" }, { "input": "uuuuuuuuuuuuuu", "output": "YES\nuuuuuuuu" }, { "input": "esxwpesxwpesxwp", "output": "YES\nesxwpesxwp" }, { "input": "qltrajqltrajqltr", "output": "YES\nqltrajqltr" }, { "input": "alxalxalxalxalxal", "output": "YES\nalxalxalxal" }, { "input": "ijtojrijtojrijtojr", "output": "YES\nijtojrijtojr" }, { "input": "yhbhamyhbhamyhbhamy", "output": "YES\nyhbhamyhbhamy" }, { "input": "cdrcuccdrcuccdrcuccd", "output": "YES\ncdrcuccdrcuccd" }, { "input": "ddoaxeaddoaxeaddoaxea", "output": "YES\nddoaxeaddoaxea" }, { "input": "ejfrayejfrayejfrayejfr", "output": "YES\nejfrayejfrayejfr" }, { "input": "oxciazoxciazoxciazoxcia", "output": "YES\noxciazoxciazoxcia" }, { "input": "zfusxizfusxizfusxizfusxi", "output": "YES\nzfusxizfusxizfusxi" }, { "input": "kqkqkqkqkqkqkqkqkqkqkqkqk", "output": "YES\nkqkqkqkqkqkqk" }, { "input": "mrmrmrmrmrmrmrmrmrmrmrmrmr", "output": "YES\nmrmrmrmrmrmrmr" }, { "input": "wnwnwnwnwnwnwnwnwnwnwnwnwnw", "output": "YES\nwnwnwnwnwnwnwnw" }, { "input": "zchvhrmcrzchvhrmcrzchvhrmcrz", "output": "YES\nzchvhrmcrzchvhrmcrz" }, { "input": "hngryskhngryskhngryskhngryskh", "output": "YES\nhngryskhngryskh" }, { "input": "papapapapapapapapapapapapapapa", "output": "YES\npapapapapapapapa" }, { "input": "qqgedqkewrelydzqqgedqkewrelydzq", "output": "YES\nqqgedqkewrelydzq" }, { "input": "mtphoncwmtphoncwmtphoncwmtphoncw", "output": "YES\nmtphoncwmtphoncwmtphoncw" }, { "input": "sypfetgsuhifxzsypfetgsuhifxzsypfe", "output": "YES\nsypfetgsuhifxzsypfe" }, { "input": "avhiggygrtudeavhiggygrtudeavhiggyg", "output": "YES\navhiggygrtudeavhiggyg" }, { "input": "hphhiattwnahphhiattwnahphhiattwnahp", "output": "YES\nhphhiattwnahphhiattwnahp" }, { "input": "lpuilpuilpuilpuilpuilpuilpuilpuilpui", "output": "YES\nlpuilpuilpuilpuilpui" }, { "input": "bbztwlxbocpbbztwlxbocpbbztwlxbocpbbzt", "output": "YES\nbbztwlxbocpbbztwlxbocpbbzt" }, { "input": "dvdvdvdvdvdvdvdvdvdvdvdvdvdvdvdvdvdvdv", "output": "YES\ndvdvdvdvdvdvdvdvdvdv" }, { "input": "mnvkmnvkmnvkmnvkmnvkmnvkmnvkmnvkmnvkmnv", "output": "YES\nmnvkmnvkmnvkmnvkmnvkmnv" }, { "input": "ugugugugugugugugugugugugugugugugugugugug", "output": "YES\nugugugugugugugugugugug" }, { "input": "nyilpgayabfzpqifnyilpgayabfzpqifnyilpgaya", "output": "YES\nnyilpgayabfzpqifnyilpgaya" }, { "input": "awxmegcmrkzawxmegcmrkzawxmegcmrkzawxmegcmr", "output": "YES\nawxmegcmrkzawxmegcmrkzawxmegcmr" }, { "input": "ugduygugduygugduygugduygugduygugduygugduygu", "output": "YES\nugduygugduygugduygugduygu" }, { "input": "dkwelorlspdltsdkwelorlspdltsdkwelorlspdltsdk", "output": "YES\ndkwelorlspdltsdkwelorlspdltsdk" }, { "input": "xwyxssvcedrwtpgxwyxssvcedrwtpgxwyxssvcedrwtpg", "output": "YES\nxwyxssvcedrwtpgxwyxssvcedrwtpg" }, { "input": "pwjkpwjkpwjkpwjkpwjkpwjkpwjkpwjkpwjkpwjkpwjkpw", "output": "YES\npwjkpwjkpwjkpwjkpwjkpwjkpw" }, { "input": "vxumrzwwzrzzfuvxumrzwwzrzzfuvxumrzwwzrzzfuvxumr", "output": "YES\nvxumrzwwzrzzfuvxumrzwwzrzzfuvxumr" }, { "input": "kkkkrhhkkkkrhhkkkkrhhkkkkrhhkkkkrhhkkkkrhhkkkkrh", "output": "YES\nkkkkrhhkkkkrhhkkkkrhhkkkkrh" }, { "input": "lfbpinxnjsfvjsfbshblyvlfbpinxnjsfvjsfbshblyvlfbpi", "output": "YES\nlfbpinxnjsfvjsfbshblyvlfbpi" }, { "input": "sqdrmjqbfbmjmqfbcemrjtsqdrmjqbfbmjmqfbcemrjtsqdrmj", "output": "YES\nsqdrmjqbfbmjmqfbcemrjtsqdrmj" }, { "input": "eeaiaeeaiaeeaiaeeaiaeeaiaeeaiaeeaiaeeaiaeeaiaeeaiae", "output": "YES\neeaiaeeaiaeeaiaeeaiaeeaiae" }, { "input": "fhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfh", "output": "YES\nfhfhfhfhfhfhfhfhfhfhfhfhfhfh" }, { "input": "ouygsznbnotbouygsznbnotbouygsznbnotbouygsznbnotbouygs", "output": "YES\nouygsznbnotbouygsznbnotbouygs" }, { "input": "wtqqagwaguqgaffuqgqtwtwawtqqagwaguqgaffuqgqtwtwawtqqag", "output": "YES\nwtqqagwaguqgaffuqgqtwtwawtqqag" }, { "input": "sogoiyexpwmpaixsogoiyexpwmpaixsogoiyexpwmpaixsogoiyexpw", "output": "YES\nsogoiyexpwmpaixsogoiyexpwmpaixsogoiyexpw" }, { "input": "vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvv", "output": "YES\nvvvvvvvvvvvvvvvvvvvvvvvvvvvvv" }, { "input": "hlyjflfbvbtvtqtsjklkfsbqthvshlyjflfbvbtvtqtsjklkfsbqthvsh", "output": "YES\nhlyjflfbvbtvtqtsjklkfsbqthvsh" }, { "input": "mlymfzfkmkfjomlymfzfkmkfjomlymfzfkmkfjomlymfzfkmkfjomlymfz", "output": "YES\nmlymfzfkmkfjomlymfzfkmkfjomlymfz" }, { "input": "swylxswylxswylxswylxswylxswylxswylxswylxswylxswylxswylxswyl", "output": "YES\nswylxswylxswylxswylxswylxswylxswyl" }, { "input": "cifcifcifcifcifcifcifcifcifcifcifcifcifcifcifcifcifcifcifcif", "output": "YES\ncifcifcifcifcifcifcifcifcifcifcif" }, { "input": "lvifmwwfkvewsezsufghillvifmwwfkvewsezsufghillvifmwwfkvewsezsu", "output": "YES\nlvifmwwfkvewsezsufghillvifmwwfkvewsezsu" }, { "input": "mhgbtgdmhgbtgdmhgbtgdmhgbtgdmhgbtgdmhgbtgdmhgbtgdmhgbtgdmhgbtg", "output": "YES\nmhgbtgdmhgbtgdmhgbtgdmhgbtgdmhgbtg" }, { "input": "szfsdufuduiofckbszfsdufuduiofckbszfsdufuduiofckbszfsdufuduiofck", "output": "YES\nszfsdufuduiofckbszfsdufuduiofckbszfsdufuduiofck" }, { "input": "ceypvrszdqljkzezlcceypvrszdqljkzezlcceypvrszdqljkzezlcceypvrszdq", "output": "YES\nceypvrszdqljkzezlcceypvrszdqljkzezlcceypvrszdq" }, { "input": "ojmtpzmojamdjydojmtpzmojamdjydojmtpzmojamdjydojmtpzmojamdjydojmtp", "output": "YES\nojmtpzmojamdjydojmtpzmojamdjydojmtp" }, { "input": "uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu", "output": "YES\nuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu" }, { "input": "uhkuqbhrhlqjhgbshsvtqouquhkuqbhrhlqjhgbshsvtqouquhkuqbhrhlqjhgbshsv", "output": "YES\nuhkuqbhrhlqjhgbshsvtqouquhkuqbhrhlqjhgbshsv" }, { "input": "xcgtgdpomjvngwdtrvrttldigxcgtgdpomjvngwdtrvrttldigxcgtgdpomjvngwdtrv", "output": "YES\nxcgtgdpomjvngwdtrvrttldigxcgtgdpomjvngwdtrv" }, { "input": "vuuovdvktdjvuaafiguzdrrtratjyvuuovdvktdjvuaafiguzdrrtratjyvuuovdvktdj", "output": "YES\nvuuovdvktdjvuaafiguzdrrtratjyvuuovdvktdj" }, { "input": "yukcccrccccyukcccrccccyukcccrccccyukcccrccccyukcccrccccyukcccrccccyukc", "output": "YES\nyukcccrccccyukcccrccccyukcccrccccyukc" }, { "input": "rrriiiiaaainnrrrainniiarirrriiiiaaainnrrrainniiarirrriiiiaaainnrrrainni", "output": "YES\nrrriiiiaaainnrrrainniiarirrriiiiaaainnrrrainni" }, { "input": "xmxxumdfubrcsbccxmxxumdfubrcsbccxmxxumdfubrcsbccxmxxumdfubrcsbccxmxxumdf", "output": "YES\nxmxxumdfubrcsbccxmxxumdfubrcsbccxmxxumdf" }, { "input": "xovouvxuxtcvvovpxnhruswcphrstctxovouvxuxtcvvovpxnhruswcphrstctxovouvxuxtc", "output": "YES\nxovouvxuxtcvvovpxnhruswcphrstctxovouvxuxtc" }, { "input": "howwwscoebckiatfzarhowwwscoebckiatfzarhowwwscoebckiatfzarhowwwscoebckiatfz", "output": "YES\nhowwwscoebckiatfzarhowwwscoebckiatfzarhowwwscoebckiatfz" }, { "input": "ickpakvkbaljifqdifjfcdxpashuickpakvkbaljifqdifjfcdxpashuickpakvkbaljifqdifj", "output": "YES\nickpakvkbaljifqdifjfcdxpashuickpakvkbaljifqdifj" }, { "input": "zgzwgwggzggwzzwwwhzgzgzwgwggzggwzzwwwhzgzgzwgwggzggwzzwwwhzgzgzwgwggzggwzzww", "output": "YES\nzgzwgwggzggwzzwwwhzgzgzwgwggzggwzzwwwhzgzgzwgwggzggwzzww" }, { "input": "ppdbpyheotppdbpyheotppdbpyheotppdbpyheotppdbpyheotppdbpyheotppdbpyheotppdbpyh", "output": "YES\nppdbpyheotppdbpyheotppdbpyheotppdbpyheotppdbpyh" }, { "input": "itlmmmqfkflfamdaqekrjlocitlmmmqfkflfamdaqekrjlocitlmmmqfkflfamdaqekrjlocitlmmm", "output": "YES\nitlmmmqfkflfamdaqekrjlocitlmmmqfkflfamdaqekrjlocitlmmm" }, { "input": "yqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqy", "output": "YES\nyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqyqy" }, { "input": "ijdghvidfbqqpajplojvtlppdiftzvhuqatijdghvidfbqqpajplojvtlppdiftzvhuqatijdghvidfb", "output": "YES\nijdghvidfbqqpajplojvtlppdiftzvhuqatijdghvidfb" }, { "input": "jozbicochmmtmmhogkgrfutknpjozbicochmmtmmhogkgrfutknpjozbicochmmtmmhogkgrfutknpjoz", "output": "YES\njozbicochmmtmmhogkgrfutknpjozbicochmmtmmhogkgrfutknpjoz" }, { "input": "tvsyxhopzmbebwoimyxhjbjuyszplhhggftvsyxhopzmbebwoimyxhjbjuyszplhhggftvsyxhopzmbebw", "output": "YES\ntvsyxhopzmbebwoimyxhjbjuyszplhhggftvsyxhopzmbebw" }, { "input": "kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk", "output": "YES\nkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk" }, { "input": "zyqxlypnlpavjxuydvxcnnzszyqxlypnlpavjxuydvxcnnzszyqxlypnlpavjxuydvxcnnzszyqxlypnlpav", "output": "YES\nzyqxlypnlpavjxuydvxcnnzszyqxlypnlpavjxuydvxcnnzszyqxlypnlpav" }, { "input": "irlgpgsejirlgpgsejirlgpgsejirlgpgsejirlgpgsejirlgpgsejirlgpgsejirlgpgsejirlgpgsejirlg", "output": "YES\nirlgpgsejirlgpgsejirlgpgsejirlgpgsejirlgpgsejirlg" }, { "input": "hththththththththththththththththththththththththththththththththththththththththththt", "output": "YES\nhthththththththththththththththththththththt" }, { "input": "wlladflfanfmlljbbldamdjabtfbnftawbfnllfjwlladflfanfmlljbbldamdjabtfbnftawbfnllfjwlladfl", "output": "YES\nwlladflfanfmlljbbldamdjabtfbnftawbfnllfjwlladfl" }, { "input": "frxafrxafrxafrxafrxafrxafrxafrxafrxafrxafrxafrxafrxafrxafrxafrxafrxafrxafrxafrxafrxafrxa", "output": "YES\nfrxafrxafrxafrxafrxafrxafrxafrxafrxafrxafrxafrxa" }, { "input": "uzdcgbifcuzdcgbifcuzdcgbifcuzdcgbifcuzdcgbifcuzdcgbifcuzdcgbifcuzdcgbifcuzdcgbifcuzdcgbif", "output": "YES\nuzdcgbifcuzdcgbifcuzdcgbifcuzdcgbifcuzdcgbifcuzdcgbif" }, { "input": "dzpttoozpoqsjywqnzokdzpttoozpoqsjywqnzokdzpttoozpoqsjywqnzokdzpttoozpoqsjywqnzokdzpttoozpo", "output": "YES\ndzpttoozpoqsjywqnzokdzpttoozpoqsjywqnzokdzpttoozpo" }, { "input": "avqriqniaavqriqniaavqriqniaavqriqniaavqriqniaavqriqniaavqriqniaavqriqniaavqriqniaavqriqniaa", "output": "YES\navqriqniaavqriqniaavqriqniaavqriqniaavqriqniaa" }, { "input": "qqpppqqpqqqqqpqqpqpqqqpqpqqqqqqqpppqqpqqqqqpqqpqpqqqpqpqqqqqqqpppqqpqqqqqpqqpqpqqqpqpqqqqqqq", "output": "YES\nqqpppqqpqqqqqpqqpqpqqqpqpqqqqqqqpppqqpqqqqqpqqpqpqqqpqpqqqqqqq" }, { "input": "mnmxvxqrfnjxnmnmxvxqrfnjxnmnmxvxqrfnjxnmnmxvxqrfnjxnmnmxvxqrfnjxnmnmxvxqrfnjxnmnmxvxqrfnjxnmn", "output": "YES\nmnmxvxqrfnjxnmnmxvxqrfnjxnmnmxvxqrfnjxnmnmxvxqrfnjxnmn" }, { "input": "qzcgreoroxoxqzwvvoeiggriwrzotcxizqzcgreoroxoxqzwvvoeiggriwrzotcxizqzcgreoroxoxqzwvvoeiggriwrzo", "output": "YES\nqzcgreoroxoxqzwvvoeiggriwrzotcxizqzcgreoroxoxqzwvvoeiggriwrzo" }, { "input": "pymvkuoucpujkekgnjrvnkrvodtszsbkmoabtlgdbpymvkuoucpujkekgnjrvnkrvodtszsbkmoabtlgdbpymvkuoucpujk", "output": "YES\npymvkuoucpujkekgnjrvnkrvodtszsbkmoabtlgdbpymvkuoucpujk" }, { "input": "yguclskcmiuobsgckhotgkzqykebvttqaqmtzsyguclskcmiuobsgckhotgkzqykebvttqaqmtzsyguclskcmiuobsgckhot", "output": "YES\nyguclskcmiuobsgckhotgkzqykebvttqaqmtzsyguclskcmiuobsgckhot" }, { "input": "kowiovfyffitkipvmccesjhatgyqaekowiovfyffitkipvmccesjhatgyqaekowiovfyffitkipvmccesjhatgyqaekowiovf", "output": "YES\nkowiovfyffitkipvmccesjhatgyqaekowiovfyffitkipvmccesjhatgyqaekowiovf" }, { "input": "mrjdrepsprwlwwjewemrjdrepsprwlwwjewemrjdrepsprwlwwjewemrjdrepsprwlwwjewemrjdrepsprwlwwjewemrjdreps", "output": "YES\nmrjdrepsprwlwwjewemrjdrepsprwlwwjewemrjdrepsprwlwwjewemrjdreps" }, { "input": "hgxenqnawiyiirinhraywlhgxenqnawiyiirinhraywlhgxenqnawiyiirinhraywlhgxenqnawiyiirinhraywlhgxenqnawiy", "output": "YES\nhgxenqnawiyiirinhraywlhgxenqnawiyiirinhraywlhgxenqnawiy" }, { "input": "foxywhckxuiipgfoxywhckxuiipgfoxywhckxuiipgfoxywhckxuiipgfoxywhckxuiipgfoxywhckxuiipgfoxywhckxuiipgfo", "output": "YES\nfoxywhckxuiipgfoxywhckxuiipgfoxywhckxuiipgfoxywhckxuiipgfo" }, { "input": "bkwdegdnxtnvtczozttjitzmfienbtxhoipldptluxbtvhmybkwdegdnxtnvtczozttjitzmfienbtxhoipldptluxbtvhmybkwd", "output": "YES\nbkwdegdnxtnvtczozttjitzmfienbtxhoipldptluxbtvhmybkwd" }, { "input": "cftorbxtglokyoxsemzlysptutvldtlzqbhawyecivljlcftorbxtglokyoxsemzlysptutvldtlzqbhawyecivljlcftorbxtgl", "output": "YES\ncftorbxtglokyoxsemzlysptutvldtlzqbhawyecivljlcftorbxtgl" }, { "input": "twfflboprkkjobbgoubmybfkbmmconrjhsktwfflboprkkjobbgoubmybfkbmmconrjhsktwfflboprkkjobbgoubmybfkbmmcon", "output": "YES\ntwfflboprkkjobbgoubmybfkbmmconrjhsktwfflboprkkjobbgoubmybfkbmmcon" }, { "input": "wajaubjjlsvvatkrwphykszmkwajaubjjlsvvatkrwphykszmkwajaubjjlsvvatkrwphykszmkwajaubjjlsvvatkrwphykszmk", "output": "YES\nwajaubjjlsvvatkrwphykszmkwajaubjjlsvvatkrwphykszmkwajaubjjlsvvatkrwphykszmk" }, { "input": "pppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppp", "output": "YES\nppppppppppppppppppppppppppppppppppppppppppppppppppp" }, { "input": "axquczgfdshcpqjcqaxquczgfdshcpqjcqaxquczgfdshcpqjcqaxquczxfdshcpqjcqaxquczgfdshcpqjcqaxquc", "output": "NO" }, { "input": "vyhsqvvyhsqvvyhsqvvyhsqvvyhsqvvyhsqvvyhsqvvyhsqvvyhsqvvyhsqvvyhsqvvyhsqvvyhsqvvshsqvvyhsqvv", "output": "NO" }, { "input": "bpqxbraxrcxwdoftbpqxbraxryxwdoftbpqxbraxrcxwdoftbpqxbraxrcxwdoftbpqxbraxrcxwdoftbpqxbraxrcxw", "output": "NO" }, { "input": "renpsuotrenpsuotrenpsuotrenpsuotrenpsuotrenpsuoprenpsuotrenpsuotrenpsuotrenpsuotrenpsuotrenps", "output": "NO" }, { "input": "qqeemdmddqddkmudbmaabaedquqmqqdqqqeemdmddqddkmudbmaabaedquqmqqdqqqeemdmddqddkmudbmaabaedquqmqq", "output": "YES\nqqeemdmddqddkmudbmaabaedquqmqqdqqqeemdmddqddkmudbmaabaedquqmqq" }, { "input": "gfpiskgfpiskgfpiskgfpiskgfpiskgfpiskgfpiskgfpiskgfpiskgfpiskgfpiskgfpiskgfpiskgfpiskgfpiskgfpis", "output": "YES\ngfpiskgfpiskgfpiskgfpiskgfpiskgfpiskgfpiskgfpiskgfpis" }, { "input": "nnsssnnngsbnngnsnnbgbgnbnbnnsssnnngsbnngnsnnbgbgnbnbnnsssnnngsbnngnbnnbgbgnbnbnnsssnnngsbnngnsnn", "output": "NO" }, { "input": "qimxxxojmmjqmxqfxfqiximjxqimxxxojqmjqmxqfxfqiximjxqimxxxojmmjqmxqfxfqiximjxqimxxxojmmjqmxqfxfqixi", "output": "NO" }, { "input": "otjwmbgahamrbbhnttmoqahohbhbjxwkbtotjwmbgahamrbbhnttmoqahohbhyjxwkbtotjwmbgahamrbbhnttmoqahohbhbjx", "output": "NO" }, { "input": "hligdsxyzyjejeskxapshligdsxyzyjejeskxapshligdsxyzyjejeskxapshligdsxyzyjejeskxapshligdsxyzljejeskxap", "output": "NO" }, { "input": "ooogesrsajsnzroyhabbckrnovooogesrsajsnzroyhabbckrnovooogesrsajsnzroyhabbckrnovooogesrsajsnzroyhadbck", "output": "NO" } ]
1,458,671,345
102,545
Python 3
OK
TESTS
124
62
4,812,800
n=input() #s=n[:(len(n)-1)//2+1] c=len(n)//2 for i in range(c-1): if n[len(n)-c-1-i:]==n[:c+1+i]: print('YES') print(n[:c+i+1]) break else: print('NO')
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: В Берляндском государственном университете локальная сеть между серверами не всегда работает без ошибок. При передаче двух одинаковых сообщений подряд возможна ошибка, в результате которой эти два сообщения сливаются в одно. При таком слиянии конец первого сообщения совмещается с началом второго. Конечно, совмещение может происходить только по одинаковым символам. Длина совмещения должна быть положительным числом, меньшим длины текста сообщения. Например, при передаче двух сообщений «abrakadabra» подряд возможно, что оно будет передано с ошибкой описанного вида, и тогда будет получено сообщение вида «abrakadabrabrakadabra» или «abrakadabrakadabra» (в первом случае совмещение произошло по одному символу, а во втором — по четырем). По полученному сообщению *t* определите, возможно ли, что это результат ошибки описанного вида работы локальной сети, и если возможно, определите возможное значение *s*. Не следует считать ошибкой ситуацию полного наложения друга на друга двух сообщений. К примеру, если получено сообщение «abcd», следует считать, что в нём ошибки нет. Аналогично, простое дописывание одного сообщения вслед за другим не является признаком ошибки. Например, если получено сообщение «abcabc», следует считать, что в нём ошибки нет. Input Specification: В единственной строке выходных данных следует непустая строка *t*, состоящая из строчных букв латинского алфавита. Длина строки *t* не превосходит 100 символов. Output Specification: Если сообщение *t* не может содержать ошибки, выведите «NO» (без кавычек) в единственную строку выходных данных. В противном случае в первой строке выведите «YES» (без кавычек), а в следующей строке выведите строку *s* — возможное сообщение, которое могло привести к ошибке. Если возможных ответов несколько, разрешается вывести любой из них. Demo Input: ['abrakadabrabrakadabra\n', 'acacacaca\n', 'abcabc\n', 'abababab\n', 'tatbt\n'] Demo Output: ['YES\nabrakadabra\n', 'YES\nacaca\n', 'NO\n', 'YES\nababab\n', 'NO\n'] Note: Во втором примере подходящим ответом также является строка acacaca.
```python n=input() #s=n[:(len(n)-1)//2+1] c=len(n)//2 for i in range(c-1): if n[len(n)-c-1-i:]==n[:c+1+i]: print('YES') print(n[:c+i+1]) break else: print('NO') ```
3
862
C
Mahmoud and Ehab and the xor
PROGRAMMING
1,900
[ "constructive algorithms" ]
null
null
Mahmoud and Ehab are on the third stage of their adventures now. As you know, Dr. Evil likes sets. This time he won't show them any set from his large collection, but will ask them to create a new set to replenish his beautiful collection of sets. Dr. Evil has his favorite evil integer *x*. He asks Mahmoud and Ehab to find a set of *n* distinct non-negative integers such the bitwise-xor sum of the integers in it is exactly *x*. Dr. Evil doesn't like big numbers, so any number in the set shouldn't be greater than 106.
The only line contains two integers *n* and *x* (1<=≤<=*n*<=≤<=105, 0<=≤<=*x*<=≤<=105) — the number of elements in the set and the desired bitwise-xor, respectively.
If there is no such set, print "NO" (without quotes). Otherwise, on the first line print "YES" (without quotes) and on the second line print *n* distinct integers, denoting the elements in the set is any order. If there are multiple solutions you can print any of them.
[ "5 5\n", "3 6\n" ]
[ "YES\n1 2 4 5 7", "YES\n1 2 5" ]
You can read more about the bitwise-xor operation here: [https://en.wikipedia.org/wiki/Bitwise_operation#XOR](https://en.wikipedia.org/wiki/Bitwise_operation#XOR) For the first sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb8ccd05d3a7a41eff93c98f79d158cf85e702f9.png" style="max-width: 100.0%;max-height: 100.0%;"/>. For the second sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/d05d19f05b03f8ac89b7f86ef830eeccc0050c42.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
1,500
[ { "input": "5 5", "output": "YES\n1 2 131072 131078 0 " }, { "input": "3 6", "output": "YES\n131072 131078 0 " }, { "input": "3 0", "output": "YES\n393216 131072 262144" }, { "input": "1 0", "output": "YES\n0" }, { "input": "3 3", "output": "YES\n131072 131075 0 " }, { "input": "100000 41243", "output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..." }, { "input": "100000 100000", "output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..." }, { "input": "32 32", "output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 131072 131105 0 " }, { "input": "32 31", "output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 131072 131102 0 " }, { "input": "1 1", "output": "YES\n1" }, { "input": "2 0", "output": "NO" }, { "input": "3 1", "output": "YES\n131072 131073 0 " }, { "input": "3 2", "output": "YES\n131072 131074 0 " }, { "input": "3 5", "output": "YES\n131072 131077 0 " }, { "input": "3 4", "output": "YES\n131072 131076 0 " }, { "input": "3 10203", "output": "YES\n131072 141275 0 " }, { "input": "3 10100", "output": "YES\n131072 141172 0 " }, { "input": "5 0", "output": "YES\n1 2 131072 131075 0 " }, { "input": "5 1", "output": "YES\n1 2 131072 131074 0 " }, { "input": "5 2", "output": "YES\n1 2 131072 131073 0 " }, { "input": "5 3", "output": "YES\n1 2 393216 131072 262144" }, { "input": "5 4", "output": "YES\n1 2 131072 131079 0 " }, { "input": "5 6", "output": "YES\n1 2 131072 131077 0 " }, { "input": "5 7", "output": "YES\n1 2 131072 131076 0 " }, { "input": "5 8", "output": "YES\n1 2 131072 131083 0 " }, { "input": "5 9", "output": "YES\n1 2 131072 131082 0 " }, { "input": "100000 1", "output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..." }, { "input": "100000 0", "output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..." }, { "input": "100000 21323", "output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..." }, { "input": "100000 65536", "output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..." }, { "input": "100000 65537", "output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..." }, { "input": "100000 65535", "output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..." }, { "input": "4 2", "output": "YES\n1 131072 131075 0 " }, { "input": "10 2", "output": "YES\n1 2 3 4 5 6 7 131072 131074 0 " }, { "input": "1 2", "output": "YES\n2" }, { "input": "1 3", "output": "YES\n3" }, { "input": "2 1", "output": "YES\n0 1" }, { "input": "2 2", "output": "YES\n0 2" }, { "input": "2 3", "output": "YES\n0 3" }, { "input": "4 0", "output": "YES\n1 131072 131073 0 " }, { "input": "4 1", "output": "YES\n1 393216 131072 262144" }, { "input": "4 3", "output": "YES\n1 131072 131074 0 " }, { "input": "6 0", "output": "YES\n1 2 3 393216 131072 262144" }, { "input": "7 1", "output": "YES\n1 2 3 4 131072 131077 0 " } ]
1,535,056,449
2,147,483,647
Python 3
OK
TESTS
44
436
204,800
n, x = map(int, input().split()) if (n == 1): print("Yes") print(x) elif (n==2): if (x == 0): print("No") else: print("Yes") print(0, x) else: print("Yes") for i in range(n-3): print(i, end=' ') x ^= i print(2**18, 2**19, x^(2**18)^(2**19))
Title: Mahmoud and Ehab and the xor Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mahmoud and Ehab are on the third stage of their adventures now. As you know, Dr. Evil likes sets. This time he won't show them any set from his large collection, but will ask them to create a new set to replenish his beautiful collection of sets. Dr. Evil has his favorite evil integer *x*. He asks Mahmoud and Ehab to find a set of *n* distinct non-negative integers such the bitwise-xor sum of the integers in it is exactly *x*. Dr. Evil doesn't like big numbers, so any number in the set shouldn't be greater than 106. Input Specification: The only line contains two integers *n* and *x* (1<=≤<=*n*<=≤<=105, 0<=≤<=*x*<=≤<=105) — the number of elements in the set and the desired bitwise-xor, respectively. Output Specification: If there is no such set, print "NO" (without quotes). Otherwise, on the first line print "YES" (without quotes) and on the second line print *n* distinct integers, denoting the elements in the set is any order. If there are multiple solutions you can print any of them. Demo Input: ['5 5\n', '3 6\n'] Demo Output: ['YES\n1 2 4 5 7', 'YES\n1 2 5'] Note: You can read more about the bitwise-xor operation here: [https://en.wikipedia.org/wiki/Bitwise_operation#XOR](https://en.wikipedia.org/wiki/Bitwise_operation#XOR) For the first sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb8ccd05d3a7a41eff93c98f79d158cf85e702f9.png" style="max-width: 100.0%;max-height: 100.0%;"/>. For the second sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/d05d19f05b03f8ac89b7f86ef830eeccc0050c42.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
```python n, x = map(int, input().split()) if (n == 1): print("Yes") print(x) elif (n==2): if (x == 0): print("No") else: print("Yes") print(0, x) else: print("Yes") for i in range(n-3): print(i, end=' ') x ^= i print(2**18, 2**19, x^(2**18)^(2**19)) ```
3
859
A
Declined Finalists
PROGRAMMING
800
[ "greedy", "implementation" ]
null
null
This year, as in previous years, MemSQL is inviting the top 25 competitors from the Start[c]up qualification round to compete onsite for the final round. Not everyone who is eligible to compete onsite can afford to travel to the office, though. Initially the top 25 contestants are invited to come onsite. Each eligible contestant must either accept or decline the invitation. Whenever a contestant declines, the highest ranked contestant not yet invited is invited to take the place of the one that declined. This continues until 25 contestants have accepted invitations. After the qualifying round completes, you know *K* of the onsite finalists, as well as their qualifying ranks (which start at 1, there are no ties). Determine the minimum possible number of contestants that declined the invitation to compete onsite in the final round.
The first line of input contains *K* (1<=≤<=*K*<=≤<=25), the number of onsite finalists you know. The second line of input contains *r*1,<=*r*2,<=...,<=*r**K* (1<=≤<=*r**i*<=≤<=106), the qualifying ranks of the finalists you know. All these ranks are distinct.
Print the minimum possible number of contestants that declined the invitation to compete onsite.
[ "25\n2 3 4 5 6 7 8 9 10 11 12 14 15 16 17 18 19 20 21 22 23 24 25 26 28\n", "5\n16 23 8 15 4\n", "3\n14 15 92\n" ]
[ "3\n", "0\n", "67\n" ]
In the first example, you know all 25 onsite finalists. The contestants who ranked 1-st, 13-th, and 27-th must have declined, so the answer is 3.
500
[ { "input": "25\n2 3 4 5 6 7 8 9 10 11 12 14 15 16 17 18 19 20 21 22 23 24 25 26 28", "output": "3" }, { "input": "5\n16 23 8 15 4", "output": "0" }, { "input": "3\n14 15 92", "output": "67" }, { "input": "1\n1000000", "output": "999975" }, { "input": "25\n1000000 999999 999998 999997 999996 999995 999994 999993 999992 999991 999990 999989 999988 999987 999986 999985 999984 999983 999982 999981 999980 999979 999978 999977 999976", "output": "999975" }, { "input": "25\n13 15 24 2 21 18 9 4 16 6 10 25 20 11 23 17 8 3 1 12 5 19 22 14 7", "output": "0" }, { "input": "10\n17 11 7 13 18 12 14 5 16 2", "output": "0" }, { "input": "22\n22 14 23 20 11 21 4 12 3 8 7 9 19 10 13 17 15 1 5 18 16 2", "output": "0" }, { "input": "21\n6 21 24 3 10 23 14 2 26 12 8 1 15 13 9 5 19 20 4 16 22", "output": "1" }, { "input": "1\n1", "output": "0" }, { "input": "2\n100 60", "output": "75" }, { "input": "4\n999 581 787 236", "output": "974" }, { "input": "6\n198 397 732 1234 309 827", "output": "1209" }, { "input": "11\n6494 3961 1858 4351 8056 780 7720 6211 1961 8192 3621", "output": "8167" }, { "input": "14\n18809 9534 11652 6493 8929 9370 4125 23888 16403 3559 23649 19243 14289 17852", "output": "23863" }, { "input": "18\n24939 35558 47058 70307 26221 12866 3453 40422 47557 36322 40698 64060 10825 77777 48645 26124 4859 64222", "output": "77752" }, { "input": "24\n633483 654321 122445 481150 347578 37803 525083 151084 211073 358699 339420 452023 219553 119727 74852 66750 371279 405099 618894 649977 235337 607819 81649 649804", "output": "654296" }, { "input": "25\n58115 794098 753382 484882 238434 674285 690118 858677 196185 173301 349729 918792 600745 636016 122678 366783 137179 377098 917081 369620 449039 379412 503678 1000000 292099", "output": "999975" }, { "input": "2\n26 27", "output": "2" }, { "input": "3\n40 30 35", "output": "15" }, { "input": "2\n46 45", "output": "21" }, { "input": "3\n1 25 90", "output": "65" }, { "input": "5\n14 15 16 30 92", "output": "67" }, { "input": "2\n1000 1001", "output": "976" }, { "input": "25\n3 4 5 6 7 8 9 10 11 12 14 15 16 17 18 19 20 21 22 23 24 25 26 28 2", "output": "3" } ]
1,676,579,558
2,147,483,647
PyPy 3
OK
TESTS
25
77
0
k = int(input()) l = list(map(int, input().split())) l.sort() print(max((0, l[-1] - 25)))
Title: Declined Finalists Time Limit: None seconds Memory Limit: None megabytes Problem Description: This year, as in previous years, MemSQL is inviting the top 25 competitors from the Start[c]up qualification round to compete onsite for the final round. Not everyone who is eligible to compete onsite can afford to travel to the office, though. Initially the top 25 contestants are invited to come onsite. Each eligible contestant must either accept or decline the invitation. Whenever a contestant declines, the highest ranked contestant not yet invited is invited to take the place of the one that declined. This continues until 25 contestants have accepted invitations. After the qualifying round completes, you know *K* of the onsite finalists, as well as their qualifying ranks (which start at 1, there are no ties). Determine the minimum possible number of contestants that declined the invitation to compete onsite in the final round. Input Specification: The first line of input contains *K* (1<=≤<=*K*<=≤<=25), the number of onsite finalists you know. The second line of input contains *r*1,<=*r*2,<=...,<=*r**K* (1<=≤<=*r**i*<=≤<=106), the qualifying ranks of the finalists you know. All these ranks are distinct. Output Specification: Print the minimum possible number of contestants that declined the invitation to compete onsite. Demo Input: ['25\n2 3 4 5 6 7 8 9 10 11 12 14 15 16 17 18 19 20 21 22 23 24 25 26 28\n', '5\n16 23 8 15 4\n', '3\n14 15 92\n'] Demo Output: ['3\n', '0\n', '67\n'] Note: In the first example, you know all 25 onsite finalists. The contestants who ranked 1-st, 13-th, and 27-th must have declined, so the answer is 3.
```python k = int(input()) l = list(map(int, input().split())) l.sort() print(max((0, l[-1] - 25))) ```
3
263
A
Beautiful Matrix
PROGRAMMING
800
[ "implementation" ]
null
null
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix: 1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=&lt;<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=&lt;<=5). You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
[ "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n", "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n" ]
[ "3\n", "1\n" ]
none
500
[ { "input": "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "0" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1", "output": "4" }, { "input": "0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "4" }, { "input": "0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "4" }, { "input": "0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0", "output": "4" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0", "output": "3" } ]
1,696,861,429
2,147,483,647
Python 3
OK
TESTS
25
62
0
result = 0 row = -1 col = -1 for i in range(0 , 5): rows = input("") values = rows.split(" ") for j in range (0 , len(values)) : # num = int(input("")) if int(values[j]) == 1 : row = i col = j result = abs(row - 2) + abs(col - 2) print(result)
Title: Beautiful Matrix Time Limit: None seconds Memory Limit: None megabytes Problem Description: You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix: 1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=&lt;<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=&lt;<=5). You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful. Input Specification: The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one. Output Specification: Print a single integer — the minimum number of moves needed to make the matrix beautiful. Demo Input: ['0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n', '0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n'] Demo Output: ['3\n', '1\n'] Note: none
```python result = 0 row = -1 col = -1 for i in range(0 , 5): rows = input("") values = rows.split(" ") for j in range (0 , len(values)) : # num = int(input("")) if int(values[j]) == 1 : row = i col = j result = abs(row - 2) + abs(col - 2) print(result) ```
3
231
A
Team
PROGRAMMING
800
[ "brute force", "greedy" ]
null
null
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution. This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Print a single integer — the number of problems the friends will implement on the contest.
[ "3\n1 1 0\n1 1 1\n1 0 0\n", "2\n1 0 0\n0 1 1\n" ]
[ "2\n", "1\n" ]
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it. In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
500
[ { "input": "3\n1 1 0\n1 1 1\n1 0 0", "output": "2" }, { "input": "2\n1 0 0\n0 1 1", "output": "1" }, { "input": "1\n1 0 0", "output": "0" }, { "input": "2\n1 0 0\n1 1 1", "output": "1" }, { "input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0", "output": "1" }, { "input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0", "output": "4" }, { "input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1", "output": "10" }, { "input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1", "output": "29" }, { "input": "1\n1 1 1", "output": "1" }, { "input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1", "output": "4" }, { "input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1", "output": "16" } ]
1,696,159,485
2,147,483,647
Python 3
OK
TESTS
21
92
0
n = int(input()) sum2 = 0 for i in range(n): inp = str(input()) inp = inp.split(" ") sum1 = 0 for elt in inp: if elt =='1': sum1 +=1 if sum1>=2: sum2 +=1 print(sum2)
Title: Team Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution. This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution. Input Specification: The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces. Output Specification: Print a single integer — the number of problems the friends will implement on the contest. Demo Input: ['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n'] Demo Output: ['2\n', '1\n'] Note: In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it. In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
```python n = int(input()) sum2 = 0 for i in range(n): inp = str(input()) inp = inp.split(" ") sum1 = 0 for elt in inp: if elt =='1': sum1 +=1 if sum1>=2: sum2 +=1 print(sum2) ```
3
932
A
Palindromic Supersequence
PROGRAMMING
800
[ "constructive algorithms" ]
null
null
You are given a string *A*. Find a string *B*, where *B* is a palindrome and *A* is a subsequence of *B*. A subsequence of a string is a string that can be derived from it by deleting some (not necessarily consecutive) characters without changing the order of the remaining characters. For example, "cotst" is a subsequence of "contest". A palindrome is a string that reads the same forward or backward. The length of string *B* should be at most 104. It is guaranteed that there always exists such string. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104.
First line contains a string *A* (1<=≤<=|*A*|<=≤<=103) consisting of lowercase Latin letters, where |*A*| is a length of *A*.
Output single line containing *B* consisting of only lowercase Latin letters. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. If there are many possible *B*, print any of them.
[ "aba\n", "ab\n" ]
[ "aba", "aabaa" ]
In the first example, "aba" is a subsequence of "aba" which is a palindrome. In the second example, "ab" is a subsequence of "aabaa" which is a palindrome.
500
[ { "input": "aba", "output": "abaaba" }, { "input": "ab", "output": "abba" }, { "input": "krnyoixirslfszfqivgkaflgkctvbvksipwomqxlyqxhlbceuhbjbfnhofcgpgwdseffycthmlpcqejgskwjkbkbbmifnurnwyhevsoqzmtvzgfiqajfrgyuzxnrtxectcnlyoisbglpdbjbslxlpoymrcxmdtqhcnlvtqdwftuzgbdxsyscwbrguostbelnvtaqdmkmihmoxqtqlxvlsssisvqvvzotoyqryuyqwoknnqcqggysrqpkrccvyhxsjmhoqoyocwcriplarjoyiqrmmpmueqbsbljddwrumauczfziodpudheexalbwpiypmdjlmwtgdrzhpxneofhqzjdmurgvmrwdotuwyknlrbvuvtnhiouvqitgyfgfieonbaapyhwpcrmehxcpkijzfiayfvoxkpa", "output": "krnyoixirslfszfqivgkaflgkctvbvksipwomqxlyqxhlbceuhbjbfnhofcgpgwdseffycthmlpcqejgskwjkbkbbmifnurnwyhevsoqzmtvzgfiqajfrgyuzxnrtxectcnlyoisbglpdbjbslxlpoymrcxmdtqhcnlvtqdwftuzgbdxsyscwbrguostbelnvtaqdmkmihmoxqtqlxvlsssisvqvvzotoyqryuyqwoknnqcqggysrqpkrccvyhxsjmhoqoyocwcriplarjoyiqrmmpmueqbsbljddwrumauczfziodpudheexalbwpiypmdjlmwtgdrzhpxneofhqzjdmurgvmrwdotuwyknlrbvuvtnhiouvqitgyfgfieonbaapyhwpcrmehxcpkijzfiayfvoxkpaapkxovfyaifzjikpcxhemrcpwhypaabnoeifgfygtiqvuoihntvuvbrlnkywutodwrmvgrumdjzqhfoenxphzrdgtwmljdm..." }, { "input": "mgrfmzxqpejcixxppqgvuawutgrmezjkteofjbnrvzzkvjtacfxjjokisavsgrslryxfqgrmdsqwptajbqzvethuljbdatxghfzqrwvfgakwmoawlzqjypmhllbbuuhbpriqsnibywlgjlxowyzagrfnqafvcqwktkcjwejevzbnxhsfmwojshcdypnvbuhhuzqmgovmvgwiizatoxgblyudipahfbkewmuneoqhjmbpdtwnznblwvtjrniwlbyblhppndspojrouffazpoxtqdfpjuhitvijrohavpqatofxwmksvjcvhdecxwwmosqiczjpkfafqlboxosnjgzgdraehzdltthemeusxhiiimrdrugabnxwsygsktkcslhjebfexucsyvlwrptebkjhefsvfrmcqqdlanbetrgzwylizmrystvpgrkhlicfadco", "output": "mgrfmzxqpejcixxppqgvuawutgrmezjkteofjbnrvzzkvjtacfxjjokisavsgrslryxfqgrmdsqwptajbqzvethuljbdatxghfzqrwvfgakwmoawlzqjypmhllbbuuhbpriqsnibywlgjlxowyzagrfnqafvcqwktkcjwejevzbnxhsfmwojshcdypnvbuhhuzqmgovmvgwiizatoxgblyudipahfbkewmuneoqhjmbpdtwnznblwvtjrniwlbyblhppndspojrouffazpoxtqdfpjuhitvijrohavpqatofxwmksvjcvhdecxwwmosqiczjpkfafqlboxosnjgzgdraehzdltthemeusxhiiimrdrugabnxwsygsktkcslhjebfexucsyvlwrptebkjhefsvfrmcqqdlanbetrgzwylizmrystvpgrkhlicfadcoocdafcilhkrgpvtsyrmzilywzgrtebnaldqqcmrfvsfehjkbetprwlvyscuxef..." }, { "input": "hdmasfcjuigrwjchmjslmpynewnzpphmudzcbxzdexjuhktdtcoibzvevsmwaxakrtdfoivkvoooypyemiidadquqepxwqkesdnakxkbzrcjkgvwwxtqxvfpxcwitljyehldgsjytmekimkkndjvnzqtjykiymkmdzpwakxdtkzcqcatlevppgfhyykgmipuodjrnfjzhcmjdbzvhywprbwdcfxiffpzbjbmbyijkqnosslqbfvvicxvoeuzruraetglthgourzhfpnubzvblfzmmbgepjjyshchthulxar", "output": "hdmasfcjuigrwjchmjslmpynewnzpphmudzcbxzdexjuhktdtcoibzvevsmwaxakrtdfoivkvoooypyemiidadquqepxwqkesdnakxkbzrcjkgvwwxtqxvfpxcwitljyehldgsjytmekimkkndjvnzqtjykiymkmdzpwakxdtkzcqcatlevppgfhyykgmipuodjrnfjzhcmjdbzvhywprbwdcfxiffpzbjbmbyijkqnosslqbfvvicxvoeuzruraetglthgourzhfpnubzvblfzmmbgepjjyshchthulxarraxluhthchsyjjpegbmmzflbvzbunpfhzruoghtlgtearurzueovxcivvfbqlssonqkjiybmbjbzpffixfcdwbrpwyhvzbdjmchzjfnrjdoupimgkyyhfgppveltacqczktdxkawpzdmkmyikyjtqznvjdnkkmikemtyjsgdlheyjltiwcxpfvxqtxwwvgkjcrzbkxkandsekqwxpequ..." }, { "input": "fggbyzobbmxtwdajawqdywnppflkkmtxzjvxopqvliwdwhzepcuiwelhbuotlkvesexnwkytonfrpqcxzzqzdvsmbsjcxxeugavekozfjlolrtqgwzqxsfgrnvrgfrqpixhsskbpzghndesvwptpvvkasfalzsetopervpwzmkgpcexqnvtnoulprwnowmsorscecvvvrjfwumcjqyrounqsgdruxttvtmrkivtxauhosokdiahsyrftzsgvgyveqwkzhqstbgywrvmsgfcfyuxpphvmyydzpohgdicoxbtjnsbyhoidnkrialowvlvmjpxcfeygqzphmbcjkupojsmmuqlydixbaluwezvnfasjfxilbyllwyipsmovdzosuwotcxerzcfuvxprtziseshjfcosalyqglpotxvxaanpocypsiyazsejjoximnbvqucftuvdksaxutvjeunodbipsumlaymjnzljurefjg", "output": "fggbyzobbmxtwdajawqdywnppflkkmtxzjvxopqvliwdwhzepcuiwelhbuotlkvesexnwkytonfrpqcxzzqzdvsmbsjcxxeugavekozfjlolrtqgwzqxsfgrnvrgfrqpixhsskbpzghndesvwptpvvkasfalzsetopervpwzmkgpcexqnvtnoulprwnowmsorscecvvvrjfwumcjqyrounqsgdruxttvtmrkivtxauhosokdiahsyrftzsgvgyveqwkzhqstbgywrvmsgfcfyuxpphvmyydzpohgdicoxbtjnsbyhoidnkrialowvlvmjpxcfeygqzphmbcjkupojsmmuqlydixbaluwezvnfasjfxilbyllwyipsmovdzosuwotcxerzcfuvxprtziseshjfcosalyqglpotxvxaanpocypsiyazsejjoximnbvqucftuvdksaxutvjeunodbipsumlaymjnzljurefjggjferujlznjmyalmuspib..." }, { "input": "qyyxqkbxsvfnjzttdqmpzinbdgayllxpfrpopwciejjjzadguurnnhvixgueukugkkjyghxknedojvmdrskswiotgatsajowionuiumuhyggjuoympuxyfahwftwufvocdguxmxabbxnfviscxtilzzauizsgugwcqtbqgoosefhkumhodwpgolfdkbuiwlzjydonwbgyzzrjwxnceltqgqelrrljmzdbftmaogiuosaqhngmdzxzlmyrwefzhqawmkdckfnyyjgdjgadtfjvrkdwysqofcgyqrnyzutycvspzbjmmesobvhshtqlrytztyieknnkporrbcmlopgtknlmsstzkigreqwgsvagmvbrvwypoxttmzzsgm", "output": "qyyxqkbxsvfnjzttdqmpzinbdgayllxpfrpopwciejjjzadguurnnhvixgueukugkkjyghxknedojvmdrskswiotgatsajowionuiumuhyggjuoympuxyfahwftwufvocdguxmxabbxnfviscxtilzzauizsgugwcqtbqgoosefhkumhodwpgolfdkbuiwlzjydonwbgyzzrjwxnceltqgqelrrljmzdbftmaogiuosaqhngmdzxzlmyrwefzhqawmkdckfnyyjgdjgadtfjvrkdwysqofcgyqrnyzutycvspzbjmmesobvhshtqlrytztyieknnkporrbcmlopgtknlmsstzkigreqwgsvagmvbrvwypoxttmzzsgmmgszzmttxopywvrbvmgavsgwqergikztssmlnktgpolmcbrropknnkeiytztyrlqthshvbosemmjbzpsvcytuzynrqygcfoqsywdkrvjftdagjdgjyynfkcdkmwaqhzfewry..." }, { "input": "scvlhflaqvniyiyofonowwcuqajuwscdrzhbvasymvqfnthzvtjcfuaftrbjghhvslcohwpxkggrbtatjtgehuqtorwinwvrtdldyoeeozxwippuahgkuehvsmyqtodqvlufqqmqautaqirvwzvtodzxtgxiinubhrbeoiybidutrqamsdnasctxatzkvkjkrmavdravnsxyngjlugwftmhmcvvxdbfndurrbmcpuoigjpssqcortmqoqttrabhoqvopjkxvpbqdqsilvlplhgqazauyvnodsxtwnomlinjpozwhrgrkqwmlwcwdkxjxjftexiavwrejvdjcfptterblxysjcheesyqsbgdrzjxbfjqgjgmvccqcyj", "output": "scvlhflaqvniyiyofonowwcuqajuwscdrzhbvasymvqfnthzvtjcfuaftrbjghhvslcohwpxkggrbtatjtgehuqtorwinwvrtdldyoeeozxwippuahgkuehvsmyqtodqvlufqqmqautaqirvwzvtodzxtgxiinubhrbeoiybidutrqamsdnasctxatzkvkjkrmavdravnsxyngjlugwftmhmcvvxdbfndurrbmcpuoigjpssqcortmqoqttrabhoqvopjkxvpbqdqsilvlplhgqazauyvnodsxtwnomlinjpozwhrgrkqwmlwcwdkxjxjftexiavwrejvdjcfptterblxysjcheesyqsbgdrzjxbfjqgjgmvccqcyjjycqccvmgjgqjfbxjzrdgbsqyseehcjsyxlbrettpfcjdvjerwvaixetfjxjxkdwcwlmwqkrgrhwzopjnilmonwtxsdonvyuazaqghlplvlisqdqbpvxkjpovqohbarttqoqm..." }, { "input": "oohkqxxtvxzmvfjjxyjwlbqmeqwwlienzkdbhswgfbkhfygltsucdijozwaiewpixapyazfztksjeoqjugjfhdbqzuezbuajfvvffkwprroyivfoocvslejffgxuiofisenroxoeixmdbzonmreikpflciwsbafrdqfvdfojgoziiibqhwwsvhnzmptgirqqulkgmyzrfekzqqujmdumxkudsgexisupedisgmdgebvlvrpyfrbrqjknrxyzfpwmsxjxismgd", "output": "oohkqxxtvxzmvfjjxyjwlbqmeqwwlienzkdbhswgfbkhfygltsucdijozwaiewpixapyazfztksjeoqjugjfhdbqzuezbuajfvvffkwprroyivfoocvslejffgxuiofisenroxoeixmdbzonmreikpflciwsbafrdqfvdfojgoziiibqhwwsvhnzmptgirqqulkgmyzrfekzqqujmdumxkudsgexisupedisgmdgebvlvrpyfrbrqjknrxyzfpwmsxjxismgddgmsixjxsmwpfzyxrnkjqrbrfyprvlvbegdmgsidepusixegsdukxmudmjuqqzkefrzymgkluqqrigtpmznhvswwhqbiiizogjofdvfqdrfabswiclfpkiermnozbdmxieoxornesifoiuxgffjelsvcoofviyorrpwkffvvfjaubzeuzqbdhfjgujqoejsktzfzaypaxipweiawzojidcustlgyfhkbfgwshbdkzneilwwqemqblw..." }, { "input": "gilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlwzjyeyfktduzdjnivcldjjarfzmmdbyytvipbbnjqolfnlqjpidotxxfobgtgpvjmpddcyddwdcjsxxumuoyznhpvpqccgqnuouzojntanfwctthcgynrukcvshsuuqrxfdvqqggaatwytikkitywtaaggqqvdfxrquushsvckurnygchttcwfnatnjozuounqgccqpvphnzyoumuxxsjcdwddycddpmjvpgtgbofxxtodipjqlnfloqjnbbpivtyybdmmzfrajjdlcvinjdzudtkfyeyjzwlzcnrgkdxrnjwyfwtnzawmeljknllaqhrgdagttixpljuupcivnlejkemrqnafdigjzxiohlig", "output": "gilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlwzjyeyfktduzdjnivcldjjarfzmmdbyytvipbbnjqolfnlqjpidotxxfobgtgpvjmpddcyddwdcjsxxumuoyznhpvpqccgqnuouzojntanfwctthcgynrukcvshsuuqrxfdvqqggaatwytikkitywtaaggqqvdfxrquushsvckurnygchttcwfnatnjozuounqgccqpvphnzyoumuxxsjcdwddycddpmjvpgtgbofxxtodipjqlnfloqjnbbpivtyybdmmzfrajjdlcvinjdzudtkfyeyjzwlzcnrgkdxrnjwyfwtnzawmeljknllaqhrgdagttixpljuupcivnlejkemrqnafdigjzxiohliggilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlw..." }, { "input": "abcab", "output": "abcabbacba" }, { "input": "baaaaaaa", "output": "baaaaaaaaaaaaaab" }, { "input": "baaaaaa", "output": "baaaaaaaaaaaab" }, { "input": "baaaaaaaaa", "output": "baaaaaaaaaaaaaaaaaab" }, { "input": "baaaaaaaa", "output": "baaaaaaaaaaaaaaaab" } ]
1,586,165,154
2,147,483,647
PyPy 3
OK
TESTS
48
140
0
# Problem URL: https://codeforces.com/problemset/problem/932/A a = input() print(a+"".join(reversed(a)))
Title: Palindromic Supersequence Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a string *A*. Find a string *B*, where *B* is a palindrome and *A* is a subsequence of *B*. A subsequence of a string is a string that can be derived from it by deleting some (not necessarily consecutive) characters without changing the order of the remaining characters. For example, "cotst" is a subsequence of "contest". A palindrome is a string that reads the same forward or backward. The length of string *B* should be at most 104. It is guaranteed that there always exists such string. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. Input Specification: First line contains a string *A* (1<=≤<=|*A*|<=≤<=103) consisting of lowercase Latin letters, where |*A*| is a length of *A*. Output Specification: Output single line containing *B* consisting of only lowercase Latin letters. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. If there are many possible *B*, print any of them. Demo Input: ['aba\n', 'ab\n'] Demo Output: ['aba', 'aabaa'] Note: In the first example, "aba" is a subsequence of "aba" which is a palindrome. In the second example, "ab" is a subsequence of "aabaa" which is a palindrome.
```python # Problem URL: https://codeforces.com/problemset/problem/932/A a = input() print(a+"".join(reversed(a))) ```
3
25
A
IQ test
PROGRAMMING
1,300
[ "brute force" ]
A. IQ test
2
256
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
[ "5\n2 4 7 8 10\n", "4\n1 2 1 1\n" ]
[ "3\n", "2\n" ]
none
0
[ { "input": "5\n2 4 7 8 10", "output": "3" }, { "input": "4\n1 2 1 1", "output": "2" }, { "input": "3\n1 2 2", "output": "1" }, { "input": "3\n100 99 100", "output": "2" }, { "input": "3\n5 3 2", "output": "3" }, { "input": "4\n43 28 1 91", "output": "2" }, { "input": "4\n75 13 94 77", "output": "3" }, { "input": "4\n97 8 27 3", "output": "2" }, { "input": "10\n95 51 12 91 85 3 1 31 25 7", "output": "3" }, { "input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46", "output": "4" }, { "input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36", "output": "26" }, { "input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83", "output": "48" }, { "input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25", "output": "1" }, { "input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46", "output": "25" }, { "input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73", "output": "13" }, { "input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76", "output": "99" }, { "input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14", "output": "1" }, { "input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22", "output": "93" }, { "input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23", "output": "1" }, { "input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98", "output": "1" }, { "input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94", "output": "93" }, { "input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29", "output": "32" }, { "input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47", "output": "26" }, { "input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72", "output": "56" }, { "input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86", "output": "97" }, { "input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42", "output": "79" }, { "input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52", "output": "25" }, { "input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86", "output": "78" }, { "input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68", "output": "70" }, { "input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81", "output": "39" }, { "input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83", "output": "88" }, { "input": "3\n100 100 1", "output": "3" } ]
1,648,077,479
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
60
0
x = input() x = input().split() x = [i % 2 for i in x] t = sum(x) if t != 1: for i in range(len(x)): if x[i] != 0: print(i + 1) else: for i in range(len(x)): if x[i] == 1: print(i + 1)
Title: IQ test Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness. Input Specification: The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness. Output Specification: Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order. Demo Input: ['5\n2 4 7 8 10\n', '4\n1 2 1 1\n'] Demo Output: ['3\n', '2\n'] Note: none
```python x = input() x = input().split() x = [i % 2 for i in x] t = sum(x) if t != 1: for i in range(len(x)): if x[i] != 0: print(i + 1) else: for i in range(len(x)): if x[i] == 1: print(i + 1) ```
-1
622
B
The Time
PROGRAMMING
900
[ "implementation" ]
null
null
You are given the current time in 24-hour format hh:mm. Find and print the time after *a* minutes. Note that you should find only the time after *a* minutes, see the examples to clarify the problem statement. You can read more about 24-hour format here [https://en.wikipedia.org/wiki/24-hour_clock](https://en.wikipedia.org/wiki/24-hour_clock).
The first line contains the current time in the format hh:mm (0<=≤<=*hh*<=&lt;<=24,<=0<=≤<=*mm*<=&lt;<=60). The hours and the minutes are given with two digits (the hours or the minutes less than 10 are given with the leading zeroes). The second line contains integer *a* (0<=≤<=*a*<=≤<=104) — the number of the minutes passed.
The only line should contain the time after *a* minutes in the format described in the input. Note that you should print exactly two digits for the hours and the minutes (add leading zeroes to the numbers if needed). See the examples to check the input/output format.
[ "23:59\n10\n", "20:20\n121\n", "10:10\n0\n" ]
[ "00:09\n", "22:21\n", "10:10\n" ]
none
0
[ { "input": "23:59\n10", "output": "00:09" }, { "input": "20:20\n121", "output": "22:21" }, { "input": "10:10\n0", "output": "10:10" }, { "input": "12:34\n10000", "output": "11:14" }, { "input": "00:00\n10000", "output": "22:40" }, { "input": "00:00\n1440", "output": "00:00" }, { "input": "23:59\n8640", "output": "23:59" }, { "input": "10:01\n0", "output": "10:01" }, { "input": "04:05\n0", "output": "04:05" }, { "input": "02:59\n1", "output": "03:00" }, { "input": "05:15\n10", "output": "05:25" }, { "input": "03:10\n20", "output": "03:30" }, { "input": "09:11\n0", "output": "09:11" }, { "input": "19:00\n0", "output": "19:00" }, { "input": "23:59\n1", "output": "00:00" }, { "input": "11:59\n1", "output": "12:00" }, { "input": "19:34\n566", "output": "05:00" }, { "input": "00:01\n59", "output": "01:00" }, { "input": "03:30\n0", "output": "03:30" }, { "input": "22:30\n30", "output": "23:00" }, { "input": "22:50\n70", "output": "00:00" }, { "input": "05:12\n0", "output": "05:12" }, { "input": "09:20\n40", "output": "10:00" }, { "input": "15:04\n36", "output": "15:40" }, { "input": "05:37\n23", "output": "06:00" }, { "input": "23:59\n59", "output": "00:58" }, { "input": "21:09\n9997", "output": "19:46" }, { "input": "11:00\n1", "output": "11:01" }, { "input": "20:01\n2699", "output": "17:00" }, { "input": "01:00\n59", "output": "01:59" }, { "input": "07:09\n6538", "output": "20:07" }, { "input": "00:00\n10", "output": "00:10" }, { "input": "02:09\n2074", "output": "12:43" }, { "input": "01:10\n1", "output": "01:11" }, { "input": "23:01\n59", "output": "00:00" }, { "input": "08:50\n20", "output": "09:10" }, { "input": "13:18\n5121", "output": "02:39" }, { "input": "18:31\n2677", "output": "15:08" }, { "input": "14:17\n108", "output": "16:05" }, { "input": "02:45\n5617", "output": "00:22" }, { "input": "00:00\n3600", "output": "12:00" }, { "input": "19:01\n59", "output": "20:00" }, { "input": "19:02\n59", "output": "20:01" }, { "input": "14:00\n2880", "output": "14:00" }, { "input": "01:10\n44", "output": "01:54" }, { "input": "02:01\n59", "output": "03:00" }, { "input": "07:02\n121", "output": "09:03" }, { "input": "10:00\n61", "output": "11:01" }, { "input": "23:59\n61", "output": "01:00" }, { "input": "00:00\n0", "output": "00:00" }, { "input": "23:59\n121", "output": "02:00" }, { "input": "00:00\n60", "output": "01:00" }, { "input": "15:52\n60", "output": "16:52" }, { "input": "00:39\n6525", "output": "13:24" }, { "input": "00:30\n30", "output": "01:00" }, { "input": "00:59\n1", "output": "01:00" }, { "input": "00:55\n4321", "output": "00:56" }, { "input": "10:05\n1", "output": "10:06" }, { "input": "23:00\n60", "output": "00:00" } ]
1,623,851,512
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
46
0
h,m=map(int,input().split(":")) ad=int(input()) ad=ad+m+h*60 h=ad//60 m=ad%60 print(f"{h:02d}:{m:02d}")
Title: The Time Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given the current time in 24-hour format hh:mm. Find and print the time after *a* minutes. Note that you should find only the time after *a* minutes, see the examples to clarify the problem statement. You can read more about 24-hour format here [https://en.wikipedia.org/wiki/24-hour_clock](https://en.wikipedia.org/wiki/24-hour_clock). Input Specification: The first line contains the current time in the format hh:mm (0<=≤<=*hh*<=&lt;<=24,<=0<=≤<=*mm*<=&lt;<=60). The hours and the minutes are given with two digits (the hours or the minutes less than 10 are given with the leading zeroes). The second line contains integer *a* (0<=≤<=*a*<=≤<=104) — the number of the minutes passed. Output Specification: The only line should contain the time after *a* minutes in the format described in the input. Note that you should print exactly two digits for the hours and the minutes (add leading zeroes to the numbers if needed). See the examples to check the input/output format. Demo Input: ['23:59\n10\n', '20:20\n121\n', '10:10\n0\n'] Demo Output: ['00:09\n', '22:21\n', '10:10\n'] Note: none
```python h,m=map(int,input().split(":")) ad=int(input()) ad=ad+m+h*60 h=ad//60 m=ad%60 print(f"{h:02d}:{m:02d}") ```
0
622
C
Not Equal on a Segment
PROGRAMMING
1,700
[ "data structures", "implementation" ]
null
null
You are given array *a* with *n* integers and *m* queries. The *i*-th query is given with three integers *l**i*,<=*r**i*,<=*x**i*. For the *i*-th query find any position *p**i* (*l**i*<=≤<=*p**i*<=≤<=*r**i*) so that *a**p**i*<=≠<=*x**i*.
The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=2·105) — the number of elements in *a* and the number of queries. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=106) — the elements of the array *a*. Each of the next *m* lines contains three integers *l**i*,<=*r**i*,<=*x**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*,<=1<=≤<=*x**i*<=≤<=106) — the parameters of the *i*-th query.
Print *m* lines. On the *i*-th line print integer *p**i* — the position of any number not equal to *x**i* in segment [*l**i*,<=*r**i*] or the value <=-<=1 if there is no such number.
[ "6 4\n1 2 1 1 3 5\n1 4 1\n2 6 2\n3 4 1\n3 4 2\n" ]
[ "2\n6\n-1\n4\n" ]
none
0
[ { "input": "6 4\n1 2 1 1 3 5\n1 4 1\n2 6 2\n3 4 1\n3 4 2", "output": "2\n6\n-1\n4" }, { "input": "1 1\n1\n1 1 1", "output": "-1" }, { "input": "1 1\n2\n1 1 2", "output": "-1" }, { "input": "1 1\n569888\n1 1 967368", "output": "1" }, { "input": "10 10\n1 1 1 1 1 1 1 1 1 1\n3 10 1\n3 6 1\n1 8 1\n1 7 1\n1 5 1\n3 7 1\n4 7 1\n9 9 1\n6 7 1\n3 4 1", "output": "-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1" }, { "input": "10 10\n1 2 2 2 2 1 1 2 1 1\n3 3 1\n4 9 1\n4 8 1\n2 7 2\n2 8 2\n3 10 1\n7 7 2\n10 10 2\n1 5 1\n1 2 1", "output": "3\n8\n8\n7\n7\n8\n7\n10\n5\n2" }, { "input": "10 10\n318890 307761 832732 700511 820583 522866 130891 914566 128429 739710\n4 9 178864\n6 9 741003\n4 9 172997\n4 6 314469\n1 4 694802\n8 8 401658\n7 10 376243\n7 8 508771\n3 5 30038\n2 10 591490", "output": "9\n9\n9\n6\n4\n8\n10\n8\n5\n10" }, { "input": "1 1\n2\n1 1 1", "output": "1" }, { "input": "10 10\n1 1 1 1 1 2 1 1 1 1\n1 9 1\n6 7 1\n2 4 1\n7 8 1\n1 3 1\n10 10 1\n3 5 1\n6 7 1\n1 10 1\n6 6 1", "output": "6\n6\n-1\n-1\n-1\n-1\n-1\n6\n6\n6" }, { "input": "7 1\n2 1 3 2 2 2 2\n1 7 2", "output": "3" }, { "input": "4 1\n3 1 2 2\n1 4 2", "output": "2" }, { "input": "6 1\n3 2 4 3 3 3\n1 6 3", "output": "3" }, { "input": "4 1\n1 3 2 2\n1 4 2", "output": "2" }, { "input": "5 1\n2 3 1 2 2\n1 5 2", "output": "3" }, { "input": "3 1\n1 9 5\n1 3 5", "output": "2" }, { "input": "4 1\n4 2 6 4\n1 4 4", "output": "3" }, { "input": "2 1\n1 3\n1 2 2", "output": "2" }, { "input": "10 1\n2 2 1 3 2 2 2 2 2 2\n2 5 2", "output": "4" }, { "input": "7 1\n6 5 7 6 6 6 6\n1 7 6", "output": "3" }, { "input": "3 1\n2 4 3\n1 3 3", "output": "2" }, { "input": "4 1\n4 2 3 3\n1 4 3", "output": "2" }, { "input": "5 1\n3 2 4 5 5\n1 3 3", "output": "3" }, { "input": "2 6\n1 1\n1 1 1\n1 1 2\n1 2 1\n1 2 2\n2 2 1\n2 2 2", "output": "-1\n1\n-1\n2\n-1\n2" } ]
1,626,202,480
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
61
6,963,200
m,n=map(int,input().split()) arr=list(map(int,input().split())) for i in range(0,n): l,r,x=map(int,input().split()) arr1=arr[l-1:r] set1=list(set(arr1)) count=0 if(x not in arr1): print(l) elif(len(set1)==1 and set1[0]==x): print(-1) else: if(arr[l-1]!=x): print(l) elif(arr[r-1]!=x): print(r) elif(arr[int((l+r-1)/2)]!=x): print(int((l+r-1)/2)) else: for i in range(l-1,r): if(arr[i]!=x): print(i) break elif(arr[r-i-1]): print(r-i-1) break
Title: Not Equal on a Segment Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given array *a* with *n* integers and *m* queries. The *i*-th query is given with three integers *l**i*,<=*r**i*,<=*x**i*. For the *i*-th query find any position *p**i* (*l**i*<=≤<=*p**i*<=≤<=*r**i*) so that *a**p**i*<=≠<=*x**i*. Input Specification: The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=2·105) — the number of elements in *a* and the number of queries. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=106) — the elements of the array *a*. Each of the next *m* lines contains three integers *l**i*,<=*r**i*,<=*x**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*,<=1<=≤<=*x**i*<=≤<=106) — the parameters of the *i*-th query. Output Specification: Print *m* lines. On the *i*-th line print integer *p**i* — the position of any number not equal to *x**i* in segment [*l**i*,<=*r**i*] or the value <=-<=1 if there is no such number. Demo Input: ['6 4\n1 2 1 1 3 5\n1 4 1\n2 6 2\n3 4 1\n3 4 2\n'] Demo Output: ['2\n6\n-1\n4\n'] Note: none
```python m,n=map(int,input().split()) arr=list(map(int,input().split())) for i in range(0,n): l,r,x=map(int,input().split()) arr1=arr[l-1:r] set1=list(set(arr1)) count=0 if(x not in arr1): print(l) elif(len(set1)==1 and set1[0]==x): print(-1) else: if(arr[l-1]!=x): print(l) elif(arr[r-1]!=x): print(r) elif(arr[int((l+r-1)/2)]!=x): print(int((l+r-1)/2)) else: for i in range(l-1,r): if(arr[i]!=x): print(i) break elif(arr[r-i-1]): print(r-i-1) break ```
0
104
A
Blackjack
PROGRAMMING
800
[ "implementation" ]
A. Blackjack
2
256
One rainy gloomy evening when all modules hid in the nearby cafes to drink hot energetic cocktails, the Hexadecimal virus decided to fly over the Mainframe to look for a Great Idea. And she has found one! Why not make her own Codeforces, with blackjack and other really cool stuff? Many people will surely be willing to visit this splendid shrine of high culture. In Mainframe a standard pack of 52 cards is used to play blackjack. The pack contains cards of 13 values: 2, 3, 4, 5, 6, 7, 8, 9, 10, jacks, queens, kings and aces. Each value also exists in one of four suits: hearts, diamonds, clubs and spades. Also, each card earns some value in points assigned to it: cards with value from two to ten earn from 2 to 10 points, correspondingly. An ace can either earn 1 or 11, whatever the player wishes. The picture cards (king, queen and jack) earn 10 points. The number of points a card earns does not depend on the suit. The rules of the game are very simple. The player gets two cards, if the sum of points of those cards equals *n*, then the player wins, otherwise the player loses. The player has already got the first card, it's the queen of spades. To evaluate chances for victory, you should determine how many ways there are to get the second card so that the sum of points exactly equals *n*.
The only line contains *n* (1<=≤<=*n*<=≤<=25) — the required sum of points.
Print the numbers of ways to get the second card in the required way if the first card is the queen of spades.
[ "12\n", "20\n", "10\n" ]
[ "4", "15", "0" ]
In the first sample only four two's of different suits can earn the required sum of points. In the second sample we can use all tens, jacks, queens and kings; overall it's 15 cards, as the queen of spades (as any other card) is only present once in the pack of cards and it's already in use. In the third sample there is no card, that would add a zero to the current ten points.
500
[ { "input": "12", "output": "4" }, { "input": "20", "output": "15" }, { "input": "10", "output": "0" }, { "input": "11", "output": "4" }, { "input": "15", "output": "4" }, { "input": "18", "output": "4" }, { "input": "25", "output": "0" }, { "input": "22", "output": "0" }, { "input": "1", "output": "0" }, { "input": "2", "output": "0" }, { "input": "3", "output": "0" }, { "input": "4", "output": "0" }, { "input": "5", "output": "0" }, { "input": "6", "output": "0" }, { "input": "7", "output": "0" }, { "input": "8", "output": "0" }, { "input": "9", "output": "0" }, { "input": "13", "output": "4" }, { "input": "14", "output": "4" }, { "input": "16", "output": "4" }, { "input": "17", "output": "4" }, { "input": "19", "output": "4" }, { "input": "21", "output": "4" }, { "input": "23", "output": "0" }, { "input": "24", "output": "0" } ]
1,615,475,029
2,147,483,647
Python 3
OK
TESTS
25
124
0
n=int(input()) n-=10 cards=[2,3,4,5,6,7,8,9,10,10,10,1,11] if(n==0): print('0') else: cnt=0 for x in cards: if(x==n): cnt+=4 if(n==10): cnt+=3 print(cnt)
Title: Blackjack Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: One rainy gloomy evening when all modules hid in the nearby cafes to drink hot energetic cocktails, the Hexadecimal virus decided to fly over the Mainframe to look for a Great Idea. And she has found one! Why not make her own Codeforces, with blackjack and other really cool stuff? Many people will surely be willing to visit this splendid shrine of high culture. In Mainframe a standard pack of 52 cards is used to play blackjack. The pack contains cards of 13 values: 2, 3, 4, 5, 6, 7, 8, 9, 10, jacks, queens, kings and aces. Each value also exists in one of four suits: hearts, diamonds, clubs and spades. Also, each card earns some value in points assigned to it: cards with value from two to ten earn from 2 to 10 points, correspondingly. An ace can either earn 1 or 11, whatever the player wishes. The picture cards (king, queen and jack) earn 10 points. The number of points a card earns does not depend on the suit. The rules of the game are very simple. The player gets two cards, if the sum of points of those cards equals *n*, then the player wins, otherwise the player loses. The player has already got the first card, it's the queen of spades. To evaluate chances for victory, you should determine how many ways there are to get the second card so that the sum of points exactly equals *n*. Input Specification: The only line contains *n* (1<=≤<=*n*<=≤<=25) — the required sum of points. Output Specification: Print the numbers of ways to get the second card in the required way if the first card is the queen of spades. Demo Input: ['12\n', '20\n', '10\n'] Demo Output: ['4', '15', '0'] Note: In the first sample only four two's of different suits can earn the required sum of points. In the second sample we can use all tens, jacks, queens and kings; overall it's 15 cards, as the queen of spades (as any other card) is only present once in the pack of cards and it's already in use. In the third sample there is no card, that would add a zero to the current ten points.
```python n=int(input()) n-=10 cards=[2,3,4,5,6,7,8,9,10,10,10,1,11] if(n==0): print('0') else: cnt=0 for x in cards: if(x==n): cnt+=4 if(n==10): cnt+=3 print(cnt) ```
3.969
394
A
Counting Sticks
PROGRAMMING
0
[ "brute force", "implementation" ]
null
null
When new students come to the Specialized Educational and Scientific Centre (SESC) they need to start many things from the beginning. Sometimes the teachers say (not always unfairly) that we cannot even count. So our teachers decided to teach us arithmetics from the start. And what is the best way to teach students add and subtract? — That's right, using counting sticks! An here's our new task: An expression of counting sticks is an expression of type: Sign + consists of two crossed sticks: one vertical and one horizontal. Sign = consists of two horizontal sticks. The expression is arithmetically correct if *A*<=+<=*B*<==<=*C*. We've got an expression that looks like *A*<=+<=*B*<==<=*C* given by counting sticks. Our task is to shift at most one stick (or we can shift nothing) so that the expression became arithmetically correct. Note that we cannot remove the sticks from the expression, also we cannot shift the sticks from the signs + and =. We really aren't fabulous at arithmetics. Can you help us?
The single line contains the initial expression. It is guaranteed that the expression looks like *A*<=+<=*B*<==<=*C*, where 1<=≤<=*A*,<=*B*,<=*C*<=≤<=100.
If there isn't a way to shift the stick so the expression becomes correct, print on a single line "Impossible" (without the quotes). If there is a way, print the resulting expression. Follow the format of the output from the test samples. Don't print extra space characters. If there are multiple correct answers, print any of them. For clarifications, you are recommended to see the test samples.
[ "||+|=|||||\n", "|||||+||=||\n", "|+|=||||||\n", "||||+||=||||||\n" ]
[ "|||+|=||||\n", "Impossible\n", "Impossible\n", "||||+||=||||||\n" ]
In the first sample we can shift stick from the third group of sticks to the first one. In the second sample we cannot shift vertical stick from + sign to the second group of sticks. So we cannot make a - sign. There is no answer in the third sample because we cannot remove sticks from the expression. In the forth sample the initial expression is already arithmetically correct and that is why we don't have to shift sticks.
500
[ { "input": "||+|=|||||", "output": "|||+|=||||" }, { "input": "|||||+||=||", "output": "Impossible" }, { "input": "|+|=||||||", "output": "Impossible" }, { "input": "||||+||=||||||", "output": "||||+||=||||||" }, { "input": "||||||||||||+|||||||||||=||||||||||||||||||||||", "output": "Impossible" }, { "input": "||||||||||||||||||+||||||||||||||||||=||||||||||||||||||||||||||||||||||||||||||", "output": "Impossible" }, { "input": "|||||||||||||||||||||||||||||||||||||||||||||||||+|||||||||||||||||||||||||=|||||||||||||||||||||||||", "output": "Impossible" }, { "input": "||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||+|=|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||", "output": "|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||+|=||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||" }, { "input": "|+|=|", "output": "Impossible" }, { "input": "||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||+|||||||||||||||||||||=||||||||||||||||||||||||||||||||||||||||||||||||||", "output": "Impossible" }, { "input": "|||||||||||||||||||||||||||||||||||||||||+||||||||||||||||||||||||||||||||||||||||||=||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||", "output": "Impossible" }, { "input": "|||||||||||||||||||||||||||||||||||||||||+|||||||||||||||||||||||||||||||||||||||||=|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||", "output": "Impossible" }, { "input": "|||||||||||||||||||||||||||||||||||||||||||+|||||||||||||||||||||||||||||||||||||||||||=|", "output": "Impossible" }, { "input": "||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||+||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||=|", "output": "Impossible" }, { "input": "||||||||||||||||||||||||||||||||||||||||||||||||+||||||||||||||||||||||||||||||||||||||||||||||||||=||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||", "output": "|||||||||||||||||||||||||||||||||||||||||||||||||+||||||||||||||||||||||||||||||||||||||||||||||||||=|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||" }, { "input": "||||||||||||||||||||||||||||||||||||||||||||||||||+||||||||||||||||||||||||||||||||||||||||||||||||=||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||", "output": "|||||||||||||||||||||||||||||||||||||||||||||||||||+||||||||||||||||||||||||||||||||||||||||||||||||=|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||" }, { "input": "||||||||||||||||||||||||||||||||||||||||||||||||||+||||||||||||||||||||||||||||||||||||||||||||||||||=|", "output": "Impossible" }, { "input": "|||||||||||||||||||||||||||||||||||||||||||||||||||+|||||||||||||||||||||||||||||||||||||||||||||||||=|", "output": "Impossible" }, { "input": "||+||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||=||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||", "output": "|+||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||=|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||" }, { "input": "||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||+||=||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||", "output": "|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||+||=|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||" }, { "input": "||+|=|", "output": "|+|=||" }, { "input": "|+||=|", "output": "|+|=||" }, { "input": "|+|=||", "output": "|+|=||" }, { "input": "|||+|=|", "output": "Impossible" }, { "input": "|||+|=|", "output": "Impossible" }, { "input": "|||||||||||||||||||||||||||||||||||||||||||||||||||+|||||||||||||||||||||||||||||||||||||||||||||||||||=||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||", "output": "||||||||||||||||||||||||||||||||||||||||||||||||||+|||||||||||||||||||||||||||||||||||||||||||||||||||=|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||" }, { "input": "||+||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||=||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||", "output": "|+||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||=|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||" }, { "input": "||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||+||||||||||||||||||||||||||||||||||||=|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||", "output": "Impossible" }, { "input": "|+|=|||", "output": "Impossible" }, { "input": "|+|=||||", "output": "||+|=|||" }, { "input": "|+||=|", "output": "|+|=||" }, { "input": "|+||||||=|||||", "output": "|+|||||=||||||" }, { "input": "|+|||=||", "output": "|+||=|||" }, { "input": "|+||||=|||", "output": "|+|||=||||" }, { "input": "|+|||||=||||", "output": "|+||||=|||||" }, { "input": "||+||=||", "output": "|+||=|||" }, { "input": "||+|||=|||", "output": "|+|||=||||" }, { "input": "|||||+||=||||||||||", "output": "Impossible" }, { "input": "|||+|||=||||", "output": "||+|||=|||||" }, { "input": "||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||+||=||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||", "output": "|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||+||=|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||" }, { "input": "|||||+|||||=||||||||||||", "output": "||||||+|||||=|||||||||||" }, { "input": "||+|||||||=|||||||", "output": "|+|||||||=||||||||" }, { "input": "||||+||||=||||||", "output": "|||+||||=|||||||" }, { "input": "||||+|||=|||||", "output": "|||+|||=||||||" }, { "input": "||+|||=|||||||", "output": "|||+|||=||||||" }, { "input": "||+|=|", "output": "|+|=||" }, { "input": "|||+|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||=||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||", "output": "||+|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||=|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||" }, { "input": "||+|=||||||", "output": "Impossible" }, { "input": "||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||+||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||=||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||", "output": "Impossible" } ]
1,579,801,816
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
7
109
0
n = input() l1, l2, r = n.replace("=", "+").split("+") if len(l1) + len(l2) == len(r): print(n) elif len(l1) + len(l2) + 1 == len(r) - 1: print(l1 + "|" + "+" + l2 + "=" + r[1:]) else: print("Impossible")
Title: Counting Sticks Time Limit: None seconds Memory Limit: None megabytes Problem Description: When new students come to the Specialized Educational and Scientific Centre (SESC) they need to start many things from the beginning. Sometimes the teachers say (not always unfairly) that we cannot even count. So our teachers decided to teach us arithmetics from the start. And what is the best way to teach students add and subtract? — That's right, using counting sticks! An here's our new task: An expression of counting sticks is an expression of type: Sign + consists of two crossed sticks: one vertical and one horizontal. Sign = consists of two horizontal sticks. The expression is arithmetically correct if *A*<=+<=*B*<==<=*C*. We've got an expression that looks like *A*<=+<=*B*<==<=*C* given by counting sticks. Our task is to shift at most one stick (or we can shift nothing) so that the expression became arithmetically correct. Note that we cannot remove the sticks from the expression, also we cannot shift the sticks from the signs + and =. We really aren't fabulous at arithmetics. Can you help us? Input Specification: The single line contains the initial expression. It is guaranteed that the expression looks like *A*<=+<=*B*<==<=*C*, where 1<=≤<=*A*,<=*B*,<=*C*<=≤<=100. Output Specification: If there isn't a way to shift the stick so the expression becomes correct, print on a single line "Impossible" (without the quotes). If there is a way, print the resulting expression. Follow the format of the output from the test samples. Don't print extra space characters. If there are multiple correct answers, print any of them. For clarifications, you are recommended to see the test samples. Demo Input: ['||+|=|||||\n', '|||||+||=||\n', '|+|=||||||\n', '||||+||=||||||\n'] Demo Output: ['|||+|=||||\n', 'Impossible\n', 'Impossible\n', '||||+||=||||||\n'] Note: In the first sample we can shift stick from the third group of sticks to the first one. In the second sample we cannot shift vertical stick from + sign to the second group of sticks. So we cannot make a - sign. There is no answer in the third sample because we cannot remove sticks from the expression. In the forth sample the initial expression is already arithmetically correct and that is why we don't have to shift sticks.
```python n = input() l1, l2, r = n.replace("=", "+").split("+") if len(l1) + len(l2) == len(r): print(n) elif len(l1) + len(l2) + 1 == len(r) - 1: print(l1 + "|" + "+" + l2 + "=" + r[1:]) else: print("Impossible") ```
0
340
A
The Wall
PROGRAMMING
1,200
[ "math" ]
null
null
Iahub and his friend Floyd have started painting a wall. Iahub is painting the wall red and Floyd is painting it pink. You can consider the wall being made of a very large number of bricks, numbered 1, 2, 3 and so on. Iahub has the following scheme of painting: he skips *x*<=-<=1 consecutive bricks, then he paints the *x*-th one. That is, he'll paint bricks *x*, 2·*x*, 3·*x* and so on red. Similarly, Floyd skips *y*<=-<=1 consecutive bricks, then he paints the *y*-th one. Hence he'll paint bricks *y*, 2·*y*, 3·*y* and so on pink. After painting the wall all day, the boys observed that some bricks are painted both red and pink. Iahub has a lucky number *a* and Floyd has a lucky number *b*. Boys wonder how many bricks numbered no less than *a* and no greater than *b* are painted both red and pink. This is exactly your task: compute and print the answer to the question.
The input will have a single line containing four integers in this order: *x*, *y*, *a*, *b*. (1<=≤<=*x*,<=*y*<=≤<=1000, 1<=≤<=*a*,<=*b*<=≤<=2·109, *a*<=≤<=*b*).
Output a single integer — the number of bricks numbered no less than *a* and no greater than *b* that are painted both red and pink.
[ "2 3 6 18\n" ]
[ "3" ]
Let's look at the bricks from *a* to *b* (*a* = 6, *b* = 18). The bricks colored in red are numbered 6, 8, 10, 12, 14, 16, 18. The bricks colored in pink are numbered 6, 9, 12, 15, 18. The bricks colored in both red and pink are numbered with 6, 12 and 18.
500
[ { "input": "2 3 6 18", "output": "3" }, { "input": "4 6 20 201", "output": "15" }, { "input": "15 27 100 10000", "output": "74" }, { "input": "105 60 3456 78910", "output": "179" }, { "input": "1 1 1000 100000", "output": "99001" }, { "input": "3 2 5 5", "output": "0" }, { "input": "555 777 1 1000000", "output": "257" }, { "input": "1000 1000 1 32323", "output": "32" }, { "input": "45 125 93451125 100000000", "output": "5821" }, { "input": "101 171 1 1000000000", "output": "57900" }, { "input": "165 255 69696 1000000000", "output": "356482" }, { "input": "555 777 666013 1000000000", "output": "257229" }, { "input": "23 46 123321 900000000", "output": "19562537" }, { "input": "321 123 15 1000000", "output": "75" }, { "input": "819 1000 9532 152901000", "output": "186" }, { "input": "819 1000 10000 1000000", "output": "1" }, { "input": "1 1 1 1", "output": "1" }, { "input": "1 2 2 1000003", "output": "500001" }, { "input": "1 1 1 1000000000", "output": "1000000000" }, { "input": "10 15 69 195610342", "output": "6520342" }, { "input": "2 1 1 1000000000", "output": "500000000" }, { "input": "1000 1000 1 20", "output": "0" }, { "input": "1 1 1 2000000000", "output": "2000000000" }, { "input": "1 2 1 2000000000", "output": "1000000000" }, { "input": "2 1 1 2000000000", "output": "1000000000" }, { "input": "2 3 1 1000000000", "output": "166666666" }, { "input": "2 3 1 2000000000", "output": "333333333" }, { "input": "3 7 1 1000000000", "output": "47619047" }, { "input": "1 1 1000000000 2000000000", "output": "1000000001" }, { "input": "2 2 1 2000000000", "output": "1000000000" }, { "input": "1 1 2 2000000000", "output": "1999999999" }, { "input": "3 2 1 2000000000", "output": "333333333" }, { "input": "1 1 2000000000 2000000000", "output": "1" }, { "input": "2 3 7 7", "output": "0" }, { "input": "3 3 3 7", "output": "2" } ]
1,610,472,123
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
1
154
0
from math import gcd x, y, a, b = map(int, input().split()) num = (x * y) // gcd(x, y) diff = b - a ans = diff // num - 1 if a % num == 0: ans += 1 if b % num == 0: ans += 1 print(ans)
Title: The Wall Time Limit: None seconds Memory Limit: None megabytes Problem Description: Iahub and his friend Floyd have started painting a wall. Iahub is painting the wall red and Floyd is painting it pink. You can consider the wall being made of a very large number of bricks, numbered 1, 2, 3 and so on. Iahub has the following scheme of painting: he skips *x*<=-<=1 consecutive bricks, then he paints the *x*-th one. That is, he'll paint bricks *x*, 2·*x*, 3·*x* and so on red. Similarly, Floyd skips *y*<=-<=1 consecutive bricks, then he paints the *y*-th one. Hence he'll paint bricks *y*, 2·*y*, 3·*y* and so on pink. After painting the wall all day, the boys observed that some bricks are painted both red and pink. Iahub has a lucky number *a* and Floyd has a lucky number *b*. Boys wonder how many bricks numbered no less than *a* and no greater than *b* are painted both red and pink. This is exactly your task: compute and print the answer to the question. Input Specification: The input will have a single line containing four integers in this order: *x*, *y*, *a*, *b*. (1<=≤<=*x*,<=*y*<=≤<=1000, 1<=≤<=*a*,<=*b*<=≤<=2·109, *a*<=≤<=*b*). Output Specification: Output a single integer — the number of bricks numbered no less than *a* and no greater than *b* that are painted both red and pink. Demo Input: ['2 3 6 18\n'] Demo Output: ['3'] Note: Let's look at the bricks from *a* to *b* (*a* = 6, *b* = 18). The bricks colored in red are numbered 6, 8, 10, 12, 14, 16, 18. The bricks colored in pink are numbered 6, 9, 12, 15, 18. The bricks colored in both red and pink are numbered with 6, 12 and 18.
```python from math import gcd x, y, a, b = map(int, input().split()) num = (x * y) // gcd(x, y) diff = b - a ans = diff // num - 1 if a % num == 0: ans += 1 if b % num == 0: ans += 1 print(ans) ```
0
841
B
Godsend
PROGRAMMING
1,100
[ "games", "math" ]
null
null
Leha somehow found an array consisting of *n* integers. Looking at it, he came up with a task. Two players play the game on the array. Players move one by one. The first player can choose for his move a subsegment of non-zero length with an odd sum of numbers and remove it from the array, after that the remaining parts are glued together into one array and the game continues. The second player can choose a subsegment of non-zero length with an even sum and remove it. Loses the one who can not make a move. Who will win if both play optimally?
First line of input data contains single integer *n* (1<=≤<=*n*<=≤<=106) — length of the array. Next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109).
Output answer in single line. "First", if first player wins, and "Second" otherwise (without quotes).
[ "4\n1 3 2 3\n", "2\n2 2\n" ]
[ "First\n", "Second\n" ]
In first sample first player remove whole array in one move and win. In second sample first player can't make a move and lose.
1,000
[ { "input": "4\n1 3 2 3", "output": "First" }, { "input": "2\n2 2", "output": "Second" }, { "input": "4\n2 4 6 8", "output": "Second" }, { "input": "5\n1 1 1 1 1", "output": "First" }, { "input": "4\n720074544 345031254 849487632 80870826", "output": "Second" }, { "input": "1\n0", "output": "Second" }, { "input": "1\n999999999", "output": "First" }, { "input": "2\n1 999999999", "output": "First" }, { "input": "4\n3 3 4 4", "output": "First" }, { "input": "2\n1 2", "output": "First" }, { "input": "8\n2 2 2 1 1 2 2 2", "output": "First" }, { "input": "5\n3 3 2 2 2", "output": "First" }, { "input": "4\n0 1 1 0", "output": "First" }, { "input": "3\n1 2 2", "output": "First" }, { "input": "6\n2 2 1 1 4 2", "output": "First" }, { "input": "8\n2 2 2 3 3 2 2 2", "output": "First" }, { "input": "4\n2 3 3 4", "output": "First" }, { "input": "10\n2 2 2 2 3 1 2 2 2 2", "output": "First" }, { "input": "6\n2 2 1 1 2 2", "output": "First" }, { "input": "3\n1 1 2", "output": "First" }, { "input": "6\n2 4 3 3 4 6", "output": "First" }, { "input": "6\n4 4 3 3 4 4", "output": "First" }, { "input": "4\n1 1 2 2", "output": "First" }, { "input": "4\n1 3 5 7", "output": "First" }, { "input": "4\n2 1 1 2", "output": "First" }, { "input": "4\n1 3 3 2", "output": "First" }, { "input": "5\n3 2 2 2 2", "output": "First" }, { "input": "3\n2 1 1", "output": "First" }, { "input": "4\n1000000000 1000000000 1000000000 99999999", "output": "First" }, { "input": "4\n2 2 1 1", "output": "First" }, { "input": "5\n2 3 2 3 2", "output": "First" }, { "input": "1\n1", "output": "First" }, { "input": "4\n1000000000 1000000000 1000000000 1", "output": "First" }, { "input": "5\n2 2 2 1 1", "output": "First" }, { "input": "6\n2 1 1 1 1 2", "output": "First" }, { "input": "6\n1 2 2 2 2 1", "output": "First" }, { "input": "11\n2 2 2 2 2 1 2 2 2 2 2", "output": "First" }, { "input": "5\n1 3 2 2 2", "output": "First" }, { "input": "3\n2 3 2", "output": "First" }, { "input": "2\n1 1", "output": "First" }, { "input": "5\n4 4 4 3 3", "output": "First" }, { "input": "5\n3 3 4 4 4", "output": "First" }, { "input": "1\n2", "output": "Second" } ]
1,584,688,244
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
77
0
n=int(input()) a=list(map(int,input().split())) o=0 for i in range(n): if a[i]%2!=0: o+=1 if o%2==0: print("SECOND") else: print("FIRST")
Title: Godsend Time Limit: None seconds Memory Limit: None megabytes Problem Description: Leha somehow found an array consisting of *n* integers. Looking at it, he came up with a task. Two players play the game on the array. Players move one by one. The first player can choose for his move a subsegment of non-zero length with an odd sum of numbers and remove it from the array, after that the remaining parts are glued together into one array and the game continues. The second player can choose a subsegment of non-zero length with an even sum and remove it. Loses the one who can not make a move. Who will win if both play optimally? Input Specification: First line of input data contains single integer *n* (1<=≤<=*n*<=≤<=106) — length of the array. Next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109). Output Specification: Output answer in single line. "First", if first player wins, and "Second" otherwise (without quotes). Demo Input: ['4\n1 3 2 3\n', '2\n2 2\n'] Demo Output: ['First\n', 'Second\n'] Note: In first sample first player remove whole array in one move and win. In second sample first player can't make a move and lose.
```python n=int(input()) a=list(map(int,input().split())) o=0 for i in range(n): if a[i]%2!=0: o+=1 if o%2==0: print("SECOND") else: print("FIRST") ```
0
779
C
Dishonest Sellers
PROGRAMMING
1,200
[ "constructive algorithms", "greedy", "sortings" ]
null
null
Igor found out discounts in a shop and decided to buy *n* items. Discounts at the store will last for a week and Igor knows about each item that its price now is *a**i*, and after a week of discounts its price will be *b**i*. Not all of sellers are honest, so now some products could be more expensive than after a week of discounts. Igor decided that buy at least *k* of items now, but wait with the rest of the week in order to save money as much as possible. Your task is to determine the minimum money that Igor can spend to buy all *n* items.
In the first line there are two positive integer numbers *n* and *k* (1<=≤<=*n*<=≤<=2·105, 0<=≤<=*k*<=≤<=*n*) — total number of items to buy and minimal number of items Igor wants to by right now. The second line contains sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) — prices of items during discounts (i.e. right now). The third line contains sequence of integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=104) — prices of items after discounts (i.e. after a week).
Print the minimal amount of money Igor will spend to buy all *n* items. Remember, he should buy at least *k* items right now.
[ "3 1\n5 4 6\n3 1 5\n", "5 3\n3 4 7 10 3\n4 5 5 12 5\n" ]
[ "10\n", "25\n" ]
In the first example Igor should buy item 3 paying 6. But items 1 and 2 he should buy after a week. He will pay 3 and 1 for them. So in total he will pay 6 + 3 + 1 = 10. In the second example Igor should buy right now items 1, 2, 4 and 5, paying for them 3, 4, 10 and 3, respectively. Item 3 he should buy after a week of discounts, he will pay 5 for it. In total he will spend 3 + 4 + 10 + 3 + 5 = 25.
1,000
[ { "input": "3 1\n5 4 6\n3 1 5", "output": "10" }, { "input": "5 3\n3 4 7 10 3\n4 5 5 12 5", "output": "25" }, { "input": "1 0\n9\n8", "output": "8" }, { "input": "2 0\n4 10\n1 2", "output": "3" }, { "input": "4 2\n19 5 17 13\n3 18 8 10", "output": "29" }, { "input": "5 3\n28 17 20 45 45\n39 12 41 27 9", "output": "101" }, { "input": "10 5\n87 96 19 81 10 88 7 49 36 21\n11 75 28 28 74 17 64 19 81 31", "output": "243" }, { "input": "50 45\n80 125 152 122 85 62 123 195 157 73 8 127 47 193 70 132 131 38 98 97 185 98 68 166 114 53 144 106 141 106 191 123 44 199 35 18 84 169 46 52 129 102 155 130 63 169 116 145 154 41\n155 187 79 106 136 173 17 146 9 47 173 21 37 183 110 74 185 14 82 156 147 25 162 195 26 25 22 80 171 180 7 92 53 18 100 17 159 184 37 127 116 192 163 49 94 95 118 102 8 30", "output": "4680" }, { "input": "5 2\n1 1 1 1 1\n2 2 2 2 2", "output": "5" }, { "input": "5 2\n2 4 4 4 4\n3 1 1 1 1", "output": "9" }, { "input": "6 3\n9 9 9 2 2 2\n6 6 6 1 1 1", "output": "24" }, { "input": "5 3\n10 17 23 26 35\n7 18 18 29 32", "output": "103" }, { "input": "2 1\n10 12\n5 6", "output": "16" } ]
1,561,548,384
2,147,483,647
Python 3
OK
TESTS
67
545
24,678,400
n,k=map(int,input().split()) a=list(map(int,input().split())) b=list(map(int,input().split())) c=list(zip(a,b)) c=sorted(c,key=lambda d:d[0]-d[1]) sum=0 i=0 co=0 while(i<len(a)): if(c[i][0]<=c[i][1]): sum+=c[i][0] co+=1 elif(co>=k): sum+=c[i][1] co+=1 else: sum+=c[i][0] co+=1 i+=1 print(sum)
Title: Dishonest Sellers Time Limit: None seconds Memory Limit: None megabytes Problem Description: Igor found out discounts in a shop and decided to buy *n* items. Discounts at the store will last for a week and Igor knows about each item that its price now is *a**i*, and after a week of discounts its price will be *b**i*. Not all of sellers are honest, so now some products could be more expensive than after a week of discounts. Igor decided that buy at least *k* of items now, but wait with the rest of the week in order to save money as much as possible. Your task is to determine the minimum money that Igor can spend to buy all *n* items. Input Specification: In the first line there are two positive integer numbers *n* and *k* (1<=≤<=*n*<=≤<=2·105, 0<=≤<=*k*<=≤<=*n*) — total number of items to buy and minimal number of items Igor wants to by right now. The second line contains sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) — prices of items during discounts (i.e. right now). The third line contains sequence of integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=104) — prices of items after discounts (i.e. after a week). Output Specification: Print the minimal amount of money Igor will spend to buy all *n* items. Remember, he should buy at least *k* items right now. Demo Input: ['3 1\n5 4 6\n3 1 5\n', '5 3\n3 4 7 10 3\n4 5 5 12 5\n'] Demo Output: ['10\n', '25\n'] Note: In the first example Igor should buy item 3 paying 6. But items 1 and 2 he should buy after a week. He will pay 3 and 1 for them. So in total he will pay 6 + 3 + 1 = 10. In the second example Igor should buy right now items 1, 2, 4 and 5, paying for them 3, 4, 10 and 3, respectively. Item 3 he should buy after a week of discounts, he will pay 5 for it. In total he will spend 3 + 4 + 10 + 3 + 5 = 25.
```python n,k=map(int,input().split()) a=list(map(int,input().split())) b=list(map(int,input().split())) c=list(zip(a,b)) c=sorted(c,key=lambda d:d[0]-d[1]) sum=0 i=0 co=0 while(i<len(a)): if(c[i][0]<=c[i][1]): sum+=c[i][0] co+=1 elif(co>=k): sum+=c[i][1] co+=1 else: sum+=c[i][0] co+=1 i+=1 print(sum) ```
3
29
C
Mail Stamps
PROGRAMMING
1,700
[ "data structures", "dfs and similar", "graphs", "implementation" ]
C. Mail Stamps
2
256
One day Bob got a letter in an envelope. Bob knows that when Berland's post officers send a letter directly from city «A» to city «B», they stamp it with «A B», or «B A». Unfortunately, often it is impossible to send a letter directly from the city of the sender to the city of the receiver, that's why the letter is sent via some intermediate cities. Post officers never send a letter in such a way that the route of this letter contains some city more than once. Bob is sure that the post officers stamp the letters accurately. There are *n* stamps on the envelope of Bob's letter. He understands that the possible routes of this letter are only two. But the stamps are numerous, and Bob can't determine himself none of these routes. That's why he asks you to help him. Find one of the possible routes of the letter.
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — amount of mail stamps on the envelope. Then there follow *n* lines with two integers each — description of the stamps. Each stamp is described with indexes of the cities between which a letter is sent. The indexes of cities are integers from 1 to 109. Indexes of all the cities are different. Every time the letter is sent from one city to another, exactly one stamp is put on the envelope. It is guaranteed that the given stamps correspond to some valid route from some city to some other city.
Output *n*<=+<=1 numbers — indexes of cities in one of the two possible routes of the letter.
[ "2\n1 100\n100 2\n", "3\n3 1\n100 2\n3 2\n" ]
[ "2 100 1 ", "100 2 3 1 " ]
none
1,500
[ { "input": "2\n1 100\n100 2", "output": "2 100 1 " }, { "input": "3\n3 1\n100 2\n3 2", "output": "100 2 3 1 " }, { "input": "3\n458744979 589655889\n248228386 824699605\n458744979 824699605", "output": "589655889 458744979 824699605 248228386 " }, { "input": "4\n90104473 221011623\n18773664 221011623\n90104473 74427905\n74427905 186329050", "output": "186329050 74427905 90104473 221011623 18773664 " }, { "input": "5\n695442143 421284135\n641835294 542627184\n852367357 120042890\n641835294 852367357\n542627184 421284135", "output": "695442143 421284135 542627184 641835294 852367357 120042890 " }, { "input": "6\n264896923 2497658\n57071588 447086061\n2497658 483723090\n57071588 264896923\n158310110 483723090\n158310110 72866107", "output": "447086061 57071588 264896923 2497658 483723090 158310110 72866107 " }, { "input": "1\n1 1000000000", "output": "1000000000 1 " }, { "input": "1\n1000000000 999999999", "output": "1000000000 999999999 " }, { "input": "10\n661239801 721746596\n225324231 116454751\n687002568 865423160\n799202882 865423160\n661239801 116454751\n387882517 687002568\n748798833 721746596\n179630172 225324231\n945958362 387882517\n179630172 945958362", "output": "799202882 865423160 687002568 387882517 945958362 179630172 225324231 116454751 661239801 721746596 748798833 " }, { "input": "21\n280810160 291988863\n760364563 140163983\n16417017 364832782\n400253359 677358550\n597688496 794948223\n400253359 603304541\n589408417 603304541\n385039298 307729574\n293170375 805849550\n140163983 219301181\n732214548 760364563\n307729574 280810160\n131915938 219301181\n4615652 347722938\n396478457 805849550\n16417017 732214548\n4615652 677358550\n131915938 589408417\n291988863 364832782\n396478457 794948223\n385039298 597688496", "output": "347722938 4615652 677358550 400253359 603304541 589408417 131915938 219301181 140163983 760364563 732214548 16417017 364832782 291988863 280810160 307729574 385039298 597688496 794948223 396478457 805849550 293170375 " }, { "input": "1\n2105127 227379126", "output": "227379126 2105127 " } ]
1,637,993,204
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
1
124
0
# Author Name: Ajay Meena # Codeforce : https://codeforces.com/profile/majay1638 import sys import math import bisect import heapq from bisect import bisect_right from sys import stdin, stdout # -------------- INPUT FUNCTIONS ------------------ def get_ints_in_variables(): return map( int, sys.stdin.readline().strip().split()) def get_int(): return int(sys.stdin.readline()) def get_ints_in_list(): return list( map(int, sys.stdin.readline().strip().split())) def get_list_of_list(n): return [list( map(int, sys.stdin.readline().strip().split())) for _ in range(n)] def get_string(): return sys.stdin.readline().strip() # -------- SOME CUSTOMIZED FUNCTIONS----------- def myceil(x, y): return (x + y - 1) // y # -------------- SOLUTION FUNCTION ------------------ def dfs(graph, n, node, visited, ans): if not node in graph: return ans.append(node) visited[node] = True for child in graph[node]: if child in visited: continue dfs(graph, n, child, visited, ans) def Solution(graph, n): # Write Your Code Here ans = [] visited = {} for key in graph: dfs(graph, n, key, visited, ans) break print(*ans) def main(): # Take input Here and Call solution function n = get_int() graph = {} for _ in range(n): x, y = get_ints_in_variables() if x in graph: graph[x].append(y) else: graph[x] = [y] if y in graph: graph[y].append(x) else: graph[y] = [x] # print(graph) Solution(graph, n) # calling main Function if __name__ == '__main__': main()
Title: Mail Stamps Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: One day Bob got a letter in an envelope. Bob knows that when Berland's post officers send a letter directly from city «A» to city «B», they stamp it with «A B», or «B A». Unfortunately, often it is impossible to send a letter directly from the city of the sender to the city of the receiver, that's why the letter is sent via some intermediate cities. Post officers never send a letter in such a way that the route of this letter contains some city more than once. Bob is sure that the post officers stamp the letters accurately. There are *n* stamps on the envelope of Bob's letter. He understands that the possible routes of this letter are only two. But the stamps are numerous, and Bob can't determine himself none of these routes. That's why he asks you to help him. Find one of the possible routes of the letter. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — amount of mail stamps on the envelope. Then there follow *n* lines with two integers each — description of the stamps. Each stamp is described with indexes of the cities between which a letter is sent. The indexes of cities are integers from 1 to 109. Indexes of all the cities are different. Every time the letter is sent from one city to another, exactly one stamp is put on the envelope. It is guaranteed that the given stamps correspond to some valid route from some city to some other city. Output Specification: Output *n*<=+<=1 numbers — indexes of cities in one of the two possible routes of the letter. Demo Input: ['2\n1 100\n100 2\n', '3\n3 1\n100 2\n3 2\n'] Demo Output: ['2 100 1 ', '100 2 3 1 '] Note: none
```python # Author Name: Ajay Meena # Codeforce : https://codeforces.com/profile/majay1638 import sys import math import bisect import heapq from bisect import bisect_right from sys import stdin, stdout # -------------- INPUT FUNCTIONS ------------------ def get_ints_in_variables(): return map( int, sys.stdin.readline().strip().split()) def get_int(): return int(sys.stdin.readline()) def get_ints_in_list(): return list( map(int, sys.stdin.readline().strip().split())) def get_list_of_list(n): return [list( map(int, sys.stdin.readline().strip().split())) for _ in range(n)] def get_string(): return sys.stdin.readline().strip() # -------- SOME CUSTOMIZED FUNCTIONS----------- def myceil(x, y): return (x + y - 1) // y # -------------- SOLUTION FUNCTION ------------------ def dfs(graph, n, node, visited, ans): if not node in graph: return ans.append(node) visited[node] = True for child in graph[node]: if child in visited: continue dfs(graph, n, child, visited, ans) def Solution(graph, n): # Write Your Code Here ans = [] visited = {} for key in graph: dfs(graph, n, key, visited, ans) break print(*ans) def main(): # Take input Here and Call solution function n = get_int() graph = {} for _ in range(n): x, y = get_ints_in_variables() if x in graph: graph[x].append(y) else: graph[x] = [y] if y in graph: graph[y].append(x) else: graph[y] = [x] # print(graph) Solution(graph, n) # calling main Function if __name__ == '__main__': main() ```
0
13
A
Numbers
PROGRAMMING
1,000
[ "implementation", "math" ]
A. Numbers
1
64
Little Petya likes numbers a lot. He found that number 123 in base 16 consists of two digits: the first is 7 and the second is 11. So the sum of digits of 123 in base 16 is equal to 18. Now he wonders what is an average value of sum of digits of the number *A* written in all bases from 2 to *A*<=-<=1. Note that all computations should be done in base 10. You should find the result as an irreducible fraction, written in base 10.
Input contains one integer number *A* (3<=≤<=*A*<=≤<=1000).
Output should contain required average value in format «X/Y», where X is the numerator and Y is the denominator.
[ "5\n", "3\n" ]
[ "7/3\n", "2/1\n" ]
In the first sample number 5 written in all bases from 2 to 4 looks so: 101, 12, 11. Sums of digits are 2, 3 and 2, respectively.
0
[ { "input": "5", "output": "7/3" }, { "input": "3", "output": "2/1" }, { "input": "1000", "output": "90132/499" }, { "input": "927", "output": "155449/925" }, { "input": "260", "output": "6265/129" }, { "input": "131", "output": "3370/129" }, { "input": "386", "output": "857/12" }, { "input": "277", "output": "2864/55" }, { "input": "766", "output": "53217/382" }, { "input": "28", "output": "85/13" }, { "input": "406", "output": "7560/101" }, { "input": "757", "output": "103847/755" }, { "input": "6", "output": "9/4" }, { "input": "239", "output": "10885/237" }, { "input": "322", "output": "2399/40" }, { "input": "98", "output": "317/16" }, { "input": "208", "output": "4063/103" }, { "input": "786", "output": "55777/392" }, { "input": "879", "output": "140290/877" }, { "input": "702", "output": "89217/700" }, { "input": "948", "output": "7369/43" }, { "input": "537", "output": "52753/535" }, { "input": "984", "output": "174589/982" }, { "input": "934", "output": "157951/932" }, { "input": "726", "output": "95491/724" }, { "input": "127", "output": "3154/125" }, { "input": "504", "output": "23086/251" }, { "input": "125", "output": "3080/123" }, { "input": "604", "output": "33178/301" }, { "input": "115", "output": "2600/113" }, { "input": "27", "output": "167/25" }, { "input": "687", "output": "85854/685" }, { "input": "880", "output": "69915/439" }, { "input": "173", "output": "640/19" }, { "input": "264", "output": "6438/131" }, { "input": "785", "output": "111560/783" }, { "input": "399", "output": "29399/397" }, { "input": "514", "output": "6031/64" }, { "input": "381", "output": "26717/379" }, { "input": "592", "output": "63769/590" }, { "input": "417", "output": "32002/415" }, { "input": "588", "output": "62723/586" }, { "input": "852", "output": "131069/850" }, { "input": "959", "output": "5059/29" }, { "input": "841", "output": "127737/839" }, { "input": "733", "output": "97598/731" }, { "input": "692", "output": "87017/690" }, { "input": "69", "output": "983/67" }, { "input": "223", "output": "556/13" }, { "input": "93", "output": "246/13" }, { "input": "643", "output": "75503/641" }, { "input": "119", "output": "2833/117" }, { "input": "498", "output": "1459/16" }, { "input": "155", "output": "4637/153" }, { "input": "305", "output": "17350/303" }, { "input": "454", "output": "37893/452" }, { "input": "88", "output": "1529/86" }, { "input": "850", "output": "32645/212" }, { "input": "474", "output": "20581/236" }, { "input": "309", "output": "17731/307" }, { "input": "762", "output": "105083/760" }, { "input": "591", "output": "63761/589" }, { "input": "457", "output": "38317/455" }, { "input": "141", "output": "3832/139" }, { "input": "385", "output": "27232/383" }, { "input": "387", "output": "27628/385" }, { "input": "469", "output": "40306/467" }, { "input": "624", "output": "35285/311" }, { "input": "330", "output": "487/8" }, { "input": "31", "output": "222/29" }, { "input": "975", "output": "171679/973" }, { "input": "584", "output": "62183/582" }, { "input": "668", "output": "81127/666" }, { "input": "331", "output": "20297/329" }, { "input": "189", "output": "6789/187" }, { "input": "251", "output": "11939/249" }, { "input": "876", "output": "69196/437" }, { "input": "615", "output": "68987/613" }, { "input": "451", "output": "37258/449" }, { "input": "499", "output": "45727/497" }, { "input": "699", "output": "89117/697" }, { "input": "619", "output": "70019/617" }, { "input": "413", "output": "10515/137" }, { "input": "197", "output": "7399/195" }, { "input": "794", "output": "14281/99" }, { "input": "659", "output": "79403/657" }, { "input": "653", "output": "77695/651" }, { "input": "23", "output": "45/7" }, { "input": "430", "output": "16985/214" }, { "input": "249", "output": "11659/247" }, { "input": "837", "output": "126869/835" }, { "input": "258", "output": "12373/256" }, { "input": "995", "output": "59665/331" }, { "input": "102", "output": "504/25" }, { "input": "989", "output": "177124/987" }, { "input": "376", "output": "13008/187" }, { "input": "657", "output": "15715/131" }, { "input": "746", "output": "50509/372" }, { "input": "602", "output": "13177/120" } ]
1,549,544,076
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
186
0
__author__ = 'NIORLYS' def gcd(a, b): if b == 0: return a return gcd(b, a % b) def sum_of_digits_base_b(a, b): if a < b: return a return sum_of_digits_base_b(a // b, b) + a % b n = int(input()) sum_of_digits_all_bases = 0 for i in range(2, n): sum_of_digits_all_bases += sum_of_digits_base_b(n, i) print(str(sum_of_digits_all_bases // gcd(sum_of_digits_all_bases, n - 2)) + '/' + str( n - 2 // gcd(sum_of_digits_all_bases, n - 2)))
Title: Numbers Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: Little Petya likes numbers a lot. He found that number 123 in base 16 consists of two digits: the first is 7 and the second is 11. So the sum of digits of 123 in base 16 is equal to 18. Now he wonders what is an average value of sum of digits of the number *A* written in all bases from 2 to *A*<=-<=1. Note that all computations should be done in base 10. You should find the result as an irreducible fraction, written in base 10. Input Specification: Input contains one integer number *A* (3<=≤<=*A*<=≤<=1000). Output Specification: Output should contain required average value in format «X/Y», where X is the numerator and Y is the denominator. Demo Input: ['5\n', '3\n'] Demo Output: ['7/3\n', '2/1\n'] Note: In the first sample number 5 written in all bases from 2 to 4 looks so: 101, 12, 11. Sums of digits are 2, 3 and 2, respectively.
```python __author__ = 'NIORLYS' def gcd(a, b): if b == 0: return a return gcd(b, a % b) def sum_of_digits_base_b(a, b): if a < b: return a return sum_of_digits_base_b(a // b, b) + a % b n = int(input()) sum_of_digits_all_bases = 0 for i in range(2, n): sum_of_digits_all_bases += sum_of_digits_base_b(n, i) print(str(sum_of_digits_all_bases // gcd(sum_of_digits_all_bases, n - 2)) + '/' + str( n - 2 // gcd(sum_of_digits_all_bases, n - 2))) ```
0
41
A
Translation
PROGRAMMING
800
[ "implementation", "strings" ]
A. Translation
2
256
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
[ "code\nedoc\n", "abb\naba\n", "code\ncode\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
500
[ { "input": "code\nedoc", "output": "YES" }, { "input": "abb\naba", "output": "NO" }, { "input": "code\ncode", "output": "NO" }, { "input": "abacaba\nabacaba", "output": "YES" }, { "input": "q\nq", "output": "YES" }, { "input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk", "output": "NO" }, { "input": "z\na", "output": "NO" }, { "input": "asd\ndsa", "output": "YES" }, { "input": "abcdef\nfecdba", "output": "NO" }, { "input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu", "output": "NO" }, { "input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf", "output": "NO" }, { "input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp", "output": "NO" }, { "input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb", "output": "NO" }, { "input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom", "output": "NO" }, { "input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh", "output": "NO" }, { "input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy", "output": "NO" }, { "input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko", "output": "NO" }, { "input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv", "output": "NO" }, { "input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd", "output": "NO" }, { "input": "w\nw", "output": "YES" }, { "input": "vz\nzv", "output": "YES" }, { "input": "ry\nyr", "output": "YES" }, { "input": "xou\nuox", "output": "YES" }, { "input": "axg\ngax", "output": "NO" }, { "input": "zdsl\nlsdz", "output": "YES" }, { "input": "kudl\nldku", "output": "NO" }, { "input": "zzlzwnqlcl\nlclqnwzlzz", "output": "YES" }, { "input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv", "output": "YES" }, { "input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar", "output": "NO" }, { "input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn", "output": "YES" }, { "input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum", "output": "YES" }, { "input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv", "output": "YES" }, { "input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm", "output": "NO" }, { "input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd", "output": "NO" }, { "input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg", "output": "YES" }, { "input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis", "output": "YES" }, { "input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy", "output": "NO" }, { "input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw", "output": "YES" }, { "input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi", "output": "YES" }, { "input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib", "output": "YES" } ]
1,680,533,251
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
9
92
0
#41A n=input() m=input() d=0 if (len(n)!=len(m)): pritn("NO") else: for i in range(len(n)): if n[i]!=m[len(m)-i-1]: print("NO") d=1 break; if d==0: print("YES")
Title: Translation Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. Input Specification: The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. Output Specification: If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. Demo Input: ['code\nedoc\n', 'abb\naba\n', 'code\ncode\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python #41A n=input() m=input() d=0 if (len(n)!=len(m)): pritn("NO") else: for i in range(len(n)): if n[i]!=m[len(m)-i-1]: print("NO") d=1 break; if d==0: print("YES") ```
-1
370
A
Rook, Bishop and King
PROGRAMMING
1,100
[ "graphs", "math", "shortest paths" ]
null
null
Little Petya is learning to play chess. He has already learned how to move a king, a rook and a bishop. Let us remind you the rules of moving chess pieces. A chessboard is 64 square fields organized into an 8<=×<=8 table. A field is represented by a pair of integers (*r*,<=*c*) — the number of the row and the number of the column (in a classical game the columns are traditionally indexed by letters). Each chess piece takes up exactly one field. To make a move is to move a chess piece, the pieces move by the following rules: - A rook moves any number of fields horizontally or vertically. - A bishop moves any number of fields diagonally. - A king moves one field in any direction — horizontally, vertically or diagonally. Petya is thinking about the following problem: what minimum number of moves is needed for each of these pieces to move from field (*r*1,<=*c*1) to field (*r*2,<=*c*2)? At that, we assume that there are no more pieces besides this one on the board. Help him solve this problem.
The input contains four integers *r*1,<=*c*1,<=*r*2,<=*c*2 (1<=≤<=*r*1,<=*c*1,<=*r*2,<=*c*2<=≤<=8) — the coordinates of the starting and the final field. The starting field doesn't coincide with the final one. You can assume that the chessboard rows are numbered from top to bottom 1 through 8, and the columns are numbered from left to right 1 through 8.
Print three space-separated integers: the minimum number of moves the rook, the bishop and the king (in this order) is needed to move from field (*r*1,<=*c*1) to field (*r*2,<=*c*2). If a piece cannot make such a move, print a 0 instead of the corresponding number.
[ "4 3 1 6\n", "5 5 5 6\n" ]
[ "2 1 3\n", "1 0 1\n" ]
none
500
[ { "input": "4 3 1 6", "output": "2 1 3" }, { "input": "5 5 5 6", "output": "1 0 1" }, { "input": "1 1 8 8", "output": "2 1 7" }, { "input": "1 1 8 1", "output": "1 0 7" }, { "input": "1 1 1 8", "output": "1 0 7" }, { "input": "8 1 1 1", "output": "1 0 7" }, { "input": "8 1 1 8", "output": "2 1 7" }, { "input": "7 7 6 6", "output": "2 1 1" }, { "input": "8 1 8 8", "output": "1 0 7" }, { "input": "1 8 1 1", "output": "1 0 7" }, { "input": "1 8 8 1", "output": "2 1 7" }, { "input": "1 8 8 8", "output": "1 0 7" }, { "input": "8 8 1 1", "output": "2 1 7" }, { "input": "8 8 1 8", "output": "1 0 7" }, { "input": "8 8 8 1", "output": "1 0 7" }, { "input": "1 3 1 6", "output": "1 0 3" }, { "input": "1 3 1 4", "output": "1 0 1" }, { "input": "1 3 1 5", "output": "1 2 2" }, { "input": "3 3 2 4", "output": "2 1 1" }, { "input": "3 3 1 5", "output": "2 1 2" }, { "input": "1 6 2 1", "output": "2 2 5" }, { "input": "1 5 6 4", "output": "2 2 5" }, { "input": "1 3 3 7", "output": "2 2 4" }, { "input": "1 1 8 1", "output": "1 0 7" }, { "input": "1 7 5 4", "output": "2 0 4" }, { "input": "1 5 2 7", "output": "2 0 2" }, { "input": "1 4 6 2", "output": "2 0 5" }, { "input": "1 2 3 5", "output": "2 0 3" }, { "input": "1 8 8 7", "output": "2 2 7" }, { "input": "6 5 6 2", "output": "1 0 3" }, { "input": "6 3 3 5", "output": "2 0 3" }, { "input": "6 1 7 8", "output": "2 2 7" }, { "input": "1 2 3 2", "output": "1 2 2" }, { "input": "3 8 7 2", "output": "2 2 6" }, { "input": "4 2 6 4", "output": "2 1 2" }, { "input": "1 1 1 3", "output": "1 2 2" }, { "input": "6 8 8 6", "output": "2 1 2" }, { "input": "6 7 4 1", "output": "2 2 6" }, { "input": "6 5 1 4", "output": "2 2 5" }, { "input": "3 2 7 6", "output": "2 1 4" }, { "input": "3 8 4 1", "output": "2 2 7" }, { "input": "3 6 1 4", "output": "2 1 2" } ]
1,569,037,423
2,147,483,647
Python 3
OK
TESTS
42
140
716,800
#https://codeforces.com/problemset/problem/266/B import sys import math from collections import defaultdict import heapq try: sys.stdin = open('input.txt', 'r') sys.stdout = open('output.txt', 'w') except: pass class Graph(): def __init__(self,type): self.neighbours=defaultdict(list) if(type==0): #King self.addKing() elif(type==1): #Rook self.addRook() else: #Add Bishop moves self.addBishop() def addKing(self): for x in range(1,9): for y in range(1,9): for i in range(-1,2): for j in range(-1,2): pos_x=x+i pos_y=y+j if(self.isValid(pos_x,pos_y)): self.addEdge([x,y],[pos_x,pos_y]) def addRook(self): for x in range(1,9): for y in range(1,9): for pos_y in range(1,9): if(pos_y!=y): self.addEdge([x,y],[x,pos_y]) for x in range(1,9): for y in range(1,9): for pos_x in range(1,9): if(pos_x!=x): self.addEdge([x,y],[pos_x,y]) def addBishop(self): #Absolute diff(x2-x1)==Absolute diff (y2-y1) for x in range(1,9): for y in range(1,9): for posx in range(1,9): for posy in range(1,9): if(abs(x-posx)==abs(y-posy)): self.addEdge([x,y],[posx,posy]) def addEdge(self,u,v): pos1=self.ltos(u) pos2=self.ltos(v) self.neighbours[pos1].append(pos2) self.neighbours[pos2].append(pos1) def ltos(self,l): return str(l[0])+":"+str(l[1]) def isValid(self,x,y): if(x<1 or x>8): return False if(y<1 or y>8): return False return True def stol(self,s): return [int(s[0]),int(s[2])] def BFS(self,source,destination): source=self.ltos(source) destination=self.ltos(destination) visited=defaultdict(lambda:False) distance=defaultdict(lambda:float("inf")) distance[source]=0 visited[source]=True queue=[source] parent=defaultdict(lambda:None) while queue: u=queue.pop(0) if(u==destination): break for v in self.neighbours[u]: if(not visited[v]): visited[v]=True parent[v]=u distance[v]=distance[u]+1 queue.append(v) if(distance[destination]==float("inf")): return 0 return(distance[destination]) x1,y1,x2,y2=[int(x) for x in input().split()] source=[x1,y1] destination=[x2,y2] king=Graph(0) rook=Graph(1) bishop=Graph(2) print(rook.BFS(source,destination),bishop.BFS(source,destination),king.BFS(source,destination))
Title: Rook, Bishop and King Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Petya is learning to play chess. He has already learned how to move a king, a rook and a bishop. Let us remind you the rules of moving chess pieces. A chessboard is 64 square fields organized into an 8<=×<=8 table. A field is represented by a pair of integers (*r*,<=*c*) — the number of the row and the number of the column (in a classical game the columns are traditionally indexed by letters). Each chess piece takes up exactly one field. To make a move is to move a chess piece, the pieces move by the following rules: - A rook moves any number of fields horizontally or vertically. - A bishop moves any number of fields diagonally. - A king moves one field in any direction — horizontally, vertically or diagonally. Petya is thinking about the following problem: what minimum number of moves is needed for each of these pieces to move from field (*r*1,<=*c*1) to field (*r*2,<=*c*2)? At that, we assume that there are no more pieces besides this one on the board. Help him solve this problem. Input Specification: The input contains four integers *r*1,<=*c*1,<=*r*2,<=*c*2 (1<=≤<=*r*1,<=*c*1,<=*r*2,<=*c*2<=≤<=8) — the coordinates of the starting and the final field. The starting field doesn't coincide with the final one. You can assume that the chessboard rows are numbered from top to bottom 1 through 8, and the columns are numbered from left to right 1 through 8. Output Specification: Print three space-separated integers: the minimum number of moves the rook, the bishop and the king (in this order) is needed to move from field (*r*1,<=*c*1) to field (*r*2,<=*c*2). If a piece cannot make such a move, print a 0 instead of the corresponding number. Demo Input: ['4 3 1 6\n', '5 5 5 6\n'] Demo Output: ['2 1 3\n', '1 0 1\n'] Note: none
```python #https://codeforces.com/problemset/problem/266/B import sys import math from collections import defaultdict import heapq try: sys.stdin = open('input.txt', 'r') sys.stdout = open('output.txt', 'w') except: pass class Graph(): def __init__(self,type): self.neighbours=defaultdict(list) if(type==0): #King self.addKing() elif(type==1): #Rook self.addRook() else: #Add Bishop moves self.addBishop() def addKing(self): for x in range(1,9): for y in range(1,9): for i in range(-1,2): for j in range(-1,2): pos_x=x+i pos_y=y+j if(self.isValid(pos_x,pos_y)): self.addEdge([x,y],[pos_x,pos_y]) def addRook(self): for x in range(1,9): for y in range(1,9): for pos_y in range(1,9): if(pos_y!=y): self.addEdge([x,y],[x,pos_y]) for x in range(1,9): for y in range(1,9): for pos_x in range(1,9): if(pos_x!=x): self.addEdge([x,y],[pos_x,y]) def addBishop(self): #Absolute diff(x2-x1)==Absolute diff (y2-y1) for x in range(1,9): for y in range(1,9): for posx in range(1,9): for posy in range(1,9): if(abs(x-posx)==abs(y-posy)): self.addEdge([x,y],[posx,posy]) def addEdge(self,u,v): pos1=self.ltos(u) pos2=self.ltos(v) self.neighbours[pos1].append(pos2) self.neighbours[pos2].append(pos1) def ltos(self,l): return str(l[0])+":"+str(l[1]) def isValid(self,x,y): if(x<1 or x>8): return False if(y<1 or y>8): return False return True def stol(self,s): return [int(s[0]),int(s[2])] def BFS(self,source,destination): source=self.ltos(source) destination=self.ltos(destination) visited=defaultdict(lambda:False) distance=defaultdict(lambda:float("inf")) distance[source]=0 visited[source]=True queue=[source] parent=defaultdict(lambda:None) while queue: u=queue.pop(0) if(u==destination): break for v in self.neighbours[u]: if(not visited[v]): visited[v]=True parent[v]=u distance[v]=distance[u]+1 queue.append(v) if(distance[destination]==float("inf")): return 0 return(distance[destination]) x1,y1,x2,y2=[int(x) for x in input().split()] source=[x1,y1] destination=[x2,y2] king=Graph(0) rook=Graph(1) bishop=Graph(2) print(rook.BFS(source,destination),bishop.BFS(source,destination),king.BFS(source,destination)) ```
3
239
A
Two Bags of Potatoes
PROGRAMMING
1,200
[ "greedy", "implementation", "math" ]
null
null
Valera had two bags of potatoes, the first of these bags contains *x* (*x*<=≥<=1) potatoes, and the second — *y* (*y*<=≥<=1) potatoes. Valera — very scattered boy, so the first bag of potatoes (it contains *x* potatoes) Valera lost. Valera remembers that the total amount of potatoes (*x*<=+<=*y*) in the two bags, firstly, was not gerater than *n*, and, secondly, was divisible by *k*. Help Valera to determine how many potatoes could be in the first bag. Print all such possible numbers in ascending order.
The first line of input contains three integers *y*, *k*, *n* (1<=≤<=*y*,<=*k*,<=*n*<=≤<=109; <=≤<=105).
Print the list of whitespace-separated integers — all possible values of *x* in ascending order. You should print each possible value of *x* exactly once. If there are no such values of *x* print a single integer -1.
[ "10 1 10\n", "10 6 40\n" ]
[ "-1\n", "2 8 14 20 26 \n" ]
none
500
[ { "input": "10 1 10", "output": "-1" }, { "input": "10 6 40", "output": "2 8 14 20 26 " }, { "input": "10 1 20", "output": "1 2 3 4 5 6 7 8 9 10 " }, { "input": "1 10000 1000000000", "output": "9999 19999 29999 39999 49999 59999 69999 79999 89999 99999 109999 119999 129999 139999 149999 159999 169999 179999 189999 199999 209999 219999 229999 239999 249999 259999 269999 279999 289999 299999 309999 319999 329999 339999 349999 359999 369999 379999 389999 399999 409999 419999 429999 439999 449999 459999 469999 479999 489999 499999 509999 519999 529999 539999 549999 559999 569999 579999 589999 599999 609999 619999 629999 639999 649999 659999 669999 679999 689999 699999 709999 719999 729999 739999 7499..." }, { "input": "84817 1 33457", "output": "-1" }, { "input": "21 37 99", "output": "16 53 " }, { "input": "78 7 15", "output": "-1" }, { "input": "74 17 27", "output": "-1" }, { "input": "79 23 43", "output": "-1" }, { "input": "32 33 3", "output": "-1" }, { "input": "55 49 44", "output": "-1" }, { "input": "64 59 404", "output": "54 113 172 231 290 " }, { "input": "61 69 820", "output": "8 77 146 215 284 353 422 491 560 629 698 " }, { "input": "17 28 532", "output": "11 39 67 95 123 151 179 207 235 263 291 319 347 375 403 431 459 487 515 " }, { "input": "46592 52 232", "output": "-1" }, { "input": "1541 58 648", "output": "-1" }, { "input": "15946 76 360", "output": "-1" }, { "input": "30351 86 424", "output": "-1" }, { "input": "1 2 37493", "output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161 163 165 167 169 171 173 175 177 179 181 183 185 187 189 191 193 195 197 199 201 203 205 207 209 211 213 215 217 219 221 223 225 227 229 231 233 235 237 239 241 243 245 247 249 251 253 255 257 259 261 263 265 267 269 271 273 275 277 279 281 28..." }, { "input": "1 3 27764", "output": "2 5 8 11 14 17 20 23 26 29 32 35 38 41 44 47 50 53 56 59 62 65 68 71 74 77 80 83 86 89 92 95 98 101 104 107 110 113 116 119 122 125 128 131 134 137 140 143 146 149 152 155 158 161 164 167 170 173 176 179 182 185 188 191 194 197 200 203 206 209 212 215 218 221 224 227 230 233 236 239 242 245 248 251 254 257 260 263 266 269 272 275 278 281 284 287 290 293 296 299 302 305 308 311 314 317 320 323 326 329 332 335 338 341 344 347 350 353 356 359 362 365 368 371 374 377 380 383 386 389 392 395 398 401 404 407 410..." }, { "input": "10 4 9174", "output": "2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 102 106 110 114 118 122 126 130 134 138 142 146 150 154 158 162 166 170 174 178 182 186 190 194 198 202 206 210 214 218 222 226 230 234 238 242 246 250 254 258 262 266 270 274 278 282 286 290 294 298 302 306 310 314 318 322 326 330 334 338 342 346 350 354 358 362 366 370 374 378 382 386 390 394 398 402 406 410 414 418 422 426 430 434 438 442 446 450 454 458 462 466 470 474 478 482 486 490 494 498 502 506 510 514 518 522 526 530 534 53..." }, { "input": "33 7 4971", "output": "2 9 16 23 30 37 44 51 58 65 72 79 86 93 100 107 114 121 128 135 142 149 156 163 170 177 184 191 198 205 212 219 226 233 240 247 254 261 268 275 282 289 296 303 310 317 324 331 338 345 352 359 366 373 380 387 394 401 408 415 422 429 436 443 450 457 464 471 478 485 492 499 506 513 520 527 534 541 548 555 562 569 576 583 590 597 604 611 618 625 632 639 646 653 660 667 674 681 688 695 702 709 716 723 730 737 744 751 758 765 772 779 786 793 800 807 814 821 828 835 842 849 856 863 870 877 884 891 898 905 912 919..." }, { "input": "981 1 3387", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "386 1 2747", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "123 2 50000", "output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161 163 165 167 169 171 173 175 177 179 181 183 185 187 189 191 193 195 197 199 201 203 205 207 209 211 213 215 217 219 221 223 225 227 229 231 233 235 237 239 241 243 245 247 249 251 253 255 257 259 261 263 265 267 269 271 273 275 277 279 281 28..." }, { "input": "3123 100 10000000", "output": "77 177 277 377 477 577 677 777 877 977 1077 1177 1277 1377 1477 1577 1677 1777 1877 1977 2077 2177 2277 2377 2477 2577 2677 2777 2877 2977 3077 3177 3277 3377 3477 3577 3677 3777 3877 3977 4077 4177 4277 4377 4477 4577 4677 4777 4877 4977 5077 5177 5277 5377 5477 5577 5677 5777 5877 5977 6077 6177 6277 6377 6477 6577 6677 6777 6877 6977 7077 7177 7277 7377 7477 7577 7677 7777 7877 7977 8077 8177 8277 8377 8477 8577 8677 8777 8877 8977 9077 9177 9277 9377 9477 9577 9677 9777 9877 9977 10077 10177 10277 1037..." }, { "input": "2 10000 1000000000", "output": "9998 19998 29998 39998 49998 59998 69998 79998 89998 99998 109998 119998 129998 139998 149998 159998 169998 179998 189998 199998 209998 219998 229998 239998 249998 259998 269998 279998 289998 299998 309998 319998 329998 339998 349998 359998 369998 379998 389998 399998 409998 419998 429998 439998 449998 459998 469998 479998 489998 499998 509998 519998 529998 539998 549998 559998 569998 579998 589998 599998 609998 619998 629998 639998 649998 659998 669998 679998 689998 699998 709998 719998 729998 739998 7499..." }, { "input": "3 10000 1000000000", "output": "9997 19997 29997 39997 49997 59997 69997 79997 89997 99997 109997 119997 129997 139997 149997 159997 169997 179997 189997 199997 209997 219997 229997 239997 249997 259997 269997 279997 289997 299997 309997 319997 329997 339997 349997 359997 369997 379997 389997 399997 409997 419997 429997 439997 449997 459997 469997 479997 489997 499997 509997 519997 529997 539997 549997 559997 569997 579997 589997 599997 609997 619997 629997 639997 649997 659997 669997 679997 689997 699997 709997 719997 729997 739997 7499..." }, { "input": "12312223 10000 1000000000", "output": "7777 17777 27777 37777 47777 57777 67777 77777 87777 97777 107777 117777 127777 137777 147777 157777 167777 177777 187777 197777 207777 217777 227777 237777 247777 257777 267777 277777 287777 297777 307777 317777 327777 337777 347777 357777 367777 377777 387777 397777 407777 417777 427777 437777 447777 457777 467777 477777 487777 497777 507777 517777 527777 537777 547777 557777 567777 577777 587777 597777 607777 617777 627777 637777 647777 657777 667777 677777 687777 697777 707777 717777 727777 737777 7477..." }, { "input": "500000000 1000000000 1000000000", "output": "500000000 " }, { "input": "1 1000000000 1000000000", "output": "999999999 " }, { "input": "10 6 11", "output": "-1" }, { "input": "2 100 10", "output": "-1" }, { "input": "1 100000007 1000000000", "output": "100000006 200000013 300000020 400000027 500000034 600000041 700000048 800000055 900000062 " }, { "input": "1 999999999 1000000000", "output": "999999998 " }, { "input": "100000000 1000000000 1000000000", "output": "900000000 " }, { "input": "11 2 12", "output": "1 " }, { "input": "31 10 39", "output": "-1" }, { "input": "48 6 50", "output": "-1" }, { "input": "500000000 500000000 1000000000", "output": "500000000 " }, { "input": "1 1000000000 999999999", "output": "-1" }, { "input": "4 2 10", "output": "2 4 6 " }, { "input": "1000000000 1 1", "output": "-1" }, { "input": "1000000000 1 100000", "output": "-1" }, { "input": "1000000000 1 10", "output": "-1" }, { "input": "10 5 14", "output": "-1" }, { "input": "500000000 499999999 1000000000", "output": "499999998 " }, { "input": "1 999999997 1000000000", "output": "999999996 " } ]
1,573,546,232
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
3
1,000
0
y, k, n = map(int, input().split()) sols = [] x = 1 while (x+y) <= n: if (y+x)%k == 0: sols.append(x) x+=1 if sols: print(*sols, sep=" ") else: print(-1)
Title: Two Bags of Potatoes Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera had two bags of potatoes, the first of these bags contains *x* (*x*<=≥<=1) potatoes, and the second — *y* (*y*<=≥<=1) potatoes. Valera — very scattered boy, so the first bag of potatoes (it contains *x* potatoes) Valera lost. Valera remembers that the total amount of potatoes (*x*<=+<=*y*) in the two bags, firstly, was not gerater than *n*, and, secondly, was divisible by *k*. Help Valera to determine how many potatoes could be in the first bag. Print all such possible numbers in ascending order. Input Specification: The first line of input contains three integers *y*, *k*, *n* (1<=≤<=*y*,<=*k*,<=*n*<=≤<=109; <=≤<=105). Output Specification: Print the list of whitespace-separated integers — all possible values of *x* in ascending order. You should print each possible value of *x* exactly once. If there are no such values of *x* print a single integer -1. Demo Input: ['10 1 10\n', '10 6 40\n'] Demo Output: ['-1\n', '2 8 14 20 26 \n'] Note: none
```python y, k, n = map(int, input().split()) sols = [] x = 1 while (x+y) <= n: if (y+x)%k == 0: sols.append(x) x+=1 if sols: print(*sols, sep=" ") else: print(-1) ```
0
1,006
C
Three Parts of the Array
PROGRAMMING
1,200
[ "binary search", "data structures", "two pointers" ]
null
null
You are given an array $d_1, d_2, \dots, d_n$ consisting of $n$ integer numbers. Your task is to split this array into three parts (some of which may be empty) in such a way that each element of the array belongs to exactly one of the three parts, and each of the parts forms a consecutive contiguous subsegment (possibly, empty) of the original array. Let the sum of elements of the first part be $sum_1$, the sum of elements of the second part be $sum_2$ and the sum of elements of the third part be $sum_3$. Among all possible ways to split the array you have to choose a way such that $sum_1 = sum_3$ and $sum_1$ is maximum possible. More formally, if the first part of the array contains $a$ elements, the second part of the array contains $b$ elements and the third part contains $c$ elements, then: $$sum_1 = \sum\limits_{1 \le i \le a}d_i,$$ $$sum_2 = \sum\limits_{a + 1 \le i \le a + b}d_i,$$ $$sum_3 = \sum\limits_{a + b + 1 \le i \le a + b + c}d_i.$$ The sum of an empty array is $0$. Your task is to find a way to split the array such that $sum_1 = sum_3$ and $sum_1$ is maximum possible.
The first line of the input contains one integer $n$ ($1 \le n \le 2 \cdot 10^5$) — the number of elements in the array $d$. The second line of the input contains $n$ integers $d_1, d_2, \dots, d_n$ ($1 \le d_i \le 10^9$) — the elements of the array $d$.
Print a single integer — the maximum possible value of $sum_1$, considering that the condition $sum_1 = sum_3$ must be met. Obviously, at least one valid way to split the array exists (use $a=c=0$ and $b=n$).
[ "5\n1 3 1 1 4\n", "5\n1 3 2 1 4\n", "3\n4 1 2\n" ]
[ "5\n", "4\n", "0\n" ]
In the first example there is only one possible splitting which maximizes $sum_1$: $[1, 3, 1], [~], [1, 4]$. In the second example the only way to have $sum_1=4$ is: $[1, 3], [2, 1], [4]$. In the third example there is only one way to split the array: $[~], [4, 1, 2], [~]$.
0
[ { "input": "5\n1 3 1 1 4", "output": "5" }, { "input": "5\n1 3 2 1 4", "output": "4" }, { "input": "3\n4 1 2", "output": "0" }, { "input": "1\n1000000000", "output": "0" }, { "input": "2\n1 1", "output": "1" }, { "input": "5\n1 3 5 4 5", "output": "9" } ]
1,631,524,275
2,147,483,647
Python 3
OK
TESTS
27
280
24,678,400
n = int(input()) mas = list(map(int, input().split())) r = n s1 = 0 s2 = 0 res = 0 for l in range(n): s1 += mas[l] while s1 > s2: r-=1 s2 += mas[r] if s1 == s2 and r > l: res = max(res, s1) print(res)
Title: Three Parts of the Array Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given an array $d_1, d_2, \dots, d_n$ consisting of $n$ integer numbers. Your task is to split this array into three parts (some of which may be empty) in such a way that each element of the array belongs to exactly one of the three parts, and each of the parts forms a consecutive contiguous subsegment (possibly, empty) of the original array. Let the sum of elements of the first part be $sum_1$, the sum of elements of the second part be $sum_2$ and the sum of elements of the third part be $sum_3$. Among all possible ways to split the array you have to choose a way such that $sum_1 = sum_3$ and $sum_1$ is maximum possible. More formally, if the first part of the array contains $a$ elements, the second part of the array contains $b$ elements and the third part contains $c$ elements, then: $$sum_1 = \sum\limits_{1 \le i \le a}d_i,$$ $$sum_2 = \sum\limits_{a + 1 \le i \le a + b}d_i,$$ $$sum_3 = \sum\limits_{a + b + 1 \le i \le a + b + c}d_i.$$ The sum of an empty array is $0$. Your task is to find a way to split the array such that $sum_1 = sum_3$ and $sum_1$ is maximum possible. Input Specification: The first line of the input contains one integer $n$ ($1 \le n \le 2 \cdot 10^5$) — the number of elements in the array $d$. The second line of the input contains $n$ integers $d_1, d_2, \dots, d_n$ ($1 \le d_i \le 10^9$) — the elements of the array $d$. Output Specification: Print a single integer — the maximum possible value of $sum_1$, considering that the condition $sum_1 = sum_3$ must be met. Obviously, at least one valid way to split the array exists (use $a=c=0$ and $b=n$). Demo Input: ['5\n1 3 1 1 4\n', '5\n1 3 2 1 4\n', '3\n4 1 2\n'] Demo Output: ['5\n', '4\n', '0\n'] Note: In the first example there is only one possible splitting which maximizes $sum_1$: $[1, 3, 1], [~], [1, 4]$. In the second example the only way to have $sum_1=4$ is: $[1, 3], [2, 1], [4]$. In the third example there is only one way to split the array: $[~], [4, 1, 2], [~]$.
```python n = int(input()) mas = list(map(int, input().split())) r = n s1 = 0 s2 = 0 res = 0 for l in range(n): s1 += mas[l] while s1 > s2: r-=1 s2 += mas[r] if s1 == s2 and r > l: res = max(res, s1) print(res) ```
3
870
C
Maximum splitting
PROGRAMMING
1,300
[ "dp", "greedy", "math", "number theory" ]
null
null
You are given several queries. In the *i*-th query you are given a single positive integer *n**i*. You are to represent *n**i* as a sum of maximum possible number of composite summands and print this maximum number, or print -1, if there are no such splittings. An integer greater than 1 is composite, if it is not prime, i.e. if it has positive divisors not equal to 1 and the integer itself.
The first line contains single integer *q* (1<=≤<=*q*<=≤<=105) — the number of queries. *q* lines follow. The (*i*<=+<=1)-th line contains single integer *n**i* (1<=≤<=*n**i*<=≤<=109) — the *i*-th query.
For each query print the maximum possible number of summands in a valid splitting to composite summands, or -1, if there are no such splittings.
[ "1\n12\n", "2\n6\n8\n", "3\n1\n2\n3\n" ]
[ "3\n", "1\n2\n", "-1\n-1\n-1\n" ]
12 = 4 + 4 + 4 = 4 + 8 = 6 + 6 = 12, but the first splitting has the maximum possible number of summands. 8 = 4 + 4, 6 can't be split into several composite summands. 1, 2, 3 are less than any composite number, so they do not have valid splittings.
1,500
[ { "input": "1\n12", "output": "3" }, { "input": "2\n6\n8", "output": "1\n2" }, { "input": "3\n1\n2\n3", "output": "-1\n-1\n-1" }, { "input": "6\n1\n2\n3\n5\n7\n11", "output": "-1\n-1\n-1\n-1\n-1\n-1" }, { "input": "3\n4\n6\n9", "output": "1\n1\n1" }, { "input": "20\n8\n13\n20\n12\n9\n16\n4\n19\n7\n15\n10\n6\n14\n11\n3\n2\n5\n17\n18\n1", "output": "2\n2\n5\n3\n1\n4\n1\n3\n-1\n2\n2\n1\n3\n-1\n-1\n-1\n-1\n3\n4\n-1" }, { "input": "100\n611\n513\n544\n463\n38\n778\n347\n317\n848\n664\n382\n108\n718\n33\n334\n876\n234\n22\n944\n305\n159\n245\n513\n691\n639\n135\n308\n324\n813\n459\n304\n116\n331\n993\n184\n224\n853\n769\n121\n687\n93\n930\n751\n308\n485\n914\n400\n695\n95\n981\n175\n972\n121\n654\n242\n610\n617\n999\n237\n548\n742\n767\n613\n172\n223\n391\n102\n907\n673\n116\n230\n355\n189\n552\n399\n493\n903\n201\n985\n459\n776\n641\n693\n919\n253\n540\n427\n394\n655\n101\n461\n854\n417\n249\n66\n380\n213\n906\n212\n528", "output": "151\n127\n136\n114\n9\n194\n85\n78\n212\n166\n95\n27\n179\n7\n83\n219\n58\n5\n236\n75\n38\n60\n127\n171\n158\n32\n77\n81\n202\n113\n76\n29\n81\n247\n46\n56\n212\n191\n29\n170\n22\n232\n186\n77\n120\n228\n100\n172\n22\n244\n42\n243\n29\n163\n60\n152\n153\n248\n58\n137\n185\n190\n152\n43\n54\n96\n25\n225\n167\n29\n57\n87\n46\n138\n98\n122\n224\n49\n245\n113\n194\n159\n172\n228\n62\n135\n105\n98\n162\n24\n114\n213\n103\n61\n16\n95\n52\n226\n53\n132" }, { "input": "1\n10000001", "output": "2499999" } ]
1,652,844,308
2,147,483,647
Python 3
OK
TESTS
20
810
4,505,600
def find_summand(n): if (n % 4 == 0): return n // 4 if (n % 4 == 1): if (n < 9): return -1 return (n-9) // 4 + 1 if (n % 4 == 2): if (n < 6): return -1 return (n-6) // 4 + 1 if (n < 15): return -1 return (n-15) // 4 + 2 q = int(input()) for tc in range(q): n = int(input()) print(find_summand(n))
Title: Maximum splitting Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given several queries. In the *i*-th query you are given a single positive integer *n**i*. You are to represent *n**i* as a sum of maximum possible number of composite summands and print this maximum number, or print -1, if there are no such splittings. An integer greater than 1 is composite, if it is not prime, i.e. if it has positive divisors not equal to 1 and the integer itself. Input Specification: The first line contains single integer *q* (1<=≤<=*q*<=≤<=105) — the number of queries. *q* lines follow. The (*i*<=+<=1)-th line contains single integer *n**i* (1<=≤<=*n**i*<=≤<=109) — the *i*-th query. Output Specification: For each query print the maximum possible number of summands in a valid splitting to composite summands, or -1, if there are no such splittings. Demo Input: ['1\n12\n', '2\n6\n8\n', '3\n1\n2\n3\n'] Demo Output: ['3\n', '1\n2\n', '-1\n-1\n-1\n'] Note: 12 = 4 + 4 + 4 = 4 + 8 = 6 + 6 = 12, but the first splitting has the maximum possible number of summands. 8 = 4 + 4, 6 can't be split into several composite summands. 1, 2, 3 are less than any composite number, so they do not have valid splittings.
```python def find_summand(n): if (n % 4 == 0): return n // 4 if (n % 4 == 1): if (n < 9): return -1 return (n-9) // 4 + 1 if (n % 4 == 2): if (n < 6): return -1 return (n-6) // 4 + 1 if (n < 15): return -1 return (n-15) // 4 + 2 q = int(input()) for tc in range(q): n = int(input()) print(find_summand(n)) ```
3
37
A
Towers
PROGRAMMING
1,000
[ "sortings" ]
A. Towers
2
256
Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same. Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible.
The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000.
In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars.
[ "3\n1 2 3\n", "4\n6 5 6 7\n" ]
[ "1 3\n", "2 3\n" ]
none
500
[ { "input": "3\n1 2 3", "output": "1 3" }, { "input": "4\n6 5 6 7", "output": "2 3" }, { "input": "4\n3 2 1 1", "output": "2 3" }, { "input": "4\n1 2 3 3", "output": "2 3" }, { "input": "3\n20 22 36", "output": "1 3" }, { "input": "25\n47 30 94 41 45 20 96 51 110 129 24 116 9 47 32 82 105 114 116 75 154 151 70 42 162", "output": "2 23" }, { "input": "45\n802 664 442 318 318 827 417 878 711 291 231 414 807 553 657 392 279 202 386 606 465 655 658 112 887 15 25 502 95 44 679 775 942 609 209 871 31 234 4 231 150 110 22 823 193", "output": "2 43" }, { "input": "63\n93 180 116 7 8 179 268 279 136 94 221 153 264 190 278 19 19 63 153 26 158 225 25 49 89 218 111 149 255 225 197 122 243 80 3 224 107 178 202 17 53 92 69 42 228 24 81 205 95 8 265 82 228 156 127 241 172 159 106 60 67 155 111", "output": "2 57" }, { "input": "83\n246 535 994 33 390 927 321 97 223 922 812 705 79 80 977 457 476 636 511 137 6 360 815 319 717 674 368 551 714 628 278 713 761 553 184 414 623 753 428 214 581 115 439 61 677 216 772 592 187 603 658 310 439 559 870 376 109 321 189 337 277 26 70 734 796 907 979 693 570 227 345 650 737 633 701 914 134 403 972 940 371 6 642", "output": "2 80" }, { "input": "105\n246 57 12 204 165 123 246 68 191 310 3 152 386 333 374 257 158 104 333 50 80 290 8 340 101 76 221 316 388 289 138 359 316 26 93 290 105 178 81 195 41 196 218 180 244 292 187 97 315 323 174 119 248 239 92 312 31 2 101 180 307 170 338 314 163 281 217 31 142 238 280 190 190 156 70 74 329 113 151 8 141 313 366 40 253 116 168 124 135 230 294 266 353 389 371 359 195 200 183 237 93 102 315 118 188", "output": "2 92" }, { "input": "123\n112 277 170 247 252 115 157 293 256 143 196 90 12 164 164 42 8 223 167 109 175 232 239 111 148 51 9 254 93 32 268 162 231 91 47 162 161 191 195 145 247 292 129 199 230 94 144 217 18 205 176 20 143 198 121 243 211 262 230 277 195 255 108 290 220 275 158 2 286 200 60 267 278 207 123 150 123 116 131 13 12 226 33 244 30 275 263 45 158 192 254 149 242 176 62 224 221 288 250 160 155 225 132 143 276 293 218 145 197 175 33 129 79 206 210 192 222 262 190 52 274 243 233", "output": "3 101" }, { "input": "5\n5 5 5 5 5", "output": "5 1" }, { "input": "3\n1000 1000 1000", "output": "3 1" }, { "input": "1\n1000", "output": "1 1" }, { "input": "1\n1", "output": "1 1" }, { "input": "5\n1 1000 1000 1000 1000", "output": "4 2" }, { "input": "5\n1000 1000 1000 8 7", "output": "3 3" } ]
1,514,257,554
2,147,483,647
Python 3
OK
TESTS
61
124
5,632,000
def towers_2(n,l): sorted_l=sorted(l) sorted_l=sorted_l+[10000] values=[] keys=[] this_count=1 for i in range(len(sorted_l)-1): if sorted_l[i+1]==sorted_l[i]: this_count+=1 else: values.append(this_count) keys.append(sorted_l[i]) this_count=1 print (max(values),len(values)) n=int(input()) l=list(map(int, input().split())) towers_2(n,l)
Title: Towers Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same. Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible. Input Specification: The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000. Output Specification: In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars. Demo Input: ['3\n1 2 3\n', '4\n6 5 6 7\n'] Demo Output: ['1 3\n', '2 3\n'] Note: none
```python def towers_2(n,l): sorted_l=sorted(l) sorted_l=sorted_l+[10000] values=[] keys=[] this_count=1 for i in range(len(sorted_l)-1): if sorted_l[i+1]==sorted_l[i]: this_count+=1 else: values.append(this_count) keys.append(sorted_l[i]) this_count=1 print (max(values),len(values)) n=int(input()) l=list(map(int, input().split())) towers_2(n,l) ```
3.95851
321
A
Ciel and Robot
PROGRAMMING
1,700
[ "binary search", "implementation", "math" ]
null
null
Fox Ciel has a robot on a 2D plane. Initially it is located in (0, 0). Fox Ciel code a command to it. The command was represented by string *s*. Each character of *s* is one move operation. There are four move operations at all: - 'U': go up, (x, y) <=→<= (x, y+1); - 'D': go down, (x, y) <=→<= (x, y-1); - 'L': go left, (x, y) <=→<= (x-1, y); - 'R': go right, (x, y) <=→<= (x+1, y). The robot will do the operations in *s* from left to right, and repeat it infinite times. Help Fox Ciel to determine if after some steps the robot will located in (*a*,<=*b*).
The first line contains two integers *a* and *b*, (<=-<=109<=≤<=*a*,<=*b*<=≤<=109). The second line contains a string *s* (1<=≤<=|*s*|<=≤<=100, *s* only contains characters 'U', 'D', 'L', 'R') — the command.
Print "Yes" if the robot will be located at (*a*,<=*b*), and "No" otherwise.
[ "2 2\nRU\n", "1 2\nRU\n", "-1 1000000000\nLRRLU\n", "0 0\nD\n" ]
[ "Yes\n", "No\n", "Yes\n", "Yes\n" ]
In the first and second test case, command string is "RU", so the robot will go right, then go up, then right, and then up and so on. The locations of its moves are (0, 0)  →  (1, 0)  →  (1, 1)  →  (2, 1)  →  (2, 2)  →  ... So it can reach (2, 2) but not (1, 2).
500
[ { "input": "2 2\nRU", "output": "Yes" }, { "input": "1 2\nRU", "output": "No" }, { "input": "-1 1000000000\nLRRLU", "output": "Yes" }, { "input": "0 0\nD", "output": "Yes" }, { "input": "0 0\nUURRDL", "output": "Yes" }, { "input": "987654321 987654321\nUURRDL", "output": "Yes" }, { "input": "4 2\nUURRDL", "output": "No" }, { "input": "4 3\nUURRDL", "output": "Yes" }, { "input": "4 4\nUURRDL", "output": "Yes" }, { "input": "4 6\nUURRDL", "output": "Yes" }, { "input": "4 7\nUURRDL", "output": "No" }, { "input": "1000000000 1000000000\nUURRDL", "output": "Yes" }, { "input": "-1 -1\nUR", "output": "No" }, { "input": "1 1\nUURRDDLL", "output": "No" }, { "input": "987654321 2\nUURDD", "output": "Yes" }, { "input": "0 123456789\nRRULL", "output": "Yes" }, { "input": "4 4\nUUUURRRRDDDDLLLL", "output": "Yes" }, { "input": "-491226083 -49122610\nUDRLDURLDLLLDUDURLRDUUDDUUULUDRDRDUULURDRLLDDDLUDUURLUUDLLDULLLLDDLDDUU", "output": "Yes" }, { "input": "-261597957 418556728\nLLLDLUDUULLRDDULLRRUDRDLULRLRLLRRUUDRRLRUDLRRLUDRDLLUUDUULRURLDLULUUULDDUURLRUDURRL", "output": "Yes" }, { "input": "-771928144 -3\nRUDULULDRDLLLULDDUDDDDUDULRULRUULDDDURUDLUURULLLDLLDDRDDRLRURUULRUURRUDLDLDDRLLULRRDRRLLUULUDRUUDRRD", "output": "Yes" }, { "input": "397346346 1\nDDURRUURLDLRRLULD", "output": "Yes" }, { "input": "-528551525 0\nUDRLRRLDLDLURRRRULDLRLRLURUUDDLRLLDRRULLUDLURDLUUULLLRUUUDRRURLDUDULDDRDDDRDL", "output": "Yes" }, { "input": "311692421 -129871846\nLLLDURULDDDDUDDURRLUUDRLDDRDURDDRUDUURLUDUDLDRUDDDUUURDRRUDRDRDURLLDURUUDRLDLDURRRRRRDULURDRU", "output": "Yes" }, { "input": "485940814 728911221\nURURU", "output": "Yes" }, { "input": "-843450986 632588242\nLURLULULRUDUDULRDDLUL", "output": "Yes" }, { "input": "647999516 -809999401\nUDLDDLLULUDDLLDUULRRRDLUDDLDDLRLRRDRURURDRRDRULUDRDULRULLRRLLDDRLRRUDRURDUULUDLRRLRDR", "output": "Yes" }, { "input": "352820537 -764444491\nRDDUDLUDDUDLRRRDRRRDRRDUDUDDURLRRLDRLLRLLLLUULUDRURRDRLDDLLDRDURDUDRUDDLUDRLURUDRURDRDDLDRLDLDLLU", "output": "Yes" }, { "input": "-284973644 -1\nDLULLDLRUUDRR", "output": "Yes" }, { "input": "356922591 -2\nRRLDLDUDRUUUULUUDDULDDUDD", "output": "No" }, { "input": "27033101 54066203\nUDDDRDLLLRUUDDLRDLDRLRUDDULRLLRULR", "output": "No" }, { "input": "-199335150 39867031\nLLURRDUULRUDDRDUUULDLDRDDLURDRLDRLLLRRRRRULRRRUUDD", "output": "No" }, { "input": "609504072 609504074\nULRLUDLDDR", "output": "No" }, { "input": "497684357 829473929\nRRLDUUURULURRLLRRLRLURRLDU", "output": "Yes" }, { "input": "551922835 183974295\nDUDUUULDRLRURRDULRRUDDLRLLUULLRLRDRDRR", "output": "No" }, { "input": "825368095 -825368096\nRD", "output": "No" }, { "input": "-458990423 -229495204\nDLLDDRLUDLRLUL", "output": "No" }, { "input": "285102789 570205594\nRRDULRULULRRDUURRLURUDDULLRDUL", "output": "No" }, { "input": "109928480 219856920\nLRURLRLURDRDLDRDLRDDUUDDLULDRRUUURRUDLLUULUUUR", "output": "No" }, { "input": "-532674020 532674026\nUURLLL", "output": "No" }, { "input": "999999999 0\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR", "output": "Yes" }, { "input": "0 0\nUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLR", "output": "Yes" }, { "input": "1 1\nUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLRUDLR", "output": "No" }, { "input": "-1000000000 -1000000000\nDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDL", "output": "Yes" }, { "input": "3 3\nUURR", "output": "No" }, { "input": "-2 -2\nUR", "output": "No" }, { "input": "5 5\nUDLR", "output": "No" }, { "input": "0 -1\nU", "output": "No" }, { "input": "-1 0\nR", "output": "No" }, { "input": "1000000000 1000000000\nURURURUR", "output": "Yes" }, { "input": "-1 -1\nRU", "output": "No" }, { "input": "1 1\nLD", "output": "No" }, { "input": "-2 -2\nUURR", "output": "No" }, { "input": "1000000000 0\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR", "output": "Yes" }, { "input": "2 6\nRUUUURLDDDL", "output": "Yes" }, { "input": "0 1\nLUUR", "output": "No" }, { "input": "1 1\nURDLDL", "output": "Yes" }, { "input": "-10 -10\nRU", "output": "No" }, { "input": "1000000000 1000000000\nRURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURU", "output": "Yes" }, { "input": "-1000000000 -500000000\nURR", "output": "No" }, { "input": "-2 0\nULLLDDRRRR", "output": "Yes" }, { "input": "999999999 -999999999\nRRRRRRRRRRRRRRRRRRRRRRRRRDDDDDDDDDDDDDDDDDDDDDDDDDLLLLLLLLLLLLLLLLLLLLLLLUUUUUUUUUUUUUUUUUUUUUUU", "output": "Yes" }, { "input": "-100 -100\nRU", "output": "No" }, { "input": "100 100\nRUL", "output": "No" }, { "input": "0 1\nUDLR", "output": "Yes" }, { "input": "0 1\nD", "output": "No" }, { "input": "0 -3\nRDDL", "output": "No" } ]
1,568,524,927
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
0
248
0
a,b=map(int,input().split()) s=input() n=len(s) #s=s*1000 x=0 y=0 if x==a and y==b: print('Yes') exit() k=0 dp=[0]*n for i in s: if i=='U': y+=1 if i=='R': x+=1 if i=='D': y-=1 if i=='L': x-=1 dp[k]=[x,y] k+=1 if x==a and y==b: print('Yes') exit() dx=x dy=y n=len(s) for p in range(n): extrax,extray=dp[p][0],dp[p][1] a=a-extrax b=b-extray if not dx: if b%dy==0: print('Yes') exit() continue if not dy: if a%dx==0: print('Yes') exit() continue if a%dx==0 and b%dy==0 and a//dx==b//dy: print('Yes') exit() print('No')
Title: Ciel and Robot Time Limit: None seconds Memory Limit: None megabytes Problem Description: Fox Ciel has a robot on a 2D plane. Initially it is located in (0, 0). Fox Ciel code a command to it. The command was represented by string *s*. Each character of *s* is one move operation. There are four move operations at all: - 'U': go up, (x, y) <=→<= (x, y+1); - 'D': go down, (x, y) <=→<= (x, y-1); - 'L': go left, (x, y) <=→<= (x-1, y); - 'R': go right, (x, y) <=→<= (x+1, y). The robot will do the operations in *s* from left to right, and repeat it infinite times. Help Fox Ciel to determine if after some steps the robot will located in (*a*,<=*b*). Input Specification: The first line contains two integers *a* and *b*, (<=-<=109<=≤<=*a*,<=*b*<=≤<=109). The second line contains a string *s* (1<=≤<=|*s*|<=≤<=100, *s* only contains characters 'U', 'D', 'L', 'R') — the command. Output Specification: Print "Yes" if the robot will be located at (*a*,<=*b*), and "No" otherwise. Demo Input: ['2 2\nRU\n', '1 2\nRU\n', '-1 1000000000\nLRRLU\n', '0 0\nD\n'] Demo Output: ['Yes\n', 'No\n', 'Yes\n', 'Yes\n'] Note: In the first and second test case, command string is "RU", so the robot will go right, then go up, then right, and then up and so on. The locations of its moves are (0, 0)  →  (1, 0)  →  (1, 1)  →  (2, 1)  →  (2, 2)  →  ... So it can reach (2, 2) but not (1, 2).
```python a,b=map(int,input().split()) s=input() n=len(s) #s=s*1000 x=0 y=0 if x==a and y==b: print('Yes') exit() k=0 dp=[0]*n for i in s: if i=='U': y+=1 if i=='R': x+=1 if i=='D': y-=1 if i=='L': x-=1 dp[k]=[x,y] k+=1 if x==a and y==b: print('Yes') exit() dx=x dy=y n=len(s) for p in range(n): extrax,extray=dp[p][0],dp[p][1] a=a-extrax b=b-extray if not dx: if b%dy==0: print('Yes') exit() continue if not dy: if a%dx==0: print('Yes') exit() continue if a%dx==0 and b%dy==0 and a//dx==b//dy: print('Yes') exit() print('No') ```
0
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,678,202,925
2,147,483,647
Python 3
OK
TESTS
30
92
0
x = input() u = sum(1 for c in x if c.isupper()) l = sum(1 for c in x if c.islower()) if u > l: print(x.upper()) else: print(x.lower())
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python x = input() u = sum(1 for c in x if c.isupper()) l = sum(1 for c in x if c.islower()) if u > l: print(x.upper()) else: print(x.lower()) ```
3.977
133
B
Unary
PROGRAMMING
1,200
[ "implementation" ]
null
null
Unary is a minimalistic Brainfuck dialect in which programs are written using only one token. Brainfuck programs use 8 commands: "+", "-", "[", "]", "&lt;", "&gt;", "." and "," (their meaning is not important for the purposes of this problem). Unary programs are created from Brainfuck programs using the following algorithm. First, replace each command with a corresponding binary code, using the following conversion table: - "&gt;" <=→<= 1000, - "&lt;" <=→<= 1001, - "+" <=→<= 1010, - "-" <=→<= 1011, - "." <=→<= 1100, - "," <=→<= 1101, - "[" <=→<= 1110, - "]" <=→<= 1111. Next, concatenate the resulting binary codes into one binary number in the same order as in the program. Finally, write this number using unary numeral system — this is the Unary program equivalent to the original Brainfuck one. You are given a Brainfuck program. Your task is to calculate the size of the equivalent Unary program, and print it modulo 1000003 (106<=+<=3).
The input will consist of a single line *p* which gives a Brainfuck program. String *p* will contain between 1 and 100 characters, inclusive. Each character of *p* will be "+", "-", "[", "]", "&lt;", "&gt;", "." or ",".
Output the size of the equivalent Unary program modulo 1000003 (106<=+<=3).
[ ",.\n", "++++[&gt;,.&lt;-]\n" ]
[ "220\n", "61425\n" ]
To write a number *n* in unary numeral system, one simply has to write 1 *n* times. For example, 5 written in unary system will be 11111. In the first example replacing Brainfuck commands with binary code will give us 1101 1100. After we concatenate the codes, we'll get 11011100 in binary system, or 220 in decimal. That's exactly the number of tokens in the equivalent Unary program.
1,000
[ { "input": ",.", "output": "220" }, { "input": "++++[>,.<-]", "output": "61425" }, { "input": "[-],<],<<,<[,>,+>[[<>.,[>-[-[<><>><<<<]>,.-].>-[[>+,>,[,-,.-,-[[]>..<>,<[+,-<]-++.<+.]<,[[.<<-><<<],", "output": "43789" }, { "input": "+", "output": "10" }, { "input": "-", "output": "11" }, { "input": "<", "output": "9" }, { "input": ">", "output": "8" }, { "input": ".", "output": "12" }, { "input": ",", "output": "13" }, { "input": "[", "output": "14" }, { "input": "]", "output": "15" }, { "input": ",]+>.],,+->+>-[]][><,-]><]++<.,-[.>.<+.[.<,[-,,[<]+>]->>]>]-+-+<][].,.]+][[<,-.+][+<<-+.],,,<,.]-].-", "output": "859903" }, { "input": "][-+>,>[,<[<+-,[+[-.<+,<[.,<+<,>+],.]><+<,+<..[[[>,[<>+-<<[>,[>-->[>+[<+<[-<]]]<>.+-,.+++-+++-+>-.]+", "output": "235230" }, { "input": "+]+<-]-<,>[,]<[][+<[+]>[[,", "output": "221907" }, { "input": ".>]+,>->,.>[+>+<-.-+<<>-,..+-<.,>]>.<<,+-[].,],<,..-<[-", "output": "223676" }, { "input": ">.><]..>,,<<-[.,]]+,+,>[<>>+]+++--,>.[+,,+,+[><+,+[<,-]<-,..[,,.[[><]]<[<.-++][.[]][<", "output": "916864" }, { "input": "]+<+[,.[,]-,.][]..[.<[<-]]]+.<[]]>>]-+]-+-.>-.].,[+[]><-.[[]++<", "output": "86015" }, { "input": "-[.<>].[,>,]>++<+].>,<<],,,]++<[<+,,,,[.]<[-[,,]-..+<++].----]++><,+.,>+,+[,-[<.]-+++][-]<+.<", "output": "170107" }, { "input": "<.,+.><[,.+<[,.,<-,[>,", "output": "982288" }, { "input": "[,+.-.<],,]-]-[[,[]+,[.]][>],,]<[>,<+<<>>].>]>][->+>", "output": "411338" }, { "input": "+]]],,>],][],<+.[->,>..<-+]][>><.+>[][.]<,>-..-,..-]>-]+>,><+<<.+>.,++]<]],],<+-<.", "output": "113966" }, { "input": ".<>.+]>],>><", "output": "228058" }, { "input": "-[.<++]-,-]-,[<<+[,-+]+[[...,[-...,<>+[]>][+.],[-[>>-->---+-+]>>><-++]]-++>][,],<[[,+],++<---<[", "output": "709697" }, { "input": "]<><]>,>]-]],[,>+[->,,[<-+,.][[++[,+.<[,[-][[>.]<.].+-,,]]+[->]]-][>[].,>.,],,>,]-]]<+[,>>-]+]", "output": "283602" }, { "input": "<-[>[,.+>-]<-[[]+[.]--<-[[]->[.<<,,.,+[.][].,<<]],,+[.>+.>+-<.-+[-,-<][+,[>[.,.+,[+[]+<-.>-<>", "output": "204479" }, { "input": "+,+><[>..,]-.[.++[>-<<-,-.>,.>]+,<,]]<[>,-+,.-[+,[.[<.-[].+>[,>-.>>]-[-][+,>>-,+<-,<.+-.+[.,", "output": "537427" }, { "input": ">]-[.-+[,,]].]+,][[>>[+][,<+,>.<[],.>+[]-[,[[+],..>..<[>.,,,+]]<+++<][[>..>>+-]+][--],]<[]", "output": "952413" }, { "input": ",><[-]-,],+<<]>.][]][+]>.[-]]>++-.+[.<[,.-,<,[,,>,],,>-<+],>->-[<<.,>>,<][,<-->+-..+.,>>.", "output": "11994" }, { "input": "[.[[+.<<>,+,>],<][+-],>.]<+]>><<][+-,][.>[-,.>--][-[]>]-<>,+<<>+,]][.>>.<,>.<..]>]<][-.[", "output": "386152" }, { "input": "-,]]]+[]-,+]>][>[[->,..-.,[[.<,,.,+[].[[[-.][.<.,.<.>[.,+.,<[-]-[--<,>+-,.,.[.,]+.>>--,", "output": "533116" }, { "input": "]+,]>>+-+++<[].][[.]->,+]]>>,<>>+<+,>]", "output": "694915" }, { "input": ".[.+<,->[++,]]++[[<-.]][.<.<]<-,>]]>.", "output": "626679" }, { "input": "+<.[[<,]<-<[<[-]<<.>]]]<--.<,-++<<<[,<.>+<+[>-,.->,<[>-><<>-<[.,+<][+],>,],],<[[,+.],<,.-,-", "output": "7032" }, { "input": ".,,>-,<-+,-<[,<>", "output": "900168" }, { "input": ">[[<][[><]+.+.[..],.<,<[],]<[>]-.-+<+->]],", "output": "419600" }, { "input": "].<.<.,++[>--[++[><", "output": "983198" }, { "input": ",]--++..<>.+.,-[-.],,<++.+<<-+[<,,.,++],>[+>", "output": "647820" }, { "input": ".<],>>[[+.+]><<<>,,+][.,-+-+<>-[,+><].+-+<[],+-+]<].>]<+-.][,,+>],[,[+", "output": "898085" }, { "input": ">,>+,-,+<-[[]][-,[<][]>.+]+<].>]+][]][,...<,-,]", "output": "586457" }, { "input": "+[-][]..+,<<+,++<<][<,]<[][+,+,++[+-],->],-.--<-[.]+]-+]<][,.>.+[<+]<+<>-", "output": "240679" }, { "input": "-.+[.<[[<],.-<-[+-->.-->>[<<.[>,]>->[<.[-++>..,.[.", "output": "185396" }, { "input": "<+[[],+,+[]-<]<<.+><,.<[.[-+>.+-]><+[]<]>[>]<<[<>.+[-><>]->>>,>.[[.>-+>]+],", "output": "915891" }, { "input": "[-.].+<<]---+[+-+-[,[[[,]-<[-[[><>]", "output": "765140" }, { "input": "[[>>[>[],+>-..]<]>-<-]<>].-[,,,.[+.-].-", "output": "416600" }, { "input": "[,[.+-,,.>+-[+[][,[][,.-+>+]]<.,,.]<+><.[<,", "output": "96775" }, { "input": "[>+,.+<<>..-+[>,><.-,--[+[>+>+[].[-[,][..<<[<,-<+-,<][][,>]++]+-<,,]++>.].[-[-[[,<[>><->]->+[+-", "output": "89776" }, { "input": ">+,][>]]]+[-..<<<+]>>.+-++.+<.,>>-[+-,+.+>]<.>-[<>]<<+[>].[++[].[++++,<[+-<<[+<[]-+][>[-+.,,],<<,>+", "output": "701493" }, { "input": "><", "output": "137" }, { "input": ">]<-.+>>..<-,[-+.]+<<>[-,.],,,[,-+>>>>>.-]>,+<.+[,<>><", "output": "481849" }, { "input": ">-[+>[++[,]-<<,.-->]+[<[-<>-]<,]<.+][]].]++]]+<,...>-[><,-", "output": "739433" }, { "input": ">[][+...+[.-[,,>,[,-.].--[..>+<>[]<,],,<<,<>[<<.+>-[]+><]+,[+[", "output": "356953" }, { "input": "<,+<-+[[-<[-,]", "output": "570514" }, { "input": "<+.,,<[+-.+[<>[>.]+<[[<]<,<].-<-", "output": "975622" }, { "input": ",-,[,,,.-]+]]>-<[+[.]]][[>-<[.[<->+.>[++[.><[+<].],]>,.,<+.--[", "output": "243567" }, { "input": "]<[--]>[-.,,.[[.,-<.]+->+++,+<+]]<>>+].]>[>].[+,><->>++,[,><,,.<-]-+-+<].][-[<].<-->-+>]<]>,", "output": "589486" }, { "input": "<].]->+,.],-][--<.--++", "output": "425408" }, { "input": "-,,....<.<-<.[[,]<+-,,+.>].<>[<>,.+]>,,>.>[<>.+<,><,>", "output": "474184" }, { "input": "].[+.,]].+->][.+-[[,--.-+.,,+]>+[-[,+.><-+[[--<[.->]<>+-]<.,]]>.<>-+,<.+[]>>[<+.][[", "output": "9085" }, { "input": ">>.<<[-,.<.].", "output": "518117" }, { "input": "-],,<<><.,.+][.[++-+..,,>-><>+,[,,,.[>.-+]]", "output": "670018" }, { "input": "],[>>-,].><-.[]>.-+]<<<+]>-,+,.,[+[<+[],]-+>+>+--+]+<,]-+],><>+,>.-,+]-,,", "output": "965603" }, { "input": ">..-", "output": "36043" }, { "input": "-[..[]+>>.>,]>.+]>.]>[.>+,>+", "output": "860720" }, { "input": "]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]", "output": "266644" }, { "input": "[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]", "output": "47113" }, { "input": "[][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][][]", "output": "889131" }, { "input": ">>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>", "output": "208877" } ]
1,693,770,014
2,147,483,647
PyPy 3-64
OK
TESTS
67
124
0
t = 0 a = input() for i in a: t = 16 * t + 8 + "><+-.,[]".index(i) print(t % 1000003)
Title: Unary Time Limit: None seconds Memory Limit: None megabytes Problem Description: Unary is a minimalistic Brainfuck dialect in which programs are written using only one token. Brainfuck programs use 8 commands: "+", "-", "[", "]", "&lt;", "&gt;", "." and "," (their meaning is not important for the purposes of this problem). Unary programs are created from Brainfuck programs using the following algorithm. First, replace each command with a corresponding binary code, using the following conversion table: - "&gt;" <=→<= 1000, - "&lt;" <=→<= 1001, - "+" <=→<= 1010, - "-" <=→<= 1011, - "." <=→<= 1100, - "," <=→<= 1101, - "[" <=→<= 1110, - "]" <=→<= 1111. Next, concatenate the resulting binary codes into one binary number in the same order as in the program. Finally, write this number using unary numeral system — this is the Unary program equivalent to the original Brainfuck one. You are given a Brainfuck program. Your task is to calculate the size of the equivalent Unary program, and print it modulo 1000003 (106<=+<=3). Input Specification: The input will consist of a single line *p* which gives a Brainfuck program. String *p* will contain between 1 and 100 characters, inclusive. Each character of *p* will be "+", "-", "[", "]", "&lt;", "&gt;", "." or ",". Output Specification: Output the size of the equivalent Unary program modulo 1000003 (106<=+<=3). Demo Input: [',.\n', '++++[&gt;,.&lt;-]\n'] Demo Output: ['220\n', '61425\n'] Note: To write a number *n* in unary numeral system, one simply has to write 1 *n* times. For example, 5 written in unary system will be 11111. In the first example replacing Brainfuck commands with binary code will give us 1101 1100. After we concatenate the codes, we'll get 11011100 in binary system, or 220 in decimal. That's exactly the number of tokens in the equivalent Unary program.
```python t = 0 a = input() for i in a: t = 16 * t + 8 + "><+-.,[]".index(i) print(t % 1000003) ```
3
540
A
Combination Lock
PROGRAMMING
800
[ "implementation" ]
null
null
Scrooge McDuck keeps his most treasured savings in a home safe with a combination lock. Each time he wants to put there the treasures that he's earned fair and square, he has to open the lock. The combination lock is represented by *n* rotating disks with digits from 0 to 9 written on them. Scrooge McDuck has to turn some disks so that the combination of digits on the disks forms a secret combination. In one move, he can rotate one disk one digit forwards or backwards. In particular, in one move he can go from digit 0 to digit 9 and vice versa. What minimum number of actions does he need for that?
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of disks on the combination lock. The second line contains a string of *n* digits — the original state of the disks. The third line contains a string of *n* digits — Scrooge McDuck's combination that opens the lock.
Print a single integer — the minimum number of moves Scrooge McDuck needs to open the lock.
[ "5\n82195\n64723\n" ]
[ "13\n" ]
In the sample he needs 13 moves: - 1 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b8967f65a723782358b93eff9ce69f336817cf70.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 2 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/07fa58573ece0d32c4d555e498d2b24d2f70f36a.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 3 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cc2275d9252aae35a6867c6a5b4ba7596e9a7626.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 4 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b100aea470fcaaab4e9529b234ba0d7875943c10.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 5 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb2cbe4324cebca65b85816262a85e473cd65967.png" style="max-width: 100.0%;max-height: 100.0%;"/>
500
[ { "input": "5\n82195\n64723", "output": "13" }, { "input": "12\n102021090898\n010212908089", "output": "16" }, { "input": "1\n8\n1", "output": "3" }, { "input": "2\n83\n57", "output": "7" }, { "input": "10\n0728592530\n1362615763", "output": "27" }, { "input": "100\n4176196363694273682807653052945037727131821799902563705176501742060696655282954944720643131654235909\n3459912084922154505910287499879975659298239371519889866585472674423008837878123067103005344986554746", "output": "245" }, { "input": "1\n8\n1", "output": "3" }, { "input": "2\n83\n57", "output": "7" }, { "input": "3\n607\n684", "output": "5" }, { "input": "4\n0809\n0636", "output": "8" }, { "input": "5\n84284\n08941", "output": "16" }, { "input": "25\n8037856825987124762280548\n9519431339078678836940020", "output": "72" }, { "input": "125\n23269567683904664184142384849516523616863461607751021071772615078579713054027902974007001544768640273491193035874486891541257\n47635110303703399505805044019026243695451609639556649012447370081552870340011971572363458960190590266459684717415349529509024", "output": "305" }, { "input": "5\n84284\n08941", "output": "16" }, { "input": "25\n8037856825987124762285484\n9519431339078678836940202", "output": "74" }, { "input": "125\n23269567689466418414238845152168634610771021717726157879713054270294007001544768647391193035874486891412573389247025830678706\n47635110307339950580504010224954516093956649124473708152870340117152363458960190596659684717415349529090241694059599629136831", "output": "357" }, { "input": "5\n84284\n08941", "output": "16" }, { "input": "25\n8378525987476228048406972\n9194339078883694020217816", "output": "55" }, { "input": "125\n23269576839046618414238484916523616863461607750210717761078579713054027902974007015447686027349193035874486891541257338624472\n47635103037033950580504401926243695451609639556490124437081552870340011971572363489601905026645984717415349529509024169604599", "output": "274" }, { "input": "1\n0\n0", "output": "0" }, { "input": "1\n7\n7", "output": "0" }, { "input": "1\n0\n5", "output": "5" }, { "input": "1\n2\n7", "output": "5" }, { "input": "1\n7\n9", "output": "2" }, { "input": "1\n9\n7", "output": "2" }, { "input": "1\n2\n9", "output": "3" }, { "input": "1\n9\n2", "output": "3" }, { "input": "25\n3164978461316464614169874\n9413979197249127496597357", "output": "66" }, { "input": "4\n9999\n9999", "output": "0" }, { "input": "2\n11\n11", "output": "0" } ]
1,692,406,731
2,147,483,647
PyPy 3-64
OK
TESTS
43
77
0
n = int(input()) orig = input() final = input() moves = 0 for i in range(n): moves += min(abs(int(orig[i])-int(final[i])), 10 - (abs(int(orig[i])-int(final[i])))) print(moves)
Title: Combination Lock Time Limit: None seconds Memory Limit: None megabytes Problem Description: Scrooge McDuck keeps his most treasured savings in a home safe with a combination lock. Each time he wants to put there the treasures that he's earned fair and square, he has to open the lock. The combination lock is represented by *n* rotating disks with digits from 0 to 9 written on them. Scrooge McDuck has to turn some disks so that the combination of digits on the disks forms a secret combination. In one move, he can rotate one disk one digit forwards or backwards. In particular, in one move he can go from digit 0 to digit 9 and vice versa. What minimum number of actions does he need for that? Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of disks on the combination lock. The second line contains a string of *n* digits — the original state of the disks. The third line contains a string of *n* digits — Scrooge McDuck's combination that opens the lock. Output Specification: Print a single integer — the minimum number of moves Scrooge McDuck needs to open the lock. Demo Input: ['5\n82195\n64723\n'] Demo Output: ['13\n'] Note: In the sample he needs 13 moves: - 1 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b8967f65a723782358b93eff9ce69f336817cf70.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 2 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/07fa58573ece0d32c4d555e498d2b24d2f70f36a.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 3 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cc2275d9252aae35a6867c6a5b4ba7596e9a7626.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 4 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b100aea470fcaaab4e9529b234ba0d7875943c10.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 5 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb2cbe4324cebca65b85816262a85e473cd65967.png" style="max-width: 100.0%;max-height: 100.0%;"/>
```python n = int(input()) orig = input() final = input() moves = 0 for i in range(n): moves += min(abs(int(orig[i])-int(final[i])), 10 - (abs(int(orig[i])-int(final[i])))) print(moves) ```
3
837
A
Text Volume
PROGRAMMING
800
[ "implementation" ]
null
null
You are given a text of single-space separated words, consisting of small and capital Latin letters. Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text. Calculate the volume of the given text.
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text. The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters.
Print one integer number — volume of text.
[ "7\nNonZERO\n", "24\nthis is zero answer text\n", "24\nHarbour Space University\n" ]
[ "5\n", "0\n", "1\n" ]
In the first example there is only one word, there are 5 capital letters in it. In the second example all of the words contain 0 capital letters.
0
[ { "input": "7\nNonZERO", "output": "5" }, { "input": "24\nthis is zero answer text", "output": "0" }, { "input": "24\nHarbour Space University", "output": "1" }, { "input": "2\nWM", "output": "2" }, { "input": "200\nLBmJKQLCKUgtTxMoDsEerwvLOXsxASSydOqWyULsRcjMYDWdDCgaDvBfATIWPVSXlbcCLHPYahhxMEYUiaxoCebghJqvmRnaNHYTKLeOiaLDnATPZAOgSNfBzaxLymTGjfzvTegbXsAthTxyDTcmBUkqyGlVGZhoazQzVSoKbTFcCRvYsgSCwjGMxBfWEwMHuagTBxkz", "output": "105" }, { "input": "199\no A r v H e J q k J k v w Q F p O R y R Z o a K R L Z E H t X y X N y y p b x B m r R S q i A x V S u i c L y M n N X c C W Z m S j e w C w T r I S X T D F l w o k f t X u n W w p Z r A k I Y E h s g", "output": "1" }, { "input": "200\nhCyIdivIiISmmYIsCLbpKcTyHaOgTUQEwnQACXnrLdHAVFLtvliTEMlzBVzTesQbhXmcqvwPDeojglBMIjOXANfyQxCSjOJyO SIqOTnRzVzseGIDDYNtrwIusScWSuEhPyEmgQIVEzXofRptjeMzzhtUQxJgcUWILUhEaaRmYRBVsjoqgmyPIKwSajdlNPccOOtWrez", "output": "50" }, { "input": "1\ne", "output": "0" }, { "input": "1\nA", "output": "1" }, { "input": "200\nABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU VWXYZABCDE KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KZ", "output": "10" }, { "input": "200\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "200" }, { "input": "200\nffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff", "output": "0" }, { "input": "24\nHarbour Space UniversitY", "output": "2" }, { "input": "5\naA AA", "output": "2" }, { "input": "10\nas AS ASDA", "output": "4" }, { "input": "10\nas AS ASDZ", "output": "4" }, { "input": "3\na A", "output": "1" }, { "input": "24\nHarbour space UniversitY", "output": "2" }, { "input": "10\nas AS ASAa", "output": "3" }, { "input": "15\naAb ABCDFGRHTJS", "output": "11" }, { "input": "53\nsdfAZEZR AZE dfdf dsdRFGSDF ZZDZSD dfsd ERBGF dsfsdfR", "output": "6" }, { "input": "10\nABC ABc AB", "output": "3" }, { "input": "10\nA c de CDE", "output": "3" }, { "input": "4\nA AB", "output": "2" }, { "input": "18\nHARbour Space UNIV", "output": "4" }, { "input": "13\na b c d e f A", "output": "1" }, { "input": "6\nA B CA", "output": "2" }, { "input": "4\naa A", "output": "1" }, { "input": "3\nA a", "output": "1" } ]
1,610,890,278
2,147,483,647
Python 3
OK
TESTS
29
61
0
n=int(input()) s=input() c=0 l=0 for i in s: m=ord(i) if(m>=65 and m<=91): c+=1 elif(i==' '): l=max(c,l) c=0 l=max(l,c) print(l)
Title: Text Volume Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a text of single-space separated words, consisting of small and capital Latin letters. Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text. Calculate the volume of the given text. Input Specification: The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text. The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters. Output Specification: Print one integer number — volume of text. Demo Input: ['7\nNonZERO\n', '24\nthis is zero answer text\n', '24\nHarbour Space University\n'] Demo Output: ['5\n', '0\n', '1\n'] Note: In the first example there is only one word, there are 5 capital letters in it. In the second example all of the words contain 0 capital letters.
```python n=int(input()) s=input() c=0 l=0 for i in s: m=ord(i) if(m>=65 and m<=91): c+=1 elif(i==' '): l=max(c,l) c=0 l=max(l,c) print(l) ```
3
353
A
Domino
PROGRAMMING
1,200
[ "implementation", "math" ]
null
null
Valera has got *n* domino pieces in a row. Each piece consists of two halves — the upper one and the lower one. Each of the halves contains a number from 1 to 6. Valera loves even integers very much, so he wants the sum of the numbers on the upper halves and the sum of the numbers on the lower halves to be even. To do that, Valera can rotate the dominoes by 180 degrees. After the rotation the upper and the lower halves swap places. This action takes one second. Help Valera find out the minimum time he must spend rotating dominoes to make his wish come true.
The first line contains integer *n* (1<=≤<=*n*<=≤<=100), denoting the number of dominoes Valera has. Next *n* lines contain two space-separated integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=6). Number *x**i* is initially written on the upper half of the *i*-th domino, *y**i* is initially written on the lower half.
Print a single number — the minimum required number of seconds. If Valera can't do the task in any time, print <=-<=1.
[ "2\n4 2\n6 4\n", "1\n2 3\n", "3\n1 4\n2 3\n4 4\n" ]
[ "0\n", "-1\n", "1\n" ]
In the first test case the sum of the numbers on the upper halves equals 10 and the sum of the numbers on the lower halves equals 6. Both numbers are even, so Valera doesn't required to do anything. In the second sample Valera has only one piece of domino. It is written 3 on the one of its halves, therefore one of the sums will always be odd. In the third case Valera can rotate the first piece, and after that the sum on the upper halves will be equal to 10, and the sum on the lower halves will be equal to 8.
500
[ { "input": "2\n4 2\n6 4", "output": "0" }, { "input": "1\n2 3", "output": "-1" }, { "input": "3\n1 4\n2 3\n4 4", "output": "1" }, { "input": "5\n5 4\n5 4\n1 5\n5 5\n3 3", "output": "1" }, { "input": "20\n1 3\n5 2\n5 2\n2 6\n2 4\n1 1\n1 3\n1 4\n2 6\n4 2\n5 6\n2 2\n6 2\n4 3\n2 1\n6 2\n6 5\n4 5\n2 4\n1 4", "output": "-1" }, { "input": "100\n2 3\n2 4\n3 3\n1 4\n5 2\n5 4\n6 6\n3 4\n1 1\n4 2\n5 1\n5 5\n5 3\n3 6\n4 1\n1 6\n1 1\n3 2\n4 5\n6 1\n6 4\n1 1\n3 4\n3 3\n2 2\n1 1\n4 4\n6 4\n3 2\n5 2\n6 4\n3 2\n3 5\n4 4\n1 4\n5 2\n3 4\n1 4\n2 2\n5 6\n3 5\n6 1\n5 5\n1 6\n6 3\n1 4\n1 5\n5 5\n4 1\n3 2\n4 1\n5 5\n5 5\n1 5\n1 2\n6 4\n1 3\n3 6\n4 3\n3 5\n6 4\n2 6\n5 5\n1 4\n2 2\n2 3\n5 1\n2 5\n1 2\n2 6\n5 5\n4 6\n1 4\n3 6\n2 3\n6 1\n6 5\n3 2\n6 4\n4 5\n4 5\n2 6\n1 3\n6 2\n1 2\n2 3\n4 3\n5 4\n3 4\n1 6\n6 6\n2 4\n4 1\n3 1\n2 6\n5 4\n1 2\n6 5\n3 6\n2 4", "output": "-1" }, { "input": "1\n2 4", "output": "0" }, { "input": "1\n1 1", "output": "-1" }, { "input": "1\n1 2", "output": "-1" }, { "input": "2\n1 1\n3 3", "output": "0" }, { "input": "2\n1 1\n2 2", "output": "-1" }, { "input": "2\n1 1\n1 2", "output": "-1" }, { "input": "5\n1 2\n6 6\n1 1\n3 3\n6 1", "output": "1" }, { "input": "5\n5 4\n2 6\n6 2\n1 4\n6 2", "output": "0" }, { "input": "10\n4 1\n3 2\n1 2\n2 6\n3 5\n2 1\n5 2\n4 6\n5 6\n3 1", "output": "0" }, { "input": "10\n6 1\n4 4\n2 6\n6 5\n3 6\n6 3\n2 4\n5 1\n1 6\n1 5", "output": "-1" }, { "input": "15\n1 2\n5 1\n6 4\n5 1\n1 6\n2 6\n3 1\n6 4\n3 1\n2 1\n6 4\n3 5\n6 2\n1 6\n1 1", "output": "1" }, { "input": "15\n3 3\n2 1\n5 4\n3 3\n5 3\n5 4\n2 5\n1 3\n3 2\n3 3\n3 5\n2 5\n4 1\n2 3\n5 4", "output": "-1" }, { "input": "20\n1 5\n6 4\n4 3\n6 2\n1 1\n1 5\n6 3\n2 3\n3 6\n3 6\n3 6\n2 5\n4 3\n4 6\n5 5\n4 6\n3 4\n4 2\n3 3\n5 2", "output": "0" }, { "input": "20\n2 1\n6 5\n3 1\n2 5\n3 5\n4 1\n1 1\n5 4\n5 1\n2 4\n1 5\n3 2\n1 2\n3 5\n5 2\n1 2\n1 3\n4 2\n2 3\n4 5", "output": "-1" }, { "input": "25\n4 1\n6 3\n1 3\n2 3\n2 4\n6 6\n4 2\n4 2\n1 5\n5 4\n1 2\n2 5\n3 6\n4 1\n3 4\n2 6\n6 1\n5 6\n6 6\n4 2\n1 5\n3 3\n3 3\n6 5\n1 4", "output": "-1" }, { "input": "25\n5 5\n4 3\n2 5\n4 3\n4 6\n4 2\n5 6\n2 1\n5 4\n6 6\n1 3\n1 4\n2 3\n5 6\n5 4\n5 6\n5 4\n6 3\n3 5\n1 3\n2 5\n2 2\n4 4\n2 1\n4 4", "output": "-1" }, { "input": "30\n3 5\n2 5\n1 6\n1 6\n2 4\n5 5\n5 4\n5 6\n5 4\n2 1\n2 4\n1 6\n3 5\n1 1\n3 6\n5 5\n1 6\n3 4\n1 4\n4 6\n2 1\n3 3\n1 3\n4 5\n1 4\n1 6\n2 1\n4 6\n3 5\n5 6", "output": "1" }, { "input": "30\n2 3\n3 1\n6 6\n1 3\n5 5\n3 6\n4 5\n2 1\n1 3\n2 3\n4 4\n2 4\n6 4\n2 4\n5 4\n2 1\n2 5\n2 5\n4 2\n1 4\n2 6\n3 2\n3 2\n6 6\n4 2\n3 4\n6 3\n6 6\n6 6\n5 5", "output": "1" }, { "input": "35\n6 1\n4 3\n1 2\n4 3\n6 4\n4 6\n3 1\n5 5\n3 4\n5 4\n4 6\n1 6\n2 4\n6 6\n5 4\n5 2\n1 3\n1 4\n3 5\n1 4\n2 3\n4 5\n4 3\n6 1\n5 3\n3 2\n5 6\n3 5\n6 5\n4 1\n1 3\n5 5\n4 6\n6 1\n1 3", "output": "1" }, { "input": "35\n4 3\n5 6\n4 5\n2 5\n6 6\n4 1\n2 2\n4 2\n3 4\n4 1\n6 6\n6 3\n1 5\n1 5\n5 6\n4 2\n4 6\n5 5\n2 2\n5 2\n1 2\n4 6\n6 6\n6 5\n2 1\n3 5\n2 5\n3 1\n5 3\n6 4\n4 6\n5 6\n5 1\n3 4\n3 5", "output": "1" }, { "input": "40\n5 6\n1 1\n3 3\n2 6\n6 6\n5 4\n6 4\n3 5\n1 3\n4 4\n4 4\n2 5\n1 3\n3 6\n5 2\n4 3\n4 4\n5 6\n2 3\n1 1\n3 1\n1 1\n1 5\n4 3\n5 5\n3 4\n6 6\n5 6\n2 2\n6 6\n2 1\n2 4\n5 2\n2 2\n1 1\n1 4\n4 2\n3 5\n5 5\n4 5", "output": "-1" }, { "input": "40\n3 2\n5 3\n4 6\n3 5\n6 1\n5 2\n1 2\n6 2\n5 3\n3 2\n4 4\n3 3\n5 2\n4 5\n1 4\n5 1\n3 3\n1 3\n1 3\n2 1\n3 6\n4 2\n4 6\n6 2\n2 5\n2 2\n2 5\n3 3\n5 3\n2 1\n3 2\n2 3\n6 3\n6 3\n3 4\n3 2\n4 3\n5 4\n2 4\n4 6", "output": "-1" }, { "input": "45\n2 4\n3 4\n6 1\n5 5\n1 1\n3 5\n4 3\n5 2\n3 6\n6 1\n4 4\n6 1\n2 1\n6 1\n3 6\n3 3\n6 1\n1 2\n1 5\n6 5\n1 3\n5 6\n6 1\n4 5\n3 6\n2 2\n1 2\n4 5\n5 6\n1 5\n6 2\n2 4\n3 3\n3 1\n6 5\n6 5\n2 1\n5 2\n2 1\n3 3\n2 2\n1 4\n2 2\n3 3\n2 1", "output": "-1" }, { "input": "45\n6 6\n1 6\n1 2\n3 5\n4 4\n2 1\n5 3\n2 1\n5 2\n5 3\n1 4\n5 2\n4 2\n3 6\n5 2\n1 5\n4 4\n5 5\n6 5\n2 1\n2 6\n5 5\n2 1\n6 1\n1 6\n6 5\n2 4\n4 3\n2 6\n2 4\n6 5\n6 4\n6 3\n6 6\n2 1\n6 4\n5 6\n5 4\n1 5\n5 1\n3 3\n5 6\n2 5\n4 5\n3 6", "output": "-1" }, { "input": "50\n4 4\n5 1\n6 4\n6 2\n6 2\n1 4\n5 5\n4 2\n5 5\n5 4\n1 3\n3 5\n6 1\n6 1\n1 4\n4 3\n5 1\n3 6\n2 2\n6 2\n4 4\n2 3\n4 2\n6 5\n5 6\n2 2\n2 4\n3 5\n1 5\n3 2\n3 4\n5 6\n4 6\n1 6\n4 5\n2 6\n2 2\n3 5\n6 4\n5 1\n4 3\n3 4\n3 5\n3 3\n2 3\n3 2\n2 2\n1 4\n3 1\n4 4", "output": "1" }, { "input": "50\n1 2\n1 4\n1 1\n4 5\n4 4\n3 2\n4 5\n3 5\n1 1\n3 4\n3 2\n2 4\n2 6\n2 6\n3 2\n4 6\n1 6\n3 1\n1 6\n2 1\n4 1\n1 6\n4 3\n6 6\n5 2\n6 4\n2 1\n4 3\n6 4\n5 1\n5 5\n3 1\n1 1\n5 5\n2 2\n2 3\n2 3\n3 5\n5 5\n1 6\n1 5\n3 6\n3 6\n1 1\n3 3\n2 6\n5 5\n1 3\n6 3\n6 6", "output": "-1" }, { "input": "55\n3 2\n5 6\n5 1\n3 5\n5 5\n1 5\n5 4\n6 3\n5 6\n4 2\n3 1\n1 2\n5 5\n1 1\n5 2\n6 3\n5 4\n3 6\n4 6\n2 6\n6 4\n1 4\n1 6\n4 1\n2 5\n4 3\n2 1\n2 1\n6 2\n3 1\n2 5\n4 4\n6 3\n2 2\n3 5\n5 1\n3 6\n5 4\n4 6\n6 5\n5 6\n2 2\n3 2\n5 2\n6 5\n2 2\n5 3\n3 1\n4 5\n6 4\n2 4\n1 2\n5 6\n2 6\n5 2", "output": "0" }, { "input": "55\n4 6\n3 3\n6 5\n5 3\n5 6\n2 3\n2 2\n3 4\n3 1\n5 4\n5 4\n2 4\n3 4\n4 5\n1 5\n6 3\n1 1\n5 1\n3 4\n1 5\n3 1\n2 5\n3 3\n4 3\n3 3\n3 1\n6 6\n3 3\n3 3\n5 6\n5 3\n3 5\n1 4\n5 5\n1 3\n1 4\n3 5\n3 6\n2 4\n2 4\n5 1\n6 4\n5 1\n5 5\n1 1\n3 2\n4 3\n5 4\n5 1\n2 4\n4 3\n6 1\n3 4\n1 5\n6 3", "output": "-1" }, { "input": "60\n2 6\n1 4\n3 2\n1 2\n3 2\n2 4\n6 4\n4 6\n1 3\n3 1\n6 5\n2 4\n5 4\n4 2\n1 6\n3 4\n4 5\n5 2\n1 5\n5 4\n3 4\n3 4\n4 4\n4 1\n6 6\n3 6\n2 4\n2 1\n4 4\n6 5\n3 1\n4 3\n1 3\n6 3\n5 5\n1 4\n3 1\n3 6\n1 5\n3 1\n1 5\n4 4\n1 3\n2 4\n6 2\n4 1\n5 3\n3 4\n5 6\n1 2\n1 6\n6 3\n1 6\n3 6\n3 4\n6 2\n4 6\n2 3\n3 3\n3 3", "output": "-1" }, { "input": "60\n2 3\n4 6\n2 4\n1 3\n5 6\n1 5\n1 2\n1 3\n5 6\n4 3\n4 2\n3 1\n1 3\n3 5\n1 5\n3 4\n2 4\n3 5\n4 5\n1 2\n3 1\n1 5\n2 5\n6 2\n1 6\n3 3\n6 2\n5 3\n1 3\n1 4\n6 4\n6 3\n4 2\n4 2\n1 4\n1 3\n3 2\n3 1\n2 1\n1 2\n3 1\n2 6\n1 4\n3 6\n3 3\n1 5\n2 4\n5 5\n6 2\n5 2\n3 3\n5 3\n3 4\n4 5\n5 6\n2 4\n5 3\n3 1\n2 4\n5 4", "output": "-1" }, { "input": "65\n5 4\n3 3\n1 2\n4 3\n3 5\n1 5\n4 5\n2 6\n1 2\n1 5\n6 3\n2 6\n4 3\n3 6\n1 5\n3 5\n4 6\n2 5\n6 5\n1 4\n3 4\n4 3\n1 4\n2 5\n6 5\n3 1\n4 3\n1 2\n1 1\n6 1\n5 2\n3 2\n1 6\n2 6\n3 3\n6 6\n4 6\n1 5\n5 1\n4 5\n1 4\n3 2\n5 4\n4 2\n6 2\n1 3\n4 2\n5 3\n6 4\n3 6\n1 2\n6 1\n6 6\n3 3\n4 2\n3 5\n4 6\n4 1\n5 4\n6 1\n5 1\n5 6\n6 1\n4 6\n5 5", "output": "1" }, { "input": "65\n5 4\n6 3\n5 4\n4 5\n5 3\n3 6\n1 3\n3 1\n1 3\n6 1\n6 4\n1 3\n2 2\n4 6\n4 1\n5 6\n6 5\n1 1\n1 3\n6 6\n4 1\n2 4\n5 4\n4 1\n5 5\n5 3\n6 2\n2 6\n4 2\n2 2\n6 2\n3 3\n4 5\n4 3\n3 1\n1 4\n4 5\n3 2\n5 5\n4 6\n5 1\n3 4\n5 4\n5 2\n1 6\n4 2\n3 4\n3 4\n1 3\n1 2\n3 3\n3 6\n6 4\n4 6\n6 2\n6 5\n3 2\n2 1\n6 4\n2 1\n1 5\n5 2\n6 5\n3 6\n5 1", "output": "1" }, { "input": "70\n4 1\n2 6\n1 1\n5 6\n5 1\n2 3\n3 5\n1 1\n1 1\n4 6\n4 3\n1 5\n2 2\n2 3\n3 1\n6 4\n3 1\n4 2\n5 4\n1 3\n3 5\n5 2\n5 6\n4 4\n4 5\n2 2\n4 5\n3 2\n3 5\n2 5\n2 6\n5 5\n2 6\n5 1\n1 1\n2 5\n3 1\n1 2\n6 4\n6 5\n5 5\n5 1\n1 5\n2 2\n6 3\n4 3\n6 2\n5 5\n1 1\n6 2\n6 6\n3 4\n2 2\n3 5\n1 5\n2 5\n4 5\n2 4\n6 3\n5 1\n2 6\n4 2\n1 4\n1 6\n6 2\n5 2\n5 6\n2 5\n5 6\n5 5", "output": "-1" }, { "input": "70\n4 3\n6 4\n5 5\n3 1\n1 2\n2 5\n4 6\n4 2\n3 2\n4 2\n1 5\n2 2\n4 3\n1 2\n6 1\n6 6\n1 6\n5 1\n2 2\n6 3\n4 2\n4 3\n1 2\n6 6\n3 3\n6 5\n6 2\n3 6\n6 6\n4 6\n5 2\n5 4\n3 3\n1 6\n5 6\n2 3\n4 6\n1 1\n1 2\n6 6\n1 1\n3 4\n1 6\n2 6\n3 4\n6 3\n5 3\n1 2\n2 3\n4 6\n2 1\n6 4\n4 6\n4 6\n4 2\n5 5\n3 5\n3 2\n4 3\n3 6\n1 4\n3 6\n1 4\n1 6\n1 5\n5 6\n4 4\n3 3\n3 5\n2 2", "output": "0" }, { "input": "75\n1 3\n4 5\n4 1\n6 5\n2 1\n1 4\n5 4\n1 5\n5 3\n1 2\n4 1\n1 1\n5 1\n5 3\n1 5\n4 2\n2 2\n6 3\n1 2\n4 3\n2 5\n5 3\n5 5\n4 1\n4 6\n2 5\n6 1\n2 4\n6 4\n5 2\n6 2\n2 4\n1 3\n5 4\n6 5\n5 4\n6 4\n1 5\n4 6\n1 5\n1 1\n4 4\n3 5\n6 3\n6 5\n1 5\n2 1\n1 5\n6 6\n2 2\n2 2\n4 4\n6 6\n5 4\n4 5\n3 2\n2 4\n1 1\n4 3\n3 2\n5 4\n1 6\n1 2\n2 2\n3 5\n2 6\n1 1\n2 2\n2 3\n6 2\n3 6\n4 4\n5 1\n4 1\n4 1", "output": "0" }, { "input": "75\n1 1\n2 1\n5 5\n6 5\n6 3\n1 6\n6 1\n4 4\n2 1\n6 2\n3 1\n6 4\n1 6\n2 2\n4 3\n4 2\n1 2\n6 2\n4 2\n5 1\n1 2\n3 2\n6 6\n6 3\n2 4\n4 1\n4 1\n2 4\n5 5\n2 3\n5 5\n4 5\n3 1\n1 5\n4 3\n2 3\n3 5\n4 6\n5 6\n1 6\n2 3\n2 2\n1 2\n5 6\n1 4\n1 5\n1 3\n6 2\n1 2\n4 2\n2 1\n1 3\n6 4\n4 1\n5 2\n6 2\n3 5\n2 3\n4 2\n5 1\n5 6\n3 2\n2 1\n6 6\n2 1\n6 2\n1 1\n3 2\n1 2\n3 5\n4 6\n1 3\n3 4\n5 5\n6 2", "output": "1" }, { "input": "80\n3 1\n6 3\n2 2\n2 2\n6 3\n6 1\n6 5\n1 4\n3 6\n6 5\n1 3\n2 4\n1 4\n3 1\n5 3\n5 3\n1 4\n2 5\n4 3\n4 4\n4 5\n6 1\n3 1\n2 6\n4 2\n3 1\n6 5\n2 6\n2 2\n5 1\n1 3\n5 1\n2 1\n4 3\n6 3\n3 5\n4 3\n5 6\n3 3\n4 1\n5 1\n6 5\n5 1\n2 5\n6 1\n3 2\n4 3\n3 3\n5 6\n1 6\n5 2\n1 5\n5 6\n6 4\n2 2\n4 2\n4 6\n4 2\n4 4\n6 5\n5 2\n6 2\n4 6\n6 4\n4 3\n5 1\n4 1\n3 5\n3 2\n3 2\n5 3\n5 4\n3 4\n1 3\n1 2\n6 6\n6 3\n6 1\n5 6\n3 2", "output": "0" }, { "input": "80\n4 5\n3 3\n3 6\n4 5\n3 4\n6 5\n1 5\n2 5\n5 6\n5 1\n5 1\n1 2\n5 5\n5 1\n2 3\n1 1\n4 5\n4 1\n1 1\n5 5\n5 6\n5 2\n5 4\n4 2\n6 2\n5 3\n3 2\n4 2\n1 3\n1 6\n2 1\n6 6\n4 5\n6 4\n2 2\n1 6\n6 2\n4 3\n2 3\n4 6\n4 6\n6 2\n3 4\n4 3\n5 5\n1 6\n3 2\n4 6\n2 3\n1 6\n5 4\n4 2\n5 4\n1 1\n4 3\n5 1\n3 6\n6 2\n3 1\n4 1\n5 3\n2 2\n3 4\n3 6\n3 5\n5 5\n5 1\n3 5\n2 6\n6 3\n6 5\n3 3\n5 6\n1 2\n3 1\n6 3\n3 4\n6 6\n6 6\n1 2", "output": "-1" }, { "input": "85\n6 3\n4 1\n1 2\n3 5\n6 4\n6 2\n2 6\n1 2\n1 5\n6 2\n1 4\n6 6\n2 4\n4 6\n4 5\n1 6\n3 1\n2 5\n5 1\n5 2\n3 5\n1 1\n4 1\n2 3\n1 1\n3 3\n6 4\n1 4\n1 1\n3 6\n1 5\n1 6\n2 5\n2 2\n5 1\n6 6\n1 3\n1 5\n5 6\n4 5\n4 3\n5 5\n1 3\n6 3\n4 6\n2 4\n5 6\n6 2\n4 5\n1 4\n1 4\n6 5\n1 6\n6 1\n1 6\n5 5\n2 1\n5 2\n2 3\n1 6\n1 6\n1 6\n5 6\n2 4\n6 5\n6 5\n4 2\n5 4\n3 4\n4 3\n6 6\n3 3\n3 2\n3 6\n2 5\n2 1\n2 5\n3 4\n1 2\n5 4\n6 2\n5 1\n1 4\n3 4\n4 5", "output": "0" }, { "input": "85\n3 1\n3 2\n6 3\n1 3\n2 1\n3 6\n1 4\n2 5\n6 5\n1 6\n1 5\n1 1\n4 3\n3 5\n4 6\n3 2\n6 6\n4 4\n4 1\n5 5\n4 2\n6 2\n2 2\n4 5\n6 1\n3 4\n4 5\n3 5\n4 2\n3 5\n4 4\n3 1\n4 4\n6 4\n1 4\n5 5\n1 5\n2 2\n6 5\n5 6\n6 5\n3 2\n3 2\n6 1\n6 5\n2 1\n4 6\n2 1\n3 1\n5 6\n1 3\n5 4\n1 4\n1 4\n5 3\n2 3\n1 3\n2 2\n5 3\n2 3\n2 3\n1 3\n3 6\n4 4\n6 6\n6 2\n5 1\n5 5\n5 5\n1 2\n1 4\n2 4\n3 6\n4 6\n6 3\n6 4\n5 5\n3 2\n5 4\n5 4\n4 5\n6 4\n2 1\n5 2\n5 1", "output": "-1" }, { "input": "90\n5 2\n5 5\n5 1\n4 6\n4 3\n5 3\n5 6\n5 1\n3 4\n1 3\n4 2\n1 6\n6 4\n1 2\n6 1\n4 1\n6 2\n6 5\n6 2\n5 4\n3 6\n1 1\n5 5\n2 2\n1 6\n3 5\n6 5\n1 6\n1 5\n2 3\n2 6\n2 3\n3 3\n1 3\n5 1\n2 5\n3 6\n1 2\n4 4\n1 6\n2 3\n1 5\n2 5\n1 3\n2 2\n4 6\n3 6\n6 3\n1 2\n4 3\n4 5\n4 6\n3 2\n6 5\n6 2\n2 5\n2 4\n1 3\n1 6\n4 3\n1 3\n6 4\n4 6\n4 1\n1 1\n4 1\n4 4\n6 2\n6 5\n1 1\n2 2\n3 1\n1 4\n6 2\n5 2\n1 4\n1 3\n6 5\n3 2\n6 4\n3 4\n2 6\n2 2\n6 3\n4 6\n1 2\n4 2\n3 4\n2 3\n1 5", "output": "-1" }, { "input": "90\n1 4\n3 5\n4 2\n2 5\n4 3\n2 6\n2 6\n3 2\n4 4\n6 1\n4 3\n2 3\n5 3\n6 6\n2 2\n6 3\n4 1\n4 4\n5 6\n6 4\n4 2\n5 6\n4 6\n4 4\n6 4\n4 1\n5 3\n3 2\n4 4\n5 2\n5 4\n6 4\n1 2\n3 3\n3 4\n6 4\n1 6\n4 2\n3 2\n1 1\n2 2\n5 1\n6 6\n4 1\n5 2\n3 6\n2 1\n2 2\n4 6\n6 5\n4 4\n5 5\n5 6\n1 6\n1 4\n5 6\n3 6\n6 3\n5 6\n6 5\n5 1\n6 1\n6 6\n6 3\n1 5\n4 5\n3 1\n6 6\n3 4\n6 2\n1 4\n2 2\n3 2\n5 6\n2 4\n1 4\n6 3\n4 6\n1 4\n5 2\n1 2\n6 5\n1 5\n1 4\n4 2\n2 5\n3 2\n5 1\n5 4\n5 3", "output": "-1" }, { "input": "95\n4 3\n3 2\n5 5\n5 3\n1 6\n4 4\n5 5\n6 5\n3 5\n1 5\n4 2\n5 1\n1 2\n2 3\n6 4\n2 3\n6 3\n6 5\n5 6\n1 4\n2 6\n2 6\n2 5\n2 1\n3 1\n3 5\n2 2\n6 1\n2 4\n4 6\n6 6\n6 4\n3 2\n5 1\n4 3\n6 5\n2 3\n4 1\n2 5\n6 5\n6 5\n6 5\n5 1\n5 4\n4 6\n3 2\n2 5\n2 6\n4 6\n6 3\n6 4\n5 6\n4 6\n2 4\n3 4\n1 4\n2 4\n2 3\n5 6\n6 4\n3 1\n5 1\n3 6\n3 5\n2 6\n6 3\n4 3\n3 1\n6 1\n2 2\n6 3\n2 2\n2 2\n6 4\n6 1\n2 1\n5 6\n5 4\n5 2\n3 4\n3 6\n2 1\n1 6\n5 5\n2 6\n2 3\n3 6\n1 3\n1 5\n5 1\n1 2\n2 2\n5 3\n6 4\n4 5", "output": "0" }, { "input": "95\n4 5\n5 6\n3 2\n5 1\n4 3\n4 1\n6 1\n5 2\n2 4\n5 3\n2 3\n6 4\n4 1\n1 6\n2 6\n2 3\n4 6\n2 4\n3 4\n4 2\n5 5\n1 1\n1 5\n4 3\n4 5\n6 2\n6 1\n6 3\n5 5\n4 1\n5 1\n2 3\n5 1\n3 6\n6 6\n4 5\n4 4\n4 3\n1 6\n6 6\n4 6\n6 4\n1 2\n6 2\n4 6\n6 6\n5 5\n6 1\n5 2\n4 5\n6 6\n6 5\n4 4\n1 5\n4 6\n4 1\n3 6\n5 1\n3 1\n4 6\n4 5\n1 3\n5 4\n4 5\n2 2\n6 1\n5 2\n6 5\n2 2\n1 1\n6 3\n6 1\n2 6\n3 3\n2 1\n4 6\n2 4\n5 5\n5 2\n3 2\n1 2\n6 6\n6 2\n5 1\n2 6\n5 2\n2 2\n5 5\n3 5\n3 3\n2 6\n5 3\n4 3\n1 6\n5 4", "output": "-1" }, { "input": "100\n1 1\n3 5\n2 1\n1 2\n3 4\n5 6\n5 6\n6 1\n5 5\n2 4\n5 5\n5 6\n6 2\n6 6\n2 6\n1 4\n2 2\n3 2\n1 3\n5 5\n6 3\n5 6\n1 1\n1 2\n1 2\n2 1\n2 3\n1 6\n4 3\n1 1\n2 5\n2 4\n4 4\n1 5\n3 3\n6 1\n3 5\n1 1\n3 6\n3 1\n4 2\n4 3\n3 6\n6 6\n1 6\n6 2\n2 5\n5 4\n6 3\n1 4\n2 6\n6 2\n3 4\n6 1\n6 5\n4 6\n6 5\n4 4\n3 1\n6 3\n5 1\n2 4\n5 1\n1 2\n2 4\n2 1\n6 6\n5 3\n4 6\n6 3\n5 5\n3 3\n1 1\n6 5\n4 3\n2 6\n1 5\n3 5\n2 4\n4 5\n1 6\n2 3\n6 3\n5 5\n2 6\n2 6\n3 4\n3 2\n6 1\n3 4\n6 4\n3 3\n2 3\n5 1\n3 1\n6 2\n2 3\n6 4\n1 4\n1 2", "output": "-1" }, { "input": "100\n1 1\n5 5\n1 2\n5 3\n5 5\n2 2\n1 5\n3 4\n3 2\n1 3\n5 6\n4 5\n2 1\n5 5\n2 2\n1 6\n6 1\n5 1\n4 1\n4 6\n3 5\n6 1\n2 3\n5 6\n3 6\n2 3\n5 6\n1 6\n3 2\n2 2\n3 3\n6 5\n5 5\n1 4\n5 6\n6 4\n1 4\n1 2\n2 6\n3 2\n6 4\n5 3\n3 3\n6 4\n4 6\n2 2\n5 6\n5 1\n1 2\n3 4\n4 5\n1 1\n3 4\n5 2\n4 5\n3 3\n1 1\n3 4\n1 6\n2 4\n1 3\n3 2\n6 5\n1 6\n3 6\n2 3\n2 6\n5 1\n5 5\n5 6\n4 1\n6 2\n3 6\n5 3\n2 2\n2 4\n6 6\n3 6\n4 6\n2 5\n5 3\n1 2\n3 4\n3 4\n6 2\n2 4\n2 2\n4 6\n3 5\n4 2\n5 6\n4 2\n2 3\n6 2\n5 6\n2 1\n3 3\n6 6\n4 3\n4 2", "output": "1" }, { "input": "1\n2 2", "output": "0" }, { "input": "3\n2 4\n6 6\n3 3", "output": "-1" }, { "input": "2\n3 6\n4 1", "output": "1" }, { "input": "3\n1 1\n1 1\n3 3", "output": "-1" }, { "input": "3\n2 3\n1 1\n2 3", "output": "1" }, { "input": "3\n2 2\n2 1\n1 2", "output": "1" }, { "input": "3\n1 1\n1 1\n1 1", "output": "-1" } ]
1,617,283,797
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
6
186
0
n=int(input()) if n==1: x,y=[int(x) for x in input().split()] if x%2+y%2==1: print("-1") else: s='False' l=0 r=0 for i in range(n): x,y=[int(x) for x in input().split()] if y%2+x%2==1: s='True' l+=x r+=y if l%2==0 and r%2==0: print("0") elif l%2==1 and r%2==1 and s=='True': print("1") else: print("-1")
Title: Domino Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera has got *n* domino pieces in a row. Each piece consists of two halves — the upper one and the lower one. Each of the halves contains a number from 1 to 6. Valera loves even integers very much, so he wants the sum of the numbers on the upper halves and the sum of the numbers on the lower halves to be even. To do that, Valera can rotate the dominoes by 180 degrees. After the rotation the upper and the lower halves swap places. This action takes one second. Help Valera find out the minimum time he must spend rotating dominoes to make his wish come true. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=100), denoting the number of dominoes Valera has. Next *n* lines contain two space-separated integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=6). Number *x**i* is initially written on the upper half of the *i*-th domino, *y**i* is initially written on the lower half. Output Specification: Print a single number — the minimum required number of seconds. If Valera can't do the task in any time, print <=-<=1. Demo Input: ['2\n4 2\n6 4\n', '1\n2 3\n', '3\n1 4\n2 3\n4 4\n'] Demo Output: ['0\n', '-1\n', '1\n'] Note: In the first test case the sum of the numbers on the upper halves equals 10 and the sum of the numbers on the lower halves equals 6. Both numbers are even, so Valera doesn't required to do anything. In the second sample Valera has only one piece of domino. It is written 3 on the one of its halves, therefore one of the sums will always be odd. In the third case Valera can rotate the first piece, and after that the sum on the upper halves will be equal to 10, and the sum on the lower halves will be equal to 8.
```python n=int(input()) if n==1: x,y=[int(x) for x in input().split()] if x%2+y%2==1: print("-1") else: s='False' l=0 r=0 for i in range(n): x,y=[int(x) for x in input().split()] if y%2+x%2==1: s='True' l+=x r+=y if l%2==0 and r%2==0: print("0") elif l%2==1 and r%2==1 and s=='True': print("1") else: print("-1") ```
0
87
D
Beautiful Road
PROGRAMMING
2,300
[ "dfs and similar", "dp", "dsu", "graphs", "implementation", "sortings", "trees" ]
D. Beautiful Road
1
256
A long time ago in some country in Asia were civil wars. Each of *n* cities wanted to seize power. That's why sometimes one city gathered an army and sent it to campaign against another city. Road making was difficult, so the country had few roads, exactly *n*<=-<=1. Also you could reach any city from any other city going on those roads. Even during the war the Oriental people remain spiritually rich and appreciate the beauty of nature. And to keep the memory of this great crusade for the centuries to come, they planted one beautiful tree by the road on which the army spent most time. The Oriental people love nature, that's why if there were several such roads, then one tree was planted by each of them. Recently, when the records of the war were found, it became clear that each city attacked each other one exactly once. There were exactly *n*(*n*<=-<=1) attacks in total. Everyone has been wondering what road after those wars became the most beautiful, that is, by which road they planted the largest number of beautiful trees.
The first line contains an integer *n* (2<=≤<=*n*<=≤<=105), which represents the number of cities. Next *n*<=-<=1 lines contain three integers each: the numbers of cities *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*), connected by the *i*-th road and the number of days *d**i* the army spends to go on it (1<=≤<=*d**i*<=≤<=109). The lengths of several roads may coincide.
Print on the first line two integers — the number of beautiful trees on the most beautiful road and the number of the most beautiful roads. Print on the second line the list of the most beautiful roads in the sorted order by the numbers' increasing. The roads are numbered from 1 to *n*<=-<=1 in the order in which they are given in the input data. Please, do not use %lld specificator to write 64-bit integers in C++. It is preferred to use the cout stream (also you may use the %I64d specificator).
[ "2\n2 1 5\n", "6\n1 2 1\n1 3 5\n3 4 2\n3 5 3\n3 6 4\n" ]
[ "2 1\n1 \n", "16 1\n2 \n" ]
none
2,000
[ { "input": "2\n2 1 5", "output": "2 1\n1 " }, { "input": "6\n1 2 1\n1 3 5\n3 4 2\n3 5 3\n3 6 4", "output": "16 1\n2 " }, { "input": "10\n10 6 43981\n4 2 6730\n1 2 35174\n5 3 61951\n8 7 43981\n7 1 6730\n5 8 6730\n9 3 52479\n6 4 18138", "output": "32 1\n4 " }, { "input": "9\n6 4 72697\n9 6 72697\n1 6 38220\n2 6 38220\n6 7 72697\n6 5 72697\n8 6 72697\n3 6 38220", "output": "16 5\n1 2 5 6 7 " }, { "input": "10\n9 2 18232\n3 4 45701\n3 9 13895\n8 9 18232\n7 6 56122\n3 5 45701\n7 1 56122\n8 10 18232\n2 7 91606", "output": "42 1\n9 " }, { "input": "7\n1 2 7485\n6 7 50574\n3 1 50574\n3 4 50574\n5 6 58286\n6 1 58286", "output": "24 1\n6 " }, { "input": "4\n2 3 1914\n4 1 31823\n4 2 26249", "output": "6 1\n2 " }, { "input": "5\n3 2 72460\n3 4 69285\n3 5 69285\n1 3 11694", "output": "8 1\n1 " }, { "input": "9\n5 9 29573\n7 3 72031\n8 5 72031\n6 7 72031\n9 7 27434\n3 2 27434\n4 7 76150\n1 9 27434", "output": "24 1\n2 " }, { "input": "5\n5 4 58958\n2 1 37970\n2 5 37970\n1 3 37970", "output": "8 2\n1 2 " }, { "input": "10\n6 5 30\n2 5 30\n7 8 81\n5 4 46\n9 10 30\n5 7 30\n10 2 46\n8 3 46\n1 10 46", "output": "32 1\n3 " }, { "input": "10\n4 2 73\n10 8 73\n8 7 83\n9 5 83\n2 1 86\n4 9 88\n2 6 30\n8 4 30\n7 3 32", "output": "32 1\n6 " }, { "input": "10\n9 4 75\n2 7 29\n1 8 19\n9 5 20\n4 1 19\n2 4 19\n10 3 29\n2 3 20\n6 4 29", "output": "32 1\n1 " }, { "input": "10\n10 1 74\n8 1 43\n6 3 59\n2 9 58\n6 4 62\n6 7 74\n2 5 62\n1 6 74\n5 3 8", "output": "42 1\n8 " }, { "input": "17\n6 16 69066\n2 5 77345\n7 17 49859\n11 15 77345\n14 2 96308\n3 5 49859\n10 13 16769\n4 17 58915\n15 1 99387\n1 3 77937\n6 8 53782\n13 14 21754\n9 4 49859\n12 8 96308\n11 9 96308\n12 7 96288", "output": "140 1\n9 " }, { "input": "9\n1 6 802882924\n7 5 807576793\n9 4 343794537\n5 3 807576793\n2 7 394413002\n9 7 353519612\n1 7 784711994\n5 8 784711994", "output": "36 1\n2 " } ]
1,692,640,792
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
30
0
print("_RANDOM_GUESS_1692640792.20967")# 1692640792.2096875
Title: Beautiful Road Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: A long time ago in some country in Asia were civil wars. Each of *n* cities wanted to seize power. That's why sometimes one city gathered an army and sent it to campaign against another city. Road making was difficult, so the country had few roads, exactly *n*<=-<=1. Also you could reach any city from any other city going on those roads. Even during the war the Oriental people remain spiritually rich and appreciate the beauty of nature. And to keep the memory of this great crusade for the centuries to come, they planted one beautiful tree by the road on which the army spent most time. The Oriental people love nature, that's why if there were several such roads, then one tree was planted by each of them. Recently, when the records of the war were found, it became clear that each city attacked each other one exactly once. There were exactly *n*(*n*<=-<=1) attacks in total. Everyone has been wondering what road after those wars became the most beautiful, that is, by which road they planted the largest number of beautiful trees. Input Specification: The first line contains an integer *n* (2<=≤<=*n*<=≤<=105), which represents the number of cities. Next *n*<=-<=1 lines contain three integers each: the numbers of cities *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*), connected by the *i*-th road and the number of days *d**i* the army spends to go on it (1<=≤<=*d**i*<=≤<=109). The lengths of several roads may coincide. Output Specification: Print on the first line two integers — the number of beautiful trees on the most beautiful road and the number of the most beautiful roads. Print on the second line the list of the most beautiful roads in the sorted order by the numbers' increasing. The roads are numbered from 1 to *n*<=-<=1 in the order in which they are given in the input data. Please, do not use %lld specificator to write 64-bit integers in C++. It is preferred to use the cout stream (also you may use the %I64d specificator). Demo Input: ['2\n2 1 5\n', '6\n1 2 1\n1 3 5\n3 4 2\n3 5 3\n3 6 4\n'] Demo Output: ['2 1\n1 \n', '16 1\n2 \n'] Note: none
```python print("_RANDOM_GUESS_1692640792.20967")# 1692640792.2096875 ```
0
467
A
George and Accommodation
PROGRAMMING
800
[ "implementation" ]
null
null
George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory. George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms. The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity.
Print a single integer — the number of rooms where George and Alex can move in.
[ "3\n1 1\n2 2\n3 3\n", "3\n1 10\n0 10\n10 10\n" ]
[ "0\n", "2\n" ]
none
500
[ { "input": "3\n1 1\n2 2\n3 3", "output": "0" }, { "input": "3\n1 10\n0 10\n10 10", "output": "2" }, { "input": "2\n36 67\n61 69", "output": "2" }, { "input": "3\n21 71\n10 88\n43 62", "output": "3" }, { "input": "3\n1 2\n2 3\n3 4", "output": "0" }, { "input": "10\n0 10\n0 20\n0 30\n0 40\n0 50\n0 60\n0 70\n0 80\n0 90\n0 100", "output": "10" }, { "input": "13\n14 16\n30 31\n45 46\n19 20\n15 17\n66 67\n75 76\n95 97\n29 30\n37 38\n0 2\n36 37\n8 9", "output": "4" }, { "input": "19\n66 67\n97 98\n89 91\n67 69\n67 68\n18 20\n72 74\n28 30\n91 92\n27 28\n75 77\n17 18\n74 75\n28 30\n16 18\n90 92\n9 11\n22 24\n52 54", "output": "12" }, { "input": "15\n55 57\n95 97\n57 59\n34 36\n50 52\n96 98\n39 40\n13 15\n13 14\n74 76\n47 48\n56 58\n24 25\n11 13\n67 68", "output": "10" }, { "input": "17\n68 69\n47 48\n30 31\n52 54\n41 43\n33 35\n38 40\n56 58\n45 46\n92 93\n73 74\n61 63\n65 66\n37 39\n67 68\n77 78\n28 30", "output": "8" }, { "input": "14\n64 66\n43 44\n10 12\n76 77\n11 12\n25 27\n87 88\n62 64\n39 41\n58 60\n10 11\n28 29\n57 58\n12 14", "output": "7" }, { "input": "38\n74 76\n52 54\n78 80\n48 49\n40 41\n64 65\n28 30\n6 8\n49 51\n68 70\n44 45\n57 59\n24 25\n46 48\n49 51\n4 6\n63 64\n76 78\n57 59\n18 20\n63 64\n71 73\n88 90\n21 22\n89 90\n65 66\n89 91\n96 98\n42 44\n1 1\n74 76\n72 74\n39 40\n75 76\n29 30\n48 49\n87 89\n27 28", "output": "22" }, { "input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "26\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2", "output": "0" }, { "input": "68\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2", "output": "68" }, { "input": "7\n0 1\n1 5\n2 4\n3 5\n4 6\n5 6\n6 8", "output": "5" }, { "input": "1\n0 0", "output": "0" }, { "input": "1\n100 100", "output": "0" }, { "input": "44\n0 8\n1 11\n2 19\n3 5\n4 29\n5 45\n6 6\n7 40\n8 19\n9 22\n10 18\n11 26\n12 46\n13 13\n14 27\n15 48\n16 25\n17 20\n18 29\n19 27\n20 45\n21 39\n22 29\n23 39\n24 42\n25 37\n26 52\n27 36\n28 43\n29 35\n30 38\n31 70\n32 47\n33 38\n34 61\n35 71\n36 51\n37 71\n38 59\n39 77\n40 70\n41 80\n42 77\n43 73", "output": "42" }, { "input": "3\n1 3\n2 7\n8 9", "output": "2" }, { "input": "53\n0 1\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53", "output": "0" }, { "input": "55\n0 0\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54", "output": "0" }, { "input": "51\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 62\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 82\n55 68\n55 70\n55 63\n55 55\n55 55\n55 55\n55 75\n55 75\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 82\n55 99\n55 60", "output": "12" }, { "input": "14\n1 1\n1 1\n1 55\n1 16\n1 1\n1 1\n1 55\n1 62\n1 53\n1 26\n1 1\n1 36\n1 2\n1 3", "output": "8" } ]
1,699,380,005
2,147,483,647
Python 3
COMPILATION_ERROR
TESTS
0
0
0
#include<bits/stdc++.h> using namespace std; int main() { int t,people,capacity,c=0; cin>>t; while(t--) { cin>>people>>capacity; if(capacity-people>=2) c++; } cout<<c<<endl; return 0; }
Title: George and Accommodation Time Limit: None seconds Memory Limit: None megabytes Problem Description: George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory. George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms. The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity. Output Specification: Print a single integer — the number of rooms where George and Alex can move in. Demo Input: ['3\n1 1\n2 2\n3 3\n', '3\n1 10\n0 10\n10 10\n'] Demo Output: ['0\n', '2\n'] Note: none
```python #include<bits/stdc++.h> using namespace std; int main() { int t,people,capacity,c=0; cin>>t; while(t--) { cin>>people>>capacity; if(capacity-people>=2) c++; } cout<<c<<endl; return 0; } ```
-1
748
B
Santa Claus and Keyboard Check
PROGRAMMING
1,500
[ "implementation", "strings" ]
null
null
Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be. In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard. You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once.
The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters.
If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes). Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct. If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair. Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes.
[ "helloworld\nehoolwlroz\n", "hastalavistababy\nhastalavistababy\n", "merrychristmas\nchristmasmerry\n" ]
[ "3\nh e\nl o\nd z\n", "0\n", "-1\n" ]
none
1,000
[ { "input": "helloworld\nehoolwlroz", "output": "3\nh e\nl o\nd z" }, { "input": "hastalavistababy\nhastalavistababy", "output": "0" }, { "input": "merrychristmas\nchristmasmerry", "output": "-1" }, { "input": "kusyvdgccw\nkusyvdgccw", "output": "0" }, { "input": "bbbbbabbab\naaaaabaaba", "output": "1\nb a" }, { "input": "zzzzzzzzzzzzzzzzzzzzz\nqwertyuiopasdfghjklzx", "output": "-1" }, { "input": "accdccdcdccacddbcacc\naccbccbcbccacbbdcacc", "output": "1\nd b" }, { "input": "giiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd\ngiiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd", "output": "0" }, { "input": "gndggadlmdefgejidmmcglbjdcmglncfmbjjndjcibnjbabfab\nfihffahlmhogfojnhmmcflkjhcmflicgmkjjihjcnkijkakgak", "output": "5\ng f\nn i\nd h\ne o\nb k" }, { "input": "ijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc\nijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc", "output": "0" }, { "input": "ab\naa", "output": "-1" }, { "input": "a\nz", "output": "1\na z" }, { "input": "zz\nzy", "output": "-1" }, { "input": "as\ndf", "output": "2\na d\ns f" }, { "input": "abc\nbca", "output": "-1" }, { "input": "rtfg\nrftg", "output": "1\nt f" }, { "input": "y\ny", "output": "0" }, { "input": "qwertyuiopasdfghjklzx\nzzzzzzzzzzzzzzzzzzzzz", "output": "-1" }, { "input": "qazwsxedcrfvtgbyhnujmik\nqwertyuiasdfghjkzxcvbnm", "output": "-1" }, { "input": "aaaaaa\nabcdef", "output": "-1" }, { "input": "qwerty\nffffff", "output": "-1" }, { "input": "dofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh\ndofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh", "output": "0" }, { "input": "acdbccddadbcbabbebbaebdcedbbcebeaccecdabadeabeecbacacdcbccedeadadedeccedecdaabcedccccbbcbcedcaccdede\ndcbaccbbdbacadaaeaadeabcebaaceaedccecbdadbedaeecadcdcbcaccebedbdbebeccebecbddacebccccaacacebcdccbebe", "output": "-1" }, { "input": "bacccbbacabbcaacbbba\nbacccbbacabbcaacbbba", "output": "0" }, { "input": "dbadbddddb\nacbacaaaac", "output": "-1" }, { "input": "dacbdbbbdd\nadbdadddaa", "output": "-1" }, { "input": "bbbbcbcbbc\ndaddbabddb", "output": "-1" }, { "input": "dddddbcdbd\nbcbbbdacdb", "output": "-1" }, { "input": "cbadcbcdaa\nabbbababbb", "output": "-1" }, { "input": "dmkgadidjgdjikgkehhfkhgkeamhdkfemikkjhhkdjfaenmkdgenijinamngjgkmgmmedfdehkhdigdnnkhmdkdindhkhndnakdgdhkdefagkedndnijekdmkdfedkhekgdkhgkimfeakdhhhgkkff\nbdenailbmnbmlcnehjjkcgnehadgickhdlecmggcimkahfdeinhflmlfadfnmncdnddhbkbhgejblnbffcgdbeilfigegfifaebnijeihkanehififlmhcbdcikhieghenbejneldkhaebjggncckk", "output": "-1" }, { "input": "acbbccabaa\nabbbbbabaa", "output": "-1" }, { "input": "ccccaccccc\naaaabaaaac", "output": "-1" }, { "input": "acbacacbbb\nacbacacbbb", "output": "0" }, { "input": "abbababbcc\nccccccccbb", "output": "-1" }, { "input": "jbcbbjiifdcbeajgdeabddbfcecafejddcigfcaedbgicjihifgbahjihcjefgabgbccdiibfjgacehbbdjceacdbdeaiibaicih\nhhihhhddcfihddhjfddhffhcididcdhffidjciddfhjdihdhdcjhdhhdhihdcjdhjhiifddhchjdidhhhfhiddifhfddddhddidh", "output": "-1" }, { "input": "ahaeheedefeehahfefhjhhedheeeedhehhfhdejdhffhhejhhhejadhefhahhadjjhdhheeeehfdaffhhefehhhefhhhhehehjda\neiefbdfgdhffieihfhjajifgjddffgifjbhigfagjhhjicaijbdaegidhiejiegaabgjidcfcjhgehhjjchcbjjdhjbiidjdjage", "output": "-1" }, { "input": "fficficbidbcbfaddifbffdbbiaccbbciiaidbcbbiadcccbccbbaibabcbbdbcibcciibiccfifbiiicadibbiaafadacdficbc\nddjhdghbgcbhadeccjdbddcbfjeiiaaigjejcaiabgechiiahibfejbeahafcfhjbihgjfgihdgdagjjhecjafjeedecehcdjhai", "output": "-1" }, { "input": "z\nz", "output": "0" }, { "input": "a\nz", "output": "1\na z" }, { "input": "z\na", "output": "1\nz a" }, { "input": "aa\nzz", "output": "1\na z" }, { "input": "az\nza", "output": "1\na z" }, { "input": "aa\nza", "output": "-1" }, { "input": "za\nzz", "output": "-1" }, { "input": "aa\nab", "output": "-1" }, { "input": "hehe\nheeh", "output": "-1" }, { "input": "bd\ncc", "output": "-1" }, { "input": "he\nhh", "output": "-1" }, { "input": "hee\nheh", "output": "-1" }, { "input": "aa\nac", "output": "-1" }, { "input": "ab\naa", "output": "-1" }, { "input": "hello\nehlol", "output": "-1" }, { "input": "ac\naa", "output": "-1" }, { "input": "aaabbb\nbbbaab", "output": "-1" }, { "input": "aa\nfa", "output": "-1" }, { "input": "hg\nee", "output": "-1" }, { "input": "helloworld\nehoolwlrow", "output": "-1" }, { "input": "abb\nbab", "output": "-1" }, { "input": "aaa\naae", "output": "-1" }, { "input": "aba\nbaa", "output": "-1" }, { "input": "aa\nba", "output": "-1" }, { "input": "da\naa", "output": "-1" }, { "input": "aaa\naab", "output": "-1" }, { "input": "xy\nzz", "output": "-1" } ]
1,593,537,996
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
13
171
409,600
from collections import defaultdict s = input() p = input() t=defaultdict(list) for i in range(len(s)): if s[i]!=p[i]: t[s[i]].append(p[i]) r='YES' #print(t) for c in t: if len(set(t[c]))!=1: r='NO' break a=[] m=set() l=0 if r=='YES': for c in t: #print(t[t[c][0]][0]) if t[c][0] in t: if t[t[c][0]][0]!=c: r='NO' break if c not in m: l+=1 a.append([c,t[c][0]]) m.add(c) m.add(t[c][0]) if r=='NO': print(-1) else: print(l) for i in range(len(a)): print(a[i][0],a[i][1])
Title: Santa Claus and Keyboard Check Time Limit: None seconds Memory Limit: None megabytes Problem Description: Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be. In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard. You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once. Input Specification: The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters. Output Specification: If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes). Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct. If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair. Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes. Demo Input: ['helloworld\nehoolwlroz\n', 'hastalavistababy\nhastalavistababy\n', 'merrychristmas\nchristmasmerry\n'] Demo Output: ['3\nh e\nl o\nd z\n', '0\n', '-1\n'] Note: none
```python from collections import defaultdict s = input() p = input() t=defaultdict(list) for i in range(len(s)): if s[i]!=p[i]: t[s[i]].append(p[i]) r='YES' #print(t) for c in t: if len(set(t[c]))!=1: r='NO' break a=[] m=set() l=0 if r=='YES': for c in t: #print(t[t[c][0]][0]) if t[c][0] in t: if t[t[c][0]][0]!=c: r='NO' break if c not in m: l+=1 a.append([c,t[c][0]]) m.add(c) m.add(t[c][0]) if r=='NO': print(-1) else: print(l) for i in range(len(a)): print(a[i][0],a[i][1]) ```
0
58
A
Chat room
PROGRAMMING
1,000
[ "greedy", "strings" ]
A. Chat room
1
256
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
If Vasya managed to say hello, print "YES", otherwise print "NO".
[ "ahhellllloou\n", "hlelo\n" ]
[ "YES\n", "NO\n" ]
none
500
[ { "input": "ahhellllloou", "output": "YES" }, { "input": "hlelo", "output": "NO" }, { "input": "helhcludoo", "output": "YES" }, { "input": "hehwelloho", "output": "YES" }, { "input": "pnnepelqomhhheollvlo", "output": "YES" }, { "input": "tymbzjyqhymedasloqbq", "output": "NO" }, { "input": "yehluhlkwo", "output": "NO" }, { "input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello", "output": "YES" }, { "input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq", "output": "YES" }, { "input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi", "output": "YES" }, { "input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo", "output": "YES" }, { "input": "lqllcolohwflhfhlnaow", "output": "NO" }, { "input": "heheeellollvoo", "output": "YES" }, { "input": "hellooo", "output": "YES" }, { "input": "o", "output": "NO" }, { "input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv", "output": "YES" }, { "input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk", "output": "YES" }, { "input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry", "output": "NO" }, { "input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq", "output": "NO" }, { "input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi", "output": "YES" }, { "input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm", "output": "YES" }, { "input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac", "output": "NO" }, { "input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok", "output": "YES" }, { "input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz", "output": "YES" }, { "input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb", "output": "YES" }, { "input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla", "output": "YES" }, { "input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz", "output": "YES" }, { "input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti", "output": "YES" }, { "input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli", "output": "YES" }, { "input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo", "output": "YES" }, { "input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk", "output": "NO" }, { "input": "loee", "output": "NO" }, { "input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo", "output": "NO" }, { "input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi", "output": "YES" }, { "input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv", "output": "NO" }, { "input": "hello", "output": "YES" }, { "input": "oohell", "output": "NO" }, { "input": "hell", "output": "NO" }, { "input": "eloellohoelo", "output": "NO" }, { "input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo", "output": "YES" } ]
1,689,482,038
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
15
0
soma = 0 for i in range(int(input())): soma += sum([int(x) for x in input().split()]) result = "YES" if soma == 0 else "NO" print(result)
Title: Chat room Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*. Input Specification: The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters. Output Specification: If Vasya managed to say hello, print "YES", otherwise print "NO". Demo Input: ['ahhellllloou\n', 'hlelo\n'] Demo Output: ['YES\n', 'NO\n'] Note: none
```python soma = 0 for i in range(int(input())): soma += sum([int(x) for x in input().split()]) result = "YES" if soma == 0 else "NO" print(result) ```
-1
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,656,454,974
2,147,483,647
Python 3
OK
TESTS
30
92
0
a=input() c=0 s=0 for i in a: if i.isupper(): c+=1 else: s+=1 if c<=s: print(a.lower()) elif c>s: print(a.upper())
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python a=input() c=0 s=0 for i in a: if i.isupper(): c+=1 else: s+=1 if c<=s: print(a.lower()) elif c>s: print(a.upper()) ```
3.977
697
B
Barnicle
PROGRAMMING
1,400
[ "brute force", "implementation", "math", "strings" ]
null
null
Barney is standing in a bar and starring at a pretty girl. He wants to shoot her with his heart arrow but he needs to know the distance between him and the girl to make his shot accurate. Barney asked the bar tender Carl about this distance value, but Carl was so busy talking to the customers so he wrote the distance value (it's a real number) on a napkin. The problem is that he wrote it in scientific notation. The scientific notation of some real number *x* is the notation of form *AeB*, where *A* is a real number and *B* is an integer and *x*<==<=*A*<=×<=10*B* is true. In our case *A* is between 0 and 9 and *B* is non-negative. Barney doesn't know anything about scientific notation (as well as anything scientific at all). So he asked you to tell him the distance value in usual decimal representation with minimal number of digits after the decimal point (and no decimal point if it is an integer). See the output format for better understanding.
The first and only line of input contains a single string of form *a*.*deb* where *a*, *d* and *b* are integers and *e* is usual character 'e' (0<=≤<=*a*<=≤<=9,<=0<=≤<=*d*<=&lt;<=10100,<=0<=≤<=*b*<=≤<=100) — the scientific notation of the desired distance value. *a* and *b* contain no leading zeros and *d* contains no trailing zeros (but may be equal to 0). Also, *b* can not be non-zero if *a* is zero.
Print the only real number *x* (the desired distance value) in the only line in its decimal notation. Thus if *x* is an integer, print it's integer value without decimal part and decimal point and without leading zeroes. Otherwise print *x* in a form of *p*.*q* such that *p* is an integer that have no leading zeroes (but may be equal to zero), and *q* is an integer that have no trailing zeroes (and may not be equal to zero).
[ "8.549e2\n", "8.549e3\n", "0.33e0\n" ]
[ "854.9\n", "8549\n", "0.33\n" ]
none
1,000
[ { "input": "8.549e2", "output": "854.9" }, { "input": "8.549e3", "output": "8549" }, { "input": "0.33e0", "output": "0.33" }, { "input": "1.31e1", "output": "13.1" }, { "input": "1.038e0", "output": "1.038" }, { "input": "8.25983e5", "output": "825983" }, { "input": "8.77056e6", "output": "8770560" }, { "input": "4.28522890224373996236468418851564462623381500262405e30", "output": "4285228902243739962364684188515.64462623381500262405" }, { "input": "4.09336275522154223604344399571355118601483591618747e85", "output": "40933627552215422360434439957135511860148359161874700000000000000000000000000000000000" }, { "input": "2.0629094807595491132306264747042243928486303384791951220362096240931158821630792563855724946791054152e85", "output": "20629094807595491132306264747042243928486303384791951220362096240931158821630792563855.724946791054152" }, { "input": "0.7e0", "output": "0.7" }, { "input": "0.75e0", "output": "0.75" }, { "input": "0.3299209894804593859495773277850971828150469972132991597085582244596065712639531451e0", "output": "0.3299209894804593859495773277850971828150469972132991597085582244596065712639531451" }, { "input": "0.1438410315232821898580886049593487999249997483354329425897344341660326482795266134253882860655873197e0", "output": "0.1438410315232821898580886049593487999249997483354329425897344341660326482795266134253882860655873197" }, { "input": "1.7282220592677586155528202123627915992640276211396528871e0", "output": "1.7282220592677586155528202123627915992640276211396528871" }, { "input": "1.91641639840522198229453882518758458881136053577016034847369545687354908120008812644841021662133251e89", "output": "191641639840522198229453882518758458881136053577016034847369545687354908120008812644841021.662133251" }, { "input": "7.0e100", "output": "70000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000" }, { "input": "1.7390193766535948887334396973270576641602486903095355363287177932797263236084900516267835886881779051e100", "output": "17390193766535948887334396973270576641602486903095355363287177932797263236084900516267835886881779051" }, { "input": "4.6329496401734172195e50", "output": "463294964017341721950000000000000000000000000000000" }, { "input": "2.806303180541991592302230754797823269634e39", "output": "2806303180541991592302230754797823269634" }, { "input": "5.8743505652112692964508303637002e64", "output": "58743505652112692964508303637002000000000000000000000000000000000" }, { "input": "6.8778661934058405217475274375560252344373481358834598914724956711e31", "output": "68778661934058405217475274375560.252344373481358834598914724956711" }, { "input": "9.4e100", "output": "94000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000" }, { "input": "3.2371070627618799335840070613481911588919091676203766004638236894609230433739617153911544972468224113e50", "output": "323710706276187993358400706134819115889190916762037.66004638236894609230433739617153911544972468224113" }, { "input": "4.8133196117786711780806656271869913331127534865038175322117213586960112955982462632332925275690064929e0", "output": "4.8133196117786711780806656271869913331127534865038175322117213586960112955982462632332925275690064929" }, { "input": "7.7060200967648284035308242369118752594772564843152902469146249303976625961451358536989314351204406625e1", "output": "77.060200967648284035308242369118752594772564843152902469146249303976625961451358536989314351204406625" }, { "input": "8.1089882894234341219420177467603732503076124872188628349726911362800974096687340341040683238197289136e31", "output": "81089882894234341219420177467603.732503076124872188628349726911362800974096687340341040683238197289136" }, { "input": "9.6576660076120385279859051742522204516365367878315639937449558670629833997839913220859648564428655877e99", "output": "9657666007612038527985905174252220451636536787831563993744955867062983399783991322085964856442865587.7" }, { "input": "0.0e0", "output": "0" }, { "input": "1.0e0", "output": "1" }, { "input": "8.0e0", "output": "8" }, { "input": "3.0e0", "output": "3" }, { "input": "4.0e0", "output": "4" }, { "input": "2.0e0", "output": "2" }, { "input": "9.0e0", "output": "9" }, { "input": "0.888888e0", "output": "0.888888" }, { "input": "9.99999999999999999999999999999999999999999999999999999999999999999999999999999999e100", "output": "99999999999999999999999999999999999999999999999999999999999999999999999999999999900000000000000000000" }, { "input": "5.0e0", "output": "5" }, { "input": "1.0e10", "output": "10000000000" }, { "input": "1.0e5", "output": "100000" }, { "input": "6.0e0", "output": "6" }, { "input": "1.1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111e1", "output": "11.111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111" } ]
1,475,915,694
2,147,483,647
Python 3
OK
TESTS
42
62
4,608,000
s=input() i=len(s)-1 while s[i]!='e': i-=1 b=int(s[i+1:len(s)]) j=0 while s[j]!='.': j+=1 p="" if s[i-1]=='0': p=s[0:j] for i in range(b): p=p+'0' elif i-j>b+1: p=s[0:j]+s[j+1:j+b+1]+'.'+s[j+b+1:i] else: p=s[0:j]+s[j+1:i]+s[j+b+1:i] for i in range(b-(i-j-1)): p=p+'0' print(p)
Title: Barnicle Time Limit: None seconds Memory Limit: None megabytes Problem Description: Barney is standing in a bar and starring at a pretty girl. He wants to shoot her with his heart arrow but he needs to know the distance between him and the girl to make his shot accurate. Barney asked the bar tender Carl about this distance value, but Carl was so busy talking to the customers so he wrote the distance value (it's a real number) on a napkin. The problem is that he wrote it in scientific notation. The scientific notation of some real number *x* is the notation of form *AeB*, where *A* is a real number and *B* is an integer and *x*<==<=*A*<=×<=10*B* is true. In our case *A* is between 0 and 9 and *B* is non-negative. Barney doesn't know anything about scientific notation (as well as anything scientific at all). So he asked you to tell him the distance value in usual decimal representation with minimal number of digits after the decimal point (and no decimal point if it is an integer). See the output format for better understanding. Input Specification: The first and only line of input contains a single string of form *a*.*deb* where *a*, *d* and *b* are integers and *e* is usual character 'e' (0<=≤<=*a*<=≤<=9,<=0<=≤<=*d*<=&lt;<=10100,<=0<=≤<=*b*<=≤<=100) — the scientific notation of the desired distance value. *a* and *b* contain no leading zeros and *d* contains no trailing zeros (but may be equal to 0). Also, *b* can not be non-zero if *a* is zero. Output Specification: Print the only real number *x* (the desired distance value) in the only line in its decimal notation. Thus if *x* is an integer, print it's integer value without decimal part and decimal point and without leading zeroes. Otherwise print *x* in a form of *p*.*q* such that *p* is an integer that have no leading zeroes (but may be equal to zero), and *q* is an integer that have no trailing zeroes (and may not be equal to zero). Demo Input: ['8.549e2\n', '8.549e3\n', '0.33e0\n'] Demo Output: ['854.9\n', '8549\n', '0.33\n'] Note: none
```python s=input() i=len(s)-1 while s[i]!='e': i-=1 b=int(s[i+1:len(s)]) j=0 while s[j]!='.': j+=1 p="" if s[i-1]=='0': p=s[0:j] for i in range(b): p=p+'0' elif i-j>b+1: p=s[0:j]+s[j+1:j+b+1]+'.'+s[j+b+1:i] else: p=s[0:j]+s[j+1:i]+s[j+b+1:i] for i in range(b-(i-j-1)): p=p+'0' print(p) ```
3
999
C
Alphabetic Removals
PROGRAMMING
1,200
[ "implementation" ]
null
null
You are given a string $s$ consisting of $n$ lowercase Latin letters. Polycarp wants to remove exactly $k$ characters ($k \le n$) from the string $s$. Polycarp uses the following algorithm $k$ times: - if there is at least one letter 'a', remove the leftmost occurrence and stop the algorithm, otherwise go to next item; - if there is at least one letter 'b', remove the leftmost occurrence and stop the algorithm, otherwise go to next item; - ... - remove the leftmost occurrence of the letter 'z' and stop the algorithm. This algorithm removes a single letter from the string. Polycarp performs this algorithm exactly $k$ times, thus removing exactly $k$ characters. Help Polycarp find the resulting string.
The first line of input contains two integers $n$ and $k$ ($1 \le k \le n \le 4 \cdot 10^5$) — the length of the string and the number of letters Polycarp will remove. The second line contains the string $s$ consisting of $n$ lowercase Latin letters.
Print the string that will be obtained from $s$ after Polycarp removes exactly $k$ letters using the above algorithm $k$ times. If the resulting string is empty, print nothing. It is allowed to print nothing or an empty line (line break).
[ "15 3\ncccaabababaccbc\n", "15 9\ncccaabababaccbc\n", "1 1\nu\n" ]
[ "cccbbabaccbc\n", "cccccc\n", "" ]
none
0
[ { "input": "15 3\ncccaabababaccbc", "output": "cccbbabaccbc" }, { "input": "15 9\ncccaabababaccbc", "output": "cccccc" }, { "input": "5 2\nzyzyx", "output": "zzy" }, { "input": "4 3\nhack", "output": "k" }, { "input": "4 3\nzzzz", "output": "z" }, { "input": "6 5\naaccdd", "output": "d" }, { "input": "2 1\nzz", "output": "z" }, { "input": "14 5\nhxehmvkybeklnj", "output": "xmvkyklnj" } ]
1,655,549,731
2,147,483,647
Python 3
OK
TESTS
44
1,200
28,467,200
n,k = map(int, input().split()) s = input() si =[] for i in range(n): si.append([i, s[i]]) si.sort(key=lambda x: x[1]) si = si[k:] si.sort() for i in si: print(i[1], end='')
Title: Alphabetic Removals Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a string $s$ consisting of $n$ lowercase Latin letters. Polycarp wants to remove exactly $k$ characters ($k \le n$) from the string $s$. Polycarp uses the following algorithm $k$ times: - if there is at least one letter 'a', remove the leftmost occurrence and stop the algorithm, otherwise go to next item; - if there is at least one letter 'b', remove the leftmost occurrence and stop the algorithm, otherwise go to next item; - ... - remove the leftmost occurrence of the letter 'z' and stop the algorithm. This algorithm removes a single letter from the string. Polycarp performs this algorithm exactly $k$ times, thus removing exactly $k$ characters. Help Polycarp find the resulting string. Input Specification: The first line of input contains two integers $n$ and $k$ ($1 \le k \le n \le 4 \cdot 10^5$) — the length of the string and the number of letters Polycarp will remove. The second line contains the string $s$ consisting of $n$ lowercase Latin letters. Output Specification: Print the string that will be obtained from $s$ after Polycarp removes exactly $k$ letters using the above algorithm $k$ times. If the resulting string is empty, print nothing. It is allowed to print nothing or an empty line (line break). Demo Input: ['15 3\ncccaabababaccbc\n', '15 9\ncccaabababaccbc\n', '1 1\nu\n'] Demo Output: ['cccbbabaccbc\n', 'cccccc\n', ''] Note: none
```python n,k = map(int, input().split()) s = input() si =[] for i in range(n): si.append([i, s[i]]) si.sort(key=lambda x: x[1]) si = si[k:] si.sort() for i in si: print(i[1], end='') ```
3
446
A
DZY Loves Sequences
PROGRAMMING
1,600
[ "dp", "implementation", "two pointers" ]
null
null
DZY has a sequence *a*, consisting of *n* integers. We'll call a sequence *a**i*,<=*a**i*<=+<=1,<=...,<=*a**j* (1<=≤<=*i*<=≤<=*j*<=≤<=*n*) a subsegment of the sequence *a*. The value (*j*<=-<=*i*<=+<=1) denotes the length of the subsegment. Your task is to find the longest subsegment of *a*, such that it is possible to change at most one number (change one number to any integer you want) from the subsegment to make the subsegment strictly increasing. You only need to output the length of the subsegment you find.
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
In a single line print the answer to the problem — the maximum length of the required subsegment.
[ "6\n7 2 3 1 5 6\n" ]
[ "5\n" ]
You can choose subsegment *a*<sub class="lower-index">2</sub>, *a*<sub class="lower-index">3</sub>, *a*<sub class="lower-index">4</sub>, *a*<sub class="lower-index">5</sub>, *a*<sub class="lower-index">6</sub> and change its 3rd element (that is *a*<sub class="lower-index">4</sub>) to 4.
500
[ { "input": "6\n7 2 3 1 5 6", "output": "5" }, { "input": "10\n424238336 649760493 681692778 714636916 719885387 804289384 846930887 957747794 596516650 189641422", "output": "9" }, { "input": "50\n804289384 846930887 681692778 714636916 957747794 424238336 719885387 649760493 596516650 189641422 25202363 350490028 783368691 102520060 44897764 967513927 365180541 540383427 304089173 303455737 35005212 521595369 294702568 726956430 336465783 861021531 59961394 89018457 101513930 125898168 131176230 145174068 233665124 278722863 315634023 369133070 468703136 628175012 635723059 653377374 656478043 801979803 859484422 914544920 608413785 756898538 734575199 973594325 149798316 38664371", "output": "19" }, { "input": "1\n1", "output": "1" }, { "input": "2\n1000000000 1000000000", "output": "2" }, { "input": "5\n1 2 3 4 1", "output": "5" }, { "input": "10\n1 2 3 4 5 5 6 7 8 9", "output": "6" }, { "input": "5\n1 1 1 1 1", "output": "2" }, { "input": "5\n1 1 2 3 4", "output": "5" }, { "input": "5\n1 2 3 1 6", "output": "5" }, { "input": "1\n42", "output": "1" }, { "input": "5\n1 2 42 3 4", "output": "4" }, { "input": "5\n1 5 9 6 10", "output": "4" }, { "input": "5\n5 2 3 4 5", "output": "5" }, { "input": "3\n2 1 3", "output": "3" }, { "input": "5\n1 2 3 3 4", "output": "4" }, { "input": "8\n1 2 3 4 1 5 6 7", "output": "5" }, { "input": "1\n3", "output": "1" }, { "input": "3\n5 1 2", "output": "3" }, { "input": "4\n1 4 3 4", "output": "4" }, { "input": "6\n7 2 12 4 5 6", "output": "5" }, { "input": "6\n7 2 3 1 4 5", "output": "4" }, { "input": "6\n2 3 5 5 6 7", "output": "6" }, { "input": "5\n2 4 7 6 8", "output": "5" }, { "input": "3\n3 1 2", "output": "3" }, { "input": "3\n1 1 2", "output": "3" }, { "input": "2\n1 2", "output": "2" }, { "input": "5\n4 1 2 3 4", "output": "5" }, { "input": "20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 3 4 5 6", "output": "7" }, { "input": "4\n1 2 1 3", "output": "3" }, { "input": "4\n4 3 1 2", "output": "3" }, { "input": "6\n1 2 2 3 4 5", "output": "5" }, { "input": "4\n1 1 1 2", "output": "3" }, { "input": "4\n5 1 2 3", "output": "4" }, { "input": "5\n9 1 2 3 4", "output": "5" }, { "input": "2\n1 1", "output": "2" }, { "input": "5\n1 3 2 4 5", "output": "4" }, { "input": "6\n1 2 1 2 4 5", "output": "5" }, { "input": "10\n1 1 5 3 2 9 9 7 7 6", "output": "3" }, { "input": "6\n1 2 3 100000 100 101", "output": "6" }, { "input": "4\n3 3 3 4", "output": "3" }, { "input": "3\n4 3 5", "output": "3" }, { "input": "5\n1 3 2 3 4", "output": "4" }, { "input": "10\n1 2 3 4 5 10 10 11 12 13", "output": "10" }, { "input": "7\n11 2 1 2 13 4 14", "output": "5" }, { "input": "3\n5 1 3", "output": "3" }, { "input": "4\n1 5 3 4", "output": "4" }, { "input": "10\n1 2 3 4 100 6 7 8 9 10", "output": "10" }, { "input": "3\n5 3 5", "output": "3" }, { "input": "5\n100 100 7 8 9", "output": "4" }, { "input": "5\n1 2 3 4 5", "output": "5" }, { "input": "5\n1 2 4 4 5", "output": "5" }, { "input": "6\n7 4 5 6 7 8", "output": "6" }, { "input": "9\n3 4 1 6 3 4 5 6 7", "output": "7" }, { "input": "3\n1000 1 2", "output": "3" }, { "input": "3\n20 1 9", "output": "3" }, { "input": "6\n7 2 3 1 4 6", "output": "4" }, { "input": "3\n100 5 10", "output": "3" }, { "input": "4\n2 2 2 3", "output": "3" }, { "input": "6\n4 2 8 1 2 5", "output": "4" }, { "input": "3\n25 1 6", "output": "3" }, { "input": "10\n17 99 23 72 78 36 5 43 95 9", "output": "5" }, { "input": "7\n21 16 22 21 11 13 19", "output": "4" }, { "input": "5\n1 2 5 3 4", "output": "4" }, { "input": "6\n2 2 2 3 4 5", "output": "5" }, { "input": "5\n1 3 1 2 3", "output": "4" }, { "input": "3\n81 33 64", "output": "3" }, { "input": "7\n14 3 3 19 13 19 15", "output": "4" }, { "input": "9\n1 2 3 4 5 42 7 8 9", "output": "9" }, { "input": "5\n2 3 7 5 6", "output": "5" }, { "input": "5\n1 3 3 4 5", "output": "5" }, { "input": "6\n1 5 4 3 4 5", "output": "4" } ]
1,620,648,946
2,147,483,647
Python 3
OK
TESTS
92
187
15,257,600
n=int(input()) a=[0]+list(map(int,input().split()))+[0] l=[] st=1 for i in range(2,n+2): if a[i]<=a[i-1]: l.append([st,i-1]) st=i if len(l)==1: print(n) exit() mx=0 for i in range(1,len(l)): lf=l[i-1][1] rt=l[i][0] ln1=l[i][1]-l[i][0]+1 ln2=l[i-1][1]-l[i-1][0]+1 if a[rt+1]-a[lf]>1 or a[rt]-a[lf-1]>1: tm=ln1+ln2 else: tm=max(ln1,ln2)+1 mx=max(mx,tm) print(mx)
Title: DZY Loves Sequences Time Limit: None seconds Memory Limit: None megabytes Problem Description: DZY has a sequence *a*, consisting of *n* integers. We'll call a sequence *a**i*,<=*a**i*<=+<=1,<=...,<=*a**j* (1<=≤<=*i*<=≤<=*j*<=≤<=*n*) a subsegment of the sequence *a*. The value (*j*<=-<=*i*<=+<=1) denotes the length of the subsegment. Your task is to find the longest subsegment of *a*, such that it is possible to change at most one number (change one number to any integer you want) from the subsegment to make the subsegment strictly increasing. You only need to output the length of the subsegment you find. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109). Output Specification: In a single line print the answer to the problem — the maximum length of the required subsegment. Demo Input: ['6\n7 2 3 1 5 6\n'] Demo Output: ['5\n'] Note: You can choose subsegment *a*<sub class="lower-index">2</sub>, *a*<sub class="lower-index">3</sub>, *a*<sub class="lower-index">4</sub>, *a*<sub class="lower-index">5</sub>, *a*<sub class="lower-index">6</sub> and change its 3rd element (that is *a*<sub class="lower-index">4</sub>) to 4.
```python n=int(input()) a=[0]+list(map(int,input().split()))+[0] l=[] st=1 for i in range(2,n+2): if a[i]<=a[i-1]: l.append([st,i-1]) st=i if len(l)==1: print(n) exit() mx=0 for i in range(1,len(l)): lf=l[i-1][1] rt=l[i][0] ln1=l[i][1]-l[i][0]+1 ln2=l[i-1][1]-l[i-1][0]+1 if a[rt+1]-a[lf]>1 or a[rt]-a[lf-1]>1: tm=ln1+ln2 else: tm=max(ln1,ln2)+1 mx=max(mx,tm) print(mx) ```
3
768
A
Oath of the Night's Watch
PROGRAMMING
900
[ "constructive algorithms", "sortings" ]
null
null
"Night gathers, and now my watch begins. It shall not end until my death. I shall take no wife, hold no lands, father no children. I shall wear no crowns and win no glory. I shall live and die at my post. I am the sword in the darkness. I am the watcher on the walls. I am the shield that guards the realms of men. I pledge my life and honor to the Night's Watch, for this night and all the nights to come." — The Night's Watch oath. With that begins the watch of Jon Snow. He is assigned the task to support the stewards. This time he has *n* stewards with him whom he has to provide support. Each steward has his own strength. Jon Snow likes to support a steward only if there exists at least one steward who has strength strictly less than him and at least one steward who has strength strictly greater than him. Can you find how many stewards will Jon support?
First line consists of a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of stewards with Jon Snow. Second line consists of *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) representing the values assigned to the stewards.
Output a single integer representing the number of stewards which Jon will feed.
[ "2\n1 5\n", "3\n1 2 5\n" ]
[ "0", "1" ]
In the first sample, Jon Snow cannot support steward with strength 1 because there is no steward with strength less than 1 and he cannot support steward with strength 5 because there is no steward with strength greater than 5. In the second sample, Jon Snow can support steward with strength 2 because there are stewards with strength less than 2 and greater than 2.
500
[ { "input": "2\n1 5", "output": "0" }, { "input": "3\n1 2 5", "output": "1" }, { "input": "4\n1 2 3 4", "output": "2" }, { "input": "8\n7 8 9 4 5 6 1 2", "output": "6" }, { "input": "1\n1", "output": "0" }, { "input": "1\n100", "output": "0" }, { "input": "205\n5 5 3 3 6 2 9 3 8 9 6 6 10 8 1 5 3 3 1 2 9 9 9 3 9 10 3 9 8 3 5 6 6 4 6 9 2 9 10 9 5 6 6 7 4 2 6 3 4 1 10 1 7 2 7 7 3 2 6 5 5 2 9 3 8 8 7 6 6 4 2 2 6 2 3 5 7 2 2 10 1 4 6 9 2 3 7 2 2 7 4 4 9 10 7 5 8 6 5 3 6 10 2 7 5 6 6 8 3 3 9 4 3 5 7 9 3 2 1 1 3 2 1 9 3 1 4 4 10 2 5 5 8 1 4 8 5 3 1 10 8 6 5 8 3 5 4 5 4 4 6 7 2 8 10 8 7 6 6 9 6 7 1 10 3 2 5 10 4 4 5 4 3 4 8 5 3 8 10 3 10 9 7 2 1 8 6 4 6 5 8 10 2 6 7 4 9 4 5 1 8 7 10 3 1", "output": "174" }, { "input": "4\n1000000000 99999999 1000000000 1000000000", "output": "0" }, { "input": "3\n2 2 2", "output": "0" }, { "input": "5\n1 1 1 1 1", "output": "0" }, { "input": "3\n1 1 1", "output": "0" }, { "input": "6\n1 1 3 3 2 2", "output": "2" }, { "input": "7\n1 1 1 1 1 1 1", "output": "0" }, { "input": "4\n1 1 2 5", "output": "1" }, { "input": "3\n0 0 0", "output": "0" }, { "input": "5\n0 0 0 0 0", "output": "0" }, { "input": "5\n1 1 1 1 5", "output": "0" }, { "input": "5\n1 1 2 3 3", "output": "1" }, { "input": "3\n1 1 3", "output": "0" }, { "input": "3\n2 2 3", "output": "0" }, { "input": "1\n6", "output": "0" }, { "input": "5\n1 5 3 5 1", "output": "1" }, { "input": "7\n1 2 2 2 2 2 3", "output": "5" }, { "input": "4\n2 2 2 2", "output": "0" }, { "input": "9\n2 2 2 3 4 5 6 6 6", "output": "3" }, { "input": "10\n1 1 1 2 3 3 3 3 3 3", "output": "1" }, { "input": "6\n1 1 1 1 1 1", "output": "0" }, { "input": "3\n0 0 1", "output": "0" }, { "input": "9\n1 1 1 2 2 2 3 3 3", "output": "3" }, { "input": "3\n1 2 2", "output": "0" }, { "input": "6\n2 2 2 2 2 2", "output": "0" }, { "input": "5\n2 2 2 2 2", "output": "0" }, { "input": "5\n5 5 5 5 5", "output": "0" }, { "input": "1\n0", "output": "0" }, { "input": "6\n1 2 5 5 5 5", "output": "1" }, { "input": "5\n1 2 3 3 3", "output": "1" }, { "input": "3\n1 1 2", "output": "0" }, { "input": "6\n1 1 1 1 1 2", "output": "0" }, { "input": "5\n1 1 2 4 4", "output": "1" }, { "input": "3\n999999 5999999 9999999", "output": "1" }, { "input": "4\n1 1 5 5", "output": "0" }, { "input": "9\n1 1 1 2 2 2 4 4 4", "output": "3" }, { "input": "5\n1 3 4 5 1", "output": "2" }, { "input": "5\n3 3 3 3 3", "output": "0" }, { "input": "5\n1 1 2 2 2", "output": "0" }, { "input": "5\n2 1 1 1 3", "output": "1" }, { "input": "5\n0 0 0 1 2", "output": "1" }, { "input": "4\n2 2 2 3", "output": "0" }, { "input": "7\n1 1 1 1 5 5 5", "output": "0" }, { "input": "5\n1 2 3 4 4", "output": "2" }, { "input": "2\n5 4", "output": "0" }, { "input": "4\n5 5 5 5", "output": "0" }, { "input": "5\n1 1 1 5 5", "output": "0" }, { "input": "2\n1 1", "output": "0" }, { "input": "1\n3", "output": "0" }, { "input": "3\n2 1 2", "output": "0" }, { "input": "4\n1 2 2 2", "output": "0" }, { "input": "8\n1000000000 1000000000 1000000000 999999999 999999999 999999999 999999998 999999998", "output": "3" }, { "input": "5\n1 1 3 4 4", "output": "1" }, { "input": "6\n1 1 2 2 3 3", "output": "2" }, { "input": "4\n1 1 1 1", "output": "0" }, { "input": "9\n1 2 3 4 1 5 6 7 8", "output": "6" }, { "input": "8\n5 4 4 6 6 4 4 3", "output": "5" }, { "input": "8\n4 3 3 3 3 3 3 3", "output": "0" }, { "input": "7\n4 3 3 3 3 3 3", "output": "0" }, { "input": "6\n4 3 3 3 3 3", "output": "0" }, { "input": "5\n4 3 3 3 3", "output": "0" } ]
1,695,274,438
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
13
77
13,209,600
r=int(input()) x=list(map(int,input().split())) print(r-(x.count(max(x))+x.count(min(x))))
Title: Oath of the Night's Watch Time Limit: None seconds Memory Limit: None megabytes Problem Description: "Night gathers, and now my watch begins. It shall not end until my death. I shall take no wife, hold no lands, father no children. I shall wear no crowns and win no glory. I shall live and die at my post. I am the sword in the darkness. I am the watcher on the walls. I am the shield that guards the realms of men. I pledge my life and honor to the Night's Watch, for this night and all the nights to come." — The Night's Watch oath. With that begins the watch of Jon Snow. He is assigned the task to support the stewards. This time he has *n* stewards with him whom he has to provide support. Each steward has his own strength. Jon Snow likes to support a steward only if there exists at least one steward who has strength strictly less than him and at least one steward who has strength strictly greater than him. Can you find how many stewards will Jon support? Input Specification: First line consists of a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of stewards with Jon Snow. Second line consists of *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) representing the values assigned to the stewards. Output Specification: Output a single integer representing the number of stewards which Jon will feed. Demo Input: ['2\n1 5\n', '3\n1 2 5\n'] Demo Output: ['0', '1'] Note: In the first sample, Jon Snow cannot support steward with strength 1 because there is no steward with strength less than 1 and he cannot support steward with strength 5 because there is no steward with strength greater than 5. In the second sample, Jon Snow can support steward with strength 2 because there are stewards with strength less than 2 and greater than 2.
```python r=int(input()) x=list(map(int,input().split())) print(r-(x.count(max(x))+x.count(min(x)))) ```
0
144
A
Arrival of the General
PROGRAMMING
800
[ "implementation" ]
null
null
A Ministry for Defense sent a general to inspect the Super Secret Military Squad under the command of the Colonel SuperDuper. Having learned the news, the colonel ordered to all *n* squad soldiers to line up on the parade ground. By the military charter the soldiers should stand in the order of non-increasing of their height. But as there's virtually no time to do that, the soldiers lined up in the arbitrary order. However, the general is rather short-sighted and he thinks that the soldiers lined up correctly if the first soldier in the line has the maximum height and the last soldier has the minimum height. Please note that the way other solders are positioned does not matter, including the case when there are several soldiers whose height is maximum or minimum. Only the heights of the first and the last soldier are important. For example, the general considers the sequence of heights (4, 3, 4, 2, 1, 1) correct and the sequence (4, 3, 1, 2, 2) wrong. Within one second the colonel can swap any two neighboring soldiers. Help him count the minimum time needed to form a line-up which the general will consider correct.
The first input line contains the only integer *n* (2<=≤<=*n*<=≤<=100) which represents the number of soldiers in the line. The second line contains integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) the values of the soldiers' heights in the order of soldiers' heights' increasing in the order from the beginning of the line to its end. The numbers are space-separated. Numbers *a*1,<=*a*2,<=...,<=*a**n* are not necessarily different.
Print the only integer — the minimum number of seconds the colonel will need to form a line-up the general will like.
[ "4\n33 44 11 22\n", "7\n10 10 58 31 63 40 76\n" ]
[ "2\n", "10\n" ]
In the first sample the colonel will need to swap the first and second soldier and then the third and fourth soldier. That will take 2 seconds. The resulting position of the soldiers is (44, 33, 22, 11). In the second sample the colonel may swap the soldiers in the following sequence: 1. (10, 10, 58, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 76, 40) 1. (10, 58, 10, 31, 76, 63, 40) 1. (10, 58, 31, 10, 76, 63, 40) 1. (10, 58, 31, 76, 10, 63, 40) 1. (10, 58, 31, 76, 63, 10, 40) 1. (10, 58, 76, 31, 63, 10, 40) 1. (10, 76, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 40, 10)
500
[ { "input": "4\n33 44 11 22", "output": "2" }, { "input": "7\n10 10 58 31 63 40 76", "output": "10" }, { "input": "2\n88 89", "output": "1" }, { "input": "5\n100 95 100 100 88", "output": "0" }, { "input": "7\n48 48 48 48 45 45 45", "output": "0" }, { "input": "10\n68 47 67 29 63 71 71 65 54 56", "output": "10" }, { "input": "15\n77 68 96 60 92 75 61 60 66 79 80 65 60 95 92", "output": "4" }, { "input": "3\n1 2 1", "output": "1" }, { "input": "20\n30 30 30 14 30 14 30 30 30 14 30 14 14 30 14 14 30 14 14 14", "output": "0" }, { "input": "35\n37 41 46 39 47 39 44 47 44 42 44 43 47 39 46 39 38 42 39 37 40 44 41 42 41 42 39 42 36 36 42 36 42 42 42", "output": "7" }, { "input": "40\n99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 98 99 99 99 99 99 99 99 99 100 99 99 99 99 99 99", "output": "47" }, { "input": "50\n48 52 44 54 53 56 62 49 39 41 53 39 40 64 53 50 62 48 40 52 51 48 40 52 61 62 62 61 48 64 55 57 56 40 48 58 41 60 60 56 64 50 64 45 48 45 46 63 59 57", "output": "50" }, { "input": "57\n7 24 17 19 6 19 10 11 12 22 14 5 5 11 13 10 24 19 24 24 24 11 21 20 4 14 24 24 18 13 24 3 20 3 3 3 3 9 3 9 22 22 16 3 3 3 15 11 3 3 8 17 10 13 3 14 13", "output": "3" }, { "input": "65\n58 50 35 44 35 37 36 58 38 36 58 56 56 49 48 56 58 43 40 44 52 44 58 58 57 50 43 35 55 39 38 49 53 56 50 42 41 56 34 57 49 38 34 51 56 38 58 40 53 46 48 34 38 43 49 49 58 56 41 43 44 34 38 48 36", "output": "3" }, { "input": "69\n70 48 49 48 49 71 48 53 55 69 48 53 54 58 53 63 48 48 69 67 72 75 71 75 74 74 57 63 65 60 48 48 65 48 48 51 50 49 62 53 76 68 76 56 76 76 64 76 76 57 61 76 73 51 59 76 65 50 69 50 76 67 76 63 62 74 74 58 73", "output": "73" }, { "input": "75\n70 65 64 71 71 64 71 64 68 71 65 64 65 68 71 66 66 69 68 63 69 65 71 69 68 68 71 67 71 65 65 65 71 71 65 69 63 66 62 67 64 63 62 64 67 65 62 69 62 64 69 62 67 64 67 70 64 63 64 64 69 62 62 64 70 62 62 68 67 69 62 64 66 70 68", "output": "7" }, { "input": "84\n92 95 84 85 94 80 90 86 80 92 95 84 86 83 86 83 93 91 95 92 84 88 82 84 84 84 80 94 93 80 94 80 95 83 85 80 95 95 80 84 86 92 83 81 90 87 81 89 92 93 80 87 90 85 93 85 93 94 93 89 94 83 93 91 80 83 90 94 95 80 95 92 85 84 93 94 94 82 91 95 95 89 85 94", "output": "15" }, { "input": "90\n86 87 72 77 82 71 75 78 61 67 79 90 64 94 94 74 85 87 73 76 71 71 60 69 77 73 76 80 82 57 62 57 57 83 76 72 75 87 72 94 77 85 59 82 86 69 62 80 95 73 83 94 79 85 91 68 85 74 93 95 68 75 89 93 83 78 95 78 83 77 81 85 66 92 63 65 75 78 67 91 77 74 59 86 77 76 90 67 70 64", "output": "104" }, { "input": "91\n94 98 96 94 95 98 98 95 98 94 94 98 95 95 99 97 97 94 95 98 94 98 96 98 96 98 97 95 94 94 94 97 94 96 98 98 98 94 96 95 94 95 97 97 97 98 94 98 96 95 98 96 96 98 94 97 96 98 97 95 97 98 94 95 94 94 97 94 96 97 97 93 94 95 95 94 96 98 97 96 94 98 98 96 96 96 96 96 94 96 97", "output": "33" }, { "input": "92\n44 28 32 29 41 41 36 39 40 39 41 35 41 28 35 27 41 34 28 38 43 43 41 38 27 26 28 36 30 29 39 32 35 35 32 30 39 30 37 27 41 41 28 30 43 31 35 33 36 28 44 40 41 35 31 42 37 38 37 34 39 40 27 40 33 33 44 43 34 33 34 34 35 38 38 37 30 39 35 41 45 42 41 32 33 33 31 30 43 41 43 43", "output": "145" }, { "input": "93\n46 32 52 36 39 30 57 63 63 30 32 44 27 59 46 38 40 45 44 62 35 36 51 48 39 58 36 51 51 51 48 58 59 36 29 35 31 49 64 60 34 38 42 56 33 42 52 31 63 34 45 51 35 45 33 53 33 62 31 38 66 29 51 54 28 61 32 45 57 41 36 34 47 36 31 28 67 48 52 46 32 40 64 58 27 53 43 57 34 66 43 39 26", "output": "76" }, { "input": "94\n56 55 54 31 32 42 46 29 24 54 40 40 20 45 35 56 32 33 51 39 26 56 21 56 51 27 29 39 56 52 54 43 43 55 48 51 44 49 52 49 23 19 19 28 20 26 45 33 35 51 42 36 25 25 38 23 21 35 54 50 41 20 37 28 42 20 22 43 37 34 55 21 24 38 19 41 45 34 19 33 44 54 38 31 23 53 35 32 47 40 39 31 20 34", "output": "15" }, { "input": "95\n57 71 70 77 64 64 76 81 81 58 63 75 81 77 71 71 71 60 70 70 69 67 62 64 78 64 69 62 76 76 57 70 68 77 70 68 73 77 79 73 60 57 69 60 74 65 58 75 75 74 73 73 65 75 72 57 81 62 62 70 67 58 76 57 79 81 68 64 58 77 70 59 79 64 80 58 71 59 81 71 80 64 78 80 78 65 70 68 78 80 57 63 64 76 81", "output": "11" }, { "input": "96\n96 95 95 95 96 97 95 97 96 95 98 96 97 95 98 96 98 96 98 96 98 95 96 95 95 95 97 97 95 95 98 98 95 96 96 95 97 96 98 96 95 97 97 95 97 97 95 94 96 96 97 96 97 97 96 94 94 97 95 95 95 96 95 96 95 97 97 95 97 96 95 94 97 97 97 96 97 95 96 94 94 95 97 94 94 97 97 97 95 97 97 95 94 96 95 95", "output": "13" }, { "input": "97\n14 15 12 12 13 15 12 15 12 12 12 12 12 14 15 15 13 12 15 15 12 12 12 13 14 15 15 13 14 15 14 14 14 14 12 13 12 13 13 12 15 12 13 13 15 12 15 13 12 13 13 13 14 13 12 15 14 13 14 15 13 14 14 13 14 12 15 12 14 12 13 14 15 14 13 15 13 12 15 15 15 13 15 15 13 14 16 16 16 13 15 13 15 14 15 15 15", "output": "104" }, { "input": "98\n37 69 35 70 58 69 36 47 41 63 60 54 49 35 55 50 35 53 52 43 35 41 40 49 38 35 48 70 42 35 35 65 56 54 44 59 59 48 51 49 59 67 35 60 69 35 58 50 35 44 48 69 41 58 44 45 35 47 70 61 49 47 37 39 35 51 44 70 72 65 36 41 63 63 48 66 45 50 50 71 37 52 72 67 72 39 72 39 36 64 48 72 69 49 45 72 72 67", "output": "100" }, { "input": "99\n31 31 16 15 19 31 19 22 29 27 12 22 28 30 25 33 26 25 19 22 34 21 17 33 31 22 16 26 22 30 31 17 13 33 13 17 28 25 18 33 27 22 31 22 13 27 20 22 23 15 24 32 29 13 16 20 32 33 14 33 19 27 16 28 25 17 17 28 18 26 32 33 19 23 30 13 14 23 24 28 14 28 22 20 30 14 24 23 17 29 18 28 29 21 28 18 16 24 32", "output": "107" }, { "input": "100\n37 54 39 29 32 49 21 13 34 21 16 42 34 27 16 26 7 34 51 9 11 27 16 40 36 7 48 52 30 42 42 52 51 11 32 26 6 7 28 54 48 51 6 54 42 20 51 48 46 4 4 31 47 6 9 16 8 23 36 50 49 30 47 37 45 24 48 26 8 50 18 24 27 13 39 7 37 34 5 43 42 19 34 23 52 38 35 6 29 11 53 49 21 29 36 22 45 33 51 22", "output": "50" }, { "input": "100\n41 5 20 23 5 47 28 28 64 5 12 14 34 56 22 48 6 52 39 55 62 40 24 54 39 28 56 27 35 51 14 24 38 10 55 20 39 62 52 2 30 55 49 48 15 23 59 44 31 28 66 29 62 59 31 13 28 12 50 45 41 47 29 27 64 66 14 39 62 22 44 63 24 5 63 17 42 7 25 41 49 33 31 51 63 3 37 66 19 9 2 40 16 45 56 21 34 29 39 61", "output": "59" }, { "input": "100\n66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95", "output": "99" }, { "input": "100\n81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10", "output": "0" }, { "input": "3\n2 1 2", "output": "1" }, { "input": "2\n100 99", "output": "0" }, { "input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "197" }, { "input": "100\n87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87", "output": "0" }, { "input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "0" }, { "input": "2\n1 1", "output": "0" }, { "input": "3\n2 2 2", "output": "0" }, { "input": "3\n1 3 2", "output": "2" } ]
1,689,511,303
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
60
0
n = int(input()) l = [] for i in range(n): elements = int(input()) l.append(elements) leftmost_max_index = l.index(max(l)) rightmost_min_index = n - l[::-1].index(min(l)) - 1 if leftmost_max_index<rightmost_min_index: print(leftmost_max_index + n - 1 - rightmost_min_index) else: print(leftmost_max_index + n - 2 - rightmost_min_index)
Title: Arrival of the General Time Limit: None seconds Memory Limit: None megabytes Problem Description: A Ministry for Defense sent a general to inspect the Super Secret Military Squad under the command of the Colonel SuperDuper. Having learned the news, the colonel ordered to all *n* squad soldiers to line up on the parade ground. By the military charter the soldiers should stand in the order of non-increasing of their height. But as there's virtually no time to do that, the soldiers lined up in the arbitrary order. However, the general is rather short-sighted and he thinks that the soldiers lined up correctly if the first soldier in the line has the maximum height and the last soldier has the minimum height. Please note that the way other solders are positioned does not matter, including the case when there are several soldiers whose height is maximum or minimum. Only the heights of the first and the last soldier are important. For example, the general considers the sequence of heights (4, 3, 4, 2, 1, 1) correct and the sequence (4, 3, 1, 2, 2) wrong. Within one second the colonel can swap any two neighboring soldiers. Help him count the minimum time needed to form a line-up which the general will consider correct. Input Specification: The first input line contains the only integer *n* (2<=≤<=*n*<=≤<=100) which represents the number of soldiers in the line. The second line contains integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) the values of the soldiers' heights in the order of soldiers' heights' increasing in the order from the beginning of the line to its end. The numbers are space-separated. Numbers *a*1,<=*a*2,<=...,<=*a**n* are not necessarily different. Output Specification: Print the only integer — the minimum number of seconds the colonel will need to form a line-up the general will like. Demo Input: ['4\n33 44 11 22\n', '7\n10 10 58 31 63 40 76\n'] Demo Output: ['2\n', '10\n'] Note: In the first sample the colonel will need to swap the first and second soldier and then the third and fourth soldier. That will take 2 seconds. The resulting position of the soldiers is (44, 33, 22, 11). In the second sample the colonel may swap the soldiers in the following sequence: 1. (10, 10, 58, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 76, 40) 1. (10, 58, 10, 31, 76, 63, 40) 1. (10, 58, 31, 10, 76, 63, 40) 1. (10, 58, 31, 76, 10, 63, 40) 1. (10, 58, 31, 76, 63, 10, 40) 1. (10, 58, 76, 31, 63, 10, 40) 1. (10, 76, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 40, 10)
```python n = int(input()) l = [] for i in range(n): elements = int(input()) l.append(elements) leftmost_max_index = l.index(max(l)) rightmost_min_index = n - l[::-1].index(min(l)) - 1 if leftmost_max_index<rightmost_min_index: print(leftmost_max_index + n - 1 - rightmost_min_index) else: print(leftmost_max_index + n - 2 - rightmost_min_index) ```
-1
615
A
Bulbs
PROGRAMMING
800
[ "implementation" ]
null
null
Vasya wants to turn on Christmas lights consisting of *m* bulbs. Initially, all bulbs are turned off. There are *n* buttons, each of them is connected to some set of bulbs. Vasya can press any of these buttons. When the button is pressed, it turns on all the bulbs it's connected to. Can Vasya light up all the bulbs? If Vasya presses the button such that some bulbs connected to it are already turned on, they do not change their state, i.e. remain turned on.
The first line of the input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of buttons and the number of bulbs respectively. Each of the next *n* lines contains *x**i* (0<=≤<=*x**i*<=≤<=*m*) — the number of bulbs that are turned on by the *i*-th button, and then *x**i* numbers *y**ij* (1<=≤<=*y**ij*<=≤<=*m*) — the numbers of these bulbs.
If it's possible to turn on all *m* bulbs print "YES", otherwise print "NO".
[ "3 4\n2 1 4\n3 1 3 1\n1 2\n", "3 3\n1 1\n1 2\n1 1\n" ]
[ "YES\n", "NO\n" ]
In the first sample you can press each button once and turn on all the bulbs. In the 2 sample it is impossible to turn on the 3-rd lamp.
500
[ { "input": "3 4\n2 1 4\n3 1 3 1\n1 2", "output": "YES" }, { "input": "3 3\n1 1\n1 2\n1 1", "output": "NO" }, { "input": "3 4\n1 1\n1 2\n1 3", "output": "NO" }, { "input": "1 5\n5 1 2 3 4 5", "output": "YES" }, { "input": "1 5\n5 4 4 1 2 3", "output": "NO" }, { "input": "1 5\n5 1 1 1 1 5", "output": "NO" }, { "input": "2 5\n4 3 1 4 2\n4 2 3 4 5", "output": "YES" }, { "input": "5 7\n2 6 7\n5 1 1 1 1 1\n3 6 5 4\n0\n4 4 3 2 1", "output": "YES" }, { "input": "100 100\n0\n0\n0\n1 53\n0\n0\n1 34\n1 54\n0\n1 14\n0\n1 33\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 82\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 34\n0\n0\n1 26\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 34\n0\n0\n0\n0\n0\n1 3\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 40\n0\n0\n0\n1 26\n0\n0\n0\n0\n0\n1 97\n0\n1 5\n0\n0\n0\n0\n0", "output": "NO" }, { "input": "100 100\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0", "output": "NO" }, { "input": "5 6\n3 1 2 6\n3 1 2 6\n1 1\n2 3 4\n3 1 5 6", "output": "YES" }, { "input": "5 2\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "NO" }, { "input": "1 4\n3 1 2 3", "output": "NO" }, { "input": "1 4\n3 2 3 4", "output": "NO" }, { "input": "2 4\n3 2 3 4\n1 1", "output": "YES" }, { "input": "2 4\n3 1 2 3\n1 4", "output": "YES" }, { "input": "5 1\n0\n0\n0\n0\n0", "output": "NO" }, { "input": "1 1\n0", "output": "NO" }, { "input": "1 10\n10 1 2 3 4 5 6 7 8 9 10", "output": "YES" }, { "input": "1 1\n1 1", "output": "YES" }, { "input": "1 100\n99 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99", "output": "NO" }, { "input": "1 3\n3 1 2 1", "output": "NO" }, { "input": "1 100\n100 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "YES" } ]
1,678,457,800
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
30
0
def main(): bulbs = [int(x) for x in input().split()] lst = [] for i in range(bulbs[0]): button = [int(x) for x in input().split() if x>0 and x<=bulbs[1]] lst.extend(button) if bulbs[1] == len(set(lst)): print("YES") else: print("NO") if __name__ == "__main__": main()
Title: Bulbs Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya wants to turn on Christmas lights consisting of *m* bulbs. Initially, all bulbs are turned off. There are *n* buttons, each of them is connected to some set of bulbs. Vasya can press any of these buttons. When the button is pressed, it turns on all the bulbs it's connected to. Can Vasya light up all the bulbs? If Vasya presses the button such that some bulbs connected to it are already turned on, they do not change their state, i.e. remain turned on. Input Specification: The first line of the input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of buttons and the number of bulbs respectively. Each of the next *n* lines contains *x**i* (0<=≤<=*x**i*<=≤<=*m*) — the number of bulbs that are turned on by the *i*-th button, and then *x**i* numbers *y**ij* (1<=≤<=*y**ij*<=≤<=*m*) — the numbers of these bulbs. Output Specification: If it's possible to turn on all *m* bulbs print "YES", otherwise print "NO". Demo Input: ['3 4\n2 1 4\n3 1 3 1\n1 2\n', '3 3\n1 1\n1 2\n1 1\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample you can press each button once and turn on all the bulbs. In the 2 sample it is impossible to turn on the 3-rd lamp.
```python def main(): bulbs = [int(x) for x in input().split()] lst = [] for i in range(bulbs[0]): button = [int(x) for x in input().split() if x>0 and x<=bulbs[1]] lst.extend(button) if bulbs[1] == len(set(lst)): print("YES") else: print("NO") if __name__ == "__main__": main() ```
-1
914
A
Perfect Squares
PROGRAMMING
900
[ "brute force", "implementation", "math" ]
null
null
Given an array *a*1,<=*a*2,<=...,<=*a**n* of *n* integers, find the largest number in the array that is not a perfect square. A number *x* is said to be a perfect square if there exists an integer *y* such that *x*<==<=*y*2.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of elements in the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=106<=≤<=*a**i*<=≤<=106) — the elements of the array. It is guaranteed that at least one element of the array is not a perfect square.
Print the largest number in the array which is not a perfect square. It is guaranteed that an answer always exists.
[ "2\n4 2\n", "8\n1 2 4 8 16 32 64 576\n" ]
[ "2\n", "32\n" ]
In the first sample case, 4 is a perfect square, so the largest number in the array that is not a perfect square is 2.
500
[ { "input": "2\n4 2", "output": "2" }, { "input": "8\n1 2 4 8 16 32 64 576", "output": "32" }, { "input": "3\n-1 -4 -9", "output": "-1" }, { "input": "5\n918375 169764 598796 76602 538757", "output": "918375" }, { "input": "5\n804610 765625 2916 381050 93025", "output": "804610" }, { "input": "5\n984065 842724 127449 525625 573049", "output": "984065" }, { "input": "2\n226505 477482", "output": "477482" }, { "input": "2\n370881 659345", "output": "659345" }, { "input": "2\n4 5", "output": "5" }, { "input": "2\n3 4", "output": "3" }, { "input": "2\n999999 1000000", "output": "999999" }, { "input": "3\n-1 -2 -3", "output": "-1" }, { "input": "2\n-1000000 1000000", "output": "-1000000" }, { "input": "2\n-1 0", "output": "-1" }, { "input": "1\n2", "output": "2" }, { "input": "1\n-1", "output": "-1" }, { "input": "35\n-871271 -169147 -590893 -400197 -476793 0 -15745 -890852 -124052 -631140 -238569 -597194 -147909 -928925 -587628 -569656 -581425 -963116 -665954 -506797 -196044 -309770 -701921 -926257 -152426 -991371 -624235 -557143 -689886 -59804 -549134 -107407 -182016 -24153 -607462", "output": "-15745" }, { "input": "16\n-882343 -791322 0 -986738 -415891 -823354 -840236 -552554 -760908 -331993 -549078 -863759 -913261 -937429 -257875 -602322", "output": "-257875" }, { "input": "71\n908209 289 44521 240100 680625 274576 212521 91809 506944 499849 3844 15376 592900 58081 240100 984064 732736 257049 600625 180625 130321 580644 261121 75625 46225 853776 485809 700569 817216 268324 293764 528529 25921 399424 175561 99856 295936 20736 611524 13924 470596 574564 5329 15376 676 431649 145161 697225 41616 550564 514089 9409 227529 1681 839056 3721 552049 465124 38809 197136 659344 214369 998001 44944 3844 186624 362404 -766506 739600 10816 299209", "output": "-766506" }, { "input": "30\n192721 -950059 -734656 625 247009 -423468 318096 622521 678976 777924 1444 748303 27556 62001 795664 89401 221841 -483208 467856 477109 196 -461813 831744 772641 574564 -519370 861184 67600 -717966 -259259", "output": "748303" }, { "input": "35\n628849 962361 436921 944784 444889 29241 -514806 171396 685584 -823202 -929730 6982 198025 783225 552049 -957165 782287 -659167 -414846 695556 -336330 41616 963781 71289 119639 952576 -346713 178929 232324 121802 393266 841 649636 179555 998001", "output": "963781" }, { "input": "53\n280988 756430 -515570 -248578 170649 -21608 642677 216770 827291 589500 940901 216097 -118956 -919104 -319264 -761585 289479 499613 588276 883036 480518 -323196 -274570 -406556 -381484 -956025 702135 -445274 -783543 136593 153664 897473 352651 737974 -21123 -284944 501734 898033 604429 624138 40804 248782 -786059 -304592 -209210 -312904 419820 -328648 -47331 -919227 -280955 104827 877304", "output": "940901" }, { "input": "15\n256 -227055 427717 827239 462070 66049 987533 -175306 -552810 -867915 -408251 -693957 -972981 -245827 896904", "output": "987533" }, { "input": "3\n-1 1 0", "output": "-1" }, { "input": "2\n0 -5", "output": "-5" }, { "input": "3\n-1 -2 0", "output": "-1" }, { "input": "2\n-5 0", "output": "-5" }, { "input": "1\n-439", "output": "-439" }, { "input": "1\n-1000000", "output": "-1000000" }, { "input": "1\n-917455", "output": "-917455" }, { "input": "3\n1 1 -1", "output": "-1" }, { "input": "2\n131073 1", "output": "131073" }, { "input": "2\n99999 3", "output": "99999" }, { "input": "2\n-524272 -1000000", "output": "-524272" }, { "input": "2\n15 131073", "output": "131073" } ]
1,547,582,134
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
15
93
0
n=int(input()) l=list(input().split(' ')) c=0 d=0 for i in range(n): if int(l[i])<0: if d==0: d=int(l[i]) elif abs(d)>abs(int(l[i])): d=l[i] if int(l[i])>=0: a=int(l[i])**0.5 b=int(a) if b<a and int(l[i])>c: c=int(l[i]) if c!=0: print(c) else: print(d)
Title: Perfect Squares Time Limit: None seconds Memory Limit: None megabytes Problem Description: Given an array *a*1,<=*a*2,<=...,<=*a**n* of *n* integers, find the largest number in the array that is not a perfect square. A number *x* is said to be a perfect square if there exists an integer *y* such that *x*<==<=*y*2. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of elements in the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=106<=≤<=*a**i*<=≤<=106) — the elements of the array. It is guaranteed that at least one element of the array is not a perfect square. Output Specification: Print the largest number in the array which is not a perfect square. It is guaranteed that an answer always exists. Demo Input: ['2\n4 2\n', '8\n1 2 4 8 16 32 64 576\n'] Demo Output: ['2\n', '32\n'] Note: In the first sample case, 4 is a perfect square, so the largest number in the array that is not a perfect square is 2.
```python n=int(input()) l=list(input().split(' ')) c=0 d=0 for i in range(n): if int(l[i])<0: if d==0: d=int(l[i]) elif abs(d)>abs(int(l[i])): d=l[i] if int(l[i])>=0: a=int(l[i])**0.5 b=int(a) if b<a and int(l[i])>c: c=int(l[i]) if c!=0: print(c) else: print(d) ```
-1
828
A
Restaurant Tables
PROGRAMMING
1,200
[ "implementation" ]
null
null
In a small restaurant there are *a* tables for one person and *b* tables for two persons. It it known that *n* groups of people come today, each consisting of one or two people. If a group consist of one person, it is seated at a vacant one-seater table. If there are none of them, it is seated at a vacant two-seater table. If there are none of them, it is seated at a two-seater table occupied by single person. If there are still none of them, the restaurant denies service to this group. If a group consist of two people, it is seated at a vacant two-seater table. If there are none of them, the restaurant denies service to this group. You are given a chronological order of groups coming. You are to determine the total number of people the restaurant denies service to.
The first line contains three integers *n*, *a* and *b* (1<=≤<=*n*<=≤<=2·105, 1<=≤<=*a*,<=*b*<=≤<=2·105) — the number of groups coming to the restaurant, the number of one-seater and the number of two-seater tables. The second line contains a sequence of integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=2) — the description of clients in chronological order. If *t**i* is equal to one, then the *i*-th group consists of one person, otherwise the *i*-th group consists of two people.
Print the total number of people the restaurant denies service to.
[ "4 1 2\n1 2 1 1\n", "4 1 1\n1 1 2 1\n" ]
[ "0\n", "2\n" ]
In the first example the first group consists of one person, it is seated at a vacant one-seater table. The next group occupies a whole two-seater table. The third group consists of one person, it occupies one place at the remaining two-seater table. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, all clients are served. In the second example the first group consists of one person, it is seated at the vacant one-seater table. The next group consists of one person, it occupies one place at the two-seater table. It's impossible to seat the next group of two people, so the restaurant denies service to them. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, the restaurant denies service to 2 clients.
500
[ { "input": "4 1 2\n1 2 1 1", "output": "0" }, { "input": "4 1 1\n1 1 2 1", "output": "2" }, { "input": "1 1 1\n1", "output": "0" }, { "input": "2 1 2\n2 2", "output": "0" }, { "input": "5 1 3\n1 2 2 2 1", "output": "1" }, { "input": "7 6 1\n1 1 1 1 1 1 1", "output": "0" }, { "input": "10 2 1\n2 1 2 2 2 2 1 2 1 2", "output": "13" }, { "input": "20 4 3\n2 2 2 2 2 2 2 2 1 2 1 1 2 2 1 2 2 2 1 2", "output": "25" }, { "input": "1 1 1\n1", "output": "0" }, { "input": "1 1 1\n2", "output": "0" }, { "input": "1 200000 200000\n2", "output": "0" }, { "input": "30 10 10\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2", "output": "20" }, { "input": "4 1 2\n1 1 1 2", "output": "2" }, { "input": "6 2 3\n1 2 1 1 1 2", "output": "2" }, { "input": "6 1 4\n1 1 1 1 1 2", "output": "2" }, { "input": "6 1 3\n1 1 1 1 2 2", "output": "4" }, { "input": "6 1 3\n1 1 1 1 1 2", "output": "2" }, { "input": "6 4 2\n2 1 2 2 1 1", "output": "2" }, { "input": "3 10 1\n2 2 2", "output": "4" }, { "input": "5 1 3\n1 1 1 1 2", "output": "2" }, { "input": "5 2 2\n1 1 1 1 2", "output": "2" }, { "input": "15 5 5\n1 1 1 1 1 1 1 1 1 1 2 2 2 2 2", "output": "10" }, { "input": "5 1 2\n1 1 1 1 1", "output": "0" }, { "input": "3 6 1\n2 2 2", "output": "4" }, { "input": "5 3 3\n2 2 2 2 2", "output": "4" }, { "input": "8 3 3\n1 1 1 1 1 1 2 2", "output": "4" }, { "input": "5 1 2\n1 1 1 2 1", "output": "2" }, { "input": "6 1 4\n1 2 2 1 2 2", "output": "2" }, { "input": "2 1 1\n2 2", "output": "2" }, { "input": "2 2 1\n2 2", "output": "2" }, { "input": "5 8 1\n2 2 2 2 2", "output": "8" }, { "input": "3 1 4\n1 1 2", "output": "0" }, { "input": "7 1 5\n1 1 1 1 1 1 2", "output": "2" }, { "input": "6 1 3\n1 1 1 2 1 1", "output": "0" }, { "input": "6 1 2\n1 1 1 2 2 2", "output": "6" }, { "input": "8 1 4\n2 1 1 1 2 2 2 2", "output": "6" }, { "input": "4 2 3\n2 2 2 2", "output": "2" }, { "input": "3 1 1\n1 1 2", "output": "2" }, { "input": "5 1 1\n2 2 2 2 2", "output": "8" }, { "input": "10 1 5\n1 1 1 1 1 2 2 2 2 2", "output": "8" }, { "input": "5 1 2\n1 1 1 2 2", "output": "4" }, { "input": "4 1 1\n1 1 2 2", "output": "4" }, { "input": "7 1 2\n1 1 1 1 1 1 1", "output": "2" }, { "input": "5 1 4\n2 2 2 2 2", "output": "2" }, { "input": "6 2 3\n1 1 1 1 2 2", "output": "2" }, { "input": "5 2 2\n2 1 2 1 2", "output": "2" }, { "input": "4 6 1\n2 2 2 2", "output": "6" }, { "input": "6 1 4\n1 1 2 1 1 2", "output": "2" }, { "input": "7 1 3\n1 1 1 1 2 2 2", "output": "6" }, { "input": "4 1 2\n1 1 2 2", "output": "2" }, { "input": "3 1 2\n1 1 2", "output": "0" }, { "input": "6 1 3\n1 2 1 1 2 1", "output": "2" }, { "input": "6 1 3\n1 1 1 2 2 2", "output": "4" }, { "input": "10 2 2\n1 1 1 1 2 2 2 2 2 2", "output": "12" }, { "input": "10 1 4\n1 1 1 1 1 2 2 2 2 2", "output": "10" }, { "input": "3 10 2\n2 2 2", "output": "2" }, { "input": "4 3 1\n1 2 2 2", "output": "4" }, { "input": "7 1 4\n1 1 1 1 1 2 2", "output": "4" }, { "input": "3 4 1\n2 2 2", "output": "4" }, { "input": "4 1 2\n2 1 1 2", "output": "2" }, { "input": "10 1 2\n1 1 1 1 1 1 1 1 1 2", "output": "6" }, { "input": "5 1 3\n1 1 2 1 2", "output": "2" }, { "input": "6 1 3\n1 1 1 1 2 1", "output": "2" }, { "input": "6 1 4\n1 1 1 2 2 2", "output": "2" }, { "input": "7 1 2\n1 2 1 1 1 1 1", "output": "3" }, { "input": "6 2 2\n1 1 1 1 1 1", "output": "0" }, { "input": "6 1 2\n1 1 2 1 1 1", "output": "2" }, { "input": "3 3 1\n2 2 1", "output": "2" }, { "input": "8 4 2\n1 1 1 1 1 1 1 2", "output": "2" }, { "input": "9 1 4\n1 1 1 1 1 2 2 2 2", "output": "8" }, { "input": "5 10 1\n2 2 2 2 2", "output": "8" }, { "input": "3 5 1\n2 2 2", "output": "4" }, { "input": "5 100 1\n2 2 2 2 2", "output": "8" }, { "input": "4 1 2\n1 1 1 1", "output": "0" }, { "input": "4 1 1\n1 1 1 1", "output": "1" }, { "input": "7 2 2\n1 1 1 1 1 1 1", "output": "1" } ]
1,500,426,729
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
11
186
7,680,000
x=input().split() y=input().split() a=int(x[1]) b=int(x[2])*2 out=0 ones=0 twos=0 for i in y: if int(i)==1: ones=ones+1 if int(i)==2: twos=twos+1 twos=twos*2 out=b-twos out=(out+a)-ones if out==0: print("0") elif out>0: print("0") elif out<0: print(out*-1)
Title: Restaurant Tables Time Limit: None seconds Memory Limit: None megabytes Problem Description: In a small restaurant there are *a* tables for one person and *b* tables for two persons. It it known that *n* groups of people come today, each consisting of one or two people. If a group consist of one person, it is seated at a vacant one-seater table. If there are none of them, it is seated at a vacant two-seater table. If there are none of them, it is seated at a two-seater table occupied by single person. If there are still none of them, the restaurant denies service to this group. If a group consist of two people, it is seated at a vacant two-seater table. If there are none of them, the restaurant denies service to this group. You are given a chronological order of groups coming. You are to determine the total number of people the restaurant denies service to. Input Specification: The first line contains three integers *n*, *a* and *b* (1<=≤<=*n*<=≤<=2·105, 1<=≤<=*a*,<=*b*<=≤<=2·105) — the number of groups coming to the restaurant, the number of one-seater and the number of two-seater tables. The second line contains a sequence of integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=2) — the description of clients in chronological order. If *t**i* is equal to one, then the *i*-th group consists of one person, otherwise the *i*-th group consists of two people. Output Specification: Print the total number of people the restaurant denies service to. Demo Input: ['4 1 2\n1 2 1 1\n', '4 1 1\n1 1 2 1\n'] Demo Output: ['0\n', '2\n'] Note: In the first example the first group consists of one person, it is seated at a vacant one-seater table. The next group occupies a whole two-seater table. The third group consists of one person, it occupies one place at the remaining two-seater table. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, all clients are served. In the second example the first group consists of one person, it is seated at the vacant one-seater table. The next group consists of one person, it occupies one place at the two-seater table. It's impossible to seat the next group of two people, so the restaurant denies service to them. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, the restaurant denies service to 2 clients.
```python x=input().split() y=input().split() a=int(x[1]) b=int(x[2])*2 out=0 ones=0 twos=0 for i in y: if int(i)==1: ones=ones+1 if int(i)==2: twos=twos+1 twos=twos*2 out=b-twos out=(out+a)-ones if out==0: print("0") elif out>0: print("0") elif out<0: print(out*-1) ```
0
427
A
Police Recruits
PROGRAMMING
800
[ "implementation" ]
null
null
The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups. Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime. If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated. Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated.
The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers. If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time.
Print a single integer, the number of crimes which will go untreated.
[ "3\n-1 -1 1\n", "8\n1 -1 1 -1 -1 1 1 1\n", "11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n" ]
[ "2\n", "1\n", "8\n" ]
Lets consider the second example: 1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired. The answer is one, as one crime (on step 5) will go untreated.
500
[ { "input": "3\n-1 -1 1", "output": "2" }, { "input": "8\n1 -1 1 -1 -1 1 1 1", "output": "1" }, { "input": "11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1", "output": "8" }, { "input": "7\n-1 -1 1 1 -1 -1 1", "output": "2" }, { "input": "21\n-1 -1 -1 -1 -1 3 2 -1 6 -1 -1 2 1 -1 2 2 1 6 5 -1 5", "output": "5" }, { "input": "98\n-1 -1 1 -1 -1 -1 -1 1 -1 -1 1 -1 -1 1 -1 1 1 1 -1 1 1 1 1 1 -1 1 -1 -1 -1 -1 1 -1 -1 1 1 -1 1 1 1 -1 -1 -1 -1 -1 -1 1 -1 -1 -1 1 -1 1 -1 1 -1 1 1 1 1 1 1 1 -1 -1 1 1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 1 -1 1 1 1 -1 1 1 -1 -1 -1 1 1 1 -1 -1 -1 1 -1 1 1", "output": "13" }, { "input": "3\n-1 5 4", "output": "1" }, { "input": "146\n4 -1 -1 -1 -1 -1 -1 -1 -1 -1 4 -1 3 -1 3 -1 -1 1 4 -1 2 -1 -1 3 -1 -1 -1 4 1 -1 -1 -1 4 -1 -1 -1 -1 -1 -1 3 2 -1 3 2 4 5 2 4 1 5 -1 -1 2 -1 -1 1 -1 5 3 -1 1 2 2 3 5 3 -1 -1 3 -1 -1 3 5 5 -1 -1 5 -1 4 4 1 -1 -1 -1 2 1 -1 -1 -1 2 5 3 -1 -1 -1 3 -1 5 4 -1 1 -1 -1 3 -1 -1 3 1 1 2 -1 -1 -1 1 3 1 -1 2 -1 -1 5 5 -1 -1 3 4 5 1 -1 2 -1 -1 -1 3 -1 5 3 2 -1 2 -1 -1 5 -1 3 -1", "output": "5" }, { "input": "1\n2", "output": "0" }, { "input": "1\n-1", "output": "1" }, { "input": "2\n1 -1", "output": "0" }, { "input": "2\n-1 1", "output": "1" }, { "input": "2\n1 1", "output": "0" }, { "input": "2\n-1 -1", "output": "2" }, { "input": "4\n10 -1 -1 -1", "output": "0" }, { "input": "1\n1", "output": "0" }, { "input": "4\n-1 -1 1 1", "output": "2" } ]
1,681,562,629
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
30
0
x=int(input()) p=0 y=0 li=input().split() li=list(map(int,li)) for i in li: if i==-1: y+=1 else: p+=i print(y-p)
Title: Police Recruits Time Limit: None seconds Memory Limit: None megabytes Problem Description: The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups. Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime. If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated. Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated. Input Specification: The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers. If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time. Output Specification: Print a single integer, the number of crimes which will go untreated. Demo Input: ['3\n-1 -1 1\n', '8\n1 -1 1 -1 -1 1 1 1\n', '11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n'] Demo Output: ['2\n', '1\n', '8\n'] Note: Lets consider the second example: 1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired. The answer is one, as one crime (on step 5) will go untreated.
```python x=int(input()) p=0 y=0 li=input().split() li=list(map(int,li)) for i in li: if i==-1: y+=1 else: p+=i print(y-p) ```
0
486
A
Calculating Function
PROGRAMMING
800
[ "implementation", "math" ]
null
null
For a positive integer *n* let's define a function *f*: *f*(*n*)<==<=<=-<=1<=+<=2<=-<=3<=+<=..<=+<=(<=-<=1)*n**n* Your task is to calculate *f*(*n*) for a given integer *n*.
The single line contains the positive integer *n* (1<=≤<=*n*<=≤<=1015).
Print *f*(*n*) in a single line.
[ "4\n", "5\n" ]
[ "2\n", "-3\n" ]
*f*(4) =  - 1 + 2 - 3 + 4 = 2 *f*(5) =  - 1 + 2 - 3 + 4 - 5 =  - 3
500
[ { "input": "4", "output": "2" }, { "input": "5", "output": "-3" }, { "input": "1000000000", "output": "500000000" }, { "input": "1000000001", "output": "-500000001" }, { "input": "1000000000000000", "output": "500000000000000" }, { "input": "100", "output": "50" }, { "input": "101", "output": "-51" }, { "input": "102", "output": "51" }, { "input": "103", "output": "-52" }, { "input": "104", "output": "52" }, { "input": "105", "output": "-53" }, { "input": "106", "output": "53" }, { "input": "107", "output": "-54" }, { "input": "108", "output": "54" }, { "input": "109", "output": "-55" }, { "input": "208170109961052", "output": "104085054980526" }, { "input": "46017661651072", "output": "23008830825536" }, { "input": "4018154546667", "output": "-2009077273334" }, { "input": "288565475053", "output": "-144282737527" }, { "input": "3052460231", "output": "-1526230116" }, { "input": "29906716", "output": "14953358" }, { "input": "87897701693326", "output": "43948850846663" }, { "input": "8240", "output": "4120" }, { "input": "577935", "output": "-288968" }, { "input": "62", "output": "31" }, { "input": "1", "output": "-1" }, { "input": "2", "output": "1" }, { "input": "9999999999999", "output": "-5000000000000" }, { "input": "1000000000000", "output": "500000000000" }, { "input": "99999999999999", "output": "-50000000000000" }, { "input": "999999999999999", "output": "-500000000000000" }, { "input": "42191359342", "output": "21095679671" }, { "input": "100000000000000", "output": "50000000000000" }, { "input": "145645214654154", "output": "72822607327077" }, { "input": "4294967296", "output": "2147483648" }, { "input": "3037000499", "output": "-1518500250" }, { "input": "10000000000001", "output": "-5000000000001" }, { "input": "100000017040846", "output": "50000008520423" }, { "input": "98979894985999", "output": "-49489947493000" } ]
1,699,079,918
2,147,483,647
PyPy 3
OK
TESTS
39
77
0
n=int(input()) if n%2==0: print(int(n/2)) else: print(int(-1*(n+1)/2))
Title: Calculating Function Time Limit: None seconds Memory Limit: None megabytes Problem Description: For a positive integer *n* let's define a function *f*: *f*(*n*)<==<=<=-<=1<=+<=2<=-<=3<=+<=..<=+<=(<=-<=1)*n**n* Your task is to calculate *f*(*n*) for a given integer *n*. Input Specification: The single line contains the positive integer *n* (1<=≤<=*n*<=≤<=1015). Output Specification: Print *f*(*n*) in a single line. Demo Input: ['4\n', '5\n'] Demo Output: ['2\n', '-3\n'] Note: *f*(4) =  - 1 + 2 - 3 + 4 = 2 *f*(5) =  - 1 + 2 - 3 + 4 - 5 =  - 3
```python n=int(input()) if n%2==0: print(int(n/2)) else: print(int(-1*(n+1)/2)) ```
3
313
B
Ilya and Queries
PROGRAMMING
1,100
[ "dp", "implementation" ]
null
null
Ilya the Lion wants to help all his friends with passing exams. They need to solve the following problem to pass the IT exam. You've got string *s*<==<=*s*1*s*2... *s**n* (*n* is the length of the string), consisting only of characters "." and "#" and *m* queries. Each query is described by a pair of integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=*n*). The answer to the query *l**i*,<=*r**i* is the number of such integers *i* (*l**i*<=≤<=*i*<=&lt;<=*r**i*), that *s**i*<==<=*s**i*<=+<=1. Ilya the Lion wants to help his friends but is there anyone to help him? Help Ilya, solve the problem.
The first line contains string *s* of length *n* (2<=≤<=*n*<=≤<=105). It is guaranteed that the given string only consists of characters "." and "#". The next line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains the description of the corresponding query. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=*n*).
Print *m* integers — the answers to the queries in the order in which they are given in the input.
[ "......\n4\n3 4\n2 3\n1 6\n2 6\n", "#..###\n5\n1 3\n5 6\n1 5\n3 6\n3 4\n" ]
[ "1\n1\n5\n4\n", "1\n1\n2\n2\n0\n" ]
none
1,000
[ { "input": "......\n4\n3 4\n2 3\n1 6\n2 6", "output": "1\n1\n5\n4" }, { "input": "#..###\n5\n1 3\n5 6\n1 5\n3 6\n3 4", "output": "1\n1\n2\n2\n0" }, { "input": ".#...#..\n6\n1 5\n2 3\n6 7\n2 4\n2 5\n1 3", "output": "2\n0\n0\n1\n2\n0" }, { "input": "#.#.#..\n5\n3 4\n4 5\n5 7\n5 7\n1 3", "output": "0\n0\n1\n1\n0" }, { "input": "#.##.##.\n7\n1 8\n2 6\n2 6\n6 8\n3 5\n2 4\n2 5", "output": "2\n1\n1\n1\n1\n1\n1" }, { "input": "#..#\n1\n1 4", "output": "1" }, { "input": "#..##...#.\n7\n5 9\n6 10\n1 7\n5 8\n3 5\n2 10\n3 4", "output": "2\n2\n3\n2\n1\n4\n0" }, { "input": "#.#.#\n7\n1 2\n3 4\n3 5\n2 3\n3 5\n1 5\n1 3", "output": "0\n0\n0\n0\n0\n0\n0" }, { "input": "###..#...#\n2\n2 4\n1 2", "output": "1\n1" }, { "input": "..\n1\n1 2", "output": "1" }, { "input": "##\n1\n1 2", "output": "1" }, { "input": ".#\n1\n1 2", "output": "0" }, { "input": "#.\n1\n1 2", "output": "0" }, { "input": "...\n2\n1 2\n1 2", "output": "1\n1" } ]
1,682,889,211
2,147,483,647
PyPy 3-64
TIME_LIMIT_EXCEEDED
TESTS
11
2,000
10,240,000
s=input();l_=[];count_=0 for i in range(len(s)-1): if s[i]==s[i+1]: count_+=1 l_.append(count_) l_=[0]+l_ for _ in range(int(input())): l,r=map(int,input().split()) print(l_[r-1]-l_[l-1])
Title: Ilya and Queries Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ilya the Lion wants to help all his friends with passing exams. They need to solve the following problem to pass the IT exam. You've got string *s*<==<=*s*1*s*2... *s**n* (*n* is the length of the string), consisting only of characters "." and "#" and *m* queries. Each query is described by a pair of integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=*n*). The answer to the query *l**i*,<=*r**i* is the number of such integers *i* (*l**i*<=≤<=*i*<=&lt;<=*r**i*), that *s**i*<==<=*s**i*<=+<=1. Ilya the Lion wants to help his friends but is there anyone to help him? Help Ilya, solve the problem. Input Specification: The first line contains string *s* of length *n* (2<=≤<=*n*<=≤<=105). It is guaranteed that the given string only consists of characters "." and "#". The next line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains the description of the corresponding query. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=*n*). Output Specification: Print *m* integers — the answers to the queries in the order in which they are given in the input. Demo Input: ['......\n4\n3 4\n2 3\n1 6\n2 6\n', '#..###\n5\n1 3\n5 6\n1 5\n3 6\n3 4\n'] Demo Output: ['1\n1\n5\n4\n', '1\n1\n2\n2\n0\n'] Note: none
```python s=input();l_=[];count_=0 for i in range(len(s)-1): if s[i]==s[i+1]: count_+=1 l_.append(count_) l_=[0]+l_ for _ in range(int(input())): l,r=map(int,input().split()) print(l_[r-1]-l_[l-1]) ```
0
922
C
Cave Painting
PROGRAMMING
1,600
[ "brute force", "number theory" ]
null
null
Imp is watching a documentary about cave painting. Some numbers, carved in chaotic order, immediately attracted his attention. Imp rapidly proposed a guess that they are the remainders of division of a number *n* by all integers *i* from 1 to *k*. Unfortunately, there are too many integers to analyze for Imp. Imp wants you to check whether all these remainders are distinct. Formally, he wants to check, if all , 1<=≤<=*i*<=≤<=*k*, are distinct, i. e. there is no such pair (*i*,<=*j*) that: - 1<=≤<=*i*<=&lt;<=*j*<=≤<=*k*, - , where is the remainder of division *x* by *y*.
The only line contains two integers *n*, *k* (1<=≤<=*n*,<=*k*<=≤<=1018).
Print "Yes", if all the remainders are distinct, and "No" otherwise. You can print each letter in arbitrary case (lower or upper).
[ "4 4\n", "5 3\n" ]
[ "No\n", "Yes\n" ]
In the first sample remainders modulo 1 and 4 coincide.
1,250
[ { "input": "4 4", "output": "No" }, { "input": "5 3", "output": "Yes" }, { "input": "1 1", "output": "Yes" }, { "input": "744 18", "output": "No" }, { "input": "47879 10", "output": "Yes" }, { "input": "1000000000000000000 1000000000000000000", "output": "No" }, { "input": "657180569218773599 42", "output": "Yes" }, { "input": "442762254977842799 30", "output": "Yes" }, { "input": "474158606260730555 1", "output": "Yes" }, { "input": "807873101233533988 39", "output": "No" }, { "input": "423 7", "output": "No" }, { "input": "264306177888923090 5", "output": "No" }, { "input": "998857801526481788 87", "output": "No" }, { "input": "999684044704565212 28", "output": "No" }, { "input": "319575605003866172 71", "output": "No" }, { "input": "755804560577415016 17", "output": "No" }, { "input": "72712630136142067 356370939", "output": "No" }, { "input": "807264258068668062 33080422", "output": "No" }, { "input": "808090496951784190 311661970", "output": "No" }, { "input": "808916740129867614 180178111", "output": "No" }, { "input": "1 2", "output": "Yes" }, { "input": "2 1", "output": "Yes" }, { "input": "57334064998850639 19", "output": "Yes" }, { "input": "144353716412182199 11", "output": "Yes" }, { "input": "411002215096001759 11", "output": "Yes" }, { "input": "347116374613371527 3", "output": "Yes" }, { "input": "518264351335130399 37", "output": "Yes" }, { "input": "192435891235905239 11", "output": "Yes" }, { "input": "491802505049361659 7", "output": "Yes" }, { "input": "310113769227703889 3", "output": "Yes" }, { "input": "876240758958364799 41", "output": "Yes" }, { "input": "173284263472319999 33", "output": "Yes" }, { "input": "334366426725130799 29", "output": "Yes" }, { "input": "415543470272330399 26", "output": "Yes" }, { "input": "631689521541558479 22", "output": "Yes" }, { "input": "581859366558790319 14", "output": "Yes" }, { "input": "224113913709159599 10", "output": "Yes" }, { "input": "740368848764104559 21", "output": "Yes" }, { "input": "895803074828822159 17", "output": "Yes" }, { "input": "400349974997012039 13", "output": "Yes" }, { "input": "205439024252247599 5", "output": "Yes" }, { "input": "197688463911338399 39", "output": "Yes" }, { "input": "283175367224349599 39", "output": "Yes" }, { "input": "893208176423362799 31", "output": "Yes" }, { "input": "440681012669897999 27", "output": "Yes" }, { "input": "947403664618451039 19", "output": "Yes" }, { "input": "232435556779345919 19", "output": "Yes" }, { "input": "504428493840551279 23", "output": "Yes" }, { "input": "30019549241681999 20", "output": "Yes" }, { "input": "648000813924303839 16", "output": "Yes" }, { "input": "763169499725761451 488954176053755860", "output": "No" }, { "input": "199398459594277592 452260924647536414", "output": "No" }, { "input": "635627415167826436 192195636386541160", "output": "No" }, { "input": "71856370741375281 155502380685354417", "output": "No" }, { "input": "731457367464667229 118809129279134971", "output": "No" }, { "input": "167686318743248777 858743836723172421", "output": "No" }, { "input": "603915274316797622 822050585316952974", "output": "No" }, { "input": "647896534275160623 65689274138731296", "output": "No" }, { "input": "648722777453244047 501918229712280140", "output": "No" }, { "input": "649549020631327471 41923378183538525", "output": "No" }, { "input": "650375259514443599 597748177714153637", "output": "No" }, { "input": "651201506987494319 33977137582669778", "output": "No" }, { "input": "652027745870610447 470206093156218622", "output": "No" }, { "input": "652853989048693871 906435048729767466", "output": "No" }, { "input": "653680227931809999 342664004303316311", "output": "No" }, { "input": "654506475404860719 375019787446735639", "output": "No" }, { "input": "655332714287976847 438493956600157103", "output": "No" }, { "input": "166512305365727033 900267947832156186", "output": "No" }, { "input": "167338548543810457 336496907700672326", "output": "No" }, { "input": "168164787426926585 772725863274221171", "output": "No" }, { "input": "523 3", "output": "No" }, { "input": "39211 6", "output": "No" }, { "input": "22151 9", "output": "No" }, { "input": "1 3", "output": "No" }, { "input": "47 5", "output": "No" }, { "input": "999999998999999999 1000000000", "output": "No" }, { "input": "11 6", "output": "No" }, { "input": "7 4", "output": "No" }, { "input": "1 10", "output": "No" }, { "input": "9 5", "output": "No" }, { "input": "2519 20", "output": "No" }, { "input": "700001 3", "output": "Yes" }, { "input": "13 7", "output": "No" }, { "input": "999999 10000", "output": "No" }, { "input": "1 4", "output": "No" }, { "input": "232792559 30", "output": "No" }, { "input": "1 5", "output": "No" }, { "input": "5 4", "output": "No" }, { "input": "5 8", "output": "No" }, { "input": "55 4", "output": "No" } ]
1,644,344,486
2,147,483,647
PyPy 3-64
OK
TESTS
90
93
0
n, k = map(int, input().split()) if k > 45: print('No') else: s = set() for i in range(1, k + 1): s.add(n % i) if len(s) == k: print('Yes') else: print('No')
Title: Cave Painting Time Limit: None seconds Memory Limit: None megabytes Problem Description: Imp is watching a documentary about cave painting. Some numbers, carved in chaotic order, immediately attracted his attention. Imp rapidly proposed a guess that they are the remainders of division of a number *n* by all integers *i* from 1 to *k*. Unfortunately, there are too many integers to analyze for Imp. Imp wants you to check whether all these remainders are distinct. Formally, he wants to check, if all , 1<=≤<=*i*<=≤<=*k*, are distinct, i. e. there is no such pair (*i*,<=*j*) that: - 1<=≤<=*i*<=&lt;<=*j*<=≤<=*k*, - , where is the remainder of division *x* by *y*. Input Specification: The only line contains two integers *n*, *k* (1<=≤<=*n*,<=*k*<=≤<=1018). Output Specification: Print "Yes", if all the remainders are distinct, and "No" otherwise. You can print each letter in arbitrary case (lower or upper). Demo Input: ['4 4\n', '5 3\n'] Demo Output: ['No\n', 'Yes\n'] Note: In the first sample remainders modulo 1 and 4 coincide.
```python n, k = map(int, input().split()) if k > 45: print('No') else: s = set() for i in range(1, k + 1): s.add(n % i) if len(s) == k: print('Yes') else: print('No') ```
3
20
C
Dijkstra?
PROGRAMMING
1,900
[ "graphs", "shortest paths" ]
C. Dijkstra?
1
64
You are given a weighted undirected graph. The vertices are enumerated from 1 to *n*. Your task is to find the shortest path between the vertex 1 and the vertex *n*.
The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105), where *n* is the number of vertices and *m* is the number of edges. Following *m* lines contain one edge each in form *a**i*, *b**i* and *w**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=1<=≤<=*w**i*<=≤<=106), where *a**i*,<=*b**i* are edge endpoints and *w**i* is the length of the edge. It is possible that the graph has loops and multiple edges between pair of vertices.
Write the only integer -1 in case of no path. Write the shortest path in opposite case. If there are many solutions, print any of them.
[ "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n", "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n" ]
[ "1 4 3 5 ", "1 4 3 5 " ]
none
1,500
[ { "input": "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1", "output": "1 4 3 5 " }, { "input": "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1", "output": "1 4 3 5 " }, { "input": "2 1\n1 2 1", "output": "1 2 " }, { "input": "3 1\n1 2 1", "output": "-1" }, { "input": "3 3\n1 2 1\n1 3 2\n2 3 1", "output": "1 3 " }, { "input": "10 10\n1 5 12\n2 4 140\n2 10 149\n3 6 154\n3 7 9\n3 8 226\n3 10 132\n4 10 55\n5 8 33\n7 8 173", "output": "1 5 8 7 3 10 " }, { "input": "10 10\n1 5 178\n1 8 221\n2 7 92\n2 8 159\n3 5 55\n3 6 179\n3 10 237\n4 8 205\n5 6 191\n8 10 157", "output": "1 8 10 " }, { "input": "10 10\n1 4 200\n1 9 197\n3 4 79\n3 5 213\n3 6 149\n5 8 3\n5 9 189\n6 7 130\n6 9 51\n8 10 135", "output": "1 9 5 8 10 " }, { "input": "10 10\n1 4 201\n2 3 238\n3 4 40\n3 6 231\n3 8 45\n4 5 227\n4 6 58\n4 9 55\n5 7 14\n6 10 242", "output": "1 4 6 10 " } ]
1,638,257,676
2,147,483,647
Python 3
OK
TESTS
33
561
25,088,000
from heapq import * INF = 1 << 60 n, m = map(int, input().split()) # n, m = 6, 9 d = [INF] * (n + 1) S = [False] * (n+1) adj = [[] for _ in range(n+1)] # print(adj) # adj = [[], [(5, 2), (4, 3)], [(2, 6), (1, 4), (5, 1)], # [(4, 1), (2, 5), (3, 4)], [(1, 2), (3, 3), (3, 5), (4, 6)], # [(2, 3), (3, 4), (2, 6)], [(2, 2), (2, 5), (4, 4)]] q = [] par = [0] * (n+1) for _ in range(m): u, v, w = map(int, input().split()) adj[u].append((w, v)) adj[v].append((w, u)) def find_path(v): p = [] while v != 0: p.append(v) v = par[v] p.reverse() return p starting_vertex = 1 d[starting_vertex] = 0 heappush(q, (0, starting_vertex)) while len(q) > 0: u = heappop(q)[1] if S[u]: continue S[u] = True for w, v in adj[u]: if d[v] > d[u] + w: d[v] = d[u] + w par[v] = u heappush(q, (d[v], v)) if par[n] == 0: print(-1) else: print(' '.join(map(str, find_path(n))))
Title: Dijkstra? Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: You are given a weighted undirected graph. The vertices are enumerated from 1 to *n*. Your task is to find the shortest path between the vertex 1 and the vertex *n*. Input Specification: The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105), where *n* is the number of vertices and *m* is the number of edges. Following *m* lines contain one edge each in form *a**i*, *b**i* and *w**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=1<=≤<=*w**i*<=≤<=106), where *a**i*,<=*b**i* are edge endpoints and *w**i* is the length of the edge. It is possible that the graph has loops and multiple edges between pair of vertices. Output Specification: Write the only integer -1 in case of no path. Write the shortest path in opposite case. If there are many solutions, print any of them. Demo Input: ['5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n', '5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n'] Demo Output: ['1 4 3 5 ', '1 4 3 5 '] Note: none
```python from heapq import * INF = 1 << 60 n, m = map(int, input().split()) # n, m = 6, 9 d = [INF] * (n + 1) S = [False] * (n+1) adj = [[] for _ in range(n+1)] # print(adj) # adj = [[], [(5, 2), (4, 3)], [(2, 6), (1, 4), (5, 1)], # [(4, 1), (2, 5), (3, 4)], [(1, 2), (3, 3), (3, 5), (4, 6)], # [(2, 3), (3, 4), (2, 6)], [(2, 2), (2, 5), (4, 4)]] q = [] par = [0] * (n+1) for _ in range(m): u, v, w = map(int, input().split()) adj[u].append((w, v)) adj[v].append((w, u)) def find_path(v): p = [] while v != 0: p.append(v) v = par[v] p.reverse() return p starting_vertex = 1 d[starting_vertex] = 0 heappush(q, (0, starting_vertex)) while len(q) > 0: u = heappop(q)[1] if S[u]: continue S[u] = True for w, v in adj[u]: if d[v] > d[u] + w: d[v] = d[u] + w par[v] = u heappush(q, (d[v], v)) if par[n] == 0: print(-1) else: print(' '.join(map(str, find_path(n)))) ```
3.53258
15
A
Cottage Village
PROGRAMMING
1,200
[ "implementation", "sortings" ]
A. Cottage Village
2
64
A new cottage village called «Flatville» is being built in Flatland. By now they have already built in «Flatville» *n* square houses with the centres on the *Оx*-axis. The houses' sides are parallel to the coordinate axes. It's known that no two houses overlap, but they can touch each other. The architect bureau, where Peter works, was commissioned to build a new house in «Flatville». The customer wants his future house to be on the *Оx*-axis, to be square in shape, have a side *t*, and touch at least one of the already built houses. For sure, its sides should be parallel to the coordinate axes, its centre should be on the *Ox*-axis and it shouldn't overlap any of the houses in the village. Peter was given a list of all the houses in «Flatville». Would you help him find the amount of possible positions of the new house?
The first line of the input data contains numbers *n* and *t* (1<=≤<=*n*,<=*t*<=≤<=1000). Then there follow *n* lines, each of them contains two space-separated integer numbers: *x**i* *a**i*, where *x**i* — *x*-coordinate of the centre of the *i*-th house, and *a**i* — length of its side (<=-<=1000<=≤<=*x**i*<=≤<=1000, 1<=≤<=*a**i*<=≤<=1000).
Output the amount of possible positions of the new house.
[ "2 2\n0 4\n6 2\n", "2 2\n0 4\n5 2\n", "2 3\n0 4\n5 2\n" ]
[ "4\n", "3\n", "2\n" ]
It is possible for the *x*-coordinate of the new house to have non-integer value.
0
[ { "input": "2 2\n0 4\n6 2", "output": "4" }, { "input": "2 2\n0 4\n5 2", "output": "3" }, { "input": "2 3\n0 4\n5 2", "output": "2" }, { "input": "1 1\n1 1", "output": "2" }, { "input": "1 2\n2 1", "output": "2" }, { "input": "2 1\n2 1\n1 1", "output": "2" }, { "input": "2 2\n0 4\n7 4", "output": "4" }, { "input": "4 1\n-12 1\n-14 1\n4 1\n-11 1", "output": "5" }, { "input": "6 15\n19 1\n2 3\n6 2\n-21 2\n-15 2\n23 1", "output": "2" }, { "input": "10 21\n-61 6\n55 2\n-97 1\n37 1\n-39 1\n26 2\n21 1\n64 3\n-68 1\n-28 6", "output": "6" }, { "input": "26 51\n783 54\n-850 6\n-997 59\n573 31\n-125 20\n472 52\n101 5\n-561 4\n625 35\n911 14\n-47 33\n677 55\n-410 54\n13 53\n173 31\n968 30\n-497 7\n832 42\n271 59\n-638 52\n-301 51\n378 36\n-813 7\n-206 22\n-737 37\n-911 9", "output": "35" }, { "input": "14 101\n121 88\n-452 91\n635 28\n-162 59\n-872 26\n-996 8\n468 86\n742 63\n892 89\n-249 107\n300 51\n-753 17\n-620 31\n-13 34", "output": "16" }, { "input": "3 501\n827 327\n-85 480\n-999 343", "output": "6" }, { "input": "2 999\n-999 471\n530 588", "output": "4" }, { "input": "22 54\n600 43\n806 19\n-269 43\n-384 78\n222 34\n392 10\n318 30\n488 73\n-756 49\n-662 22\n-568 50\n-486 16\n-470 2\n96 66\n864 16\n934 15\n697 43\n-154 30\n775 5\n-876 71\n-33 78\n-991 31", "output": "30" }, { "input": "17 109\n52 7\n216 24\n-553 101\n543 39\n391 92\n-904 67\n95 34\n132 14\n730 103\n952 118\n-389 41\n-324 36\n-74 2\n-147 99\n-740 33\n233 1\n-995 3", "output": "16" }, { "input": "4 512\n-997 354\n-568 216\n-234 221\n603 403", "output": "4" }, { "input": "3 966\n988 5\n15 2\n-992 79", "output": "6" }, { "input": "2 1000\n-995 201\n206 194", "output": "4" }, { "input": "50 21\n-178 1\n49 1\n-98 1\n-220 1\n152 1\n-160 3\n17 2\n77 1\n-24 1\n214 2\n-154 2\n-141 1\n79 1\n206 1\n8 1\n-208 1\n36 1\n231 3\n-2 2\n-130 2\n-14 2\n34 1\n-187 2\n14 1\n-83 2\n-241 1\n149 2\n73 1\n-233 3\n-45 1\n197 1\n145 2\n-127 2\n-229 4\n-85 1\n-66 1\n-76 2\n104 1\n175 1\n70 1\n131 3\n-108 1\n-5 4\n140 1\n33 1\n248 3\n-36 3\n134 1\n-183 1\n56 2", "output": "9" }, { "input": "50 1\n37 1\n-38 1\n7 1\n47 1\n-4 1\n24 1\n-32 1\n-23 1\n-3 1\n-19 1\n5 1\n-50 1\n11 1\n-11 1\n49 1\n-39 1\n0 1\n43 1\n-10 1\n6 1\n19 1\n1 1\n27 1\n29 1\n-47 1\n-40 1\n-46 1\n-26 1\n-42 1\n-37 1\n13 1\n-29 1\n-30 1\n3 1\n44 1\n10 1\n4 1\n-14 1\n-2 1\n34 1\n18 1\n-33 1\n-44 1\n9 1\n-36 1\n-7 1\n25 1\n22 1\n-20 1\n-41 1", "output": "43" }, { "input": "50 1\n-967 7\n696 7\n-366 4\n557 1\n978 2\n800 4\n-161 2\n-773 2\n-248 2\n134 3\n869 6\n-932 2\n-262 14\n191 3\n669 2\n72 5\n0 1\n757 8\n859 2\n-131 8\n-169 3\n543 10\n-120 2\n-87 8\n-936 6\n-620 3\n-281 11\n684 3\n886 10\n497 4\n380 4\n833 1\n-727 6\n470 11\n584 9\n66 6\n-609 12\n-661 4\n-57 8\n628 7\n635 4\n-924 3\n-982 4\n-201 7\n-9 8\n-560 9\n712 7\n-330 8\n-191 1\n-892 7", "output": "96" }, { "input": "1 1000\n0 1000", "output": "2" } ]
1,698,070,227
2,147,483,647
PyPy 3-64
RUNTIME_ERROR
TESTS
0
186
3,379,200
n, t = map(int, input().split()) Houses = list(map(int, input().split())) Houses = 2 for i in range(1, n - 1): Space = Houses[i] - Houses[i - 1] if Space == t: count += 1 elif Space > t: count = 2 print(count)
Title: Cottage Village Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: A new cottage village called «Flatville» is being built in Flatland. By now they have already built in «Flatville» *n* square houses with the centres on the *Оx*-axis. The houses' sides are parallel to the coordinate axes. It's known that no two houses overlap, but they can touch each other. The architect bureau, where Peter works, was commissioned to build a new house in «Flatville». The customer wants his future house to be on the *Оx*-axis, to be square in shape, have a side *t*, and touch at least one of the already built houses. For sure, its sides should be parallel to the coordinate axes, its centre should be on the *Ox*-axis and it shouldn't overlap any of the houses in the village. Peter was given a list of all the houses in «Flatville». Would you help him find the amount of possible positions of the new house? Input Specification: The first line of the input data contains numbers *n* and *t* (1<=≤<=*n*,<=*t*<=≤<=1000). Then there follow *n* lines, each of them contains two space-separated integer numbers: *x**i* *a**i*, where *x**i* — *x*-coordinate of the centre of the *i*-th house, and *a**i* — length of its side (<=-<=1000<=≤<=*x**i*<=≤<=1000, 1<=≤<=*a**i*<=≤<=1000). Output Specification: Output the amount of possible positions of the new house. Demo Input: ['2 2\n0 4\n6 2\n', '2 2\n0 4\n5 2\n', '2 3\n0 4\n5 2\n'] Demo Output: ['4\n', '3\n', '2\n'] Note: It is possible for the *x*-coordinate of the new house to have non-integer value.
```python n, t = map(int, input().split()) Houses = list(map(int, input().split())) Houses = 2 for i in range(1, n - 1): Space = Houses[i] - Houses[i - 1] if Space == t: count += 1 elif Space > t: count = 2 print(count) ```
-1
25
A
IQ test
PROGRAMMING
1,300
[ "brute force" ]
A. IQ test
2
256
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
[ "5\n2 4 7 8 10\n", "4\n1 2 1 1\n" ]
[ "3\n", "2\n" ]
none
0
[ { "input": "5\n2 4 7 8 10", "output": "3" }, { "input": "4\n1 2 1 1", "output": "2" }, { "input": "3\n1 2 2", "output": "1" }, { "input": "3\n100 99 100", "output": "2" }, { "input": "3\n5 3 2", "output": "3" }, { "input": "4\n43 28 1 91", "output": "2" }, { "input": "4\n75 13 94 77", "output": "3" }, { "input": "4\n97 8 27 3", "output": "2" }, { "input": "10\n95 51 12 91 85 3 1 31 25 7", "output": "3" }, { "input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46", "output": "4" }, { "input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36", "output": "26" }, { "input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83", "output": "48" }, { "input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25", "output": "1" }, { "input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46", "output": "25" }, { "input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73", "output": "13" }, { "input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76", "output": "99" }, { "input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14", "output": "1" }, { "input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22", "output": "93" }, { "input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23", "output": "1" }, { "input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98", "output": "1" }, { "input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94", "output": "93" }, { "input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29", "output": "32" }, { "input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47", "output": "26" }, { "input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72", "output": "56" }, { "input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86", "output": "97" }, { "input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42", "output": "79" }, { "input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52", "output": "25" }, { "input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86", "output": "78" }, { "input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68", "output": "70" }, { "input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81", "output": "39" }, { "input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83", "output": "88" }, { "input": "3\n100 100 1", "output": "3" } ]
1,561,033,877
2,147,483,647
Python 3
OK
TESTS
32
218
0
t = int(input()) l = input().split() m=list(map(int,l)) n=[i%2 for i in m] #list comprehension p=list(map(str,n)) s="".join(p) i=0 x=0 while i<t: if s[i]=="1": x+=1 i+=1 if x>1: u=s.find("0")+1 else: u=s.find("1")+1 print(u)
Title: IQ test Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness. Input Specification: The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness. Output Specification: Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order. Demo Input: ['5\n2 4 7 8 10\n', '4\n1 2 1 1\n'] Demo Output: ['3\n', '2\n'] Note: none
```python t = int(input()) l = input().split() m=list(map(int,l)) n=[i%2 for i in m] #list comprehension p=list(map(str,n)) s="".join(p) i=0 x=0 while i<t: if s[i]=="1": x+=1 i+=1 if x>1: u=s.find("0")+1 else: u=s.find("1")+1 print(u) ```
3.9455
69
A
Young Physicist
PROGRAMMING
1,000
[ "implementation", "math" ]
A. Young Physicist
2
256
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
[ "3\n4 1 7\n-2 4 -1\n1 -5 -3\n", "3\n3 -1 7\n-5 2 -4\n2 -1 -3\n" ]
[ "NO", "YES" ]
none
500
[ { "input": "3\n4 1 7\n-2 4 -1\n1 -5 -3", "output": "NO" }, { "input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3", "output": "YES" }, { "input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41", "output": "NO" }, { "input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33", "output": "NO" }, { "input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7", "output": "NO" }, { "input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38", "output": "NO" }, { "input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6", "output": "YES" }, { "input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0", "output": "YES" }, { "input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0", "output": "YES" }, { "input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0", "output": "YES" }, { "input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0", "output": "YES" }, { "input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0", "output": "YES" }, { "input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87", "output": "YES" }, { "input": "3\n1 2 3\n3 2 1\n0 0 0", "output": "NO" }, { "input": "2\n5 -23 12\n0 0 0", "output": "NO" }, { "input": "1\n0 0 0", "output": "YES" }, { "input": "1\n1 -2 0", "output": "NO" }, { "input": "2\n-23 77 -86\n23 -77 86", "output": "YES" }, { "input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82", "output": "YES" }, { "input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0", "output": "YES" }, { "input": "3\n96 49 -12\n2 -66 28\n-98 17 -16", "output": "YES" }, { "input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0", "output": "YES" }, { "input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53", "output": "YES" }, { "input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1", "output": "YES" }, { "input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0", "output": "YES" }, { "input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0", "output": "YES" }, { "input": "3\n0 2 -2\n1 -1 3\n-3 0 0", "output": "NO" } ]
1,572,333,875
2,147,483,647
Python 3
COMPILATION_ERROR
TESTS
0
0
0
def judge_force(): num = input() X = 0 Y = 0 Z = 0 for i in range num: x,y,z = map(int,input().split()) X += x Y += y Z += z if X == Y == Z == 0: print('YES') else: print('NO') judge_force()
Title: Young Physicist Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. Input Specification: The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). Output Specification: Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. Demo Input: ['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n'] Demo Output: ['NO', 'YES'] Note: none
```python def judge_force(): num = input() X = 0 Y = 0 Z = 0 for i in range num: x,y,z = map(int,input().split()) X += x Y += y Z += z if X == Y == Z == 0: print('YES') else: print('NO') judge_force() ```
-1
71
A
Way Too Long Words
PROGRAMMING
800
[ "strings" ]
A. Way Too Long Words
1
256
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome. Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation. This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes. Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n". You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
[ "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n" ]
[ "word\nl10n\ni18n\np43s\n" ]
none
500
[ { "input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis", "output": "word\nl10n\ni18n\np43s" }, { "input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm", "output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m" }, { "input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd", "output": "n20n\nj27b\nk15d" }, { "input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt", "output": "t41t" }, { "input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings", "output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings" }, { "input": "1\na", "output": "a" }, { "input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz", "output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz" }, { "input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij", "output": "a98j" }, { "input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco", "output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco" }, { "input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt", "output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t" }, { "input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr", "output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr" } ]
1,688,376,947
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
31
0
n=int(input()) for i in range(n): w=str(input()) if len(w) >=10: print(w[0]+str(len(w)-2)+w[-1]) else: print(w)
Title: Way Too Long Words Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome. Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation. This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes. Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n". You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. Output Specification: Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. Demo Input: ['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n'] Demo Output: ['word\nl10n\ni18n\np43s\n'] Note: none
```python n=int(input()) for i in range(n): w=str(input()) if len(w) >=10: print(w[0]+str(len(w)-2)+w[-1]) else: print(w) ```
0
483
A
Counterexample
PROGRAMMING
1,100
[ "brute force", "implementation", "math", "number theory" ]
null
null
Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one. Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime. You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=≤<=*a*<=&lt;<=*b*<=&lt;<=*c*<=≤<=*r*. More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=≤<=*a*<=&lt;<=*b*<=&lt;<=*c*<=≤<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime.
The single line contains two positive space-separated integers *l*, *r* (1<=≤<=*l*<=≤<=*r*<=≤<=1018; *r*<=-<=*l*<=≤<=50).
Print three positive space-separated integers *a*, *b*, *c* — three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order. If the counterexample does not exist, print the single number -1.
[ "2 4\n", "10 11\n", "900000000000000009 900000000000000029\n" ]
[ "2 3 4\n", "-1\n", "900000000000000009 900000000000000010 900000000000000021\n" ]
In the first sample pair (2, 4) is not coprime and pairs (2, 3) and (3, 4) are. In the second sample you cannot form a group of three distinct integers, so the answer is -1. In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.
500
[ { "input": "2 4", "output": "2 3 4" }, { "input": "10 11", "output": "-1" }, { "input": "900000000000000009 900000000000000029", "output": "900000000000000009 900000000000000010 900000000000000021" }, { "input": "640097987171091791 640097987171091835", "output": "640097987171091792 640097987171091793 640097987171091794" }, { "input": "19534350415104721 19534350415104725", "output": "19534350415104722 19534350415104723 19534350415104724" }, { "input": "933700505788726243 933700505788726280", "output": "933700505788726244 933700505788726245 933700505788726246" }, { "input": "1 3", "output": "-1" }, { "input": "1 4", "output": "2 3 4" }, { "input": "1 1", "output": "-1" }, { "input": "266540997167959130 266540997167959164", "output": "266540997167959130 266540997167959131 266540997167959132" }, { "input": "267367244641009850 267367244641009899", "output": "267367244641009850 267367244641009851 267367244641009852" }, { "input": "268193483524125978 268193483524125993", "output": "268193483524125978 268193483524125979 268193483524125980" }, { "input": "269019726702209402 269019726702209432", "output": "269019726702209402 269019726702209403 269019726702209404" }, { "input": "269845965585325530 269845965585325576", "output": "269845965585325530 269845965585325531 269845965585325532" }, { "input": "270672213058376250 270672213058376260", "output": "270672213058376250 270672213058376251 270672213058376252" }, { "input": "271498451941492378 271498451941492378", "output": "-1" }, { "input": "272324690824608506 272324690824608523", "output": "272324690824608506 272324690824608507 272324690824608508" }, { "input": "273150934002691930 273150934002691962", "output": "273150934002691930 273150934002691931 273150934002691932" }, { "input": "996517375802030516 996517375802030524", "output": "996517375802030516 996517375802030517 996517375802030518" }, { "input": "997343614685146644 997343614685146694", "output": "997343614685146644 997343614685146645 997343614685146646" }, { "input": "998169857863230068 998169857863230083", "output": "998169857863230068 998169857863230069 998169857863230070" }, { "input": "998996101041313492 998996101041313522", "output": "998996101041313492 998996101041313493 998996101041313494" }, { "input": "999822344219396916 999822344219396961", "output": "999822344219396916 999822344219396917 999822344219396918" }, { "input": "648583102513043 648583102513053", "output": "648583102513044 648583102513045 648583102513046" }, { "input": "266540997167959130 266540997167959131", "output": "-1" }, { "input": "267367244641009850 267367244641009850", "output": "-1" }, { "input": "268193483524125978 268193483524125979", "output": "-1" }, { "input": "269019726702209402 269019726702209402", "output": "-1" }, { "input": "269845965585325530 269845965585325530", "output": "-1" }, { "input": "270672213058376250 270672213058376254", "output": "270672213058376250 270672213058376251 270672213058376252" }, { "input": "271498451941492378 271498451941492379", "output": "-1" }, { "input": "272324690824608506 272324690824608508", "output": "272324690824608506 272324690824608507 272324690824608508" }, { "input": "273150934002691930 273150934002691931", "output": "-1" }, { "input": "996517375802030516 996517375802030518", "output": "996517375802030516 996517375802030517 996517375802030518" }, { "input": "997343614685146644 997343614685146644", "output": "-1" }, { "input": "2147483647 2147483649", "output": "-1" }, { "input": "3 5", "output": "-1" }, { "input": "1 7", "output": "2 3 4" }, { "input": "9 12", "output": "9 11 12" }, { "input": "4 4", "output": "-1" }, { "input": "11 13", "output": "-1" }, { "input": "2 2", "output": "-1" } ]
1,632,930,778
2,147,483,647
PyPy 3
OK
TESTS
42
108
20,172,800
s=input().split() l=int(s[0]) r=int(s[1]) while(l%2!=0): l+=1; if(r-l>=2): print(str(l)+" "+str(l+1)+" "+str(l+2)) else: print(-1)
Title: Counterexample Time Limit: None seconds Memory Limit: None megabytes Problem Description: Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one. Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime. You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=≤<=*a*<=&lt;<=*b*<=&lt;<=*c*<=≤<=*r*. More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=≤<=*a*<=&lt;<=*b*<=&lt;<=*c*<=≤<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime. Input Specification: The single line contains two positive space-separated integers *l*, *r* (1<=≤<=*l*<=≤<=*r*<=≤<=1018; *r*<=-<=*l*<=≤<=50). Output Specification: Print three positive space-separated integers *a*, *b*, *c* — three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order. If the counterexample does not exist, print the single number -1. Demo Input: ['2 4\n', '10 11\n', '900000000000000009 900000000000000029\n'] Demo Output: ['2 3 4\n', '-1\n', '900000000000000009 900000000000000010 900000000000000021\n'] Note: In the first sample pair (2, 4) is not coprime and pairs (2, 3) and (3, 4) are. In the second sample you cannot form a group of three distinct integers, so the answer is -1. In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.
```python s=input().split() l=int(s[0]) r=int(s[1]) while(l%2!=0): l+=1; if(r-l>=2): print(str(l)+" "+str(l+1)+" "+str(l+2)) else: print(-1) ```
3
500
A
New Year Transportation
PROGRAMMING
1,000
[ "dfs and similar", "graphs", "implementation" ]
null
null
New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=×<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells. So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≤<=*i*<=≤<=*n*<=-<=1 the condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≤<=*i*<=≤<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* one can't leave the Line World using portals. Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system.
The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=3<=×<=104) and *t* (2<=≤<=*t*<=≤<=*n*) — the number of cells, and the index of the cell which I want to go to. The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≤<=*a**i*<=≤<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World.
If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO".
[ "8 4\n1 2 1 2 1 2 1\n", "8 5\n1 2 1 2 1 1 1\n" ]
[ "YES\n", "NO\n" ]
In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4. In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
500
[ { "input": "8 4\n1 2 1 2 1 2 1", "output": "YES" }, { "input": "8 5\n1 2 1 2 1 1 1", "output": "NO" }, { "input": "20 19\n13 16 7 6 12 1 5 7 8 6 5 7 5 5 3 3 2 2 1", "output": "YES" }, { "input": "50 49\n11 7 1 41 26 36 19 16 38 14 36 35 37 27 20 27 3 6 21 2 27 11 18 17 19 16 22 8 8 9 1 7 5 12 5 6 13 6 11 2 6 3 1 5 1 1 2 2 1", "output": "YES" }, { "input": "120 104\n41 15 95 85 34 11 25 42 65 39 77 80 74 17 66 73 21 14 36 63 63 79 45 24 65 7 63 80 51 21 2 19 78 28 71 2 15 23 17 68 62 18 54 39 43 70 3 46 34 23 41 65 32 10 13 18 10 3 16 48 54 18 57 28 3 24 44 50 15 2 20 22 45 44 3 29 2 27 11 2 12 25 25 31 1 2 32 4 11 30 13 16 26 21 1 13 21 8 15 5 18 13 5 15 3 8 13 6 5 1 9 7 1 2 4 1 1 2 1", "output": "NO" }, { "input": "10 3\n8 3 5 4 2 3 2 2 1", "output": "NO" }, { "input": "10 9\n8 3 5 4 2 3 2 2 1", "output": "YES" }, { "input": "3 2\n1 1", "output": "YES" }, { "input": "3 2\n2 1", "output": "NO" }, { "input": "4 2\n2 1 1", "output": "NO" }, { "input": "4 4\n2 2 1", "output": "YES" }, { "input": "8 8\n1 2 1 2 1 2 1", "output": "YES" }, { "input": "3 3\n1 1", "output": "YES" }, { "input": "8 8\n1 2 1 2 1 1 1", "output": "YES" }, { "input": "3 3\n2 1", "output": "YES" }, { "input": "4 4\n1 1 1", "output": "YES" }, { "input": "8 8\n1 1 1 1 1 1 1", "output": "YES" }, { "input": "5 5\n1 1 1 1", "output": "YES" } ]
1,654,661,115
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
30
1,433,600
n, m = map(int, input().split()) arr = list(map(int, input().split())) flag=0 for i in range(n): pos = (i+1) + arr[i] if pos==m: flag=1 break if pos>m: break if flag==1: print("YES") else: print("NO")
Title: New Year Transportation Time Limit: None seconds Memory Limit: None megabytes Problem Description: New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=×<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells. So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≤<=*i*<=≤<=*n*<=-<=1 the condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≤<=*i*<=≤<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* one can't leave the Line World using portals. Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system. Input Specification: The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=3<=×<=104) and *t* (2<=≤<=*t*<=≤<=*n*) — the number of cells, and the index of the cell which I want to go to. The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≤<=*a**i*<=≤<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World. Output Specification: If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO". Demo Input: ['8 4\n1 2 1 2 1 2 1\n', '8 5\n1 2 1 2 1 1 1\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4. In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
```python n, m = map(int, input().split()) arr = list(map(int, input().split())) flag=0 for i in range(n): pos = (i+1) + arr[i] if pos==m: flag=1 break if pos>m: break if flag==1: print("YES") else: print("NO") ```
0
165
B
Burning Midnight Oil
PROGRAMMING
1,500
[ "binary search", "implementation" ]
null
null
One day a highly important task was commissioned to Vasya — writing a program in a night. The program consists of *n* lines of code. Vasya is already exhausted, so he works like that: first he writes *v* lines of code, drinks a cup of tea, then he writes as much as lines, drinks another cup of tea, then he writes lines and so on: , , , ... The expression is regarded as the integral part from dividing number *a* by number *b*. The moment the current value equals 0, Vasya immediately falls asleep and he wakes up only in the morning, when the program should already be finished. Vasya is wondering, what minimum allowable value *v* can take to let him write not less than *n* lines of code before he falls asleep.
The input consists of two integers *n* and *k*, separated by spaces — the size of the program in lines and the productivity reduction coefficient, 1<=≤<=*n*<=≤<=109, 2<=≤<=*k*<=≤<=10.
Print the only integer — the minimum value of *v* that lets Vasya write the program in one night.
[ "7 2\n", "59 9\n" ]
[ "4\n", "54\n" ]
In the first sample the answer is *v* = 4. Vasya writes the code in the following portions: first 4 lines, then 2, then 1, and then Vasya falls asleep. Thus, he manages to write 4 + 2 + 1 = 7 lines in a night and complete the task. In the second sample the answer is *v* = 54. Vasya writes the code in the following portions: 54, 6. The total sum is 54 + 6 = 60, that's even more than *n* = 59.
1,000
[ { "input": "7 2", "output": "4" }, { "input": "59 9", "output": "54" }, { "input": "1 9", "output": "1" }, { "input": "11 2", "output": "7" }, { "input": "747 2", "output": "376" }, { "input": "6578 2", "output": "3293" }, { "input": "37212 2", "output": "18609" }, { "input": "12357 2", "output": "6181" }, { "input": "7998332 2", "output": "3999172" }, { "input": "86275251 2", "output": "43137632" }, { "input": "75584551 2", "output": "37792280" }, { "input": "6 3", "output": "5" }, { "input": "43 4", "output": "33" }, { "input": "811 3", "output": "543" }, { "input": "3410 4", "output": "2560" }, { "input": "21341 4", "output": "16009" }, { "input": "696485 4", "output": "522368" }, { "input": "8856748 3", "output": "5904504" }, { "input": "2959379 4", "output": "2219538" }, { "input": "831410263 3", "output": "554273516" }, { "input": "2 5", "output": "2" }, { "input": "19 6", "output": "17" }, { "input": "715 7", "output": "615" }, { "input": "9122 5", "output": "7300" }, { "input": "89117 6", "output": "74268" }, { "input": "689973 7", "output": "591408" }, { "input": "3024524 5", "output": "2419624" }, { "input": "67127156 6", "output": "55939302" }, { "input": "412262167 7", "output": "353367574" }, { "input": "6 8", "output": "6" }, { "input": "59 9", "output": "54" }, { "input": "246 10", "output": "222" }, { "input": "5314 8", "output": "4651" }, { "input": "15309 9", "output": "13609" }, { "input": "35648 10", "output": "32085" }, { "input": "3018012 8", "output": "2640764" }, { "input": "92153348 9", "output": "81914089" }, { "input": "177583558 10", "output": "159825206" }, { "input": "1000000000 2", "output": "500000008" }, { "input": "1000000000 3", "output": "666666672" }, { "input": "1000000000 4", "output": "750000005" }, { "input": "1000000000 5", "output": "800000003" }, { "input": "1000000000 6", "output": "833333338" }, { "input": "1000000000 7", "output": "857142861" }, { "input": "1000000000 8", "output": "875000004" }, { "input": "1000000000 9", "output": "888888894" }, { "input": "1000000000 10", "output": "900000001" }, { "input": "1 4", "output": "1" }, { "input": "2 10", "output": "2" }, { "input": "1 2", "output": "1" }, { "input": "6 8", "output": "6" }, { "input": "987862820 9", "output": "878100288" }, { "input": "979591791 9", "output": "870748262" }, { "input": "948889213 9", "output": "843457081" }, { "input": "8 9", "output": "8" }, { "input": "999999999 10", "output": "900000000" } ]
1,657,810,503
2,147,483,647
Python 3
OK
TESTS
56
92
0
n , k = [int(i) for i in input().split()] l = 1 r = n while l < r: mid = (l + r) // 2 x = mid s = 0 while x > 0: s += x x //= k if s >= n: r = mid else: l = mid + 1 print(l)
Title: Burning Midnight Oil Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day a highly important task was commissioned to Vasya — writing a program in a night. The program consists of *n* lines of code. Vasya is already exhausted, so he works like that: first he writes *v* lines of code, drinks a cup of tea, then he writes as much as lines, drinks another cup of tea, then he writes lines and so on: , , , ... The expression is regarded as the integral part from dividing number *a* by number *b*. The moment the current value equals 0, Vasya immediately falls asleep and he wakes up only in the morning, when the program should already be finished. Vasya is wondering, what minimum allowable value *v* can take to let him write not less than *n* lines of code before he falls asleep. Input Specification: The input consists of two integers *n* and *k*, separated by spaces — the size of the program in lines and the productivity reduction coefficient, 1<=≤<=*n*<=≤<=109, 2<=≤<=*k*<=≤<=10. Output Specification: Print the only integer — the minimum value of *v* that lets Vasya write the program in one night. Demo Input: ['7 2\n', '59 9\n'] Demo Output: ['4\n', '54\n'] Note: In the first sample the answer is *v* = 4. Vasya writes the code in the following portions: first 4 lines, then 2, then 1, and then Vasya falls asleep. Thus, he manages to write 4 + 2 + 1 = 7 lines in a night and complete the task. In the second sample the answer is *v* = 54. Vasya writes the code in the following portions: 54, 6. The total sum is 54 + 6 = 60, that's even more than *n* = 59.
```python n , k = [int(i) for i in input().split()] l = 1 r = n while l < r: mid = (l + r) // 2 x = mid s = 0 while x > 0: s += x x //= k if s >= n: r = mid else: l = mid + 1 print(l) ```
3
923
C
Perfect Security
PROGRAMMING
1,800
[ "data structures", "greedy", "strings", "trees" ]
null
null
Alice has a very important message *M* consisting of some non-negative integers that she wants to keep secret from Eve. Alice knows that the only theoretically secure cipher is one-time pad. Alice generates a random key *K* of the length equal to the message's length. Alice computes the bitwise xor of each element of the message and the key (, where denotes the [bitwise XOR operation](https://en.wikipedia.org/wiki/Bitwise_operation#XOR)) and stores this encrypted message *A*. Alice is smart. Be like Alice. For example, Alice may have wanted to store a message *M*<==<=(0,<=15,<=9,<=18). She generated a key *K*<==<=(16,<=7,<=6,<=3). The encrypted message is thus *A*<==<=(16,<=8,<=15,<=17). Alice realised that she cannot store the key with the encrypted message. Alice sent her key *K* to Bob and deleted her own copy. Alice is smart. Really, be like Alice. Bob realised that the encrypted message is only secure as long as the key is secret. Bob thus randomly permuted the key before storing it. Bob thinks that this way, even if Eve gets both the encrypted message and the key, she will not be able to read the message. Bob is not smart. Don't be like Bob. In the above example, Bob may have, for instance, selected a permutation (3,<=4,<=1,<=2) and stored the permuted key *P*<==<=(6,<=3,<=16,<=7). One year has passed and Alice wants to decrypt her message. Only now Bob has realised that this is impossible. As he has permuted the key randomly, the message is lost forever. Did we mention that Bob isn't smart? Bob wants to salvage at least some information from the message. Since he is not so smart, he asks for your help. You know the encrypted message *A* and the permuted key *P*. What is the lexicographically smallest message that could have resulted in the given encrypted text? More precisely, for given *A* and *P*, find the lexicographically smallest message *O*, for which there exists a permutation π such that for every *i*. Note that the sequence *S* is lexicographically smaller than the sequence *T*, if there is an index *i* such that *S**i*<=&lt;<=*T**i* and for all *j*<=&lt;<=*i* the condition *S**j*<==<=*T**j* holds.
The first line contains a single integer *N* (1<=≤<=*N*<=≤<=300000), the length of the message. The second line contains *N* integers *A*1,<=*A*2,<=...,<=*A**N* (0<=≤<=*A**i*<=&lt;<=230) representing the encrypted message. The third line contains *N* integers *P*1,<=*P*2,<=...,<=*P**N* (0<=≤<=*P**i*<=&lt;<=230) representing the permuted encryption key.
Output a single line with *N* integers, the lexicographically smallest possible message *O*. Note that all its elements should be non-negative.
[ "3\n8 4 13\n17 2 7\n", "5\n12 7 87 22 11\n18 39 9 12 16\n", "10\n331415699 278745619 998190004 423175621 42983144 166555524 843586353 802130100 337889448 685310951\n226011312 266003835 342809544 504667531 529814910 684873393 817026985 844010788 993949858 1031395667\n" ]
[ "10 3 28\n", "0 14 69 6 44\n", "128965467 243912600 4281110 112029883 223689619 76924724 429589 119397893 613490433 362863284\n" ]
In the first case, the solution is (10, 3, 28), since <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/a896b30a69636d1bfbfa981eae10650f5fee843c.png" style="max-width: 100.0%;max-height: 100.0%;"/>, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e383e4333ea37c4652ce2ac1ccfc2cfcf96e0896.png" style="max-width: 100.0%;max-height: 100.0%;"/> and <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c24ed3c6f88805eb3710487b3fe07ff64034151a.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Other possible permutations of key yield messages (25, 6, 10), (25, 3, 15), (10, 21, 10), (15, 21, 15) and (15, 6, 28), which are all lexicographically larger than the solution.
1,500
[ { "input": "3\n8 4 13\n17 2 7", "output": "10 3 28" }, { "input": "5\n12 7 87 22 11\n18 39 9 12 16", "output": "0 14 69 6 44" }, { "input": "10\n331415699 278745619 998190004 423175621 42983144 166555524 843586353 802130100 337889448 685310951\n226011312 266003835 342809544 504667531 529814910 684873393 817026985 844010788 993949858 1031395667", "output": "128965467 243912600 4281110 112029883 223689619 76924724 429589 119397893 613490433 362863284" }, { "input": "5\n134 246 57 176 239\n14 83 97 175 187", "output": "41 77 55 209 188" }, { "input": "10\n241 187 20 18 151 144 238 193 86 63\n18 69 86 91 111 118 124 172 227 253", "output": "12 23 6 68 116 203 129 132 32 67" }, { "input": "4\n0 0 0 0\n0 0 0 0", "output": "0 0 0 0" }, { "input": "4\n5 5 3 3\n5 3 3 7", "output": "0 2 0 0" } ]
1,586,168,855
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
0
3,500
256,512,000
def add_number(x): global last,t,size curr = 0 for i in range(29,-1,-1): go = (x>>i) & 1 if not t[curr][go]: last += 1 t[curr][go] = last curr = t[curr][go] size[curr] += 1 def get_min(x): global last, t, size curr = 0 res = x for i in range(29, -1, -1): go = (x >> i) & 1 if size[t[curr][go]]==0: go ^= 1 res ^= go<<i curr = t[curr][go] size[curr] -= 1 return res if __name__=="__main__": n = int(input()) a = list(map(int,input().strip().split())) p = list(map(int,input().strip().split())) N = 9*(10**6)+20 last = 0 t = [[0 for _ in range(2)]for _ in range(N)] size = [0]*N for val in p: add_number(val) for val in a: print(get_min(val),end=' ')
Title: Perfect Security Time Limit: None seconds Memory Limit: None megabytes Problem Description: Alice has a very important message *M* consisting of some non-negative integers that she wants to keep secret from Eve. Alice knows that the only theoretically secure cipher is one-time pad. Alice generates a random key *K* of the length equal to the message's length. Alice computes the bitwise xor of each element of the message and the key (, where denotes the [bitwise XOR operation](https://en.wikipedia.org/wiki/Bitwise_operation#XOR)) and stores this encrypted message *A*. Alice is smart. Be like Alice. For example, Alice may have wanted to store a message *M*<==<=(0,<=15,<=9,<=18). She generated a key *K*<==<=(16,<=7,<=6,<=3). The encrypted message is thus *A*<==<=(16,<=8,<=15,<=17). Alice realised that she cannot store the key with the encrypted message. Alice sent her key *K* to Bob and deleted her own copy. Alice is smart. Really, be like Alice. Bob realised that the encrypted message is only secure as long as the key is secret. Bob thus randomly permuted the key before storing it. Bob thinks that this way, even if Eve gets both the encrypted message and the key, she will not be able to read the message. Bob is not smart. Don't be like Bob. In the above example, Bob may have, for instance, selected a permutation (3,<=4,<=1,<=2) and stored the permuted key *P*<==<=(6,<=3,<=16,<=7). One year has passed and Alice wants to decrypt her message. Only now Bob has realised that this is impossible. As he has permuted the key randomly, the message is lost forever. Did we mention that Bob isn't smart? Bob wants to salvage at least some information from the message. Since he is not so smart, he asks for your help. You know the encrypted message *A* and the permuted key *P*. What is the lexicographically smallest message that could have resulted in the given encrypted text? More precisely, for given *A* and *P*, find the lexicographically smallest message *O*, for which there exists a permutation π such that for every *i*. Note that the sequence *S* is lexicographically smaller than the sequence *T*, if there is an index *i* such that *S**i*<=&lt;<=*T**i* and for all *j*<=&lt;<=*i* the condition *S**j*<==<=*T**j* holds. Input Specification: The first line contains a single integer *N* (1<=≤<=*N*<=≤<=300000), the length of the message. The second line contains *N* integers *A*1,<=*A*2,<=...,<=*A**N* (0<=≤<=*A**i*<=&lt;<=230) representing the encrypted message. The third line contains *N* integers *P*1,<=*P*2,<=...,<=*P**N* (0<=≤<=*P**i*<=&lt;<=230) representing the permuted encryption key. Output Specification: Output a single line with *N* integers, the lexicographically smallest possible message *O*. Note that all its elements should be non-negative. Demo Input: ['3\n8 4 13\n17 2 7\n', '5\n12 7 87 22 11\n18 39 9 12 16\n', '10\n331415699 278745619 998190004 423175621 42983144 166555524 843586353 802130100 337889448 685310951\n226011312 266003835 342809544 504667531 529814910 684873393 817026985 844010788 993949858 1031395667\n'] Demo Output: ['10 3 28\n', '0 14 69 6 44\n', '128965467 243912600 4281110 112029883 223689619 76924724 429589 119397893 613490433 362863284\n'] Note: In the first case, the solution is (10, 3, 28), since <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/a896b30a69636d1bfbfa981eae10650f5fee843c.png" style="max-width: 100.0%;max-height: 100.0%;"/>, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e383e4333ea37c4652ce2ac1ccfc2cfcf96e0896.png" style="max-width: 100.0%;max-height: 100.0%;"/> and <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c24ed3c6f88805eb3710487b3fe07ff64034151a.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Other possible permutations of key yield messages (25, 6, 10), (25, 3, 15), (10, 21, 10), (15, 21, 15) and (15, 6, 28), which are all lexicographically larger than the solution.
```python def add_number(x): global last,t,size curr = 0 for i in range(29,-1,-1): go = (x>>i) & 1 if not t[curr][go]: last += 1 t[curr][go] = last curr = t[curr][go] size[curr] += 1 def get_min(x): global last, t, size curr = 0 res = x for i in range(29, -1, -1): go = (x >> i) & 1 if size[t[curr][go]]==0: go ^= 1 res ^= go<<i curr = t[curr][go] size[curr] -= 1 return res if __name__=="__main__": n = int(input()) a = list(map(int,input().strip().split())) p = list(map(int,input().strip().split())) N = 9*(10**6)+20 last = 0 t = [[0 for _ in range(2)]for _ in range(N)] size = [0]*N for val in p: add_number(val) for val in a: print(get_min(val),end=' ') ```
0
964
A
Splits
PROGRAMMING
800
[ "math" ]
null
null
Let's define a split of $n$ as a nonincreasing sequence of positive integers, the sum of which is $n$. For example, the following sequences are splits of $8$: $[4, 4]$, $[3, 3, 2]$, $[2, 2, 1, 1, 1, 1]$, $[5, 2, 1]$. The following sequences aren't splits of $8$: $[1, 7]$, $[5, 4]$, $[11, -3]$, $[1, 1, 4, 1, 1]$. The weight of a split is the number of elements in the split that are equal to the first element. For example, the weight of the split $[1, 1, 1, 1, 1]$ is $5$, the weight of the split $[5, 5, 3, 3, 3]$ is $2$ and the weight of the split $[9]$ equals $1$. For a given $n$, find out the number of different weights of its splits.
The first line contains one integer $n$ ($1 \leq n \leq 10^9$).
Output one integer — the answer to the problem.
[ "7\n", "8\n", "9\n" ]
[ "4\n", "5\n", "5\n" ]
In the first sample, there are following possible weights of splits of $7$: Weight 1: [$\textbf 7$] Weight 2: [$\textbf 3$, $\textbf 3$, 1] Weight 3: [$\textbf 2$, $\textbf 2$, $\textbf 2$, 1] Weight 7: [$\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$]
500
[ { "input": "7", "output": "4" }, { "input": "8", "output": "5" }, { "input": "9", "output": "5" }, { "input": "1", "output": "1" }, { "input": "286", "output": "144" }, { "input": "48", "output": "25" }, { "input": "941", "output": "471" }, { "input": "45154", "output": "22578" }, { "input": "60324", "output": "30163" }, { "input": "91840", "output": "45921" }, { "input": "41909", "output": "20955" }, { "input": "58288", "output": "29145" }, { "input": "91641", "output": "45821" }, { "input": "62258", "output": "31130" }, { "input": "79811", "output": "39906" }, { "input": "88740", "output": "44371" }, { "input": "12351", "output": "6176" }, { "input": "1960", "output": "981" }, { "input": "29239", "output": "14620" }, { "input": "85801", "output": "42901" }, { "input": "43255", "output": "21628" }, { "input": "13439", "output": "6720" }, { "input": "35668", "output": "17835" }, { "input": "19122", "output": "9562" }, { "input": "60169", "output": "30085" }, { "input": "50588", "output": "25295" }, { "input": "2467", "output": "1234" }, { "input": "39315", "output": "19658" }, { "input": "29950", "output": "14976" }, { "input": "17286", "output": "8644" }, { "input": "7359066", "output": "3679534" }, { "input": "1016391", "output": "508196" }, { "input": "7928871", "output": "3964436" }, { "input": "3968891", "output": "1984446" }, { "input": "2636452", "output": "1318227" }, { "input": "5076901", "output": "2538451" }, { "input": "9870265", "output": "4935133" }, { "input": "2453786", "output": "1226894" }, { "input": "7263670", "output": "3631836" }, { "input": "1890845", "output": "945423" }, { "input": "574128507", "output": "287064254" }, { "input": "648476655", "output": "324238328" }, { "input": "97349542", "output": "48674772" }, { "input": "716489761", "output": "358244881" }, { "input": "858771038", "output": "429385520" }, { "input": "520778784", "output": "260389393" }, { "input": "439004204", "output": "219502103" }, { "input": "589992198", "output": "294996100" }, { "input": "371106544", "output": "185553273" }, { "input": "894241590", "output": "447120796" }, { "input": "123957268", "output": "61978635" }, { "input": "234149297", "output": "117074649" }, { "input": "789954052", "output": "394977027" }, { "input": "667978920", "output": "333989461" }, { "input": "154647261", "output": "77323631" }, { "input": "751453521", "output": "375726761" }, { "input": "848862308", "output": "424431155" }, { "input": "323926781", "output": "161963391" }, { "input": "576768825", "output": "288384413" }, { "input": "31293802", "output": "15646902" }, { "input": "2", "output": "2" }, { "input": "1000000000", "output": "500000001" }, { "input": "3", "output": "2" } ]
1,523,974,356
456
Python 3
WRONG_ANSWER
PRETESTS
1
77
7,065,600
n=int(input()) s=set() for i in range(1,n+1): s.add(n%i) print(len(s))
Title: Splits Time Limit: None seconds Memory Limit: None megabytes Problem Description: Let's define a split of $n$ as a nonincreasing sequence of positive integers, the sum of which is $n$. For example, the following sequences are splits of $8$: $[4, 4]$, $[3, 3, 2]$, $[2, 2, 1, 1, 1, 1]$, $[5, 2, 1]$. The following sequences aren't splits of $8$: $[1, 7]$, $[5, 4]$, $[11, -3]$, $[1, 1, 4, 1, 1]$. The weight of a split is the number of elements in the split that are equal to the first element. For example, the weight of the split $[1, 1, 1, 1, 1]$ is $5$, the weight of the split $[5, 5, 3, 3, 3]$ is $2$ and the weight of the split $[9]$ equals $1$. For a given $n$, find out the number of different weights of its splits. Input Specification: The first line contains one integer $n$ ($1 \leq n \leq 10^9$). Output Specification: Output one integer — the answer to the problem. Demo Input: ['7\n', '8\n', '9\n'] Demo Output: ['4\n', '5\n', '5\n'] Note: In the first sample, there are following possible weights of splits of $7$: Weight 1: [$\textbf 7$] Weight 2: [$\textbf 3$, $\textbf 3$, 1] Weight 3: [$\textbf 2$, $\textbf 2$, $\textbf 2$, 1] Weight 7: [$\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$]
```python n=int(input()) s=set() for i in range(1,n+1): s.add(n%i) print(len(s)) ```
0
129
A
Cookies
PROGRAMMING
900
[ "implementation" ]
null
null
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
[ "1\n1\n", "10\n1 2 2 3 4 4 4 2 2 2\n", "11\n2 2 2 2 2 2 2 2 2 2 99\n" ]
[ "1\n", "8\n", "1\n" ]
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies. In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total. In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
500
[ { "input": "1\n1", "output": "1" }, { "input": "10\n1 2 2 3 4 4 4 2 2 2", "output": "8" }, { "input": "11\n2 2 2 2 2 2 2 2 2 2 99", "output": "1" }, { "input": "2\n1 1", "output": "0" }, { "input": "2\n2 2", "output": "2" }, { "input": "2\n1 2", "output": "1" }, { "input": "7\n7 7 7 7 7 7 7", "output": "7" }, { "input": "8\n1 2 3 4 5 6 7 8", "output": "4" }, { "input": "100\n1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2", "output": "50" }, { "input": "99\n99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99", "output": "49" }, { "input": "82\n43 44 96 33 23 42 33 66 53 87 8 90 43 91 40 88 51 18 48 62 59 10 22 20 54 6 13 63 2 56 31 52 98 42 54 32 26 77 9 24 33 91 16 30 39 34 78 82 73 90 12 15 67 76 30 18 44 86 84 98 65 54 100 79 28 34 40 56 11 43 72 35 86 59 89 40 30 33 7 19 44 15", "output": "50" }, { "input": "17\n50 14 17 77 74 74 38 76 41 27 45 29 66 98 38 73 38", "output": "7" }, { "input": "94\n81 19 90 99 26 11 86 44 78 36 80 59 99 90 78 72 71 20 94 56 42 40 71 84 10 85 10 70 52 27 39 55 90 16 48 25 7 79 99 100 38 10 99 56 3 4 78 9 16 57 14 40 52 54 57 70 30 86 56 84 97 60 59 69 49 66 23 92 90 46 86 73 53 47 1 83 14 20 24 66 13 45 41 14 86 75 55 88 48 95 82 24 47 87", "output": "39" }, { "input": "88\n64 95 12 90 40 65 98 45 52 54 79 7 81 25 98 19 68 82 41 53 35 50 5 22 32 21 8 39 8 6 72 27 81 30 12 79 21 42 60 2 66 87 46 93 62 78 52 71 76 32 78 94 86 85 55 15 34 76 41 20 32 26 94 81 89 45 74 49 11 40 40 39 49 46 80 85 90 23 80 40 86 58 70 26 48 93 23 53", "output": "37" }, { "input": "84\n95 9 43 43 13 84 60 90 1 8 97 99 54 34 59 83 33 15 51 26 40 12 66 65 19 30 29 78 92 60 25 13 19 84 71 73 12 24 54 49 16 41 11 40 57 59 34 40 39 9 71 83 1 77 79 53 94 47 78 55 77 85 29 52 80 90 53 77 97 97 27 79 28 23 83 25 26 22 49 86 63 56 3 32", "output": "51" }, { "input": "47\n61 97 76 94 91 22 2 68 62 73 90 47 16 79 44 71 98 68 43 6 53 52 40 27 68 67 43 96 14 91 60 61 96 24 97 13 32 65 85 96 81 77 34 18 23 14 80", "output": "21" }, { "input": "69\n71 1 78 74 58 89 30 6 100 90 22 61 11 59 14 74 27 25 78 61 45 19 25 33 37 4 52 43 53 38 9 100 56 67 69 38 76 91 63 60 93 52 28 61 9 98 8 14 57 63 89 64 98 51 36 66 36 86 13 82 50 91 52 64 86 78 78 83 81", "output": "37" }, { "input": "52\n38 78 36 75 19 3 56 1 39 97 24 79 84 16 93 55 96 64 12 24 1 86 80 29 12 32 36 36 73 39 76 65 53 98 30 20 28 8 86 43 70 22 75 69 62 65 81 25 53 40 71 59", "output": "28" }, { "input": "74\n81 31 67 97 26 75 69 81 11 13 13 74 77 88 52 20 52 64 66 75 72 28 41 54 26 75 41 91 75 15 18 36 13 83 63 61 14 48 53 63 19 67 35 48 23 65 73 100 44 55 92 88 99 17 73 25 83 7 31 89 12 80 98 39 42 75 14 29 81 35 77 87 33 94", "output": "47" }, { "input": "44\n46 56 31 31 37 71 94 2 14 100 45 72 36 72 80 3 38 54 42 98 50 32 31 42 62 31 45 50 95 100 18 17 64 22 18 25 52 56 70 57 43 40 81 28", "output": "15" }, { "input": "22\n28 57 40 74 51 4 45 84 99 12 95 14 92 60 47 81 84 51 31 91 59 42", "output": "11" }, { "input": "59\n73 45 94 76 41 49 65 13 74 66 36 25 47 75 40 23 92 72 11 32 32 8 81 26 68 56 41 8 76 47 96 55 70 11 84 14 83 18 70 22 30 39 28 100 48 11 92 45 78 69 86 1 54 90 98 91 13 17 35", "output": "33" }, { "input": "63\n20 18 44 94 68 57 16 43 74 55 68 24 21 95 76 84 50 50 47 86 86 12 58 55 28 72 86 18 34 45 81 88 3 72 41 9 60 90 81 93 12 6 9 6 2 41 1 7 9 29 81 14 64 80 20 36 67 54 7 5 35 81 22", "output": "37" }, { "input": "28\n49 84 48 19 44 91 11 82 96 95 88 90 71 82 87 25 31 23 18 13 98 45 26 65 35 12 31 14", "output": "15" }, { "input": "61\n34 18 28 64 28 45 9 77 77 20 63 92 79 16 16 100 86 2 91 91 57 15 31 95 10 88 84 5 82 83 53 98 59 17 97 80 76 80 81 3 91 81 87 93 61 46 10 49 6 22 21 75 63 89 21 81 30 19 67 38 77", "output": "35" }, { "input": "90\n41 90 43 1 28 75 90 50 3 70 76 64 81 63 25 69 83 82 29 91 59 66 21 61 7 55 72 49 38 69 72 20 64 58 30 81 61 29 96 14 39 5 100 20 29 98 75 29 44 78 97 45 26 77 73 59 22 99 41 6 3 96 71 20 9 18 96 18 90 62 34 78 54 5 41 6 73 33 2 54 26 21 18 6 45 57 43 73 95 75", "output": "42" }, { "input": "45\n93 69 4 27 20 14 71 48 79 3 32 26 49 30 57 88 13 56 49 61 37 32 47 41 41 70 45 68 82 18 8 6 25 20 15 13 71 99 28 6 52 34 19 59 26", "output": "23" }, { "input": "33\n29 95 48 49 91 10 83 71 47 25 66 36 51 12 34 10 54 74 41 96 89 26 89 1 42 33 1 62 9 32 49 65 78", "output": "15" }, { "input": "34\n98 24 42 36 41 82 28 58 89 34 77 70 76 44 74 54 66 100 13 79 4 88 21 1 11 45 91 29 87 100 29 54 82 78", "output": "13" }, { "input": "29\n91 84 26 84 9 63 52 9 65 56 90 2 36 7 67 33 91 14 65 38 53 36 81 83 85 14 33 95 51", "output": "17" }, { "input": "100\n2 88 92 82 87 100 78 28 84 43 78 32 43 33 97 19 15 52 29 84 57 72 54 13 99 28 82 79 40 70 34 92 91 53 9 88 27 43 14 92 72 37 26 37 20 95 19 34 49 64 33 37 34 27 80 79 9 54 99 68 25 4 68 73 46 66 24 78 3 87 26 52 50 84 4 95 23 83 39 58 86 36 33 16 98 2 84 19 53 12 69 60 10 11 78 17 79 92 77 59", "output": "45" }, { "input": "100\n2 95 45 73 9 54 20 97 57 82 88 26 18 71 25 27 75 54 31 11 58 85 69 75 72 91 76 5 25 80 45 49 4 73 8 81 81 38 5 12 53 77 7 96 90 35 28 80 73 94 19 69 96 17 94 49 69 9 32 19 5 12 46 29 26 40 59 59 6 95 82 50 72 2 45 69 12 5 72 29 39 72 23 96 81 28 28 56 68 58 37 41 30 1 90 84 15 24 96 43", "output": "53" }, { "input": "100\n27 72 35 91 13 10 35 45 24 55 83 84 63 96 29 79 34 67 63 92 48 83 18 77 28 27 49 66 29 88 55 15 6 58 14 67 94 36 77 7 7 64 61 52 71 18 36 99 76 6 50 67 16 13 41 7 89 73 61 51 78 22 78 32 76 100 3 31 89 71 63 53 15 85 77 54 89 33 68 74 3 23 57 5 43 89 75 35 9 86 90 11 31 46 48 37 74 17 77 8", "output": "40" }, { "input": "100\n69 98 69 88 11 49 55 8 25 91 17 81 47 26 15 73 96 71 18 42 42 61 48 14 92 78 35 72 4 27 62 75 83 79 17 16 46 80 96 90 82 54 37 69 85 21 67 70 96 10 46 63 21 59 56 92 54 88 77 30 75 45 44 29 86 100 51 11 65 69 66 56 82 63 27 1 51 51 13 10 3 55 26 85 34 16 87 72 13 100 81 71 90 95 86 50 83 55 55 54", "output": "53" }, { "input": "100\n34 35 99 64 2 66 78 93 20 48 12 79 19 10 87 7 42 92 60 79 5 2 24 89 57 48 63 92 74 4 16 51 7 12 90 48 87 17 18 73 51 58 97 97 25 38 15 97 96 73 67 91 6 75 14 13 87 79 75 3 15 55 35 95 71 45 10 13 20 37 82 26 2 22 13 83 97 84 39 79 43 100 54 59 98 8 61 34 7 65 75 44 24 77 73 88 34 95 44 77", "output": "55" }, { "input": "100\n15 86 3 1 51 26 74 85 37 87 64 58 10 6 57 26 30 47 85 65 24 72 50 40 12 35 91 47 91 60 47 87 95 34 80 91 26 3 36 39 14 86 28 70 51 44 28 21 72 79 57 61 16 71 100 94 57 67 36 74 24 21 89 85 25 2 97 67 76 53 76 80 97 64 35 13 8 32 21 52 62 61 67 14 74 73 66 44 55 76 24 3 43 42 99 61 36 80 38 66", "output": "52" }, { "input": "100\n45 16 54 54 80 94 74 93 75 85 58 95 79 30 81 2 84 4 57 23 92 64 78 1 50 36 13 27 56 54 10 77 87 1 5 38 85 74 94 82 30 45 72 83 82 30 81 82 82 3 69 82 7 92 39 60 94 42 41 5 3 17 67 21 79 44 79 96 28 3 53 68 79 89 63 83 1 44 4 31 84 15 73 77 19 66 54 6 73 1 67 24 91 11 86 45 96 82 20 89", "output": "51" }, { "input": "100\n84 23 50 32 90 71 92 43 58 70 6 82 7 55 85 19 70 89 12 26 29 56 74 30 2 27 4 39 63 67 91 81 11 33 75 10 82 88 39 43 43 80 68 35 55 67 53 62 73 65 86 74 43 51 14 48 42 92 83 57 22 33 24 99 5 27 78 96 7 28 11 15 8 38 85 67 5 92 24 96 57 59 14 95 91 4 9 18 45 33 74 83 64 85 14 51 51 94 29 2", "output": "53" }, { "input": "100\n77 56 56 45 73 55 32 37 39 50 30 95 79 21 44 34 51 43 86 91 39 30 85 15 35 93 100 14 57 31 80 79 38 40 88 4 91 54 7 95 76 26 62 84 17 33 67 47 6 82 69 51 17 2 59 24 11 12 31 90 12 11 55 38 72 49 30 50 42 46 5 97 9 9 30 45 86 23 19 82 40 42 5 40 35 98 35 32 60 60 5 28 84 35 21 49 68 53 68 23", "output": "48" }, { "input": "100\n78 38 79 61 45 86 83 83 86 90 74 69 2 84 73 39 2 5 20 71 24 80 54 89 58 34 77 40 39 62 2 47 28 53 97 75 88 98 94 96 33 71 44 90 47 36 19 89 87 98 90 87 5 85 34 79 82 3 42 88 89 63 35 7 89 30 40 48 12 41 56 76 83 60 80 80 39 56 77 4 72 96 30 55 57 51 7 19 11 1 66 1 91 87 11 62 95 85 79 25", "output": "48" }, { "input": "100\n5 34 23 20 76 75 19 51 17 82 60 13 83 6 65 16 20 43 66 54 87 10 87 73 50 24 16 98 33 28 80 52 54 82 26 92 14 13 84 92 94 29 61 21 60 20 48 94 24 20 75 70 58 27 68 45 86 89 29 8 67 38 83 48 18 100 11 22 46 84 52 97 70 19 50 75 3 7 52 53 72 41 18 31 1 38 49 53 11 64 99 76 9 87 48 12 100 32 44 71", "output": "58" }, { "input": "100\n76 89 68 78 24 72 73 95 98 72 58 15 2 5 56 32 9 65 50 70 94 31 29 54 89 52 31 93 43 56 26 35 72 95 51 55 78 70 11 92 17 5 54 94 81 31 78 95 73 91 95 37 59 9 53 48 65 55 84 8 45 97 64 37 96 34 36 53 66 17 72 48 99 23 27 18 92 84 44 73 60 78 53 29 68 99 19 39 61 40 69 6 77 12 47 29 15 4 8 45", "output": "53" }, { "input": "100\n82 40 31 53 8 50 85 93 3 84 54 17 96 59 51 42 18 19 35 84 79 31 17 46 54 82 72 49 35 73 26 89 61 73 3 50 12 29 25 77 88 21 58 24 22 89 96 54 82 29 96 56 77 16 1 68 90 93 20 23 57 22 31 18 92 90 51 14 50 72 31 54 12 50 66 62 2 34 17 45 68 50 87 97 23 71 1 72 17 82 42 15 20 78 4 49 66 59 10 17", "output": "54" }, { "input": "100\n32 82 82 24 39 53 48 5 29 24 9 37 91 37 91 95 1 97 84 52 12 56 93 47 22 20 14 17 40 22 79 34 24 2 69 30 69 29 3 89 21 46 60 92 39 29 18 24 49 18 40 22 60 13 77 50 39 64 50 70 99 8 66 31 90 38 20 54 7 21 5 56 41 68 69 20 54 89 69 62 9 53 43 89 81 97 15 2 52 78 89 65 16 61 59 42 56 25 32 52", "output": "49" }, { "input": "100\n72 54 23 24 97 14 99 87 15 25 7 23 17 87 72 31 71 87 34 82 51 77 74 85 62 38 24 7 84 48 98 21 29 71 70 84 25 58 67 92 18 44 32 9 81 15 53 29 63 18 86 16 7 31 38 99 70 32 89 16 23 11 66 96 69 82 97 59 6 9 49 80 85 19 6 9 52 51 85 74 53 46 73 55 31 63 78 61 34 80 77 65 87 77 92 52 89 8 52 31", "output": "44" }, { "input": "100\n56 88 8 19 7 15 11 54 35 50 19 57 63 72 51 43 50 19 57 90 40 100 8 92 11 96 30 32 59 65 93 47 62 3 50 41 30 50 72 83 61 46 83 60 20 46 33 1 5 18 83 22 34 16 41 95 63 63 7 59 55 95 91 29 64 60 64 81 45 45 10 9 88 37 69 85 21 82 41 76 42 34 47 78 51 83 65 100 13 22 59 76 63 1 26 86 36 94 99 74", "output": "46" }, { "input": "100\n27 89 67 60 62 80 43 50 28 88 72 5 94 11 63 91 18 78 99 3 71 26 12 97 74 62 23 24 22 3 100 72 98 7 94 32 12 75 61 88 42 48 10 14 45 9 48 56 73 76 70 70 79 90 35 39 96 37 81 11 19 65 99 39 23 79 34 61 35 74 90 37 73 23 46 21 94 84 73 58 11 89 13 9 10 85 42 78 73 32 53 39 49 90 43 5 28 31 97 75", "output": "53" }, { "input": "100\n33 24 97 96 1 14 99 51 13 65 67 20 46 88 42 44 20 49 5 89 98 83 15 40 74 83 58 3 10 79 34 2 69 28 37 100 55 52 14 8 44 94 97 89 6 42 11 28 30 33 55 56 20 57 52 25 75 1 87 42 62 41 37 12 54 85 95 80 42 36 94 96 28 76 54 36 4 17 26 24 62 15 17 79 84 36 92 78 74 91 96 77 54 92 81 91 62 98 37 37", "output": "43" }, { "input": "100\n86 24 61 15 11 85 1 31 47 36 23 36 59 34 3 27 16 29 82 28 58 52 52 66 71 61 98 39 60 20 67 41 67 90 73 29 92 17 70 95 58 98 58 32 21 73 46 56 87 72 80 75 40 27 94 31 59 92 93 37 14 99 96 21 97 23 81 91 52 52 96 94 92 28 38 29 52 16 57 27 17 24 91 21 79 55 96 98 95 94 23 78 79 12 77 35 32 75 100 82", "output": "51" }, { "input": "100\n88 85 41 37 69 21 7 69 36 5 92 26 64 75 22 46 67 20 70 22 62 66 38 24 47 49 68 30 90 31 67 86 86 82 9 51 43 45 48 42 73 44 31 94 45 60 54 66 20 87 11 94 34 32 87 66 56 28 75 39 37 90 72 93 55 72 31 42 30 71 87 61 4 12 12 81 23 61 56 98 71 32 30 33 96 63 92 16 8 78 47 91 47 54 49 3 81 82 41 5", "output": "47" }, { "input": "1\n2", "output": "1" }, { "input": "5\n1 1 3 2 2", "output": "3" } ]
1,695,564,485
2,147,483,647
PyPy 3-64
OK
TESTS
52
124
0
n = int(input()) lst = list(map(int, input().split())) odds = sum(1 for x in lst if x % 2 == 1) if odds % 2 == 1: print(odds) else: print(n - odds)
Title: Cookies Time Limit: None seconds Memory Limit: None megabytes Problem Description: Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even? Input Specification: The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag. Output Specification: Print in the only line the only number — the sought number of ways. If there are no such ways print 0. Demo Input: ['1\n1\n', '10\n1 2 2 3 4 4 4 2 2 2\n', '11\n2 2 2 2 2 2 2 2 2 2 99\n'] Demo Output: ['1\n', '8\n', '1\n'] Note: In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies. In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total. In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
```python n = int(input()) lst = list(map(int, input().split())) odds = sum(1 for x in lst if x % 2 == 1) if odds % 2 == 1: print(odds) else: print(n - odds) ```
3
709
A
Juicer
PROGRAMMING
900
[ "implementation" ]
null
null
Kolya is going to make fresh orange juice. He has *n* oranges of sizes *a*1,<=*a*2,<=...,<=*a**n*. Kolya will put them in the juicer in the fixed order, starting with orange of size *a*1, then orange of size *a*2 and so on. To be put in the juicer the orange must have size not exceeding *b*, so if Kolya sees an orange that is strictly greater he throws it away and continues with the next one. The juicer has a special section to collect waste. It overflows if Kolya squeezes oranges of the total size strictly greater than *d*. When it happens Kolya empties the waste section (even if there are no more oranges) and continues to squeeze the juice. How many times will he have to empty the waste section?
The first line of the input contains three integers *n*, *b* and *d* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*b*<=≤<=*d*<=≤<=1<=000<=000) — the number of oranges, the maximum size of the orange that fits in the juicer and the value *d*, which determines the condition when the waste section should be emptied. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1<=000<=000) — sizes of the oranges listed in the order Kolya is going to try to put them in the juicer.
Print one integer — the number of times Kolya will have to empty the waste section.
[ "2 7 10\n5 6\n", "1 5 10\n7\n", "3 10 10\n5 7 7\n", "1 1 1\n1\n" ]
[ "1\n", "0\n", "1\n", "0\n" ]
In the first sample, Kolya will squeeze the juice from two oranges and empty the waste section afterwards. In the second sample, the orange won't fit in the juicer so Kolya will have no juice at all.
500
[ { "input": "2 7 10\n5 6", "output": "1" }, { "input": "1 5 10\n7", "output": "0" }, { "input": "3 10 10\n5 7 7", "output": "1" }, { "input": "1 1 1\n1", "output": "0" }, { "input": "2 951637 951638\n44069 951637", "output": "1" }, { "input": "50 100 129\n55 130 91 19 116 3 63 52 104 76 75 27 151 99 149 147 39 148 84 9 132 49 40 112 124 141 144 93 36 32 146 74 48 38 150 55 94 32 107 69 77 81 33 57 62 98 78 127 154 126", "output": "12" }, { "input": "100 1000 1083\n992 616 818 359 609 783 263 989 501 929 362 394 919 1081 870 830 1097 975 62 346 531 367 323 457 707 360 949 334 867 116 478 417 961 963 1029 114 867 1008 988 916 983 1077 959 942 572 961 579 318 721 337 488 717 111 70 416 685 987 130 353 107 61 191 827 849 106 815 211 953 111 398 889 860 801 71 375 320 395 1059 116 222 931 444 582 74 677 655 88 173 686 491 661 186 114 832 615 814 791 464 517 850", "output": "36" }, { "input": "2 6 8\n2 1", "output": "0" }, { "input": "5 15 16\n7 11 5 12 8", "output": "2" }, { "input": "15 759966 759967\n890397 182209 878577 548548 759966 812923 759966 860479 200595 381358 299175 339368 759966 907668 69574", "output": "4" }, { "input": "5 234613 716125\n642626 494941 234613 234613 234613", "output": "0" }, { "input": "50 48547 567054\n529808 597004 242355 559114 78865 537318 631455 733020 655072 645093 309010 855034 306058 625046 524574 834944 27330 664392 443637 821584 338013 490702 289520 675471 885846 258814 134220 571301 84875 94132 200425 928833 375166 521232 317961 175315 947093 89971 322071 174033 48547 998535 954205 704114 943163 438900 48547 538422 48547 48547", "output": "0" }, { "input": "5 10 20\n10 10 10 10 1", "output": "1" }, { "input": "5 10 11\n10 10 10 10 1", "output": "2" }, { "input": "3 10 10\n4 3 3", "output": "0" }, { "input": "3 5 5\n5 5 5", "output": "1" }, { "input": "3 4 14\n5 5 5", "output": "0" }, { "input": "2 7 10\n1234 1234", "output": "0" }, { "input": "1 5 6\n10", "output": "0" }, { "input": "3 4 6\n1 2 3", "output": "0" }, { "input": "5 10 12\n13 13 13 13 13", "output": "0" }, { "input": "3 4 5\n5 7 9", "output": "0" }, { "input": "3 10 100\n5 5 5", "output": "0" }, { "input": "5 1 2\n2 2 2 2 2", "output": "0" }, { "input": "5 5 5\n5 5 5 5 5", "output": "2" }, { "input": "2 2 5\n5 5", "output": "0" }, { "input": "3 1 4\n2 2 2", "output": "0" } ]
1,657,288,935
2,147,483,647
Python 3
OK
TESTS
58
109
6,963,200
n,b,d=map(int,input().split()) a=list(map(int,input().split())) x,y=0,0 for i in a: if i<=b: x+=i if x>d: y+=1 x=0 print(y)
Title: Juicer Time Limit: None seconds Memory Limit: None megabytes Problem Description: Kolya is going to make fresh orange juice. He has *n* oranges of sizes *a*1,<=*a*2,<=...,<=*a**n*. Kolya will put them in the juicer in the fixed order, starting with orange of size *a*1, then orange of size *a*2 and so on. To be put in the juicer the orange must have size not exceeding *b*, so if Kolya sees an orange that is strictly greater he throws it away and continues with the next one. The juicer has a special section to collect waste. It overflows if Kolya squeezes oranges of the total size strictly greater than *d*. When it happens Kolya empties the waste section (even if there are no more oranges) and continues to squeeze the juice. How many times will he have to empty the waste section? Input Specification: The first line of the input contains three integers *n*, *b* and *d* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*b*<=≤<=*d*<=≤<=1<=000<=000) — the number of oranges, the maximum size of the orange that fits in the juicer and the value *d*, which determines the condition when the waste section should be emptied. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1<=000<=000) — sizes of the oranges listed in the order Kolya is going to try to put them in the juicer. Output Specification: Print one integer — the number of times Kolya will have to empty the waste section. Demo Input: ['2 7 10\n5 6\n', '1 5 10\n7\n', '3 10 10\n5 7 7\n', '1 1 1\n1\n'] Demo Output: ['1\n', '0\n', '1\n', '0\n'] Note: In the first sample, Kolya will squeeze the juice from two oranges and empty the waste section afterwards. In the second sample, the orange won't fit in the juicer so Kolya will have no juice at all.
```python n,b,d=map(int,input().split()) a=list(map(int,input().split())) x,y=0,0 for i in a: if i<=b: x+=i if x>d: y+=1 x=0 print(y) ```
3
181
A
Series of Crimes
PROGRAMMING
800
[ "brute force", "geometry", "implementation" ]
null
null
The Berland capital is shaken with three bold crimes committed by the Pihsters, a notorious criminal gang. The Berland capital's map is represented by an *n*<=×<=*m* rectangular table. Each cell of the table on the map represents some districts of the capital. The capital's main detective Polycarpus took a map and marked there the districts where the first three robberies had been committed as asterisks. Deduction tells Polycarpus that the fourth robbery will be committed in such district, that all four robbed districts will form the vertices of some rectangle, parallel to the sides of the map. Polycarpus is good at deduction but he's hopeless at math. So he asked you to find the district where the fourth robbery will be committed.
The first line contains two space-separated integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of rows and columns in the table, correspondingly. Each of the next *n* lines contains *m* characters — the description of the capital's map. Each character can either be a "." (dot), or an "*" (asterisk). A character equals "*" if the corresponding district has been robbed. Otherwise, it equals ".". It is guaranteed that the map has exactly three characters "*" and we can always find the fourth district that meets the problem requirements.
Print two integers — the number of the row and the number of the column of the city district that is the fourth one to be robbed. The rows are numbered starting from one from top to bottom and the columns are numbered starting from one from left to right.
[ "3 2\n.*\n..\n**\n", "3 3\n*.*\n*..\n...\n" ]
[ "1 1\n", "2 3\n" ]
none
500
[ { "input": "3 2\n.*\n..\n**", "output": "1 1" }, { "input": "2 5\n*....\n*...*", "output": "1 5" }, { "input": "7 2\n..\n**\n..\n..\n..\n..\n.*", "output": "7 1" }, { "input": "7 2\n*.\n..\n..\n..\n..\n..\n**", "output": "1 2" }, { "input": "2 10\n*......*..\n.......*..", "output": "2 1" }, { "input": "10 3\n*..\n...\n...\n...\n...\n...\n...\n...\n...\n**.", "output": "1 2" }, { "input": "100 2\n*.\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n**", "output": "1 2" }, { "input": "99 3\n**.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n*..", "output": "99 2" }, { "input": "98 3\n...\n.*.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n.**", "output": "2 3" }, { "input": "99 3\n**.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n*..", "output": "99 2" }, { "input": "98 3\n...\n.*.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n.**", "output": "2 3" }, { "input": "2 100\n...................................................................................................*\n*..................................................................................................*", "output": "1 1" }, { "input": "2 2\n*.\n**", "output": "1 2" }, { "input": "2 2\n**\n.*", "output": "2 1" }, { "input": "2 3\n*.*\n..*", "output": "2 1" } ]
1,679,167,798
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
92
0
entrada=list(input().lower()) vocales = "aeiouy" lista2=[] for i in range(len(entrada)): if entrada[i] in vocales: pass else: lista2.append(entrada[i]) for k in lista2: print(f".{k}",end="")
Title: Series of Crimes Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Berland capital is shaken with three bold crimes committed by the Pihsters, a notorious criminal gang. The Berland capital's map is represented by an *n*<=×<=*m* rectangular table. Each cell of the table on the map represents some districts of the capital. The capital's main detective Polycarpus took a map and marked there the districts where the first three robberies had been committed as asterisks. Deduction tells Polycarpus that the fourth robbery will be committed in such district, that all four robbed districts will form the vertices of some rectangle, parallel to the sides of the map. Polycarpus is good at deduction but he's hopeless at math. So he asked you to find the district where the fourth robbery will be committed. Input Specification: The first line contains two space-separated integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of rows and columns in the table, correspondingly. Each of the next *n* lines contains *m* characters — the description of the capital's map. Each character can either be a "." (dot), or an "*" (asterisk). A character equals "*" if the corresponding district has been robbed. Otherwise, it equals ".". It is guaranteed that the map has exactly three characters "*" and we can always find the fourth district that meets the problem requirements. Output Specification: Print two integers — the number of the row and the number of the column of the city district that is the fourth one to be robbed. The rows are numbered starting from one from top to bottom and the columns are numbered starting from one from left to right. Demo Input: ['3 2\n.*\n..\n**\n', '3 3\n*.*\n*..\n...\n'] Demo Output: ['1 1\n', '2 3\n'] Note: none
```python entrada=list(input().lower()) vocales = "aeiouy" lista2=[] for i in range(len(entrada)): if entrada[i] in vocales: pass else: lista2.append(entrada[i]) for k in lista2: print(f".{k}",end="") ```
0
745
A
Hongcow Learns the Cyclic Shift
PROGRAMMING
900
[ "implementation", "strings" ]
null
null
Hongcow is learning to spell! One day, his teacher gives him a word that he needs to learn to spell. Being a dutiful student, he immediately learns how to spell the word. Hongcow has decided to try to make new words from this one. He starts by taking the word he just learned how to spell, and moves the last character of the word to the beginning of the word. He calls this a cyclic shift. He can apply cyclic shift many times. For example, consecutively applying cyclic shift operation to the word "abracadabra" Hongcow will get words "aabracadabr", "raabracadab" and so on. Hongcow is now wondering how many distinct words he can generate by doing the cyclic shift arbitrarily many times. The initial string is also counted.
The first line of input will be a single string *s* (1<=≤<=|*s*|<=≤<=50), the word Hongcow initially learns how to spell. The string *s* consists only of lowercase English letters ('a'–'z').
Output a single integer equal to the number of distinct strings that Hongcow can obtain by applying the cyclic shift arbitrarily many times to the given string.
[ "abcd\n", "bbb\n", "yzyz\n" ]
[ "4\n", "1\n", "2\n" ]
For the first sample, the strings Hongcow can generate are "abcd", "dabc", "cdab", and "bcda". For the second sample, no matter how many times Hongcow does the cyclic shift, Hongcow can only generate "bbb". For the third sample, the two strings Hongcow can generate are "yzyz" and "zyzy".
500
[ { "input": "abcd", "output": "4" }, { "input": "bbb", "output": "1" }, { "input": "yzyz", "output": "2" }, { "input": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxy", "output": "25" }, { "input": "zclkjadoprqronzclkjadoprqronzclkjadoprqron", "output": "14" }, { "input": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz", "output": "1" }, { "input": "xyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxy", "output": "2" }, { "input": "y", "output": "1" }, { "input": "ervbfotfedpozygoumbmxeaqegouaqqzqerlykhmvxvvlcaos", "output": "49" }, { "input": "zyzzzyyzyyyzyyzyzyzyzyzzzyyyzzyzyyzzzzzyyyzzzzyzyy", "output": "50" }, { "input": "zzfyftdezzfyftdezzfyftdezzfyftdezzfyftdezzfyftde", "output": "8" }, { "input": "yehcqdlllqpuxdsaicyjjxiylahgxbygmsopjbxhtimzkashs", "output": "49" }, { "input": "yyyyzzzyzzzyzyzyzyyyyyzzyzyzyyyyyzyzyyyzyzzyyzzzz", "output": "49" }, { "input": "zkqcrhzlzsnwzkqcrhzlzsnwzkqcrhzlzsnwzkqcrhzlzsnw", "output": "12" }, { "input": "xxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxy", "output": "3" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaabaaaaaaaaaaaaaaaaaaaaaaaab", "output": "25" }, { "input": "aabaaabaaabaaabaaabaaabaaabaaabaaabaaabaaabaaaba", "output": "4" }, { "input": "pqqpqqpqqpqqpqqpqqpqqpqqpqqpqqpqqppqppqppqppqppq", "output": "48" }, { "input": "zxkljaqzxkljaqzxkljaqzxkljaqzxrljaqzxkljaqzxkljaq", "output": "49" }, { "input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwx", "output": "50" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaz", "output": "50" }, { "input": "abcddcba", "output": "8" }, { "input": "aabaabaabaacaabaabaabaacaabaabaabaacaabaabaabaac", "output": "12" }, { "input": "aabaabcaabaabcdaabaabcaabaabcd", "output": "15" }, { "input": "ababaababaaababaababaaaababaababaaababaababaaaa", "output": "47" }, { "input": "ababaababaaababaababaaaababaababaaababaababaaa", "output": "23" }, { "input": "aaababaab", "output": "9" }, { "input": "aba", "output": "3" } ]
1,481,993,742
1,242
Python 3
OK
TESTS
28
62
4,608,000
s=input() temp=[] temp.append(s) l=len(s) for i in range(0,l): p="" for j in range(1,l): p=p+s[j]; p=p+s[0] s=p if(p not in temp): temp.append(p) print(len(temp))
Title: Hongcow Learns the Cyclic Shift Time Limit: None seconds Memory Limit: None megabytes Problem Description: Hongcow is learning to spell! One day, his teacher gives him a word that he needs to learn to spell. Being a dutiful student, he immediately learns how to spell the word. Hongcow has decided to try to make new words from this one. He starts by taking the word he just learned how to spell, and moves the last character of the word to the beginning of the word. He calls this a cyclic shift. He can apply cyclic shift many times. For example, consecutively applying cyclic shift operation to the word "abracadabra" Hongcow will get words "aabracadabr", "raabracadab" and so on. Hongcow is now wondering how many distinct words he can generate by doing the cyclic shift arbitrarily many times. The initial string is also counted. Input Specification: The first line of input will be a single string *s* (1<=≤<=|*s*|<=≤<=50), the word Hongcow initially learns how to spell. The string *s* consists only of lowercase English letters ('a'–'z'). Output Specification: Output a single integer equal to the number of distinct strings that Hongcow can obtain by applying the cyclic shift arbitrarily many times to the given string. Demo Input: ['abcd\n', 'bbb\n', 'yzyz\n'] Demo Output: ['4\n', '1\n', '2\n'] Note: For the first sample, the strings Hongcow can generate are "abcd", "dabc", "cdab", and "bcda". For the second sample, no matter how many times Hongcow does the cyclic shift, Hongcow can only generate "bbb". For the third sample, the two strings Hongcow can generate are "yzyz" and "zyzy".
```python s=input() temp=[] temp.append(s) l=len(s) for i in range(0,l): p="" for j in range(1,l): p=p+s[j]; p=p+s[0] s=p if(p not in temp): temp.append(p) print(len(temp)) ```
3
496
B
Secret Combination
PROGRAMMING
1,500
[ "brute force", "constructive algorithms", "implementation" ]
null
null
You got a box with a combination lock. The lock has a display showing *n* digits. There are two buttons on the box, each button changes digits on the display. You have quickly discovered that the first button adds 1 to all the digits (all digits 9 become digits 0), and the second button shifts all the digits on the display one position to the right (the last digit becomes the first one). For example, if the display is currently showing number 579, then if we push the first button, the display will show 680, and if after that we push the second button, the display will show 068. You know that the lock will open if the display is showing the smallest possible number that can be obtained by pushing the buttons in some order. The leading zeros are ignored while comparing numbers. Now your task is to find the desired number.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of digits on the display. The second line contains *n* digits — the initial state of the display.
Print a single line containing *n* digits — the desired state of the display containing the smallest possible number.
[ "3\n579\n", "4\n2014\n" ]
[ "024\n", "0142\n" ]
none
1,000
[ { "input": "3\n579", "output": "024" }, { "input": "4\n2014", "output": "0142" }, { "input": "1\n1", "output": "0" }, { "input": "3\n039", "output": "014" }, { "input": "4\n4444", "output": "0000" }, { "input": "5\n46802", "output": "02468" }, { "input": "10\n4447444444", "output": "0000000003" }, { "input": "10\n5810438174", "output": "0147609473" }, { "input": "30\n027027027027027027027027027027", "output": "027027027027027027027027027027" }, { "input": "50\n41012516454101251645410125164541012516454101251645", "output": "01076781720107678172010767817201076781720107678172" }, { "input": "72\n464553044645330446455304464553064645530445455304464553044645530446455304", "output": "001011960020119600201196002011960020119600201996002011960020119620201196" }, { "input": "100\n2144315253572020279108092911160072328496568665545836825277616363478721946398140227406814602154768031", "output": "0005996121738545755443472571416650525236761083528703911639570359104365792010332041424619191680979818" }, { "input": "200\n79025531557298703099245700860027432585447902553155729870309924570086002743258544790255315572987030992457008600274325854479025531557298703099245700860027432585447902553155729870309924570086002743258544", "output": "00274325854479025531557298703099245700860027432585447902553155729870309924570086002743258544790255315572987030992457008600274325854479025531557298703099245700860027432585447902553155729870309924570086" }, { "input": "100\n6669666666666666666866266666666666666666666666666666666666666666626666666666666966666766665667666656", "output": "0000000000000000000000000000000000000000006000000000000030000010000900100009000030000000000000002006" }, { "input": "1\n0", "output": "0" } ]
1,587,386,522
2,147,483,647
PyPy 3
OK
TESTS
28
576
9,932,800
import io, os from functools import cmp_to_key input = io.BytesIO(os.read(0, os.fstat(0).st_size)).readline tokens = [] tokens_next = 0 def next_str(): global tokens, tokens_next while tokens_next >= len(tokens): tokens = input().split() tokens_next = 0 tokens_next += 1 return tokens[tokens_next - 1] def nextInt(): return int(next_str()) # the second operation is basically making the number circular # so we need to find the digit to make it num[0] # we can try every increment or decrement to search over the first operation # we need to go max 10 steps in every direction n = nextInt() s = next_str() s = map(int, list(s)) s = list(s) s_new = None def f(ind): return (ind + n) % n def my_compare(a, b): for i in range(n): cur = s_new[f(a + i)] - s_new[f(b + i)] if cur != 0: return cur return 0 res = s # we will never need to go farther than 10 in both directions cz we always mod 10 for i in range(-10, 10): s_new = map(lambda x: (x + i + 10) % 10, s) s_new = list(s_new) indices = list(range(n)) best = sorted(indices, key=cmp_to_key(my_compare))[0] if s_new[best:] + s_new[0:best] < res: res = s_new[best:] + s_new[0:best] print(''.join(map(str, res)))
Title: Secret Combination Time Limit: None seconds Memory Limit: None megabytes Problem Description: You got a box with a combination lock. The lock has a display showing *n* digits. There are two buttons on the box, each button changes digits on the display. You have quickly discovered that the first button adds 1 to all the digits (all digits 9 become digits 0), and the second button shifts all the digits on the display one position to the right (the last digit becomes the first one). For example, if the display is currently showing number 579, then if we push the first button, the display will show 680, and if after that we push the second button, the display will show 068. You know that the lock will open if the display is showing the smallest possible number that can be obtained by pushing the buttons in some order. The leading zeros are ignored while comparing numbers. Now your task is to find the desired number. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of digits on the display. The second line contains *n* digits — the initial state of the display. Output Specification: Print a single line containing *n* digits — the desired state of the display containing the smallest possible number. Demo Input: ['3\n579\n', '4\n2014\n'] Demo Output: ['024\n', '0142\n'] Note: none
```python import io, os from functools import cmp_to_key input = io.BytesIO(os.read(0, os.fstat(0).st_size)).readline tokens = [] tokens_next = 0 def next_str(): global tokens, tokens_next while tokens_next >= len(tokens): tokens = input().split() tokens_next = 0 tokens_next += 1 return tokens[tokens_next - 1] def nextInt(): return int(next_str()) # the second operation is basically making the number circular # so we need to find the digit to make it num[0] # we can try every increment or decrement to search over the first operation # we need to go max 10 steps in every direction n = nextInt() s = next_str() s = map(int, list(s)) s = list(s) s_new = None def f(ind): return (ind + n) % n def my_compare(a, b): for i in range(n): cur = s_new[f(a + i)] - s_new[f(b + i)] if cur != 0: return cur return 0 res = s # we will never need to go farther than 10 in both directions cz we always mod 10 for i in range(-10, 10): s_new = map(lambda x: (x + i + 10) % 10, s) s_new = list(s_new) indices = list(range(n)) best = sorted(indices, key=cmp_to_key(my_compare))[0] if s_new[best:] + s_new[0:best] < res: res = s_new[best:] + s_new[0:best] print(''.join(map(str, res))) ```
3
732
A
Buy a Shovel
PROGRAMMING
800
[ "brute force", "constructive algorithms", "implementation", "math" ]
null
null
Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop. In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9). What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel.
The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins". Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels.
Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change.
[ "117 3\n", "237 7\n", "15 2\n" ]
[ "9\n", "1\n", "2\n" ]
In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change. In the second example it is enough for Polycarp to buy one shovel. In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
500
[ { "input": "117 3", "output": "9" }, { "input": "237 7", "output": "1" }, { "input": "15 2", "output": "2" }, { "input": "1 1", "output": "1" }, { "input": "1 9", "output": "9" }, { "input": "1000 3", "output": "1" }, { "input": "1000 1", "output": "1" }, { "input": "1000 9", "output": "1" }, { "input": "1 2", "output": "2" }, { "input": "999 9", "output": "1" }, { "input": "999 8", "output": "2" }, { "input": "105 6", "output": "2" }, { "input": "403 9", "output": "3" }, { "input": "546 4", "output": "4" }, { "input": "228 9", "output": "5" }, { "input": "57 2", "output": "6" }, { "input": "437 9", "output": "7" }, { "input": "997 6", "output": "8" }, { "input": "109 1", "output": "9" }, { "input": "998 9", "output": "5" }, { "input": "4 2", "output": "3" }, { "input": "9 3", "output": "7" }, { "input": "8 2", "output": "4" }, { "input": "1 3", "output": "3" }, { "input": "1 4", "output": "4" }, { "input": "1 5", "output": "5" }, { "input": "1 6", "output": "6" }, { "input": "1 7", "output": "7" }, { "input": "1 8", "output": "8" }, { "input": "100 3", "output": "1" }, { "input": "1000 2", "output": "1" }, { "input": "1000 4", "output": "1" }, { "input": "1000 5", "output": "1" }, { "input": "1000 6", "output": "1" }, { "input": "1000 7", "output": "1" }, { "input": "1000 8", "output": "1" }, { "input": "23 4", "output": "8" }, { "input": "33 1", "output": "7" }, { "input": "33 2", "output": "4" }, { "input": "666 5", "output": "5" }, { "input": "2 3", "output": "5" }, { "input": "5 5", "output": "1" }, { "input": "3 6", "output": "2" }, { "input": "12 4", "output": "2" }, { "input": "15 5", "output": "1" }, { "input": "2 5", "output": "5" }, { "input": "25 5", "output": "1" }, { "input": "2 9", "output": "5" }, { "input": "6 7", "output": "5" }, { "input": "8 9", "output": "5" }, { "input": "2 7", "output": "5" }, { "input": "4 7", "output": "5" }, { "input": "2 1", "output": "5" }, { "input": "261 1", "output": "1" } ]
1,676,590,159
2,147,483,647
Python 3
OK
TESTS
54
46
0
num_list = input().split(' ') num1 = int(num_list[0]) % 10 num2 = int(num_list[1]) for i in range(1,10): if (str(num1*i)[-1] == str(num2)) or (str(num1*i)[-1] == '0'): break print(i)
Title: Buy a Shovel Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop. In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9). What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel. Input Specification: The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins". Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels. Output Specification: Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change. Demo Input: ['117 3\n', '237 7\n', '15 2\n'] Demo Output: ['9\n', '1\n', '2\n'] Note: In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change. In the second example it is enough for Polycarp to buy one shovel. In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
```python num_list = input().split(' ') num1 = int(num_list[0]) % 10 num2 = int(num_list[1]) for i in range(1,10): if (str(num1*i)[-1] == str(num2)) or (str(num1*i)[-1] == '0'): break print(i) ```
3
80
A
Panoramix's Prediction
PROGRAMMING
800
[ "brute force" ]
A. Panoramix's Prediction
2
256
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not. The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2. One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside. Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song. Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=&gt;<=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=&lt;<=*m*<=≤<=50). It is guaranteed that *n* is prime. Pretests contain all the cases with restrictions 2<=≤<=*n*<=&lt;<=*m*<=≤<=4.
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
[ "3 5\n", "7 11\n", "7 9\n" ]
[ "YES", "YES", "NO" ]
none
500
[ { "input": "3 5", "output": "YES" }, { "input": "7 11", "output": "YES" }, { "input": "7 9", "output": "NO" }, { "input": "2 3", "output": "YES" }, { "input": "2 4", "output": "NO" }, { "input": "3 4", "output": "NO" }, { "input": "3 5", "output": "YES" }, { "input": "5 7", "output": "YES" }, { "input": "7 11", "output": "YES" }, { "input": "11 13", "output": "YES" }, { "input": "13 17", "output": "YES" }, { "input": "17 19", "output": "YES" }, { "input": "19 23", "output": "YES" }, { "input": "23 29", "output": "YES" }, { "input": "29 31", "output": "YES" }, { "input": "31 37", "output": "YES" }, { "input": "37 41", "output": "YES" }, { "input": "41 43", "output": "YES" }, { "input": "43 47", "output": "YES" }, { "input": "2 5", "output": "NO" }, { "input": "2 7", "output": "NO" }, { "input": "2 6", "output": "NO" }, { "input": "2 11", "output": "NO" }, { "input": "3 6", "output": "NO" }, { "input": "3 7", "output": "NO" }, { "input": "3 9", "output": "NO" }, { "input": "5 6", "output": "NO" }, { "input": "5 9", "output": "NO" }, { "input": "5 11", "output": "NO" }, { "input": "5 13", "output": "NO" }, { "input": "5 15", "output": "NO" }, { "input": "7 8", "output": "NO" }, { "input": "7 13", "output": "NO" }, { "input": "13 15", "output": "NO" }, { "input": "13 17", "output": "YES" }, { "input": "19 21", "output": "NO" }, { "input": "13 20", "output": "NO" }, { "input": "41 49", "output": "NO" }, { "input": "43 49", "output": "NO" }, { "input": "47 50", "output": "NO" }, { "input": "47 49", "output": "NO" }, { "input": "47 48", "output": "NO" }, { "input": "23 25", "output": "NO" }, { "input": "2 50", "output": "NO" }, { "input": "31 33", "output": "NO" } ]
1,681,495,621
2,147,483,647
Python 3
OK
TESTS
45
92
0
from math import sqrt def isPrime(n): if (n <= 1): return False for i in range(2, int(sqrt(n))+1): if (n % i == 0): return False return True x , y = map(int, input().split()) prime = [] for i in range(x, y+1): if isPrime(i): prime.append(i) #print(prime) if len(prime) > 2: break if len(prime)>1: if isPrime(y) and prime[1] == y: print("YES") else: print("NO") else: print("NO")
Title: Panoramix's Prediction Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not. The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2. One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside. Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song. Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=&gt;<=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix? Input Specification: The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=&lt;<=*m*<=≤<=50). It is guaranteed that *n* is prime. Pretests contain all the cases with restrictions 2<=≤<=*n*<=&lt;<=*m*<=≤<=4. Output Specification: Print YES, if *m* is the next prime number after *n*, or NO otherwise. Demo Input: ['3 5\n', '7 11\n', '7 9\n'] Demo Output: ['YES', 'YES', 'NO'] Note: none
```python from math import sqrt def isPrime(n): if (n <= 1): return False for i in range(2, int(sqrt(n))+1): if (n % i == 0): return False return True x , y = map(int, input().split()) prime = [] for i in range(x, y+1): if isPrime(i): prime.append(i) #print(prime) if len(prime) > 2: break if len(prime)>1: if isPrime(y) and prime[1] == y: print("YES") else: print("NO") else: print("NO") ```
3.977
965
A
Paper Airplanes
PROGRAMMING
800
[ "math" ]
null
null
To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes. A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy?
The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively.
Print a single integer — the minimum number of packs they should buy.
[ "5 3 2 3\n", "5 3 100 1\n" ]
[ "4\n", "5\n" ]
In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs. In the second sample they have to buy a pack for each person as they can't share sheets.
500
[ { "input": "5 3 2 3", "output": "4" }, { "input": "5 3 100 1", "output": "5" }, { "input": "10000 10000 1 1", "output": "100000000" }, { "input": "1 1 10000 10000", "output": "1" }, { "input": "300 300 21 23", "output": "196" }, { "input": "300 2 37 51", "output": "6" }, { "input": "2 400 23 57", "output": "1" }, { "input": "1 1 1 1", "output": "1" }, { "input": "10000 10000 3 2", "output": "16670000" }, { "input": "1 2 1 2", "output": "1" }, { "input": "1 1 2 2", "output": "1" }, { "input": "1 1 10 10", "output": "1" }, { "input": "5324 5439 32 13", "output": "69622" }, { "input": "9000 1 2432 1", "output": "9000" }, { "input": "230 1234 9124 23", "output": "10" }, { "input": "11 1 1 1", "output": "11" }, { "input": "6246 8489 1227 9", "output": "4858" }, { "input": "9 20 5 7", "output": "6" } ]
1,655,845,478
2,147,483,647
Python 3
OK
TESTS
18
46
0
import math [k,n,s,p] = map(int, input().split()) spp = math.ceil(n/s) ts = k*spp print (math.ceil(ts/p))
Title: Paper Airplanes Time Limit: None seconds Memory Limit: None megabytes Problem Description: To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes. A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy? Input Specification: The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively. Output Specification: Print a single integer — the minimum number of packs they should buy. Demo Input: ['5 3 2 3\n', '5 3 100 1\n'] Demo Output: ['4\n', '5\n'] Note: In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs. In the second sample they have to buy a pack for each person as they can't share sheets.
```python import math [k,n,s,p] = map(int, input().split()) spp = math.ceil(n/s) ts = k*spp print (math.ceil(ts/p)) ```
3
435
A
Queue on Bus Stop
PROGRAMMING
1,000
[ "implementation" ]
null
null
It's that time of the year when the Russians flood their countryside summer cottages (dachas) and the bus stop has a lot of people. People rarely go to the dacha on their own, it's usually a group, so the people stand in queue by groups. The bus stop queue has *n* groups of people. The *i*-th group from the beginning has *a**i* people. Every 30 minutes an empty bus arrives at the bus stop, it can carry at most *m* people. Naturally, the people from the first group enter the bus first. Then go the people from the second group and so on. Note that the order of groups in the queue never changes. Moreover, if some group cannot fit all of its members into the current bus, it waits for the next bus together with other groups standing after it in the queue. Your task is to determine how many buses is needed to transport all *n* groups to the dacha countryside.
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). The next line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*m*).
Print a single integer — the number of buses that is needed to transport all *n* groups to the dacha countryside.
[ "4 3\n2 3 2 1\n", "3 4\n1 2 1\n" ]
[ "3\n", "1\n" ]
none
500
[ { "input": "4 3\n2 3 2 1", "output": "3" }, { "input": "3 4\n1 2 1", "output": "1" }, { "input": "1 5\n4", "output": "1" }, { "input": "5 1\n1 1 1 1 1", "output": "5" }, { "input": "6 4\n1 3 2 3 4 1", "output": "5" }, { "input": "6 8\n6 1 1 1 4 5", "output": "3" }, { "input": "10 10\n1 10 1 10 1 1 7 8 6 7", "output": "8" }, { "input": "100 100\n85 50 17 89 65 89 5 20 86 26 16 21 85 14 44 31 87 31 6 2 48 67 8 80 79 1 48 36 97 1 5 30 79 50 78 12 2 55 76 100 54 40 26 81 97 96 68 56 87 14 51 17 54 37 52 33 69 62 38 63 74 15 62 78 9 19 67 2 60 58 93 60 18 96 55 48 34 7 79 82 32 58 90 67 20 50 27 15 7 89 98 10 11 15 99 49 4 51 77 52", "output": "63" }, { "input": "10 1\n1 1 1 1 1 1 1 1 1 1", "output": "10" }, { "input": "10 2\n2 2 1 1 1 1 1 2 1 2", "output": "8" }, { "input": "10 3\n1 3 1 1 3 2 2 2 3 3", "output": "9" }, { "input": "10 4\n2 1 1 1 3 4 4 4 1 2", "output": "6" }, { "input": "10 5\n2 2 3 4 4 1 5 3 1 2", "output": "7" }, { "input": "100 3\n1 2 3 2 1 2 2 3 1 3 3 2 2 1 1 2 2 1 1 1 1 2 3 3 2 1 1 2 2 2 3 3 3 2 1 3 1 3 3 2 3 1 2 2 2 3 2 1 1 3 3 3 3 2 1 1 2 3 2 2 3 2 3 2 2 3 2 2 2 2 3 3 3 1 3 3 1 1 2 3 2 2 2 2 3 3 3 2 1 2 3 1 1 2 3 3 1 3 3 2", "output": "83" }, { "input": "100 7\n4 7 4 7 7 4 7 3 5 6 3 5 4 3 7 2 7 2 4 1 6 3 3 7 4 4 5 4 3 6 4 3 2 2 1 4 4 1 7 3 7 7 1 3 1 5 4 1 5 3 5 2 2 1 5 5 1 5 2 7 5 5 1 5 5 4 6 5 1 3 5 6 7 4 1 3 3 4 3 2 7 6 5 7 2 7 1 1 2 2 3 1 3 7 1 3 2 1 1 7", "output": "71" }, { "input": "100 10\n3 4 8 10 8 6 4 3 7 7 6 2 3 1 3 10 1 7 9 3 5 5 2 6 2 9 1 7 4 2 4 1 6 1 7 10 2 5 3 7 6 4 6 2 8 8 8 6 6 10 3 7 4 3 4 1 7 9 3 6 3 6 1 4 9 3 8 1 10 1 4 10 7 7 9 5 3 8 10 2 1 10 8 7 10 8 5 3 1 2 1 10 6 1 5 3 3 5 7 2", "output": "64" }, { "input": "100 15\n3 12 8 3 11 14 12 14 1 11 13 3 5 13 4 14 2 11 7 8 12 9 15 7 15 1 4 11 6 12 1 3 8 13 1 8 14 4 3 14 1 3 1 6 10 15 13 11 12 1 14 13 11 14 11 3 12 7 3 15 14 4 5 6 5 14 7 14 6 2 6 12 6 13 13 1 9 13 15 11 6 3 15 11 9 4 15 8 15 12 1 15 10 10 4 1 15 1 4 1", "output": "71" }, { "input": "100 30\n7 14 22 16 11 13 7 29 20 19 22 6 12 16 1 8 27 21 22 3 15 27 20 12 4 19 1 26 26 22 25 17 29 25 16 29 29 28 16 26 25 14 16 20 5 21 5 15 19 13 17 21 17 19 23 13 1 25 6 30 16 19 12 10 28 8 15 13 14 24 19 30 12 19 22 1 3 14 16 3 20 26 15 19 9 10 19 27 2 16 10 22 15 13 19 3 24 9 8 13", "output": "71" }, { "input": "100 40\n39 19 13 36 11 21 32 12 1 2 39 26 32 39 24 1 4 19 10 4 16 39 32 34 13 24 30 35 3 10 8 18 13 12 39 27 31 40 37 20 17 17 37 5 10 12 22 17 7 1 31 13 11 10 2 6 22 16 2 4 9 27 6 35 22 16 22 30 33 2 26 20 35 19 40 37 19 17 21 28 37 28 40 4 5 4 35 19 26 36 19 12 21 20 21 30 9 16 9 32", "output": "65" }, { "input": "100 50\n2 46 4 6 38 19 15 34 10 35 37 30 3 25 5 45 40 45 33 31 6 20 10 44 11 9 2 14 35 5 9 23 20 2 48 22 25 35 38 31 24 33 35 16 4 30 27 10 12 22 6 24 12 30 23 21 14 12 32 21 7 12 25 43 18 34 34 28 47 13 28 43 18 39 44 42 35 26 35 14 8 29 32 20 29 3 20 6 20 9 9 27 8 42 10 37 42 27 8 1", "output": "60" }, { "input": "100 60\n34 21 39 17 48 46 23 56 46 52 50 39 55 48 54 38 32 38 24 26 44 12 28 9 25 26 10 52 42 60 41 3 16 60 44 29 27 55 19 19 19 57 45 59 29 35 5 14 50 47 57 48 16 7 12 36 58 31 37 58 30 50 19 11 10 41 59 57 49 41 33 9 12 11 53 50 60 51 21 9 44 23 1 16 4 15 17 57 15 17 46 50 18 52 43 24 47 50 19 18", "output": "74" }, { "input": "100 90\n74 65 49 41 3 79 61 83 50 40 13 57 90 14 62 77 36 10 3 5 5 40 50 75 32 26 3 71 79 54 88 50 46 20 42 59 30 36 83 86 60 62 82 68 62 80 18 65 28 28 81 74 62 33 61 35 33 83 90 72 6 6 51 4 22 20 29 10 8 3 84 69 12 17 24 16 12 64 80 74 68 59 1 59 15 59 37 58 79 83 51 56 81 14 37 45 19 31 61 90", "output": "67" }, { "input": "100 99\n69 46 76 47 71 9 66 46 78 17 96 83 56 96 29 3 43 48 79 23 93 61 19 9 29 72 15 84 93 46 71 87 11 43 96 44 54 75 3 66 2 95 46 32 69 52 79 38 57 53 37 60 71 82 28 31 84 58 89 40 62 74 22 50 45 38 99 67 24 28 28 12 69 88 33 10 31 71 46 7 42 81 54 81 96 44 8 1 20 24 28 19 54 35 69 32 71 13 66 15", "output": "68" }, { "input": "90 100\n25 52 88 89 36 17 57 64 66 11 89 61 54 92 48 51 18 42 44 92 6 14 67 100 16 21 17 88 85 73 33 11 94 84 56 72 4 80 90 78 96 5 62 70 54 70 94 80 10 91 100 89 98 87 69 74 88 63 53 79 38 94 89 52 21 82 67 79 100 81 2 40 30 69 34 15 12 33 87 52 95 18 51 30 15 39 30 99 46 84", "output": "67" }, { "input": "5 100\n14 67 15 28 21", "output": "2" }, { "input": "10 100\n2 17 53 94 95 57 36 47 68 48", "output": "7" }, { "input": "1 100\n18", "output": "1" }, { "input": "100 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "100" }, { "input": "30 100\n56 7 99 83 2 65 35 53 99 36 42 57 13 37 68 52 87 11 50 23 86 24 32 39 97 6 64 1 18 86", "output": "18" }, { "input": "60 100\n18 75 43 88 45 43 20 59 59 79 62 39 53 21 28 46 54 53 97 81 18 15 2 95 84 9 36 70 30 76 17 19 83 40 45 32 31 70 23 14 44 35 79 84 97 96 99 60 3 73 64 83 6 12 67 86 70 89 18 61", "output": "40" }, { "input": "1 73\n24", "output": "1" }, { "input": "4 4\n1 4 4 4", "output": "4" }, { "input": "2 6\n1 4", "output": "1" }, { "input": "2 5\n5 5", "output": "2" } ]
1,664,442,919
2,147,483,647
PyPy 3-64
OK
TESTS
34
46
0
n, m = list(map(int, input().split())) a = list(map(int, input().split())) total, x = 0, 0 while x < n: curr = 0 while x < n and curr + a[x] <= m: curr += a[x] x += 1 total += 1 print(total)
Title: Queue on Bus Stop Time Limit: None seconds Memory Limit: None megabytes Problem Description: It's that time of the year when the Russians flood their countryside summer cottages (dachas) and the bus stop has a lot of people. People rarely go to the dacha on their own, it's usually a group, so the people stand in queue by groups. The bus stop queue has *n* groups of people. The *i*-th group from the beginning has *a**i* people. Every 30 minutes an empty bus arrives at the bus stop, it can carry at most *m* people. Naturally, the people from the first group enter the bus first. Then go the people from the second group and so on. Note that the order of groups in the queue never changes. Moreover, if some group cannot fit all of its members into the current bus, it waits for the next bus together with other groups standing after it in the queue. Your task is to determine how many buses is needed to transport all *n* groups to the dacha countryside. Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). The next line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*m*). Output Specification: Print a single integer — the number of buses that is needed to transport all *n* groups to the dacha countryside. Demo Input: ['4 3\n2 3 2 1\n', '3 4\n1 2 1\n'] Demo Output: ['3\n', '1\n'] Note: none
```python n, m = list(map(int, input().split())) a = list(map(int, input().split())) total, x = 0, 0 while x < n: curr = 0 while x < n and curr + a[x] <= m: curr += a[x] x += 1 total += 1 print(total) ```
3
424
B
Megacity
PROGRAMMING
1,200
[ "binary search", "greedy", "implementation", "sortings" ]
null
null
The administration of the Tomsk Region firmly believes that it's time to become a megacity (that is, get population of one million). Instead of improving the demographic situation, they decided to achieve its goal by expanding the boundaries of the city. The city of Tomsk can be represented as point on the plane with coordinates (0; 0). The city is surrounded with *n* other locations, the *i*-th one has coordinates (*x**i*, *y**i*) with the population of *k**i* people. You can widen the city boundaries to a circle of radius *r*. In such case all locations inside the circle and on its border are included into the city. Your goal is to write a program that will determine the minimum radius *r*, to which is necessary to expand the boundaries of Tomsk, so that it becomes a megacity.
The first line of the input contains two integers *n* and *s* (1<=≤<=*n*<=≤<=103; 1<=≤<=*s*<=&lt;<=106) — the number of locatons around Tomsk city and the population of the city. Then *n* lines follow. The *i*-th line contains three integers — the *x**i* and *y**i* coordinate values of the *i*-th location and the number *k**i* of people in it (1<=≤<=*k**i*<=&lt;<=106). Each coordinate is an integer and doesn't exceed 104 in its absolute value. It is guaranteed that no two locations are at the same point and no location is at point (0; 0).
In the output, print "-1" (without the quotes), if Tomsk won't be able to become a megacity. Otherwise, in the first line print a single real number — the minimum radius of the circle that the city needs to expand to in order to become a megacity. The answer is considered correct if the absolute or relative error don't exceed 10<=-<=6.
[ "4 999998\n1 1 1\n2 2 1\n3 3 1\n2 -2 1\n", "4 999998\n1 1 2\n2 2 1\n3 3 1\n2 -2 1\n", "2 1\n1 1 999997\n2 2 1\n" ]
[ "2.8284271\n", "1.4142136\n", "-1" ]
none
1,000
[ { "input": "4 999998\n1 1 1\n2 2 1\n3 3 1\n2 -2 1", "output": "2.8284271" }, { "input": "4 999998\n1 1 2\n2 2 1\n3 3 1\n2 -2 1", "output": "1.4142136" }, { "input": "2 1\n1 1 999997\n2 2 1", "output": "-1" }, { "input": "4 999998\n3 3 10\n-3 3 10\n3 -3 10\n-3 -3 10", "output": "4.2426407" }, { "input": "15 95473\n-9 6 199715\n0 -8 110607\n0 2 6621\n-3 -2 59894\n-10 -8 175440\n-2 0 25814\n10 -4 68131\n7 1 9971\n6 7 821\n6 5 20208\n6 2 68468\n0 7 37427\n1 -3 13337\n-10 7 113041\n-6 -2 44028", "output": "12.8062485" }, { "input": "20 93350\n13 -28 486\n26 -26 48487\n5 -23 143368\n-23 -25 10371\n-2 -7 75193\n0 -8 3\n-6 -11 5015\n-19 -18 315278\n28 -15 45801\n21 8 4590\n-4 -28 12926\n-16 17 9405\n-28 -23 222092\n1 -10 1857\n14 -28 35170\n-4 -22 22036\n-2 -10 1260\n-1 12 375745\n-19 -24 38845\n10 -25 9256", "output": "26.1725047" }, { "input": "30 505231\n-18 16 88130\n-10 16 15693\n16 -32 660\n-27 17 19042\n30 -37 6680\n36 19 299674\n-45 21 3300\n11 27 76\n-49 -34 28649\n-1 11 31401\n25 42 20858\n-40 6 455660\n-29 43 105001\n-38 10 6042\n19 -45 65551\n20 -9 148533\n-5 -24 393442\n-43 2 8577\n-39 18 97059\n12 28 39189\n35 23 28178\n40 -34 51687\n23 41 219028\n21 -44 927\n47 8 13206\n33 41 97342\n10 18 24895\n0 12 288\n0 -44 1065\n-25 43 44231", "output": "24.5153013" }, { "input": "2 500000\n936 1000 500000\n961 976 500000", "output": "1369.7065379" }, { "input": "10 764008\n959 32 23049\n-513 797 38979\n-603 -838 24916\n598 -430 25414\n-280 -624 18714\n330 891 21296\n-347 -68 27466\n650 -842 30125\n-314 889 35394\n275 969 5711", "output": "1063.7029661" }, { "input": "30 295830\n1 -4 24773\n4 3 26175\n-2 -3 14789\n2 -1 46618\n-2 -2 52997\n-3 0 517\n-2 0 18173\n-4 -3 54465\n2 4 63579\n4 -4 41821\n2 2 11018\n0 4 42856\n0 -1 51885\n-3 4 57137\n3 0 4688\n0 2 60137\n-4 4 33484\n-1 3 66196\n3 -1 53634\n0 -2 41630\n-2 1 54606\n2 -2 2978\n2 -3 23733\n1 -2 35248\n-3 -3 15124\n-2 -4 26518\n4 0 28151\n4 -1 18348\n3 3 16914\n-4 2 26013", "output": "4.4721360" }, { "input": "10 511500\n-5129 -3858 76954\n1296 1130 36126\n1219 6732 102003\n-8026 -178 4150\n-3261 1342 105429\n7965 -3013 62561\n5607 8963 53539\n-9044 -3999 16509\n1406 4103 115667\n-3716 2522 110626", "output": "6841.4753526" }, { "input": "20 39342\n2 0 36476\n-3 1 136925\n1 3 31234\n0 -3 23785\n-1 3 77700\n-3 -1 50490\n-1 -3 13965\n-3 2 121093\n3 0 118933\n-3 0 125552\n-3 3 54779\n-2 0 96250\n1 2 142643\n2 2 23848\n0 2 29845\n0 -2 80462\n-1 1 91852\n-1 2 26526\n0 -1 136272\n1 1 108999", "output": "3.0000000" }, { "input": "2 1\n1 0 1\n0 1 999999", "output": "1.0000000" }, { "input": "2 999997\n1 1 1\n1 2 1", "output": "-1" } ]
1,635,873,035
2,147,483,647
Python 3
OK
TESTS
54
62
4,505,600
n,s =map(int,input().split()) arr = [] import math for i in range(n): x,y,i = map(int,input().split()) dist = math.sqrt(x**2 + y**2) arr.append((dist,i)) arr.sort() ans = False for e in arr: dist,i = e[0],e[1] s+=i if s>=int(1e6): print("{:.7f}".format(dist)) # print(dist) ans = True break if ans is False:print("-1")
Title: Megacity Time Limit: None seconds Memory Limit: None megabytes Problem Description: The administration of the Tomsk Region firmly believes that it's time to become a megacity (that is, get population of one million). Instead of improving the demographic situation, they decided to achieve its goal by expanding the boundaries of the city. The city of Tomsk can be represented as point on the plane with coordinates (0; 0). The city is surrounded with *n* other locations, the *i*-th one has coordinates (*x**i*, *y**i*) with the population of *k**i* people. You can widen the city boundaries to a circle of radius *r*. In such case all locations inside the circle and on its border are included into the city. Your goal is to write a program that will determine the minimum radius *r*, to which is necessary to expand the boundaries of Tomsk, so that it becomes a megacity. Input Specification: The first line of the input contains two integers *n* and *s* (1<=≤<=*n*<=≤<=103; 1<=≤<=*s*<=&lt;<=106) — the number of locatons around Tomsk city and the population of the city. Then *n* lines follow. The *i*-th line contains three integers — the *x**i* and *y**i* coordinate values of the *i*-th location and the number *k**i* of people in it (1<=≤<=*k**i*<=&lt;<=106). Each coordinate is an integer and doesn't exceed 104 in its absolute value. It is guaranteed that no two locations are at the same point and no location is at point (0; 0). Output Specification: In the output, print "-1" (without the quotes), if Tomsk won't be able to become a megacity. Otherwise, in the first line print a single real number — the minimum radius of the circle that the city needs to expand to in order to become a megacity. The answer is considered correct if the absolute or relative error don't exceed 10<=-<=6. Demo Input: ['4 999998\n1 1 1\n2 2 1\n3 3 1\n2 -2 1\n', '4 999998\n1 1 2\n2 2 1\n3 3 1\n2 -2 1\n', '2 1\n1 1 999997\n2 2 1\n'] Demo Output: ['2.8284271\n', '1.4142136\n', '-1'] Note: none
```python n,s =map(int,input().split()) arr = [] import math for i in range(n): x,y,i = map(int,input().split()) dist = math.sqrt(x**2 + y**2) arr.append((dist,i)) arr.sort() ans = False for e in arr: dist,i = e[0],e[1] s+=i if s>=int(1e6): print("{:.7f}".format(dist)) # print(dist) ans = True break if ans is False:print("-1") ```
3
389
A
Fox and Number Game
PROGRAMMING
1,000
[ "greedy", "math" ]
null
null
Fox Ciel is playing a game with numbers now. Ciel has *n* positive integers: *x*1, *x*2, ..., *x**n*. She can do the following operation as many times as needed: select two different indexes *i* and *j* such that *x**i* &gt; *x**j* hold, and then apply assignment *x**i* = *x**i* - *x**j*. The goal is to make the sum of all numbers as small as possible. Please help Ciel to find this minimal sum.
The first line contains an integer *n* (2<=≤<=*n*<=≤<=100). Then the second line contains *n* integers: *x*1, *x*2, ..., *x**n* (1<=≤<=*x**i*<=≤<=100).
Output a single integer — the required minimal sum.
[ "2\n1 2\n", "3\n2 4 6\n", "2\n12 18\n", "5\n45 12 27 30 18\n" ]
[ "2\n", "6\n", "12\n", "15\n" ]
In the first example the optimal way is to do the assignment: *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>. In the second example the optimal sequence of operations is: *x*<sub class="lower-index">3</sub> = *x*<sub class="lower-index">3</sub> - *x*<sub class="lower-index">2</sub>, *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
500
[ { "input": "2\n1 2", "output": "2" }, { "input": "3\n2 4 6", "output": "6" }, { "input": "2\n12 18", "output": "12" }, { "input": "5\n45 12 27 30 18", "output": "15" }, { "input": "2\n1 1", "output": "2" }, { "input": "2\n100 100", "output": "200" }, { "input": "2\n87 58", "output": "58" }, { "input": "39\n52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52", "output": "2028" }, { "input": "59\n96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96", "output": "5664" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "10000" }, { "input": "100\n70 70 77 42 98 84 56 91 35 21 7 70 77 77 56 63 14 84 56 14 77 77 63 70 14 7 28 91 63 49 21 84 98 56 77 98 98 84 98 14 7 56 49 28 91 98 7 56 14 91 14 98 49 28 98 14 98 98 14 70 35 28 63 28 49 63 63 56 91 98 35 42 42 35 63 35 42 14 63 21 77 56 42 77 35 91 56 21 28 84 56 70 70 91 98 70 84 63 21 98", "output": "700" }, { "input": "39\n63 21 21 42 21 63 21 84 42 21 84 63 42 63 84 84 84 42 42 84 21 63 42 63 42 42 63 42 42 63 84 42 21 84 21 63 42 21 42", "output": "819" }, { "input": "59\n70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70", "output": "4130" }, { "input": "87\n44 88 88 88 88 66 88 22 22 88 88 44 88 22 22 22 88 88 88 88 66 22 88 88 88 88 66 66 44 88 44 44 66 22 88 88 22 44 66 44 88 66 66 22 22 22 22 88 22 22 44 66 88 22 22 88 66 66 88 22 66 88 66 88 66 44 88 44 22 44 44 22 44 88 44 44 44 44 22 88 88 88 66 66 88 44 22", "output": "1914" }, { "input": "15\n63 63 63 63 63 63 63 63 63 63 63 63 63 63 63", "output": "945" }, { "input": "39\n63 77 21 14 14 35 21 21 70 42 21 70 28 77 28 77 7 42 63 7 98 49 98 84 35 70 70 91 14 42 98 7 42 7 98 42 56 35 91", "output": "273" }, { "input": "18\n18 18 18 36 36 36 54 72 54 36 72 54 36 36 36 36 18 36", "output": "324" }, { "input": "46\n71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71", "output": "3266" }, { "input": "70\n66 11 66 11 44 11 44 99 55 22 88 11 11 22 55 44 22 77 44 77 77 22 44 55 88 11 99 99 88 22 77 77 66 11 11 66 99 55 55 44 66 44 77 44 44 55 33 55 44 88 77 77 22 66 33 44 11 22 55 44 22 66 77 33 33 44 44 44 22 33", "output": "770" }, { "input": "10\n60 12 96 48 60 24 60 36 60 60", "output": "120" }, { "input": "20\n51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51", "output": "1020" }, { "input": "50\n58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58", "output": "2900" }, { "input": "98\n70 60 100 30 70 20 30 50 50 30 90 40 30 40 60 80 60 60 80 50 10 80 20 10 20 10 50 70 30 80 30 50 60 90 90 100 60 30 90 20 30 60 90 80 60 60 10 90 10 50 40 40 80 90 100 40 70 40 30 50 60 50 60 30 40 20 90 60 20 20 20 70 60 70 50 100 90 50 20 40 80 60 10 60 50 40 40 10 50 10 40 10 80 100 100 90 10 90", "output": "980" }, { "input": "100\n82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82", "output": "8200" }, { "input": "100\n11 87 77 93 3 54 21 93 9 71 37 23 69 85 74 3 48 99 51 31 56 19 21 96 39 6 4 4 29 69 100 42 1 22 81 53 48 49 81 61 10 7 40 61 7 71 51 59 79 44 50 35 95 80 83 8 98 40 18 94 84 49 52 74 66 69 39 37 100 44 38 62 2 80 46 31 35 53 5 60 21 49 63 55 20 53 80 53 66 34 23 92 77 50 86 63 65 24 12 70", "output": "100" }, { "input": "2\n100 1", "output": "2" }, { "input": "2\n18 30", "output": "12" }, { "input": "2\n3 5", "output": "2" }, { "input": "2\n1 10", "output": "2" }, { "input": "2\n8 5", "output": "2" }, { "input": "5\n2 3 5 8 18", "output": "5" }, { "input": "5\n2 4 1 6 8", "output": "5" }, { "input": "3\n12 10 5", "output": "3" }, { "input": "3\n6 10 15", "output": "3" } ]
1,577,571,407
2,147,483,647
PyPy 3
OK
TESTS
34
140
1,740,800
n=int(input()) lst=list(map(int,input().split())) while min(lst)!=max(lst): a=lst.index(max(lst)) b=lst.index(min(lst)) lst[a]=lst[a]-lst[b] print(sum(lst))
Title: Fox and Number Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Fox Ciel is playing a game with numbers now. Ciel has *n* positive integers: *x*1, *x*2, ..., *x**n*. She can do the following operation as many times as needed: select two different indexes *i* and *j* such that *x**i* &gt; *x**j* hold, and then apply assignment *x**i* = *x**i* - *x**j*. The goal is to make the sum of all numbers as small as possible. Please help Ciel to find this minimal sum. Input Specification: The first line contains an integer *n* (2<=≤<=*n*<=≤<=100). Then the second line contains *n* integers: *x*1, *x*2, ..., *x**n* (1<=≤<=*x**i*<=≤<=100). Output Specification: Output a single integer — the required minimal sum. Demo Input: ['2\n1 2\n', '3\n2 4 6\n', '2\n12 18\n', '5\n45 12 27 30 18\n'] Demo Output: ['2\n', '6\n', '12\n', '15\n'] Note: In the first example the optimal way is to do the assignment: *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>. In the second example the optimal sequence of operations is: *x*<sub class="lower-index">3</sub> = *x*<sub class="lower-index">3</sub> - *x*<sub class="lower-index">2</sub>, *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
```python n=int(input()) lst=list(map(int,input().split())) while min(lst)!=max(lst): a=lst.index(max(lst)) b=lst.index(min(lst)) lst[a]=lst[a]-lst[b] print(sum(lst)) ```
3
285
C
Building Permutation
PROGRAMMING
1,200
[ "greedy", "implementation", "sortings" ]
null
null
Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*. You have a sequence of integers *a*1,<=*a*2,<=...,<=*a**n*. In one move, you are allowed to decrease or increase any number by one. Count the minimum number of moves, needed to build a permutation from this sequence.
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105) — the size of the sought permutation. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=109<=≤<=*a**i*<=≤<=109).
Print a single number — the minimum number of moves. Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
[ "2\n3 0\n", "3\n-1 -1 2\n" ]
[ "2\n", "6\n" ]
In the first sample you should decrease the first number by one and then increase the second number by one. The resulting permutation is (2, 1). In the second sample you need 6 moves to build permutation (1, 3, 2).
1,500
[ { "input": "2\n3 0", "output": "2" }, { "input": "3\n-1 -1 2", "output": "6" }, { "input": "5\n-3 5 -3 3 3", "output": "10" }, { "input": "10\n9 6 -2 4 1 1 1 9 6 2", "output": "18" }, { "input": "9\n2 0 0 6 5 4 1 9 3", "output": "15" }, { "input": "100\n-77 57 -95 -23 53 -28 82 -83 38 -73 85 28 25 6 -43 4 -10 -30 -9 -92 14 34 -93 61 36 -100 90 -68 28 16 100 -3 97 30 36 -55 62 -62 53 74 -50 -23 67 11 22 -30 -19 83 7 84 43 90 -65 -75 -15 97 90 15 66 2 13 -91 91 -44 46 51 51 -58 95 77 20 30 76 79 91 60 76 2 82 42 -93 94 -57 88 65 -95 -66 100 -9 33 -67 54 -99 97 53 13 54 66 60 -48", "output": "3459" } ]
1,614,971,899
2,147,483,647
PyPy 3
OK
TESTS
33
451
29,798,400
n = int(input()) a = list(map(int, input().split())) check = [i for i in range(1, n+1)] a = sorted(a) ans = 0 for i in range(n): ans += abs(a[i] - check[i]) print(ans)
Title: Building Permutation Time Limit: None seconds Memory Limit: None megabytes Problem Description: Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*. You have a sequence of integers *a*1,<=*a*2,<=...,<=*a**n*. In one move, you are allowed to decrease or increase any number by one. Count the minimum number of moves, needed to build a permutation from this sequence. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105) — the size of the sought permutation. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=109<=≤<=*a**i*<=≤<=109). Output Specification: Print a single number — the minimum number of moves. Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier. Demo Input: ['2\n3 0\n', '3\n-1 -1 2\n'] Demo Output: ['2\n', '6\n'] Note: In the first sample you should decrease the first number by one and then increase the second number by one. The resulting permutation is (2, 1). In the second sample you need 6 moves to build permutation (1, 3, 2).
```python n = int(input()) a = list(map(int, input().split())) check = [i for i in range(1, n+1)] a = sorted(a) ans = 0 for i in range(n): ans += abs(a[i] - check[i]) print(ans) ```
3
735
C
Tennis Championship
PROGRAMMING
1,600
[ "combinatorics", "constructive algorithms", "greedy", "math" ]
null
null
Famous Brazil city Rio de Janeiro holds a tennis tournament and Ostap Bender doesn't want to miss this event. There will be *n* players participating, and the tournament will follow knockout rules from the very first game. That means, that if someone loses a game he leaves the tournament immediately. Organizers are still arranging tournament grid (i.e. the order games will happen and who is going to play with whom) but they have already fixed one rule: two players can play against each other only if the number of games one of them has already played differs by no more than one from the number of games the other one has already played. Of course, both players had to win all their games in order to continue participating in the tournament. Tournament hasn't started yet so the audience is a bit bored. Ostap decided to find out what is the maximum number of games the winner of the tournament can take part in (assuming the rule above is used). However, it is unlikely he can deal with this problem without your help.
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=1018) — the number of players to participate in the tournament.
Print the maximum number of games in which the winner of the tournament can take part.
[ "2\n", "3\n", "4\n", "10\n" ]
[ "1\n", "2\n", "2\n", "4\n" ]
In all samples we consider that player number 1 is the winner. In the first sample, there would be only one game so the answer is 1. In the second sample, player 1 can consequently beat players 2 and 3. In the third sample, player 1 can't play with each other player as after he plays with players 2 and 3 he can't play against player 4, as he has 0 games played, while player 1 already played 2. Thus, the answer is 2 and to achieve we make pairs (1, 2) and (3, 4) and then clash the winners.
1,750
[ { "input": "2", "output": "1" }, { "input": "3", "output": "2" }, { "input": "4", "output": "2" }, { "input": "10", "output": "4" }, { "input": "1000", "output": "14" }, { "input": "2500", "output": "15" }, { "input": "690000", "output": "27" }, { "input": "3000000000", "output": "45" }, { "input": "123456789123456789", "output": "81" }, { "input": "5", "output": "3" }, { "input": "143", "output": "9" }, { "input": "144", "output": "10" }, { "input": "145", "output": "10" }, { "input": "232", "output": "10" }, { "input": "233", "output": "11" }, { "input": "234", "output": "11" }, { "input": "679891637638612257", "output": "84" }, { "input": "679891637638612258", "output": "85" }, { "input": "679891637638612259", "output": "85" }, { "input": "1000000000000000000", "output": "85" }, { "input": "10235439547", "output": "47" }, { "input": "1240723548", "output": "43" }, { "input": "92353046212453", "output": "66" }, { "input": "192403205846532", "output": "68" }, { "input": "13925230525389", "output": "62" }, { "input": "12048230592523", "output": "62" }, { "input": "19204385325853", "output": "63" }, { "input": "902353283921", "output": "56" }, { "input": "793056859214355", "output": "70" }, { "input": "982045466234565", "output": "71" }, { "input": "126743950353465", "output": "67" }, { "input": "12405430465", "output": "47" }, { "input": "10238439257768", "output": "61" }, { "input": "1728493055346", "output": "58" }, { "input": "927553829046", "output": "56" }, { "input": "62735129403", "output": "51" }, { "input": "71624823950223", "output": "65" }, { "input": "8902353464851212", "output": "75" }, { "input": "61824012598535", "output": "65" }, { "input": "1294902504603347", "output": "71" }, { "input": "6", "output": "3" }, { "input": "7", "output": "3" }, { "input": "8", "output": "4" }, { "input": "9", "output": "4" }, { "input": "11", "output": "4" }, { "input": "12", "output": "4" }, { "input": "13", "output": "5" }, { "input": "14", "output": "5" }, { "input": "15", "output": "5" }, { "input": "16", "output": "5" }, { "input": "17", "output": "5" }, { "input": "18", "output": "5" }, { "input": "19", "output": "5" }, { "input": "20", "output": "5" }, { "input": "21", "output": "6" }, { "input": "22", "output": "6" }, { "input": "23", "output": "6" }, { "input": "355687428096000", "output": "69" }, { "input": "576460752303423488", "output": "84" }, { "input": "32212254719", "output": "49" }, { "input": "26388279066623", "output": "63" }, { "input": "618473717761", "output": "56" }, { "input": "262406072477", "output": "54" } ]
1,481,553,447
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
77
0
import bisect as b, itertools as i f = [1]*2 I = 2 while len(f)<90: f += [f[I-1] + f[I-2]] print(b.bisect_left(list(i.accumulate(f)), int(input())))
Title: Tennis Championship Time Limit: None seconds Memory Limit: None megabytes Problem Description: Famous Brazil city Rio de Janeiro holds a tennis tournament and Ostap Bender doesn't want to miss this event. There will be *n* players participating, and the tournament will follow knockout rules from the very first game. That means, that if someone loses a game he leaves the tournament immediately. Organizers are still arranging tournament grid (i.e. the order games will happen and who is going to play with whom) but they have already fixed one rule: two players can play against each other only if the number of games one of them has already played differs by no more than one from the number of games the other one has already played. Of course, both players had to win all their games in order to continue participating in the tournament. Tournament hasn't started yet so the audience is a bit bored. Ostap decided to find out what is the maximum number of games the winner of the tournament can take part in (assuming the rule above is used). However, it is unlikely he can deal with this problem without your help. Input Specification: The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=1018) — the number of players to participate in the tournament. Output Specification: Print the maximum number of games in which the winner of the tournament can take part. Demo Input: ['2\n', '3\n', '4\n', '10\n'] Demo Output: ['1\n', '2\n', '2\n', '4\n'] Note: In all samples we consider that player number 1 is the winner. In the first sample, there would be only one game so the answer is 1. In the second sample, player 1 can consequently beat players 2 and 3. In the third sample, player 1 can't play with each other player as after he plays with players 2 and 3 he can't play against player 4, as he has 0 games played, while player 1 already played 2. Thus, the answer is 2 and to achieve we make pairs (1, 2) and (3, 4) and then clash the winners.
```python import bisect as b, itertools as i f = [1]*2 I = 2 while len(f)<90: f += [f[I-1] + f[I-2]] print(b.bisect_left(list(i.accumulate(f)), int(input()))) ```
0
758
A
Holiday Of Equality
PROGRAMMING
800
[ "implementation", "math" ]
null
null
In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury. Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland). You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them.
The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen.
In the only line print the integer *S* — the minimum number of burles which are had to spend.
[ "5\n0 1 2 3 4\n", "5\n1 1 0 1 1\n", "3\n1 3 1\n", "1\n12\n" ]
[ "10", "1", "4", "0" ]
In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4. In the second example it is enough to give one burle to the third citizen. In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3. In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles.
500
[ { "input": "5\n0 1 2 3 4", "output": "10" }, { "input": "5\n1 1 0 1 1", "output": "1" }, { "input": "3\n1 3 1", "output": "4" }, { "input": "1\n12", "output": "0" }, { "input": "3\n1 2 3", "output": "3" }, { "input": "14\n52518 718438 358883 462189 853171 592966 225788 46977 814826 295697 676256 561479 56545 764281", "output": "5464380" }, { "input": "21\n842556 216391 427181 626688 775504 168309 851038 448402 880826 73697 593338 519033 135115 20128 424606 939484 846242 756907 377058 241543 29353", "output": "9535765" }, { "input": "3\n1 3 2", "output": "3" }, { "input": "3\n2 1 3", "output": "3" }, { "input": "3\n2 3 1", "output": "3" }, { "input": "3\n3 1 2", "output": "3" }, { "input": "3\n3 2 1", "output": "3" }, { "input": "1\n228503", "output": "0" }, { "input": "2\n32576 550340", "output": "517764" }, { "input": "3\n910648 542843 537125", "output": "741328" }, { "input": "4\n751720 572344 569387 893618", "output": "787403" }, { "input": "6\n433864 631347 597596 794426 713555 231193", "output": "1364575" }, { "input": "9\n31078 645168 695751 126111 375934 150495 838412 434477 993107", "output": "4647430" }, { "input": "30\n315421 772664 560686 654312 151528 356749 351486 707462 820089 226682 546700 136028 824236 842130 578079 337807 665903 764100 617900 822937 992759 591749 651310 742085 767695 695442 17967 515106 81059 186025", "output": "13488674" }, { "input": "45\n908719 394261 815134 419990 926993 383792 772842 277695 527137 655356 684956 695716 273062 550324 106247 399133 442382 33076 462920 294674 846052 817752 421365 474141 290471 358990 109812 74492 543281 169434 919692 786809 24028 197184 310029 801476 699355 429672 51343 374128 776726 850380 293868 981569 550763", "output": "21993384" }, { "input": "56\n100728 972537 13846 385421 756708 184642 259487 319707 376662 221694 675284 972837 499419 13846 38267 289898 901299 831197 954715 197515 514102 910423 127555 883934 362472 870788 538802 741008 973434 448124 391526 363321 947321 544618 68006 782313 955075 741981 815027 723297 585059 718114 700739 413489 454091 736144 308999 98065 3716 347323 9635 289003 986510 607065 60236 273351", "output": "26984185" }, { "input": "70\n644488 5444 150441 714420 602059 335330 510670 196555 546346 740011 509449 850947 692874 524857 750434 952985 223744 374727 896124 753037 367352 679050 560202 172728 569291 778616 332116 286927 843598 372698 244906 498046 900681 709791 420904 724593 864493 813094 791377 39998 296710 625656 403891 579231 706693 984045 16901 574259 562265 761104 930361 256045 124461 538980 573508 372148 988722 108592 784354 55302 232524 277205 782251 299943 436488 743389 324618 742543 266915 99642", "output": "32816391" }, { "input": "1\n0", "output": "0" }, { "input": "1\n1000000", "output": "0" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "100\n1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "99000000" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000", "output": "99000000" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "99000000" }, { "input": "3\n0 0 0", "output": "0" }, { "input": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "3\n5 0 0", "output": "10" }, { "input": "5\n2 10 0 0 0", "output": "38" } ]
1,650,382,819
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
4
46
0
n = int(input()) a = list(map(int,input().split())) a = set(a) if n==1: print(0) else: print(sum(a))
Title: Holiday Of Equality Time Limit: None seconds Memory Limit: None megabytes Problem Description: In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury. Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland). You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them. Input Specification: The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen. Output Specification: In the only line print the integer *S* — the minimum number of burles which are had to spend. Demo Input: ['5\n0 1 2 3 4\n', '5\n1 1 0 1 1\n', '3\n1 3 1\n', '1\n12\n'] Demo Output: ['10', '1', '4', '0'] Note: In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4. In the second example it is enough to give one burle to the third citizen. In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3. In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles.
```python n = int(input()) a = list(map(int,input().split())) a = set(a) if n==1: print(0) else: print(sum(a)) ```
0
228
A
Is your horseshoe on the other hoof?
PROGRAMMING
800
[ "implementation" ]
null
null
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers.
Print a single integer — the minimum number of horseshoes Valera needs to buy.
[ "1 7 3 3\n", "7 7 7 7\n" ]
[ "1\n", "3\n" ]
none
500
[ { "input": "1 7 3 3", "output": "1" }, { "input": "7 7 7 7", "output": "3" }, { "input": "81170865 673572653 756938629 995577259", "output": "0" }, { "input": "3491663 217797045 522540872 715355328", "output": "0" }, { "input": "251590420 586975278 916631563 586975278", "output": "1" }, { "input": "259504825 377489979 588153796 377489979", "output": "1" }, { "input": "652588203 931100304 931100304 652588203", "output": "2" }, { "input": "391958720 651507265 391958720 651507265", "output": "2" }, { "input": "90793237 90793237 90793237 90793237", "output": "3" }, { "input": "551651653 551651653 551651653 551651653", "output": "3" }, { "input": "156630260 609654355 668943582 973622757", "output": "0" }, { "input": "17061017 110313588 434481173 796661222", "output": "0" }, { "input": "24975422 256716298 337790533 690960249", "output": "0" }, { "input": "255635360 732742923 798648949 883146723", "output": "0" }, { "input": "133315691 265159773 734556507 265159773", "output": "1" }, { "input": "28442865 741657755 978106882 978106882", "output": "1" }, { "input": "131245479 174845575 497483467 131245479", "output": "1" }, { "input": "139159884 616215581 958341883 616215581", "output": "1" }, { "input": "147784432 947653080 947653080 947653080", "output": "2" }, { "input": "94055790 756126496 756126496 94055790", "output": "2" }, { "input": "240458500 511952208 240458500 511952208", "output": "2" }, { "input": "681828506 972810624 972810624 681828506", "output": "2" }, { "input": "454961014 454961014 454961014 454961014", "output": "3" }, { "input": "915819430 915819430 915819430 915819430", "output": "3" }, { "input": "671645142 671645142 671645142 671645142", "output": "3" }, { "input": "132503558 132503558 132503558 132503558", "output": "3" }, { "input": "5 5 999999 6", "output": "1" }, { "input": "1 1 2 5", "output": "1" }, { "input": "2 1 2 3", "output": "1" }, { "input": "1 1 3 5", "output": "1" }, { "input": "1 1 3 3", "output": "2" }, { "input": "2 2 2 1", "output": "2" }, { "input": "3 1 1 1", "output": "2" }, { "input": "1 2 2 2", "output": "2" } ]
1,697,028,690
2,147,483,647
Python 3
OK
TESTS
34
92
0
a=list(map(int,input().split())) b=set(a) print(4-len(b))
Title: Is your horseshoe on the other hoof? Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party. Input Specification: The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers. Output Specification: Print a single integer — the minimum number of horseshoes Valera needs to buy. Demo Input: ['1 7 3 3\n', '7 7 7 7\n'] Demo Output: ['1\n', '3\n'] Note: none
```python a=list(map(int,input().split())) b=set(a) print(4-len(b)) ```
3
0
none
none
none
0
[ "none" ]
null
null
A family consisting of father bear, mother bear and son bear owns three cars. Father bear can climb into the largest car and he likes it. Also, mother bear can climb into the middle car and she likes it. Moreover, son bear can climb into the smallest car and he likes it. It's known that the largest car is strictly larger than the middle car, and the middle car is strictly larger than the smallest car. Masha came to test these cars. She could climb into all cars, but she liked only the smallest car. It's known that a character with size *a* can climb into some car with size *b* if and only if *a*<=≤<=*b*, he or she likes it if and only if he can climb into this car and 2*a*<=≥<=*b*. You are given sizes of bears and Masha. Find out some possible integer non-negative sizes of cars.
You are given four integers *V*1, *V*2, *V*3, *V**m*(1<=≤<=*V**i*<=≤<=100) — sizes of father bear, mother bear, son bear and Masha, respectively. It's guaranteed that *V*1<=&gt;<=*V*2<=&gt;<=*V*3.
Output three integers — sizes of father bear's car, mother bear's car and son bear's car, respectively. If there are multiple possible solutions, print any. If there is no solution, print "-1" (without quotes).
[ "50 30 10 10\n", "100 50 10 21\n" ]
[ "50\n30\n10\n", "-1\n" ]
In first test case all conditions for cars' sizes are satisfied. In second test case there is no answer, because Masha should be able to climb into smallest car (so size of smallest car in not less than 21), but son bear should like it, so maximum possible size of it is 20.
0
[ { "input": "50 30 10 10", "output": "50\n30\n10" }, { "input": "100 50 10 21", "output": "-1" }, { "input": "100 50 19 10", "output": "100\n50\n19" }, { "input": "99 50 25 49", "output": "100\n99\n49" }, { "input": "3 2 1 1", "output": "4\n3\n1" }, { "input": "100 99 98 100", "output": "-1" }, { "input": "100 40 30 40", "output": "-1" }, { "input": "100 50 19 25", "output": "100\n51\n25" }, { "input": "100 50 19 30", "output": "100\n61\n30" }, { "input": "49 48 25 49", "output": "-1" }, { "input": "48 47 23 46", "output": "94\n93\n46" }, { "input": "37 23 16 20", "output": "42\n41\n20" }, { "input": "98 2 1 1", "output": "98\n3\n1" }, { "input": "99 22 13 14", "output": "99\n29\n14" }, { "input": "97 95 3 2", "output": "97\n95\n3" }, { "input": "27 3 2 3", "output": "-1" }, { "input": "13 7 6 2", "output": "-1" }, { "input": "19 17 11 6", "output": "19\n17\n11" }, { "input": "15 6 4 5", "output": "15\n11\n5" }, { "input": "21 3 1 3", "output": "-1" }, { "input": "100 99 98 97", "output": "196\n195\n98" }, { "input": "99 32 13 5", "output": "-1" }, { "input": "5 4 3 1", "output": "-1" }, { "input": "50 20 4 8", "output": "50\n20\n8" }, { "input": "60 30 10 1", "output": "-1" }, { "input": "100 50 10 1", "output": "-1" }, { "input": "40 30 20 10", "output": "40\n30\n20" }, { "input": "50 49 5 10", "output": "50\n49\n10" }, { "input": "99 98 50 97", "output": "196\n195\n97" }, { "input": "50 30 10 5", "output": "50\n30\n10" }, { "input": "4 3 2 1", "output": "4\n3\n2" }, { "input": "100 50 3 1", "output": "-1" } ]
1,514,038,206
306
Python 3
WRONG_ANSWER
PRETESTS
2
46
5,529,600
v3, v2, v1, vm = map(int, input().split()) v1r = v1 + v1 v2r = v2 + v2 v3r = v3 + v3 if v1 < vm or v2 < vm or v3 < vm: print(-1) elif v2r <= vm + vm or v3r <= vm + vm: print(-1) else: print(v3) print(v2) print(vm)
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: A family consisting of father bear, mother bear and son bear owns three cars. Father bear can climb into the largest car and he likes it. Also, mother bear can climb into the middle car and she likes it. Moreover, son bear can climb into the smallest car and he likes it. It's known that the largest car is strictly larger than the middle car, and the middle car is strictly larger than the smallest car. Masha came to test these cars. She could climb into all cars, but she liked only the smallest car. It's known that a character with size *a* can climb into some car with size *b* if and only if *a*<=≤<=*b*, he or she likes it if and only if he can climb into this car and 2*a*<=≥<=*b*. You are given sizes of bears and Masha. Find out some possible integer non-negative sizes of cars. Input Specification: You are given four integers *V*1, *V*2, *V*3, *V**m*(1<=≤<=*V**i*<=≤<=100) — sizes of father bear, mother bear, son bear and Masha, respectively. It's guaranteed that *V*1<=&gt;<=*V*2<=&gt;<=*V*3. Output Specification: Output three integers — sizes of father bear's car, mother bear's car and son bear's car, respectively. If there are multiple possible solutions, print any. If there is no solution, print "-1" (without quotes). Demo Input: ['50 30 10 10\n', '100 50 10 21\n'] Demo Output: ['50\n30\n10\n', '-1\n'] Note: In first test case all conditions for cars' sizes are satisfied. In second test case there is no answer, because Masha should be able to climb into smallest car (so size of smallest car in not less than 21), but son bear should like it, so maximum possible size of it is 20.
```python v3, v2, v1, vm = map(int, input().split()) v1r = v1 + v1 v2r = v2 + v2 v3r = v3 + v3 if v1 < vm or v2 < vm or v3 < vm: print(-1) elif v2r <= vm + vm or v3r <= vm + vm: print(-1) else: print(v3) print(v2) print(vm) ```
0
818
A
Diplomas and Certificates
PROGRAMMING
800
[ "implementation", "math" ]
null
null
There are *n* students who have taken part in an olympiad. Now it's time to award the students. Some of them will receive diplomas, some wiil get certificates, and others won't receive anything. Students with diplomas and certificates are called winners. But there are some rules of counting the number of diplomas and certificates. The number of certificates must be exactly *k* times greater than the number of diplomas. The number of winners must not be greater than half of the number of all students (i.e. not be greater than half of *n*). It's possible that there are no winners. You have to identify the maximum possible number of winners, according to these rules. Also for this case you have to calculate the number of students with diplomas, the number of students with certificates and the number of students who are not winners.
The first (and the only) line of input contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1012), where *n* is the number of students and *k* is the ratio between the number of certificates and the number of diplomas.
Output three numbers: the number of students with diplomas, the number of students with certificates and the number of students who are not winners in case when the number of winners is maximum possible. It's possible that there are no winners.
[ "18 2\n", "9 10\n", "1000000000000 5\n", "1000000000000 499999999999\n" ]
[ "3 6 9\n", "0 0 9\n", "83333333333 416666666665 500000000002\n", "1 499999999999 500000000000\n" ]
none
0
[ { "input": "18 2", "output": "3 6 9" }, { "input": "9 10", "output": "0 0 9" }, { "input": "1000000000000 5", "output": "83333333333 416666666665 500000000002" }, { "input": "1000000000000 499999999999", "output": "1 499999999999 500000000000" }, { "input": "1 1", "output": "0 0 1" }, { "input": "5 3", "output": "0 0 5" }, { "input": "42 6", "output": "3 18 21" }, { "input": "1000000000000 1000", "output": "499500499 499500499000 500000000501" }, { "input": "999999999999 999999", "output": "499999 499998500001 500000999999" }, { "input": "732577309725 132613", "output": "2762066 366285858458 366288689201" }, { "input": "152326362626 15", "output": "4760198832 71402982480 76163181314" }, { "input": "2 1", "output": "0 0 2" }, { "input": "1000000000000 500000000000", "output": "0 0 1000000000000" }, { "input": "100000000000 50000000011", "output": "0 0 100000000000" }, { "input": "1000000000000 32416187567", "output": "15 486242813505 513757186480" }, { "input": "1000000000000 7777777777", "output": "64 497777777728 502222222208" }, { "input": "1000000000000 77777777777", "output": "6 466666666662 533333333332" }, { "input": "100000000000 578485652", "output": "86 49749766072 50250233842" }, { "input": "999999999999 10000000000", "output": "49 490000000000 509999999950" }, { "input": "7 2", "output": "1 2 4" }, { "input": "420506530901 752346673804", "output": "0 0 420506530901" }, { "input": "960375521135 321688347872", "output": "1 321688347872 638687173262" }, { "input": "1000000000000 1000000000000", "output": "0 0 1000000000000" }, { "input": "99999999999 15253636363", "output": "3 45760909089 54239090907" }, { "input": "19 2", "output": "3 6 10" }, { "input": "999999999999 1000000000000", "output": "0 0 999999999999" }, { "input": "1000000000000 5915587276", "output": "84 496909331184 503090668732" }, { "input": "1000000000000 1000000006", "output": "499 499000002994 500999996507" }, { "input": "549755813888 134217728", "output": "2047 274743689216 275012122625" }, { "input": "99999999999 3333333", "output": "14999 49996661667 50003323333" }, { "input": "9 1", "output": "2 2 5" }, { "input": "1000000000000 250000000001", "output": "1 250000000001 749999999998" }, { "input": "5 1", "output": "1 1 3" }, { "input": "3107038133 596040207", "output": "2 1192080414 1914957717" }, { "input": "1000000000000 73786977", "output": "6776 499980556152 500019437072" }, { "input": "1000000000000 73786976", "output": "6776 499980549376 500019443848" }, { "input": "1000000000000 25000000000", "output": "19 475000000000 524999999981" }, { "input": "216929598879 768233755932", "output": "0 0 216929598879" }, { "input": "1000000000000 250000000000", "output": "1 250000000000 749999999999" }, { "input": "1000000000000 100000000001", "output": "4 400000000004 599999999992" }, { "input": "100000000000 100000000001", "output": "0 0 100000000000" }, { "input": "900000000000 100281800001", "output": "4 401127200004 498872799992" }, { "input": "906028900004 109123020071", "output": "4 436492080284 469536819716" }, { "input": "1000000000000 1", "output": "250000000000 250000000000 500000000000" } ]
1,628,327,553
2,147,483,647
Python 3
OK
TESTS
44
62
6,758,400
n, k = map(int, input().split()) a = (n // 2) // (k + 1) b = a * k c = n - a - b print(a, b ,c)
Title: Diplomas and Certificates Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* students who have taken part in an olympiad. Now it's time to award the students. Some of them will receive diplomas, some wiil get certificates, and others won't receive anything. Students with diplomas and certificates are called winners. But there are some rules of counting the number of diplomas and certificates. The number of certificates must be exactly *k* times greater than the number of diplomas. The number of winners must not be greater than half of the number of all students (i.e. not be greater than half of *n*). It's possible that there are no winners. You have to identify the maximum possible number of winners, according to these rules. Also for this case you have to calculate the number of students with diplomas, the number of students with certificates and the number of students who are not winners. Input Specification: The first (and the only) line of input contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1012), where *n* is the number of students and *k* is the ratio between the number of certificates and the number of diplomas. Output Specification: Output three numbers: the number of students with diplomas, the number of students with certificates and the number of students who are not winners in case when the number of winners is maximum possible. It's possible that there are no winners. Demo Input: ['18 2\n', '9 10\n', '1000000000000 5\n', '1000000000000 499999999999\n'] Demo Output: ['3 6 9\n', '0 0 9\n', '83333333333 416666666665 500000000002\n', '1 499999999999 500000000000\n'] Note: none
```python n, k = map(int, input().split()) a = (n // 2) // (k + 1) b = a * k c = n - a - b print(a, b ,c) ```
3
1,006
F
Xor-Paths
PROGRAMMING
2,100
[ "bitmasks", "brute force", "dp", "meet-in-the-middle" ]
null
null
There is a rectangular grid of size $n \times m$. Each cell has a number written on it; the number on the cell ($i, j$) is $a_{i, j}$. Your task is to calculate the number of paths from the upper-left cell ($1, 1$) to the bottom-right cell ($n, m$) meeting the following constraints: - You can move to the right or to the bottom only. Formally, from the cell ($i, j$) you may move to the cell ($i, j + 1$) or to the cell ($i + 1, j$). The target cell can't be outside of the grid. - The xor of all the numbers on the path from the cell ($1, 1$) to the cell ($n, m$) must be equal to $k$ (xor operation is the bitwise exclusive OR, it is represented as '^' in Java or C++ and "xor" in Pascal). Find the number of such paths in the given grid.
The first line of the input contains three integers $n$, $m$ and $k$ ($1 \le n, m \le 20$, $0 \le k \le 10^{18}$) — the height and the width of the grid, and the number $k$. The next $n$ lines contain $m$ integers each, the $j$-th element in the $i$-th line is $a_{i, j}$ ($0 \le a_{i, j} \le 10^{18}$).
Print one integer — the number of paths from ($1, 1$) to ($n, m$) with xor sum equal to $k$.
[ "3 3 11\n2 1 5\n7 10 0\n12 6 4\n", "3 4 2\n1 3 3 3\n0 3 3 2\n3 0 1 1\n", "3 4 1000000000000000000\n1 3 3 3\n0 3 3 2\n3 0 1 1\n" ]
[ "3\n", "5\n", "0\n" ]
All the paths from the first example: - $(1, 1) \rightarrow (2, 1) \rightarrow (3, 1) \rightarrow (3, 2) \rightarrow (3, 3)$; - $(1, 1) \rightarrow (2, 1) \rightarrow (2, 2) \rightarrow (2, 3) \rightarrow (3, 3)$; - $(1, 1) \rightarrow (1, 2) \rightarrow (2, 2) \rightarrow (3, 2) \rightarrow (3, 3)$. All the paths from the second example: - $(1, 1) \rightarrow (2, 1) \rightarrow (3, 1) \rightarrow (3, 2) \rightarrow (3, 3) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (2, 1) \rightarrow (2, 2) \rightarrow (3, 2) \rightarrow (3, 3) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (2, 1) \rightarrow (2, 2) \rightarrow (2, 3) \rightarrow (2, 4) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (1, 2) \rightarrow (2, 2) \rightarrow (2, 3) \rightarrow (3, 3) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (1, 2) \rightarrow (1, 3) \rightarrow (2, 3) \rightarrow (3, 3) \rightarrow (3, 4)$.
0
[ { "input": "3 3 11\n2 1 5\n7 10 0\n12 6 4", "output": "3" }, { "input": "3 4 2\n1 3 3 3\n0 3 3 2\n3 0 1 1", "output": "5" }, { "input": "3 4 1000000000000000000\n1 3 3 3\n0 3 3 2\n3 0 1 1", "output": "0" }, { "input": "1 1 1000000000000000000\n1000000000000000000", "output": "1" }, { "input": "1 1 1000000000000000000\n999999999999999999", "output": "0" }, { "input": "1 1 1\n1", "output": "1" }, { "input": "1 2 3\n1 2", "output": "1" }, { "input": "1 10 1023\n1 2 4 8 16 32 64 128 256 512", "output": "1" }, { "input": "1 20 1048575\n1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 65536 131072 262144 524288", "output": "1" }, { "input": "2 1 3\n1\n2", "output": "1" }, { "input": "2 2 7\n1 2\n2 4", "output": "2" }, { "input": "2 10 2047\n1 2 4 8 16 32 64 128 256 512\n2 4 8 16 32 64 128 256 512 1024", "output": "10" }, { "input": "2 20 2097151\n1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 65536 131072 262144 524288\n2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 65536 131072 262144 524288 1048576", "output": "20" }, { "input": "10 1 1023\n1\n2\n4\n8\n16\n32\n64\n128\n256\n512", "output": "1" }, { "input": "10 2 2047\n1 2\n2 4\n4 8\n8 16\n16 32\n32 64\n64 128\n128 256\n256 512\n512 1024", "output": "10" }, { "input": "10 10 524287\n1 2 4 8 16 32 64 128 256 512\n2 4 8 16 32 64 128 256 512 1024\n4 8 16 32 64 128 256 512 1024 2048\n8 16 32 64 128 256 512 1024 2048 4096\n16 32 64 128 256 512 1024 2048 4096 8192\n32 64 128 256 512 1024 2048 4096 8192 16384\n64 128 256 512 1024 2048 4096 8192 16384 32768\n128 256 512 1024 2048 4096 8192 16384 32768 65536\n256 512 1024 2048 4096 8192 16384 32768 65536 131072\n512 1024 2048 4096 8192 16384 32768 65536 131072 262144", "output": "48620" }, { "input": "20 1 1048575\n1\n2\n4\n8\n16\n32\n64\n128\n256\n512\n1024\n2048\n4096\n8192\n16384\n32768\n65536\n131072\n262144\n524288", "output": "1" }, { "input": "20 2 2097151\n1 2\n2 4\n4 8\n8 16\n16 32\n32 64\n64 128\n128 256\n256 512\n512 1024\n1024 2048\n2048 4096\n4096 8192\n8192 16384\n16384 32768\n32768 65536\n65536 131072\n131072 262144\n262144 524288\n524288 1048576", "output": "20" }, { "input": "1 1 982347923479\n1", "output": "0" }, { "input": "1 2 1\n1 1", "output": "0" } ]
1,678,830,733
2,147,483,647
PyPy 3-64
OK
TESTS
100
358
51,200,000
# https://codeforces.com/contest/1006 import sys from collections import Counter, deque input = lambda: sys.stdin.readline().rstrip() # faster! def solve_case(): n, m, k = map(int, input().split()) a = [list(map(int, input().split())) for _ in range(n)] ans = 0 # half-way from start forwards half = (n + m - 2) // 2 cnt = [[Counter() for _ in range(m)] for _ in range(n)] stack = deque([(0, 0, 0)]) while stack: r, c, xor = stack.pop() if r + c == half: cnt[r][c][xor ^ a[r][c]] += 1 continue if r + 1 < n: stack.append((r + 1, c, xor ^ a[r][c])) if c + 1 < m: stack.append((r, c + 1, xor ^ a[r][c])) # half-way from end backwards stack = deque([(n - 1, m - 1, k)]) while stack: r, c, xor = stack.pop() if r + c == half: ans += cnt[r][c][xor] continue if r - 1 >= 0: stack.append((r - 1, c, xor ^ a[r][c])) if c - 1 >= 0: stack.append((r, c - 1, xor ^ a[r][c])) print(ans) solve_case()
Title: Xor-Paths Time Limit: None seconds Memory Limit: None megabytes Problem Description: There is a rectangular grid of size $n \times m$. Each cell has a number written on it; the number on the cell ($i, j$) is $a_{i, j}$. Your task is to calculate the number of paths from the upper-left cell ($1, 1$) to the bottom-right cell ($n, m$) meeting the following constraints: - You can move to the right or to the bottom only. Formally, from the cell ($i, j$) you may move to the cell ($i, j + 1$) or to the cell ($i + 1, j$). The target cell can't be outside of the grid. - The xor of all the numbers on the path from the cell ($1, 1$) to the cell ($n, m$) must be equal to $k$ (xor operation is the bitwise exclusive OR, it is represented as '^' in Java or C++ and "xor" in Pascal). Find the number of such paths in the given grid. Input Specification: The first line of the input contains three integers $n$, $m$ and $k$ ($1 \le n, m \le 20$, $0 \le k \le 10^{18}$) — the height and the width of the grid, and the number $k$. The next $n$ lines contain $m$ integers each, the $j$-th element in the $i$-th line is $a_{i, j}$ ($0 \le a_{i, j} \le 10^{18}$). Output Specification: Print one integer — the number of paths from ($1, 1$) to ($n, m$) with xor sum equal to $k$. Demo Input: ['3 3 11\n2 1 5\n7 10 0\n12 6 4\n', '3 4 2\n1 3 3 3\n0 3 3 2\n3 0 1 1\n', '3 4 1000000000000000000\n1 3 3 3\n0 3 3 2\n3 0 1 1\n'] Demo Output: ['3\n', '5\n', '0\n'] Note: All the paths from the first example: - $(1, 1) \rightarrow (2, 1) \rightarrow (3, 1) \rightarrow (3, 2) \rightarrow (3, 3)$; - $(1, 1) \rightarrow (2, 1) \rightarrow (2, 2) \rightarrow (2, 3) \rightarrow (3, 3)$; - $(1, 1) \rightarrow (1, 2) \rightarrow (2, 2) \rightarrow (3, 2) \rightarrow (3, 3)$. All the paths from the second example: - $(1, 1) \rightarrow (2, 1) \rightarrow (3, 1) \rightarrow (3, 2) \rightarrow (3, 3) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (2, 1) \rightarrow (2, 2) \rightarrow (3, 2) \rightarrow (3, 3) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (2, 1) \rightarrow (2, 2) \rightarrow (2, 3) \rightarrow (2, 4) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (1, 2) \rightarrow (2, 2) \rightarrow (2, 3) \rightarrow (3, 3) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (1, 2) \rightarrow (1, 3) \rightarrow (2, 3) \rightarrow (3, 3) \rightarrow (3, 4)$.
```python # https://codeforces.com/contest/1006 import sys from collections import Counter, deque input = lambda: sys.stdin.readline().rstrip() # faster! def solve_case(): n, m, k = map(int, input().split()) a = [list(map(int, input().split())) for _ in range(n)] ans = 0 # half-way from start forwards half = (n + m - 2) // 2 cnt = [[Counter() for _ in range(m)] for _ in range(n)] stack = deque([(0, 0, 0)]) while stack: r, c, xor = stack.pop() if r + c == half: cnt[r][c][xor ^ a[r][c]] += 1 continue if r + 1 < n: stack.append((r + 1, c, xor ^ a[r][c])) if c + 1 < m: stack.append((r, c + 1, xor ^ a[r][c])) # half-way from end backwards stack = deque([(n - 1, m - 1, k)]) while stack: r, c, xor = stack.pop() if r + c == half: ans += cnt[r][c][xor] continue if r - 1 >= 0: stack.append((r - 1, c, xor ^ a[r][c])) if c - 1 >= 0: stack.append((r, c - 1, xor ^ a[r][c])) print(ans) solve_case() ```
3
312
B
Archer
PROGRAMMING
1,300
[ "math", "probabilities" ]
null
null
SmallR is an archer. SmallR is taking a match of archer with Zanoes. They try to shoot in the target in turns, and SmallR shoots first. The probability of shooting the target each time is for SmallR while for Zanoes. The one who shoots in the target first should be the winner. Output the probability that SmallR will win the match.
A single line contains four integers .
Print a single real number, the probability that SmallR will win the match. The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6.
[ "1 2 1 2\n" ]
[ "0.666666666667" ]
none
1,000
[ { "input": "1 2 1 2", "output": "0.666666666667" }, { "input": "1 3 1 3", "output": "0.600000000000" }, { "input": "1 3 2 3", "output": "0.428571428571" }, { "input": "3 4 3 4", "output": "0.800000000000" }, { "input": "1 2 10 11", "output": "0.523809523810" }, { "input": "4 5 4 5", "output": "0.833333333333" }, { "input": "466 701 95 721", "output": "0.937693791148" }, { "input": "268 470 444 885", "output": "0.725614009325" }, { "input": "632 916 713 821", "output": "0.719292895126" }, { "input": "269 656 918 992", "output": "0.428937461623" }, { "input": "71 657 187 695", "output": "0.310488463257" }, { "input": "435 852 973 978", "output": "0.511844133157" }, { "input": "518 816 243 359", "output": "0.719734031025" }, { "input": "882 962 311 811", "output": "0.966386645447" }, { "input": "684 774 580 736", "output": "0.906051574446" }, { "input": "486 868 929 999", "output": "0.577723252958" }, { "input": "132 359 996 998", "output": "0.368154532345" }, { "input": "933 977 266 450", "output": "0.972879407907" }, { "input": "298 833 615 872", "output": "0.441270817024" }, { "input": "34 554 14 958", "output": "0.817324099167" }, { "input": "836 934 800 905", "output": "0.906105535462" }, { "input": "482 815 69 509", "output": "0.914365577772" }, { "input": "284 423 137 521", "output": "0.885974839378" }, { "input": "648 881 486 703", "output": "0.800911421248" }, { "input": "450 885 755 836", "output": "0.533901011176" }, { "input": "533 773 823 998", "output": "0.729222130525" }, { "input": "897 957 92 898", "output": "0.993193806364" }, { "input": "699 925 441 928", "output": "0.866816866175" }, { "input": "64 704 148 603", "output": "0.289486317811" }, { "input": "719 735 626 990", "output": "0.986124079764" }, { "input": "1 1000 1 1000", "output": "0.500250125063" } ]
1,692,388,155
2,147,483,647
PyPy 3-64
OK
TESTS
31
62
0
def main(): ent = input().split() a = int(ent[0]) b = int(ent[1]) c = int(ent[2]) d = int(ent[3]) # sum{i=0 ate inf} de x*((1-x)*(1-y))**i a0 = a/b r = (1-(a/b)) * (1-(c/d)) res = a0/(1-r) print(res) return main()
Title: Archer Time Limit: None seconds Memory Limit: None megabytes Problem Description: SmallR is an archer. SmallR is taking a match of archer with Zanoes. They try to shoot in the target in turns, and SmallR shoots first. The probability of shooting the target each time is for SmallR while for Zanoes. The one who shoots in the target first should be the winner. Output the probability that SmallR will win the match. Input Specification: A single line contains four integers . Output Specification: Print a single real number, the probability that SmallR will win the match. The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6. Demo Input: ['1 2 1 2\n'] Demo Output: ['0.666666666667'] Note: none
```python def main(): ent = input().split() a = int(ent[0]) b = int(ent[1]) c = int(ent[2]) d = int(ent[3]) # sum{i=0 ate inf} de x*((1-x)*(1-y))**i a0 = a/b r = (1-(a/b)) * (1-(c/d)) res = a0/(1-r) print(res) return main() ```
3
723
A
The New Year: Meeting Friends
PROGRAMMING
800
[ "implementation", "math", "sortings" ]
null
null
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year? It's guaranteed that the optimal answer is always integer.
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
Print one integer — the minimum total distance the friends need to travel in order to meet together.
[ "7 1 4\n", "30 20 10\n" ]
[ "6\n", "20\n" ]
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
500
[ { "input": "7 1 4", "output": "6" }, { "input": "30 20 10", "output": "20" }, { "input": "1 4 100", "output": "99" }, { "input": "100 1 91", "output": "99" }, { "input": "1 45 100", "output": "99" }, { "input": "1 2 3", "output": "2" }, { "input": "71 85 88", "output": "17" }, { "input": "30 38 99", "output": "69" }, { "input": "23 82 95", "output": "72" }, { "input": "22 41 47", "output": "25" }, { "input": "9 94 77", "output": "85" }, { "input": "1 53 51", "output": "52" }, { "input": "25 97 93", "output": "72" }, { "input": "42 53 51", "output": "11" }, { "input": "81 96 94", "output": "15" }, { "input": "21 5 93", "output": "88" }, { "input": "50 13 75", "output": "62" }, { "input": "41 28 98", "output": "70" }, { "input": "69 46 82", "output": "36" }, { "input": "87 28 89", "output": "61" }, { "input": "44 45 40", "output": "5" }, { "input": "86 97 68", "output": "29" }, { "input": "43 92 30", "output": "62" }, { "input": "16 70 1", "output": "69" }, { "input": "40 46 19", "output": "27" }, { "input": "71 38 56", "output": "33" }, { "input": "82 21 80", "output": "61" }, { "input": "75 8 35", "output": "67" }, { "input": "75 24 28", "output": "51" }, { "input": "78 23 56", "output": "55" }, { "input": "85 31 10", "output": "75" }, { "input": "76 50 9", "output": "67" }, { "input": "95 37 34", "output": "61" }, { "input": "84 61 35", "output": "49" }, { "input": "87 85 37", "output": "50" }, { "input": "1 3 2", "output": "2" }, { "input": "4 2 6", "output": "4" }, { "input": "6 9 3", "output": "6" }, { "input": "12 4 8", "output": "8" }, { "input": "15 10 5", "output": "10" }, { "input": "1 50 17", "output": "49" }, { "input": "10 5 15", "output": "10" }, { "input": "8 1 9", "output": "8" }, { "input": "3 5 4", "output": "2" }, { "input": "2 1 3", "output": "2" }, { "input": "1 8 2", "output": "7" }, { "input": "1 100 2", "output": "99" }, { "input": "1 4 6", "output": "5" } ]
1,696,268,429
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
31
0
x1, x2, x3 = map(int, input().split()) average_distance = (x1 + x2 + x3) / 3 travelled_distance = abs(x1 - average_distance) + abs(x2 - average_distance) + abs(x3 - average_distance) print(int(travelled_distance))
Title: The New Year: Meeting Friends Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year? It's guaranteed that the optimal answer is always integer. Input Specification: The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively. Output Specification: Print one integer — the minimum total distance the friends need to travel in order to meet together. Demo Input: ['7 1 4\n', '30 20 10\n'] Demo Output: ['6\n', '20\n'] Note: In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
```python x1, x2, x3 = map(int, input().split()) average_distance = (x1 + x2 + x3) / 3 travelled_distance = abs(x1 - average_distance) + abs(x2 - average_distance) + abs(x3 - average_distance) print(int(travelled_distance)) ```
0
69
A
Young Physicist
PROGRAMMING
1,000
[ "implementation", "math" ]
A. Young Physicist
2
256
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
[ "3\n4 1 7\n-2 4 -1\n1 -5 -3\n", "3\n3 -1 7\n-5 2 -4\n2 -1 -3\n" ]
[ "NO", "YES" ]
none
500
[ { "input": "3\n4 1 7\n-2 4 -1\n1 -5 -3", "output": "NO" }, { "input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3", "output": "YES" }, { "input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41", "output": "NO" }, { "input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33", "output": "NO" }, { "input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7", "output": "NO" }, { "input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38", "output": "NO" }, { "input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6", "output": "YES" }, { "input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0", "output": "YES" }, { "input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0", "output": "YES" }, { "input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0", "output": "YES" }, { "input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0", "output": "YES" }, { "input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0", "output": "YES" }, { "input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87", "output": "YES" }, { "input": "3\n1 2 3\n3 2 1\n0 0 0", "output": "NO" }, { "input": "2\n5 -23 12\n0 0 0", "output": "NO" }, { "input": "1\n0 0 0", "output": "YES" }, { "input": "1\n1 -2 0", "output": "NO" }, { "input": "2\n-23 77 -86\n23 -77 86", "output": "YES" }, { "input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82", "output": "YES" }, { "input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0", "output": "YES" }, { "input": "3\n96 49 -12\n2 -66 28\n-98 17 -16", "output": "YES" }, { "input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0", "output": "YES" }, { "input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53", "output": "YES" }, { "input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1", "output": "YES" }, { "input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0", "output": "YES" }, { "input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0", "output": "YES" }, { "input": "3\n0 2 -2\n1 -1 3\n-3 0 0", "output": "NO" } ]
1,666,542,506
2,147,483,647
Python 3
OK
TESTS
81
92
0
def isEqui(): n=int(input()) sum1,sum2,sum3=0,0,0 for i in range(n): a,b,c,=map(int,input().split()) sum1+=a sum2+=b sum3+=c if sum1==0 and sum2==0 and sum3==0: return "YES" return "NO" print(isEqui())
Title: Young Physicist Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. Input Specification: The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). Output Specification: Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. Demo Input: ['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n'] Demo Output: ['NO', 'YES'] Note: none
```python def isEqui(): n=int(input()) sum1,sum2,sum3=0,0,0 for i in range(n): a,b,c,=map(int,input().split()) sum1+=a sum2+=b sum3+=c if sum1==0 and sum2==0 and sum3==0: return "YES" return "NO" print(isEqui()) ```
3.977
713
C
Sonya and Problem Wihtout a Legend
PROGRAMMING
2,300
[ "dp", "sortings" ]
null
null
Sonya was unable to think of a story for this problem, so here comes the formal description. You are given the array containing *n* positive integers. At one turn you can pick any element and increase or decrease it by 1. The goal is the make the array strictly increasing by making the minimum possible number of operations. You are allowed to change elements in any way, they can become negative or equal to 0.
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=3000) — the length of the array. Next line contains *n* integer *a**i* (1<=≤<=*a**i*<=≤<=109).
Print the minimum number of operation required to make the array strictly increasing.
[ "7\n2 1 5 11 5 9 11\n", "5\n5 4 3 2 1\n" ]
[ "9\n", "12\n" ]
In the first sample, the array is going to look as follows: 2 3 5 6 7 9 11 |2 - 2| + |1 - 3| + |5 - 5| + |11 - 6| + |5 - 7| + |9 - 9| + |11 - 11| = 9 And for the second sample: 1 2 3 4 5 |5 - 1| + |4 - 2| + |3 - 3| + |2 - 4| + |1 - 5| = 12
2,000
[ { "input": "7\n2 1 5 11 5 9 11", "output": "9" }, { "input": "5\n5 4 3 2 1", "output": "12" }, { "input": "2\n1 1000", "output": "0" }, { "input": "2\n1000 1", "output": "1000" }, { "input": "5\n100 80 60 70 90", "output": "54" }, { "input": "10\n10 16 17 11 1213 1216 1216 1209 3061 3062", "output": "16" }, { "input": "20\n103 103 110 105 107 119 113 121 116 132 128 124 128 125 138 137 140 136 154 158", "output": "43" }, { "input": "1\n1", "output": "0" }, { "input": "5\n1 1 1 2 3", "output": "3" }, { "input": "1\n1000", "output": "0" }, { "input": "50\n499 780 837 984 481 526 944 482 862 136 265 605 5 631 974 967 574 293 969 467 573 845 102 224 17 873 648 120 694 996 244 313 404 129 899 583 541 314 525 496 443 857 297 78 575 2 430 137 387 319", "output": "12423" }, { "input": "75\n392 593 98 533 515 448 220 310 386 79 539 294 208 828 75 534 875 493 94 205 656 105 546 493 60 188 222 108 788 504 809 621 934 455 307 212 630 298 938 62 850 421 839 134 950 256 934 817 209 559 866 67 990 835 534 672 468 768 757 516 959 893 275 315 692 927 321 554 801 805 885 12 67 245 495", "output": "17691" }, { "input": "10\n26 723 970 13 422 968 875 329 234 983", "output": "2546" }, { "input": "20\n245 891 363 6 193 704 420 447 237 947 664 894 512 194 513 616 671 623 686 378", "output": "3208" }, { "input": "5\n850 840 521 42 169", "output": "1485" } ]
1,697,708,147
2,147,483,647
PyPy 3-64
OK
TESTS
57
124
6,656,000
import sys import random input = sys.stdin.readline rd = random.randint(10 ** 9, 2 * 10 ** 9) n = int(input()) a = list(map(int,input().split())) for i in range(n): a[i] -= i import heapq q,ans = [],0 for i in range(n): heapq.heappush(q,-a[i]) if -q[0] > a[i]: ans += -q[0] - a[i] heapq.heapreplace(q,-a[i]) print(ans)
Title: Sonya and Problem Wihtout a Legend Time Limit: None seconds Memory Limit: None megabytes Problem Description: Sonya was unable to think of a story for this problem, so here comes the formal description. You are given the array containing *n* positive integers. At one turn you can pick any element and increase or decrease it by 1. The goal is the make the array strictly increasing by making the minimum possible number of operations. You are allowed to change elements in any way, they can become negative or equal to 0. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=3000) — the length of the array. Next line contains *n* integer *a**i* (1<=≤<=*a**i*<=≤<=109). Output Specification: Print the minimum number of operation required to make the array strictly increasing. Demo Input: ['7\n2 1 5 11 5 9 11\n', '5\n5 4 3 2 1\n'] Demo Output: ['9\n', '12\n'] Note: In the first sample, the array is going to look as follows: 2 3 5 6 7 9 11 |2 - 2| + |1 - 3| + |5 - 5| + |11 - 6| + |5 - 7| + |9 - 9| + |11 - 11| = 9 And for the second sample: 1 2 3 4 5 |5 - 1| + |4 - 2| + |3 - 3| + |2 - 4| + |1 - 5| = 12
```python import sys import random input = sys.stdin.readline rd = random.randint(10 ** 9, 2 * 10 ** 9) n = int(input()) a = list(map(int,input().split())) for i in range(n): a[i] -= i import heapq q,ans = [],0 for i in range(n): heapq.heappush(q,-a[i]) if -q[0] > a[i]: ans += -q[0] - a[i] heapq.heapreplace(q,-a[i]) print(ans) ```
3
319
C
Kalila and Dimna in the Logging Industry
PROGRAMMING
2,100
[ "dp", "geometry" ]
null
null
Kalila and Dimna are two jackals living in a huge jungle. One day they decided to join a logging factory in order to make money. The manager of logging factory wants them to go to the jungle and cut *n* trees with heights *a*1,<=*a*2,<=...,<=*a**n*. They bought a chain saw from a shop. Each time they use the chain saw on the tree number *i*, they can decrease the height of this tree by one unit. Each time that Kalila and Dimna use the chain saw, they need to recharge it. Cost of charging depends on the id of the trees which have been cut completely (a tree is cut completely if its height equal to 0). If the maximum id of a tree which has been cut completely is *i* (the tree that have height *a**i* in the beginning), then the cost of charging the chain saw would be *b**i*. If no tree is cut completely, Kalila and Dimna cannot charge the chain saw. The chainsaw is charged in the beginning. We know that for each *i* &lt; *j*, *a**i*<=&lt;<=*a**j* and *b**i*<=&gt;<=*b**j* and also *b**n*<==<=0 and *a*1<==<=1. Kalila and Dimna want to cut all the trees completely, with minimum cost. They want you to help them! Will you?
The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=105). The second line of input contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109). The third line of input contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (0<=≤<=*b**i*<=≤<=109). It's guaranteed that *a*1<==<=1, *b**n*<==<=0, *a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n* and *b*1<=&gt;<=*b*2<=&gt;<=...<=&gt;<=*b**n*.
The only line of output must contain the minimum cost of cutting all the trees completely. Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
[ "5\n1 2 3 4 5\n5 4 3 2 0\n", "6\n1 2 3 10 20 30\n6 5 4 3 2 0\n" ]
[ "25\n", "138\n" ]
none
1,500
[ { "input": "5\n1 2 3 4 5\n5 4 3 2 0", "output": "25" }, { "input": "6\n1 2 3 10 20 30\n6 5 4 3 2 0", "output": "138" } ]
1,691,747,735
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
2
93
9,011,200
def get(k1, k2, dp, b): return (dp[k1] - dp[k2]) * 1.0 / (b[k2] - b[k1]) def calc(n, a, b): dp = [0] * (n + 1) k = [0] * (n + 1) g,y= 0,0 k[y] = 1 for i in range(2, n + 1): while g + 1 < y and get(k[g + 1], k[g], dp, b) < a[i]: g += 1 dp[i] = b[k[g]] * a[i] + dp[k[g]] while g + 1 < y and get(k[y], k[y - 1], dp, b) >= get(k[y], i, dp, b): y -= 1 y += 1 k[y] = i return dp[n] n = int(input()) a = [0] + list(map(int, input().split())) b = [0] + list(map(int, input().split())) result = calc(n, a, b) print(result)# 1691747735.4628057
Title: Kalila and Dimna in the Logging Industry Time Limit: None seconds Memory Limit: None megabytes Problem Description: Kalila and Dimna are two jackals living in a huge jungle. One day they decided to join a logging factory in order to make money. The manager of logging factory wants them to go to the jungle and cut *n* trees with heights *a*1,<=*a*2,<=...,<=*a**n*. They bought a chain saw from a shop. Each time they use the chain saw on the tree number *i*, they can decrease the height of this tree by one unit. Each time that Kalila and Dimna use the chain saw, they need to recharge it. Cost of charging depends on the id of the trees which have been cut completely (a tree is cut completely if its height equal to 0). If the maximum id of a tree which has been cut completely is *i* (the tree that have height *a**i* in the beginning), then the cost of charging the chain saw would be *b**i*. If no tree is cut completely, Kalila and Dimna cannot charge the chain saw. The chainsaw is charged in the beginning. We know that for each *i* &lt; *j*, *a**i*<=&lt;<=*a**j* and *b**i*<=&gt;<=*b**j* and also *b**n*<==<=0 and *a*1<==<=1. Kalila and Dimna want to cut all the trees completely, with minimum cost. They want you to help them! Will you? Input Specification: The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=105). The second line of input contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109). The third line of input contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (0<=≤<=*b**i*<=≤<=109). It's guaranteed that *a*1<==<=1, *b**n*<==<=0, *a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n* and *b*1<=&gt;<=*b*2<=&gt;<=...<=&gt;<=*b**n*. Output Specification: The only line of output must contain the minimum cost of cutting all the trees completely. Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier. Demo Input: ['5\n1 2 3 4 5\n5 4 3 2 0\n', '6\n1 2 3 10 20 30\n6 5 4 3 2 0\n'] Demo Output: ['25\n', '138\n'] Note: none
```python def get(k1, k2, dp, b): return (dp[k1] - dp[k2]) * 1.0 / (b[k2] - b[k1]) def calc(n, a, b): dp = [0] * (n + 1) k = [0] * (n + 1) g,y= 0,0 k[y] = 1 for i in range(2, n + 1): while g + 1 < y and get(k[g + 1], k[g], dp, b) < a[i]: g += 1 dp[i] = b[k[g]] * a[i] + dp[k[g]] while g + 1 < y and get(k[y], k[y - 1], dp, b) >= get(k[y], i, dp, b): y -= 1 y += 1 k[y] = i return dp[n] n = int(input()) a = [0] + list(map(int, input().split())) b = [0] + list(map(int, input().split())) result = calc(n, a, b) print(result)# 1691747735.4628057 ```
0
706
B
Interesting drink
PROGRAMMING
1,100
[ "binary search", "dp", "implementation" ]
null
null
Vasiliy likes to rest after a hard work, so you may often meet him in some bar nearby. As all programmers do, he loves the famous drink "Beecola", which can be bought in *n* different shops in the city. It's known that the price of one bottle in the shop *i* is equal to *x**i* coins. Vasiliy plans to buy his favorite drink for *q* consecutive days. He knows, that on the *i*-th day he will be able to spent *m**i* coins. Now, for each of the days he want to know in how many different shops he can buy a bottle of "Beecola".
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of shops in the city that sell Vasiliy's favourite drink. The second line contains *n* integers *x**i* (1<=≤<=*x**i*<=≤<=100<=000) — prices of the bottles of the drink in the *i*-th shop. The third line contains a single integer *q* (1<=≤<=*q*<=≤<=100<=000) — the number of days Vasiliy plans to buy the drink. Then follow *q* lines each containing one integer *m**i* (1<=≤<=*m**i*<=≤<=109) — the number of coins Vasiliy can spent on the *i*-th day.
Print *q* integers. The *i*-th of them should be equal to the number of shops where Vasiliy will be able to buy a bottle of the drink on the *i*-th day.
[ "5\n3 10 8 6 11\n4\n1\n10\n3\n11\n" ]
[ "0\n4\n1\n5\n" ]
On the first day, Vasiliy won't be able to buy a drink in any of the shops. On the second day, Vasiliy can buy a drink in the shops 1, 2, 3 and 4. On the third day, Vasiliy can buy a drink only in the shop number 1. Finally, on the last day Vasiliy can buy a drink in any shop.
1,000
[ { "input": "5\n3 10 8 6 11\n4\n1\n10\n3\n11", "output": "0\n4\n1\n5" }, { "input": "5\n868 987 714 168 123\n10\n424\n192\n795\n873\n117\n914\n735\n158\n631\n471", "output": "2\n2\n3\n4\n0\n4\n3\n1\n2\n2" }, { "input": "3\n435 482 309\n7\n245\n241\n909\n745\n980\n29\n521", "output": "0\n0\n3\n3\n3\n0\n3" }, { "input": "1\n653\n9\n903\n980\n80\n770\n965\n874\n381\n657\n969", "output": "1\n1\n0\n1\n1\n1\n0\n1\n1" }, { "input": "12\n35345 58181 32223 84621 35905 73863 99537 30666 67771 39229 36847 29038\n23\n55052824\n82504840\n35160556\n78141700\n73401989\n86305919\n39430705\n31939373\n23501765\n4406029\n61436920\n14295390\n34275309\n28028753\n85724689\n70158847\n2396455\n66994588\n84024224\n30175981\n65622319\n76517111\n76605341", "output": "12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12" }, { "input": "4\n698 193 1584 76192\n4\n553640\n310518\n274280\n429192", "output": "4\n4\n4\n4" }, { "input": "1\n1\n1\n1000000000", "output": "1" }, { "input": "1\n1\n1\n100005", "output": "1" }, { "input": "3\n1 2 3\n1\n100005", "output": "3" }, { "input": "2\n1 2\n3\n100004\n100005\n100006", "output": "2\n2\n2" }, { "input": "3\n1 1 1\n1\n1", "output": "3" }, { "input": "1\n1\n1\n1", "output": "1" }, { "input": "3\n1 2 3\n1\n100000", "output": "3" }, { "input": "5\n1 1 1 1 10\n2\n1\n10", "output": "4\n5" }, { "input": "5\n3 10 8 6 11\n1\n10000000", "output": "5" } ]
1,694,973,674
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
15
0
import bisect n = int(input()) a = input().split() for i in range(len(a)): a[i] = int(a[i]) t = int(input()) a.sort() print(a) for _ in range(t): q = int(input()) ans = bisect.bisect_right(a, q) print(ans)
Title: Interesting drink Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasiliy likes to rest after a hard work, so you may often meet him in some bar nearby. As all programmers do, he loves the famous drink "Beecola", which can be bought in *n* different shops in the city. It's known that the price of one bottle in the shop *i* is equal to *x**i* coins. Vasiliy plans to buy his favorite drink for *q* consecutive days. He knows, that on the *i*-th day he will be able to spent *m**i* coins. Now, for each of the days he want to know in how many different shops he can buy a bottle of "Beecola". Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of shops in the city that sell Vasiliy's favourite drink. The second line contains *n* integers *x**i* (1<=≤<=*x**i*<=≤<=100<=000) — prices of the bottles of the drink in the *i*-th shop. The third line contains a single integer *q* (1<=≤<=*q*<=≤<=100<=000) — the number of days Vasiliy plans to buy the drink. Then follow *q* lines each containing one integer *m**i* (1<=≤<=*m**i*<=≤<=109) — the number of coins Vasiliy can spent on the *i*-th day. Output Specification: Print *q* integers. The *i*-th of them should be equal to the number of shops where Vasiliy will be able to buy a bottle of the drink on the *i*-th day. Demo Input: ['5\n3 10 8 6 11\n4\n1\n10\n3\n11\n'] Demo Output: ['0\n4\n1\n5\n'] Note: On the first day, Vasiliy won't be able to buy a drink in any of the shops. On the second day, Vasiliy can buy a drink in the shops 1, 2, 3 and 4. On the third day, Vasiliy can buy a drink only in the shop number 1. Finally, on the last day Vasiliy can buy a drink in any shop.
```python import bisect n = int(input()) a = input().split() for i in range(len(a)): a[i] = int(a[i]) t = int(input()) a.sort() print(a) for _ in range(t): q = int(input()) ans = bisect.bisect_right(a, q) print(ans) ```
0
281
A
Word Capitalization
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word. Note, that during capitalization all the letters except the first one remains unchanged.
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
Output the given word after capitalization.
[ "ApPLe\n", "konjac\n" ]
[ "ApPLe\n", "Konjac\n" ]
none
500
[ { "input": "ApPLe", "output": "ApPLe" }, { "input": "konjac", "output": "Konjac" }, { "input": "a", "output": "A" }, { "input": "A", "output": "A" }, { "input": "z", "output": "Z" }, { "input": "ABACABA", "output": "ABACABA" }, { "input": "xYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX", "output": "XYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX" }, { "input": "rZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO", "output": "RZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO" }, { "input": "hDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD", "output": "HDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD" }, { "input": "qUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW", "output": "QUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW" }, { "input": "kHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL", "output": "KHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL" }, { "input": "aHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC", "output": "AHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC" }, { "input": "sLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN", "output": "SLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN" }, { "input": "iRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE", "output": "IRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE" }, { "input": "cRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP", "output": "CRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP" }, { "input": "wVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG", "output": "WVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG" }, { "input": "kEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV", "output": "KEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV" }, { "input": "eIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI", "output": "EIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI" }, { "input": "uOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX", "output": "UOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX" }, { "input": "lZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ", "output": "LZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ" }, { "input": "P", "output": "P" }, { "input": "Xyzzy", "output": "Xyzzy" }, { "input": "Zzz", "output": "Zzz" }, { "input": "Zp", "output": "Zp" } ]
1,697,896,473
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
60
0
a=input() b=a[0] c=b.upper() print(c,a[1:-1],a[-1],sep='')
Title: Word Capitalization Time Limit: None seconds Memory Limit: None megabytes Problem Description: Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word. Note, that during capitalization all the letters except the first one remains unchanged. Input Specification: A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103. Output Specification: Output the given word after capitalization. Demo Input: ['ApPLe\n', 'konjac\n'] Demo Output: ['ApPLe\n', 'Konjac\n'] Note: none
```python a=input() b=a[0] c=b.upper() print(c,a[1:-1],a[-1],sep='') ```
0
69
A
Young Physicist
PROGRAMMING
1,000
[ "implementation", "math" ]
A. Young Physicist
2
256
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
[ "3\n4 1 7\n-2 4 -1\n1 -5 -3\n", "3\n3 -1 7\n-5 2 -4\n2 -1 -3\n" ]
[ "NO", "YES" ]
none
500
[ { "input": "3\n4 1 7\n-2 4 -1\n1 -5 -3", "output": "NO" }, { "input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3", "output": "YES" }, { "input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41", "output": "NO" }, { "input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33", "output": "NO" }, { "input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7", "output": "NO" }, { "input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38", "output": "NO" }, { "input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6", "output": "YES" }, { "input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0", "output": "YES" }, { "input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0", "output": "YES" }, { "input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0", "output": "YES" }, { "input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0", "output": "YES" }, { "input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0", "output": "YES" }, { "input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87", "output": "YES" }, { "input": "3\n1 2 3\n3 2 1\n0 0 0", "output": "NO" }, { "input": "2\n5 -23 12\n0 0 0", "output": "NO" }, { "input": "1\n0 0 0", "output": "YES" }, { "input": "1\n1 -2 0", "output": "NO" }, { "input": "2\n-23 77 -86\n23 -77 86", "output": "YES" }, { "input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82", "output": "YES" }, { "input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0", "output": "YES" }, { "input": "3\n96 49 -12\n2 -66 28\n-98 17 -16", "output": "YES" }, { "input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0", "output": "YES" }, { "input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53", "output": "YES" }, { "input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1", "output": "YES" }, { "input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0", "output": "YES" }, { "input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0", "output": "YES" }, { "input": "3\n0 2 -2\n1 -1 3\n-3 0 0", "output": "NO" } ]
1,591,278,256
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
80
218
0
n = int(input()) a = [] for i in range(n): m = input().split() a.append(m) s = 0 for i in range(n): a[i] = list(map(int,a[i])) s = s + sum(a[i]) if s == 0: print('YES') else: print("NO")
Title: Young Physicist Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. Input Specification: The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). Output Specification: Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. Demo Input: ['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n'] Demo Output: ['NO', 'YES'] Note: none
```python n = int(input()) a = [] for i in range(n): m = input().split() a.append(m) s = 0 for i in range(n): a[i] = list(map(int,a[i])) s = s + sum(a[i]) if s == 0: print('YES') else: print("NO") ```
0
992
A
Nastya and an Array
PROGRAMMING
800
[ "implementation", "sortings" ]
null
null
Nastya owns too many arrays now, so she wants to delete the least important of them. However, she discovered that this array is magic! Nastya now knows that the array has the following properties: - In one second we can add an arbitrary (possibly negative) integer to all elements of the array that are not equal to zero. - When all elements of the array become equal to zero, the array explodes. Nastya is always busy, so she wants to explode the array as fast as possible. Compute the minimum time in which the array can be exploded.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the size of the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=105<=≤<=*a**i*<=≤<=105) — the elements of the array.
Print a single integer — the minimum number of seconds needed to make all elements of the array equal to zero.
[ "5\n1 1 1 1 1\n", "3\n2 0 -1\n", "4\n5 -6 -5 1\n" ]
[ "1\n", "2\n", "4\n" ]
In the first example you can add  - 1 to all non-zero elements in one second and make them equal to zero. In the second example you can add  - 2 on the first second, then the array becomes equal to [0, 0,  - 3]. On the second second you can add 3 to the third (the only non-zero) element.
500
[ { "input": "5\n1 1 1 1 1", "output": "1" }, { "input": "3\n2 0 -1", "output": "2" }, { "input": "4\n5 -6 -5 1", "output": "4" }, { "input": "1\n0", "output": "0" }, { "input": "2\n21794 -79194", "output": "2" }, { "input": "3\n-63526 95085 -5239", "output": "3" }, { "input": "3\n0 53372 -20572", "output": "2" }, { "input": "13\n-2075 -32242 27034 -37618 -96962 82203 64846 48249 -71761 28908 -21222 -61370 46899", "output": "13" }, { "input": "5\n806 0 1308 1954 683", "output": "4" }, { "input": "8\n-26 0 -249 -289 -126 -206 288 -11", "output": "7" }, { "input": "10\n2 2 2 1 2 -1 0 2 -1 1", "output": "3" }, { "input": "1\n8", "output": "1" }, { "input": "3\n0 0 0", "output": "0" }, { "input": "10\n1 2 3 4 5 6 7 8 9 10", "output": "10" }, { "input": "5\n2 0 -1 0 0", "output": "2" }, { "input": "2\n0 0", "output": "0" }, { "input": "5\n0 0 0 0 0", "output": "0" }, { "input": "2\n1 0", "output": "1" }, { "input": "2\n-1 0", "output": "1" }, { "input": "4\n0 0 0 0", "output": "0" }, { "input": "8\n10 9 -1 0 0 3 2 3", "output": "5" }, { "input": "5\n5 0 1 2 3", "output": "4" }, { "input": "3\n1 1 0", "output": "1" }, { "input": "1\n-1", "output": "1" }, { "input": "5\n1 2 0 0 0", "output": "2" }, { "input": "5\n1 0 0 0 0", "output": "1" }, { "input": "5\n4 5 6 0 0", "output": "3" }, { "input": "4\n-1 0 0 1", "output": "2" }, { "input": "5\n3 0 0 4 5", "output": "3" }, { "input": "3\n0 0 2", "output": "1" }, { "input": "3\n1 0 0", "output": "1" }, { "input": "4\n0 0 0 4", "output": "1" }, { "input": "5\n-1 0 0 0 0", "output": "1" }, { "input": "2\n0 1", "output": "1" }, { "input": "3\n1 2 3", "output": "3" }, { "input": "1\n5", "output": "1" }, { "input": "10\n0 0 0 0 0 1 2 3 0 0", "output": "3" }, { "input": "4\n0 1 2 3", "output": "3" }, { "input": "3\n0 1 2", "output": "2" }, { "input": "4\n2 0 0 -1", "output": "2" } ]
1,636,576,413
2,147,483,647
PyPy 3-64
TIME_LIMIT_EXCEEDED
TESTS
5
1,000
42,496,000
n=int(input()) a=list(map(int, input().split())) a.sort() count=0 while sum(a)!=0: for i in range(len(a)): if a[i]!=0: d=a[i] break for j in range(len(a)): if a[j]!=0: a[j]-=d count+=1 print(count)
Title: Nastya and an Array Time Limit: None seconds Memory Limit: None megabytes Problem Description: Nastya owns too many arrays now, so she wants to delete the least important of them. However, she discovered that this array is magic! Nastya now knows that the array has the following properties: - In one second we can add an arbitrary (possibly negative) integer to all elements of the array that are not equal to zero. - When all elements of the array become equal to zero, the array explodes. Nastya is always busy, so she wants to explode the array as fast as possible. Compute the minimum time in which the array can be exploded. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the size of the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=105<=≤<=*a**i*<=≤<=105) — the elements of the array. Output Specification: Print a single integer — the minimum number of seconds needed to make all elements of the array equal to zero. Demo Input: ['5\n1 1 1 1 1\n', '3\n2 0 -1\n', '4\n5 -6 -5 1\n'] Demo Output: ['1\n', '2\n', '4\n'] Note: In the first example you can add  - 1 to all non-zero elements in one second and make them equal to zero. In the second example you can add  - 2 on the first second, then the array becomes equal to [0, 0,  - 3]. On the second second you can add 3 to the third (the only non-zero) element.
```python n=int(input()) a=list(map(int, input().split())) a.sort() count=0 while sum(a)!=0: for i in range(len(a)): if a[i]!=0: d=a[i] break for j in range(len(a)): if a[j]!=0: a[j]-=d count+=1 print(count) ```
0
600
B
Queries about less or equal elements
PROGRAMMING
1,300
[ "binary search", "data structures", "sortings", "two pointers" ]
null
null
You are given two arrays of integers *a* and *b*. For each element of the second array *b**j* you should find the number of elements in array *a* that are less than or equal to the value *b**j*.
The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=2·105) — the sizes of arrays *a* and *b*. The second line contains *n* integers — the elements of array *a* (<=-<=109<=≤<=*a**i*<=≤<=109). The third line contains *m* integers — the elements of array *b* (<=-<=109<=≤<=*b**j*<=≤<=109).
Print *m* integers, separated by spaces: the *j*-th of which is equal to the number of such elements in array *a* that are less than or equal to the value *b**j*.
[ "5 4\n1 3 5 7 9\n6 4 2 8\n", "5 5\n1 2 1 2 5\n3 1 4 1 5\n" ]
[ "3 2 1 4\n", "4 2 4 2 5\n" ]
none
0
[ { "input": "5 4\n1 3 5 7 9\n6 4 2 8", "output": "3 2 1 4" }, { "input": "5 5\n1 2 1 2 5\n3 1 4 1 5", "output": "4 2 4 2 5" }, { "input": "1 1\n-1\n-2", "output": "0" }, { "input": "1 1\n-80890826\n686519510", "output": "1" }, { "input": "11 11\n237468511 -779187544 -174606592 193890085 404563196 -71722998 -617934776 170102710 -442808289 109833389 953091341\n994454001 322957429 216874735 -606986750 -455806318 -663190696 3793295 41395397 -929612742 -787653860 -684738874", "output": "11 9 8 2 2 1 5 5 0 0 1" }, { "input": "20 22\n858276994 -568758442 -918490847 -983345984 -172435358 389604931 200224783 486556113 413281867 -258259500 -627945379 -584563643 444685477 -602481243 -370745158 965672503 630955806 -626138773 -997221880 633102929\n-61330638 -977252080 -212144219 385501731 669589742 954357160 563935906 584468977 -895883477 405774444 853372186 186056475 -964575261 -952431965 632332084 -388829939 -23011650 310957048 -770695392 977376693 321435214 199223897", "output": "11 2 10 12 18 19 16 16 3 13 18 11 2 2 17 8 11 12 3 20 12 11" }, { "input": "5 9\n1 3 5 7 9\n1 2 3 4 5 6 7 8 9", "output": "1 1 2 2 3 3 4 4 5" }, { "input": "22 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22\n1", "output": "1" }, { "input": "5 1\n1 3 3 3 5\n3", "output": "4" }, { "input": "4 5\n1 1 1 4\n1 5 5 4 3", "output": "3 4 4 4 3" }, { "input": "5 4\n0 5 5 5 6\n5 1 6 3", "output": "4 1 5 1" }, { "input": "1 3\n0\n-1 0 1", "output": "0 1 1" }, { "input": "96 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1", "output": "96" }, { "input": "7 1\n1 2 3 4 5 6 7\n1", "output": "1" }, { "input": "13 13\n-1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000\n-1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000", "output": "7 13 7 13 7 13 7 13 7 13 7 13 7" }, { "input": "9 5\n1 2 3 4 5 6 7 8 9\n1 2 3 4 5", "output": "1 2 3 4 5" }, { "input": "3 8\n1 1 1\n1 1 1 1 1 1 1 1", "output": "3 3 3 3 3 3 3 3" }, { "input": "1 1\n-11111\n-5938", "output": "1" }, { "input": "1 1\n1\n400000009", "output": "1" }, { "input": "1 1\n1\n300000009", "output": "1" }, { "input": "1 1\n1\n200000009", "output": "1" }, { "input": "1 1\n1\n200000003", "output": "1" } ]
1,674,436,567
2,147,483,647
Python 3
COMPILATION_ERROR
TESTS
0
0
0
#include <iostream> #include <algorithm> using namespace std; #define int long long int int32_t main(){ int a, b; cin >> a >> b; int pri[a], sec[b]; for (int i = 0; i < a; i++) { cin >> pri[i]; } for (int i = 0; i < b; i++) { cin >> sec[i]; } sort(pri, pri+a); for(int i=0; i<b;i++){ int esquerda = 0, direita = a - 1, meio=0; while(esquerda <= direita){ meio = (esquerda + direita)/2; if (meio+1 < a){ if(sec[i] >= pri[meio] and sec[i] < pri[meio+1]){ meio+=1; break; } else if(pri[meio] > sec[i]){ direita = meio - 1; } else{ esquerda = meio + 1; } } else{ break; } } if(sec[i] >= pri[a-1]){ meio = a; } cout << meio << ' '; } }
Title: Queries about less or equal elements Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given two arrays of integers *a* and *b*. For each element of the second array *b**j* you should find the number of elements in array *a* that are less than or equal to the value *b**j*. Input Specification: The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=2·105) — the sizes of arrays *a* and *b*. The second line contains *n* integers — the elements of array *a* (<=-<=109<=≤<=*a**i*<=≤<=109). The third line contains *m* integers — the elements of array *b* (<=-<=109<=≤<=*b**j*<=≤<=109). Output Specification: Print *m* integers, separated by spaces: the *j*-th of which is equal to the number of such elements in array *a* that are less than or equal to the value *b**j*. Demo Input: ['5 4\n1 3 5 7 9\n6 4 2 8\n', '5 5\n1 2 1 2 5\n3 1 4 1 5\n'] Demo Output: ['3 2 1 4\n', '4 2 4 2 5\n'] Note: none
```python #include <iostream> #include <algorithm> using namespace std; #define int long long int int32_t main(){ int a, b; cin >> a >> b; int pri[a], sec[b]; for (int i = 0; i < a; i++) { cin >> pri[i]; } for (int i = 0; i < b; i++) { cin >> sec[i]; } sort(pri, pri+a); for(int i=0; i<b;i++){ int esquerda = 0, direita = a - 1, meio=0; while(esquerda <= direita){ meio = (esquerda + direita)/2; if (meio+1 < a){ if(sec[i] >= pri[meio] and sec[i] < pri[meio+1]){ meio+=1; break; } else if(pri[meio] > sec[i]){ direita = meio - 1; } else{ esquerda = meio + 1; } } else{ break; } } if(sec[i] >= pri[a-1]){ meio = a; } cout << meio << ' '; } } ```
-1
228
A
Is your horseshoe on the other hoof?
PROGRAMMING
800
[ "implementation" ]
null
null
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers.
Print a single integer — the minimum number of horseshoes Valera needs to buy.
[ "1 7 3 3\n", "7 7 7 7\n" ]
[ "1\n", "3\n" ]
none
500
[ { "input": "1 7 3 3", "output": "1" }, { "input": "7 7 7 7", "output": "3" }, { "input": "81170865 673572653 756938629 995577259", "output": "0" }, { "input": "3491663 217797045 522540872 715355328", "output": "0" }, { "input": "251590420 586975278 916631563 586975278", "output": "1" }, { "input": "259504825 377489979 588153796 377489979", "output": "1" }, { "input": "652588203 931100304 931100304 652588203", "output": "2" }, { "input": "391958720 651507265 391958720 651507265", "output": "2" }, { "input": "90793237 90793237 90793237 90793237", "output": "3" }, { "input": "551651653 551651653 551651653 551651653", "output": "3" }, { "input": "156630260 609654355 668943582 973622757", "output": "0" }, { "input": "17061017 110313588 434481173 796661222", "output": "0" }, { "input": "24975422 256716298 337790533 690960249", "output": "0" }, { "input": "255635360 732742923 798648949 883146723", "output": "0" }, { "input": "133315691 265159773 734556507 265159773", "output": "1" }, { "input": "28442865 741657755 978106882 978106882", "output": "1" }, { "input": "131245479 174845575 497483467 131245479", "output": "1" }, { "input": "139159884 616215581 958341883 616215581", "output": "1" }, { "input": "147784432 947653080 947653080 947653080", "output": "2" }, { "input": "94055790 756126496 756126496 94055790", "output": "2" }, { "input": "240458500 511952208 240458500 511952208", "output": "2" }, { "input": "681828506 972810624 972810624 681828506", "output": "2" }, { "input": "454961014 454961014 454961014 454961014", "output": "3" }, { "input": "915819430 915819430 915819430 915819430", "output": "3" }, { "input": "671645142 671645142 671645142 671645142", "output": "3" }, { "input": "132503558 132503558 132503558 132503558", "output": "3" }, { "input": "5 5 999999 6", "output": "1" }, { "input": "1 1 2 5", "output": "1" }, { "input": "2 1 2 3", "output": "1" }, { "input": "1 1 3 5", "output": "1" }, { "input": "1 1 3 3", "output": "2" }, { "input": "2 2 2 1", "output": "2" }, { "input": "3 1 1 1", "output": "2" }, { "input": "1 2 2 2", "output": "2" } ]
1,693,194,355
2,147,483,647
Python 3
OK
TESTS
34
92
0
a = list(map(int, input().split())) A = [] b = 0 for i in range(4): b = a.count(a[i]) A.append(b) if A.count(2) == 4: print(2) else: print(max(A)-1)
Title: Is your horseshoe on the other hoof? Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party. Input Specification: The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers. Output Specification: Print a single integer — the minimum number of horseshoes Valera needs to buy. Demo Input: ['1 7 3 3\n', '7 7 7 7\n'] Demo Output: ['1\n', '3\n'] Note: none
```python a = list(map(int, input().split())) A = [] b = 0 for i in range(4): b = a.count(a[i]) A.append(b) if A.count(2) == 4: print(2) else: print(max(A)-1) ```
3
748
B
Santa Claus and Keyboard Check
PROGRAMMING
1,500
[ "implementation", "strings" ]
null
null
Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be. In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard. You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once.
The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters.
If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes). Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct. If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair. Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes.
[ "helloworld\nehoolwlroz\n", "hastalavistababy\nhastalavistababy\n", "merrychristmas\nchristmasmerry\n" ]
[ "3\nh e\nl o\nd z\n", "0\n", "-1\n" ]
none
1,000
[ { "input": "helloworld\nehoolwlroz", "output": "3\nh e\nl o\nd z" }, { "input": "hastalavistababy\nhastalavistababy", "output": "0" }, { "input": "merrychristmas\nchristmasmerry", "output": "-1" }, { "input": "kusyvdgccw\nkusyvdgccw", "output": "0" }, { "input": "bbbbbabbab\naaaaabaaba", "output": "1\nb a" }, { "input": "zzzzzzzzzzzzzzzzzzzzz\nqwertyuiopasdfghjklzx", "output": "-1" }, { "input": "accdccdcdccacddbcacc\naccbccbcbccacbbdcacc", "output": "1\nd b" }, { "input": "giiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd\ngiiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd", "output": "0" }, { "input": "gndggadlmdefgejidmmcglbjdcmglncfmbjjndjcibnjbabfab\nfihffahlmhogfojnhmmcflkjhcmflicgmkjjihjcnkijkakgak", "output": "5\ng f\nn i\nd h\ne o\nb k" }, { "input": "ijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc\nijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc", "output": "0" }, { "input": "ab\naa", "output": "-1" }, { "input": "a\nz", "output": "1\na z" }, { "input": "zz\nzy", "output": "-1" }, { "input": "as\ndf", "output": "2\na d\ns f" }, { "input": "abc\nbca", "output": "-1" }, { "input": "rtfg\nrftg", "output": "1\nt f" }, { "input": "y\ny", "output": "0" }, { "input": "qwertyuiopasdfghjklzx\nzzzzzzzzzzzzzzzzzzzzz", "output": "-1" }, { "input": "qazwsxedcrfvtgbyhnujmik\nqwertyuiasdfghjkzxcvbnm", "output": "-1" }, { "input": "aaaaaa\nabcdef", "output": "-1" }, { "input": "qwerty\nffffff", "output": "-1" }, { "input": "dofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh\ndofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh", "output": "0" }, { "input": "acdbccddadbcbabbebbaebdcedbbcebeaccecdabadeabeecbacacdcbccedeadadedeccedecdaabcedccccbbcbcedcaccdede\ndcbaccbbdbacadaaeaadeabcebaaceaedccecbdadbedaeecadcdcbcaccebedbdbebeccebecbddacebccccaacacebcdccbebe", "output": "-1" }, { "input": "bacccbbacabbcaacbbba\nbacccbbacabbcaacbbba", "output": "0" }, { "input": "dbadbddddb\nacbacaaaac", "output": "-1" }, { "input": "dacbdbbbdd\nadbdadddaa", "output": "-1" }, { "input": "bbbbcbcbbc\ndaddbabddb", "output": "-1" }, { "input": "dddddbcdbd\nbcbbbdacdb", "output": "-1" }, { "input": "cbadcbcdaa\nabbbababbb", "output": "-1" }, { "input": "dmkgadidjgdjikgkehhfkhgkeamhdkfemikkjhhkdjfaenmkdgenijinamngjgkmgmmedfdehkhdigdnnkhmdkdindhkhndnakdgdhkdefagkedndnijekdmkdfedkhekgdkhgkimfeakdhhhgkkff\nbdenailbmnbmlcnehjjkcgnehadgickhdlecmggcimkahfdeinhflmlfadfnmncdnddhbkbhgejblnbffcgdbeilfigegfifaebnijeihkanehififlmhcbdcikhieghenbejneldkhaebjggncckk", "output": "-1" }, { "input": "acbbccabaa\nabbbbbabaa", "output": "-1" }, { "input": "ccccaccccc\naaaabaaaac", "output": "-1" }, { "input": "acbacacbbb\nacbacacbbb", "output": "0" }, { "input": "abbababbcc\nccccccccbb", "output": "-1" }, { "input": "jbcbbjiifdcbeajgdeabddbfcecafejddcigfcaedbgicjihifgbahjihcjefgabgbccdiibfjgacehbbdjceacdbdeaiibaicih\nhhihhhddcfihddhjfddhffhcididcdhffidjciddfhjdihdhdcjhdhhdhihdcjdhjhiifddhchjdidhhhfhiddifhfddddhddidh", "output": "-1" }, { "input": "ahaeheedefeehahfefhjhhedheeeedhehhfhdejdhffhhejhhhejadhefhahhadjjhdhheeeehfdaffhhefehhhefhhhhehehjda\neiefbdfgdhffieihfhjajifgjddffgifjbhigfagjhhjicaijbdaegidhiejiegaabgjidcfcjhgehhjjchcbjjdhjbiidjdjage", "output": "-1" }, { "input": "fficficbidbcbfaddifbffdbbiaccbbciiaidbcbbiadcccbccbbaibabcbbdbcibcciibiccfifbiiicadibbiaafadacdficbc\nddjhdghbgcbhadeccjdbddcbfjeiiaaigjejcaiabgechiiahibfejbeahafcfhjbihgjfgihdgdagjjhecjafjeedecehcdjhai", "output": "-1" }, { "input": "z\nz", "output": "0" }, { "input": "a\nz", "output": "1\na z" }, { "input": "z\na", "output": "1\nz a" }, { "input": "aa\nzz", "output": "1\na z" }, { "input": "az\nza", "output": "1\na z" }, { "input": "aa\nza", "output": "-1" }, { "input": "za\nzz", "output": "-1" }, { "input": "aa\nab", "output": "-1" }, { "input": "hehe\nheeh", "output": "-1" }, { "input": "bd\ncc", "output": "-1" }, { "input": "he\nhh", "output": "-1" }, { "input": "hee\nheh", "output": "-1" }, { "input": "aa\nac", "output": "-1" }, { "input": "ab\naa", "output": "-1" }, { "input": "hello\nehlol", "output": "-1" }, { "input": "ac\naa", "output": "-1" }, { "input": "aaabbb\nbbbaab", "output": "-1" }, { "input": "aa\nfa", "output": "-1" }, { "input": "hg\nee", "output": "-1" }, { "input": "helloworld\nehoolwlrow", "output": "-1" }, { "input": "abb\nbab", "output": "-1" }, { "input": "aaa\naae", "output": "-1" }, { "input": "aba\nbaa", "output": "-1" }, { "input": "aa\nba", "output": "-1" }, { "input": "da\naa", "output": "-1" }, { "input": "aaa\naab", "output": "-1" }, { "input": "xy\nzz", "output": "-1" } ]
1,482,658,134
1,434
Python 3
WRONG_ANSWER
PRETESTS
0
46
4,812,800
correct = input() incorrect = input() compliance = dict()#to incorrect from correct other = dict()#to correct from incorrect for i in range(ord('a'), ord('z') + 1): compliance[chr(i)] = chr(i) other[chr(i)] = chr(i) #print(i) can = True for i in range(len(correct)): if compliance[correct[i]] == incorrect[i]: continue if compliance[correct[i]] == correct[i]: if other[incorrect[i]] != incorrect[i]: can = False break other[incorrect[i]] = correct[i] compliance[correct[i]] = incorrect[i] else: can = False break if not can: print(-1) else: ans = set() for i in range(ord('a'), ord('z') + 1): if compliance[chr(i)] != chr(i): a, b = i, ord(compliance[chr(i)]) ans.add((chr(min(a, b)), chr(max(a, b)))) print(len(ans)) for x in ans: print(*x) print(compliance) print("\n\n") print(other)
Title: Santa Claus and Keyboard Check Time Limit: None seconds Memory Limit: None megabytes Problem Description: Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be. In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard. You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once. Input Specification: The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters. Output Specification: If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes). Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct. If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair. Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes. Demo Input: ['helloworld\nehoolwlroz\n', 'hastalavistababy\nhastalavistababy\n', 'merrychristmas\nchristmasmerry\n'] Demo Output: ['3\nh e\nl o\nd z\n', '0\n', '-1\n'] Note: none
```python correct = input() incorrect = input() compliance = dict()#to incorrect from correct other = dict()#to correct from incorrect for i in range(ord('a'), ord('z') + 1): compliance[chr(i)] = chr(i) other[chr(i)] = chr(i) #print(i) can = True for i in range(len(correct)): if compliance[correct[i]] == incorrect[i]: continue if compliance[correct[i]] == correct[i]: if other[incorrect[i]] != incorrect[i]: can = False break other[incorrect[i]] = correct[i] compliance[correct[i]] = incorrect[i] else: can = False break if not can: print(-1) else: ans = set() for i in range(ord('a'), ord('z') + 1): if compliance[chr(i)] != chr(i): a, b = i, ord(compliance[chr(i)]) ans.add((chr(min(a, b)), chr(max(a, b)))) print(len(ans)) for x in ans: print(*x) print(compliance) print("\n\n") print(other) ```
0
926
H
Endless Roses Most Beautiful
PROGRAMMING
2,200
[]
null
null
Arkady decided to buy roses for his girlfriend. A flower shop has white, orange and red roses, and the total amount of them is *n*. Arkady thinks that red roses are not good together with white roses, so he won't buy a bouquet containing both red and white roses. Also, Arkady won't buy a bouquet where all roses have the same color. Arkady wants to buy exactly *k* roses. For each rose in the shop he knows its beauty and color: the beauty of the *i*-th rose is *b**i*, and its color is *c**i* ('W' for a white rose, 'O' for an orange rose and 'R' for a red rose). Compute the maximum possible total beauty of a bouquet of *k* roses satisfying the constraints above or determine that it is not possible to make such a bouquet.
The first line contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=200<=000) — the number of roses in the show and the number of roses Arkady wants to buy. The second line contains a sequence of integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=10<=000), where *b**i* equals the beauty of the *i*-th rose. The third line contains a string *c* of length *n*, consisting of uppercase English letters 'W', 'O' and 'R', where *c**i* denotes the color of the *i*-th rose: 'W' denotes white, 'O'  — orange, 'R' — red.
Print the maximum possible total beauty of a bouquet of *k* roses that satisfies the constraints above. If it is not possible to make a single such bouquet, print -1.
[ "5 3\n4 3 4 1 6\nRROWW\n", "5 2\n10 20 14 20 11\nRRRRR\n", "11 5\n5 6 3 2 3 4 7 5 4 5 6\nRWOORWORROW\n" ]
[ "11\n", "-1\n", "28\n" ]
In the first example Arkady wants to buy 3 roses. He can, for example, buy both red roses (their indices are 1 and 2, and their total beauty is 7) and the only orange rose (its index is 3, its beauty is 4). This way the total beauty of the bouquet is 11. In the second example Arkady can not buy a bouquet because all roses have the same color.
0
[ { "input": "5 3\n4 3 4 1 6\nRROWW", "output": "11" }, { "input": "5 2\n10 20 14 20 11\nRRRRR", "output": "-1" }, { "input": "11 5\n5 6 3 2 3 4 7 5 4 5 6\nRWOORWORROW", "output": "28" }, { "input": "15 10\n8560 6244 9607 5137 7187 3217 5527 9919 282 8748 3529 6110 5767 521 3393\nOWRWOORWRORWWRO", "output": "64282" }, { "input": "10 4\n1208 5835 2637 5827 3722 6837 3499 6438 43 5333\nWRRWRWRWRW", "output": "-1" }, { "input": "13 3\n9675 8988 5499 6356 5083 6067 5580 4580 6735 3617 9536 8218 3265\nRRWRRROWRWWWW", "output": "24243" }, { "input": "13 7\n8543 3460 1282 3956 8203 762 6059 9361 4427 8868 5849 3439 8891\nWWOOOOWOWWRWO", "output": "54352" }, { "input": "30 15\n7926 577 5009 7237 4395 3239 8994 4429 8126 2925 139 320 4442 3397 1292 2800 9505 6043 5946 8058 4031 6871 4689 1977 73 440 5320 5290 4707 387\nOOWOWWORRWOWORWRRRRWORROOWWROW", "output": "91633" }, { "input": "1 1\n100\nO", "output": "-1" }, { "input": "1 1\n1059\nO", "output": "-1" }, { "input": "2 2\n9907 4483\nOO", "output": "-1" }, { "input": "1 1\n6750\nW", "output": "-1" }, { "input": "2 2\n144 174\nOW", "output": "318" }, { "input": "3 2\n776 4797 9449\nOWO", "output": "14246" }, { "input": "2 2\n3486 8968\nWW", "output": "-1" }, { "input": "3 2\n2330 2140 3440\nWOW", "output": "5580" }, { "input": "4 2\n1175 8186 4321 1810\nWWOO", "output": "12507" }, { "input": "1 1\n6479\nR", "output": "-1" }, { "input": "2 2\n8512 9903\nOR", "output": "18415" }, { "input": "3 2\n7035 5046 7357\nOOR", "output": "14392" }, { "input": "2 2\n6442 4558\nWR", "output": "-1" }, { "input": "3 2\n9700 698 2122\nOWR", "output": "11822" }, { "input": "4 3\n254 4510 2194 9543\nWOOR", "output": "16247" }, { "input": "3 2\n517 6744 2364\nRWW", "output": "-1" }, { "input": "4 2\n2884 2918 8629 9905\nRWOW", "output": "18534" }, { "input": "5 2\n7882 871 789 4432 7664\nOWORW", "output": "15546" }, { "input": "2 2\n2926 8428\nRR", "output": "-1" }, { "input": "3 2\n7926 1770 3255\nORR", "output": "11181" }, { "input": "4 2\n2578 7910 108 3809\nOROR", "output": "10488" }, { "input": "3 2\n5920 9303 7542\nWRR", "output": "-1" }, { "input": "4 2\n5909 4286 5444 6473\nOWRR", "output": "12382" }, { "input": "5 2\n96 6627 8780 3764 970\nRROWO", "output": "15407" }, { "input": "4 2\n6657 1489 9138 4273\nRRWW", "output": "-1" }, { "input": "5 2\n1598 6700 334 6455 9292\nWORWR", "output": "15992" }, { "input": "6 2\n6231 9178 9845 5932 5477 6659\nORRWOW", "output": "16076" }, { "input": "1 1\n780\nO", "output": "-1" }, { "input": "1 1\n3214\nW", "output": "-1" }, { "input": "2 2\n8455 5432\nOW", "output": "13887" }, { "input": "1 1\n6555\nR", "output": "-1" }, { "input": "2 2\n1120 5670\nOR", "output": "6790" }, { "input": "3 2\n8884 4514 1673\nORW", "output": "13398" }, { "input": "1 1\n6908\nO", "output": "-1" }, { "input": "1 1\n3934\nW", "output": "-1" }, { "input": "2 2\n8856 7299\nWO", "output": "16155" }, { "input": "1 1\n2683\nR", "output": "-1" }, { "input": "2 2\n9094 5772\nRO", "output": "14866" }, { "input": "3 2\n518 9438 7938\nWOR", "output": "17376" }, { "input": "10 4\n9513 754 5917 1337 2337 1387 3499 9873 9138 7647\nWROWWOWWRO", "output": "32950" }, { "input": "20 5\n3747 219 7826 7713 6886 466 1136 7069 1234 7556 3657 6017 9965 2847 6880 362 3179 4676 5934 4913\nWWWOWOWOWOROWOWWWOWW", "output": "40129" } ]
1,521,305,509
4,609
Python 3
WRONG_ANSWER
TESTS
9
265
20,582,400
N = 10000 def main(): n, k = map(int, input().split()) b = list(map(int, input().split())) c = input() k -= 1 if (k == 0): return -1 flowers = [[0 for i in range(N + 1)] for i in range(3)] RO = [0 for i in range(N + 1)] OW = [0 for i in range(N + 1)] orange = -1 for i in range(n): if (c[i] == 'R'): RO[b[i]] += 1 if (c[i] == 'O'): orange = max(orange, b[i]) RO[b[i]] += 1 OW[b[i]] += 1 if (c[i] == 'W'): OW[b[i]] += 1 RO[orange] -= 1 OW[orange] -= 1 if (orange == -1): return -1 ans = -1 ans1 = 0 k1 = k for i in range(N, -1, -1): ans1 += min(k, RO[i]) * i k1 -= RO[i] if (k1 <= 0): k1 = 0 break if (k1 == 0): ans = max(ans, ans1 + orange) ans2 = 0 k2 = k for i in range(N, -1, -1): ans2 += min(k, OW[i]) * i k2 -= OW[i] if (k2 <= 0): k2 = 0 break if (k2 == 0): ans = max(ans, ans2 + orange) return ans print(main())
Title: Endless Roses Most Beautiful Time Limit: None seconds Memory Limit: None megabytes Problem Description: Arkady decided to buy roses for his girlfriend. A flower shop has white, orange and red roses, and the total amount of them is *n*. Arkady thinks that red roses are not good together with white roses, so he won't buy a bouquet containing both red and white roses. Also, Arkady won't buy a bouquet where all roses have the same color. Arkady wants to buy exactly *k* roses. For each rose in the shop he knows its beauty and color: the beauty of the *i*-th rose is *b**i*, and its color is *c**i* ('W' for a white rose, 'O' for an orange rose and 'R' for a red rose). Compute the maximum possible total beauty of a bouquet of *k* roses satisfying the constraints above or determine that it is not possible to make such a bouquet. Input Specification: The first line contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=200<=000) — the number of roses in the show and the number of roses Arkady wants to buy. The second line contains a sequence of integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=10<=000), where *b**i* equals the beauty of the *i*-th rose. The third line contains a string *c* of length *n*, consisting of uppercase English letters 'W', 'O' and 'R', where *c**i* denotes the color of the *i*-th rose: 'W' denotes white, 'O'  — orange, 'R' — red. Output Specification: Print the maximum possible total beauty of a bouquet of *k* roses that satisfies the constraints above. If it is not possible to make a single such bouquet, print -1. Demo Input: ['5 3\n4 3 4 1 6\nRROWW\n', '5 2\n10 20 14 20 11\nRRRRR\n', '11 5\n5 6 3 2 3 4 7 5 4 5 6\nRWOORWORROW\n'] Demo Output: ['11\n', '-1\n', '28\n'] Note: In the first example Arkady wants to buy 3 roses. He can, for example, buy both red roses (their indices are 1 and 2, and their total beauty is 7) and the only orange rose (its index is 3, its beauty is 4). This way the total beauty of the bouquet is 11. In the second example Arkady can not buy a bouquet because all roses have the same color.
```python N = 10000 def main(): n, k = map(int, input().split()) b = list(map(int, input().split())) c = input() k -= 1 if (k == 0): return -1 flowers = [[0 for i in range(N + 1)] for i in range(3)] RO = [0 for i in range(N + 1)] OW = [0 for i in range(N + 1)] orange = -1 for i in range(n): if (c[i] == 'R'): RO[b[i]] += 1 if (c[i] == 'O'): orange = max(orange, b[i]) RO[b[i]] += 1 OW[b[i]] += 1 if (c[i] == 'W'): OW[b[i]] += 1 RO[orange] -= 1 OW[orange] -= 1 if (orange == -1): return -1 ans = -1 ans1 = 0 k1 = k for i in range(N, -1, -1): ans1 += min(k, RO[i]) * i k1 -= RO[i] if (k1 <= 0): k1 = 0 break if (k1 == 0): ans = max(ans, ans1 + orange) ans2 = 0 k2 = k for i in range(N, -1, -1): ans2 += min(k, OW[i]) * i k2 -= OW[i] if (k2 <= 0): k2 = 0 break if (k2 == 0): ans = max(ans, ans2 + orange) return ans print(main()) ```
0
895
A
Pizza Separation
PROGRAMMING
1,200
[ "brute force", "implementation" ]
null
null
Students Vasya and Petya are studying at the BSU (Byteland State University). At one of the breaks they decided to order a pizza. In this problem pizza is a circle of some radius. The pizza was delivered already cut into *n* pieces. The *i*-th piece is a sector of angle equal to *a**i*. Vasya and Petya want to divide all pieces of pizza into two continuous sectors in such way that the difference between angles of these sectors is minimal. Sector angle is sum of angles of all pieces in it. Pay attention, that one of sectors can be empty.
The first line contains one integer *n* (1<=≤<=*n*<=≤<=360)  — the number of pieces into which the delivered pizza was cut. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=360)  — the angles of the sectors into which the pizza was cut. The sum of all *a**i* is 360.
Print one integer  — the minimal difference between angles of sectors that will go to Vasya and Petya.
[ "4\n90 90 90 90\n", "3\n100 100 160\n", "1\n360\n", "4\n170 30 150 10\n" ]
[ "0\n", "40\n", "360\n", "0\n" ]
In first sample Vasya can take 1 and 2 pieces, Petya can take 3 and 4 pieces. Then the answer is |(90 + 90) - (90 + 90)| = 0. In third sample there is only one piece of pizza that can be taken by only one from Vasya and Petya. So the answer is |360 - 0| = 360. In fourth sample Vasya can take 1 and 4 pieces, then Petya will take 2 and 3 pieces. So the answer is |(170 + 10) - (30 + 150)| = 0. Picture explaning fourth sample: <img class="tex-graphics" src="https://espresso.codeforces.com/4bb3450aca241f92fedcba5479bf1b6d22cf813d.png" style="max-width: 100.0%;max-height: 100.0%;"/> Both red and green sectors consist of two adjacent pieces of pizza. So Vasya can take green sector, then Petya will take red sector.
500
[ { "input": "4\n90 90 90 90", "output": "0" }, { "input": "3\n100 100 160", "output": "40" }, { "input": "1\n360", "output": "360" }, { "input": "4\n170 30 150 10", "output": "0" }, { "input": "5\n10 10 10 10 320", "output": "280" }, { "input": "8\n45 45 45 45 45 45 45 45", "output": "0" }, { "input": "3\n120 120 120", "output": "120" }, { "input": "5\n110 90 70 50 40", "output": "40" }, { "input": "2\n170 190", "output": "20" }, { "input": "15\n25 25 25 25 25 25 25 25 25 25 25 25 25 25 10", "output": "10" }, { "input": "5\n30 60 180 60 30", "output": "0" }, { "input": "2\n359 1", "output": "358" }, { "input": "5\n100 100 30 100 30", "output": "40" }, { "input": "5\n36 34 35 11 244", "output": "128" }, { "input": "5\n96 94 95 71 4", "output": "18" }, { "input": "2\n85 275", "output": "190" }, { "input": "3\n281 67 12", "output": "202" }, { "input": "5\n211 113 25 9 2", "output": "62" }, { "input": "13\n286 58 6 1 1 1 1 1 1 1 1 1 1", "output": "212" }, { "input": "15\n172 69 41 67 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "20\n226 96 2 20 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "92" }, { "input": "50\n148 53 32 11 4 56 8 2 5 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "3\n1 1 358", "output": "356" }, { "input": "20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 341", "output": "322" }, { "input": "33\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 328", "output": "296" }, { "input": "70\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 291", "output": "222" }, { "input": "130\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 231", "output": "102" }, { "input": "200\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 161", "output": "0" }, { "input": "222\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 139", "output": "0" }, { "input": "10\n8 3 11 4 1 10 10 1 8 304", "output": "248" }, { "input": "12\n8 7 7 3 11 2 10 1 10 8 10 283", "output": "206" }, { "input": "13\n10 8 9 10 5 9 4 1 10 11 1 7 275", "output": "190" }, { "input": "14\n1 6 3 11 9 5 9 8 5 6 7 3 7 280", "output": "200" }, { "input": "15\n10 11 5 4 11 5 4 1 5 4 5 5 9 6 275", "output": "190" }, { "input": "30\n8 7 5 8 3 7 2 4 3 8 11 3 9 11 2 4 1 4 5 6 11 5 8 3 6 3 11 2 11 189", "output": "18" }, { "input": "70\n5 3 6 8 9 2 8 9 11 5 2 8 9 11 7 6 6 9 7 11 7 6 3 8 2 4 4 8 4 3 2 2 3 5 6 5 11 2 7 7 5 8 10 5 2 1 10 9 4 10 7 1 8 10 9 1 5 1 1 1 2 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "29\n2 10 1 5 7 2 9 11 9 9 10 8 4 11 2 5 4 1 4 9 6 10 8 3 1 3 8 9 189", "output": "18" }, { "input": "35\n3 4 11 4 4 2 3 4 3 9 7 10 2 7 8 3 11 3 6 4 6 7 11 10 8 7 6 7 2 8 5 3 2 2 168", "output": "0" }, { "input": "60\n4 10 3 10 6 3 11 8 11 9 3 5 9 2 6 5 6 9 4 10 1 1 3 7 2 10 5 5 3 10 5 2 1 2 9 11 11 9 11 4 11 7 5 6 10 9 3 4 7 8 7 3 6 7 8 5 1 1 1 5", "output": "0" }, { "input": "71\n3 11 8 1 10 1 7 9 6 4 11 10 11 2 4 1 11 7 9 10 11 4 8 7 11 3 8 4 1 8 4 2 9 9 7 10 10 9 5 7 9 7 2 1 7 6 5 11 5 9 4 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "63\n2 11 5 8 7 9 9 8 10 5 9 10 11 8 10 2 3 5 3 7 5 10 2 9 4 8 1 8 5 9 7 7 1 8 7 7 9 10 10 10 8 7 7 2 2 8 9 7 10 8 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "81\n5 8 7 11 2 7 1 1 5 8 7 2 3 11 4 9 7 6 4 4 2 1 1 7 9 4 1 8 3 1 4 10 7 9 9 8 11 3 4 3 10 8 6 4 7 2 4 3 6 11 11 10 7 10 2 10 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "47\n5 3 7 4 2 7 8 1 9 10 5 11 10 7 7 5 1 3 2 11 3 8 6 1 6 10 8 3 2 10 5 6 8 6 9 7 10 9 7 4 8 11 10 1 5 11 68", "output": "0" }, { "input": "100\n5 8 9 3 2 3 9 8 11 10 4 8 1 1 1 1 6 5 10 9 5 3 7 7 2 11 10 2 3 2 2 8 7 3 5 5 10 9 2 5 10 6 7 7 4 7 7 8 2 8 9 9 2 4 1 1 3 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "120\n9 11 3 7 3 7 9 1 10 7 11 4 1 5 3 5 6 3 1 11 8 8 11 7 3 5 1 9 1 7 10 10 10 10 9 5 4 8 2 8 2 1 4 5 3 11 3 5 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "200\n7 7 9 8 2 8 5 8 3 9 7 10 2 9 11 8 11 7 5 2 6 3 11 9 5 1 10 2 1 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "220\n3 2 8 1 3 5 5 11 1 5 2 6 9 2 2 6 8 10 7 1 3 2 10 9 10 10 4 10 9 5 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "6\n27 15 28 34 41 215", "output": "70" }, { "input": "7\n41 38 41 31 22 41 146", "output": "14" }, { "input": "8\n24 27 34 23 29 23 30 170", "output": "20" }, { "input": "9\n11 11 20 20 33 32 35 26 172", "output": "6" }, { "input": "10\n36 13 28 13 33 34 23 25 34 121", "output": "0" }, { "input": "11\n19 37 13 41 37 15 32 12 19 35 100", "output": "10" }, { "input": "12\n37 25 34 38 21 24 34 38 11 29 28 41", "output": "2" }, { "input": "13\n24 40 20 26 25 29 39 29 35 28 19 18 28", "output": "2" }, { "input": "14\n11 21 40 19 28 34 13 16 23 30 34 22 25 44", "output": "4" }, { "input": "3\n95 91 174", "output": "12" }, { "input": "4\n82 75 78 125", "output": "46" }, { "input": "6\n87 75 88 94 15 1", "output": "4" }, { "input": "10\n27 52 58 64 45 64 1 19 2 28", "output": "12" }, { "input": "50\n14 12 11 8 1 6 11 6 7 8 4 11 4 5 7 3 5 4 7 24 10 2 3 4 6 13 2 1 8 7 5 13 10 8 5 20 1 2 23 7 14 3 4 4 2 8 8 2 6 1", "output": "0" }, { "input": "100\n3 3 4 3 3 6 3 2 8 2 13 3 1 1 2 1 3 4 1 7 1 2 2 6 3 2 10 3 1 2 5 6 2 3 3 2 3 11 8 3 2 6 1 3 3 4 7 7 2 2 1 2 6 3 3 2 3 1 3 8 2 6 4 2 1 12 2 2 2 1 4 1 4 1 3 1 3 1 5 2 6 6 7 1 2 3 2 4 4 2 5 9 8 2 4 6 5 1 1 3", "output": "0" }, { "input": "150\n1 5 1 2 2 2 1 4 2 2 2 3 1 2 1 2 2 2 2 1 2 2 2 1 5 3 4 1 3 4 5 2 4 2 1 2 2 1 1 2 3 2 4 2 2 3 3 1 1 5 2 3 2 1 9 2 1 1 2 1 4 1 1 3 2 2 2 1 2 2 2 1 3 3 4 2 2 1 3 3 3 1 4 3 4 1 2 2 1 1 1 2 2 5 4 1 1 1 2 1 2 3 2 2 6 3 3 3 1 2 1 1 2 8 2 2 4 3 4 5 3 1 4 2 2 2 2 1 4 4 1 1 2 2 4 9 6 3 1 1 2 1 3 4 1 3 2 2 2 1", "output": "0" }, { "input": "200\n1 2 1 3 1 3 1 2 1 4 6 1 2 2 2 2 1 1 1 1 3 2 1 2 2 2 1 2 2 2 2 1 1 1 3 2 3 1 1 2 1 1 2 1 1 1 1 1 1 2 1 2 2 4 1 3 1 2 1 2 2 1 2 1 3 1 1 2 2 1 1 1 1 2 4 1 2 1 1 1 2 1 3 1 1 3 1 2 2 4 1 1 2 1 2 1 2 2 2 2 1 1 2 1 2 1 3 3 1 1 1 2 1 3 3 1 2 1 3 1 3 3 1 2 2 1 4 1 2 2 1 2 2 4 2 5 1 2 2 1 2 1 2 1 5 2 1 2 2 1 2 4 1 2 2 4 2 3 2 3 1 2 1 1 2 2 2 1 1 2 1 4 1 2 1 1 2 1 2 3 1 1 1 2 2 3 1 3 2 2 3 1 2 1 2 1 1 2 1 2", "output": "0" }, { "input": "5\n35 80 45 100 100", "output": "40" }, { "input": "4\n90 179 90 1", "output": "2" }, { "input": "5\n50 50 20 160 80", "output": "0" }, { "input": "5\n30 175 30 5 120", "output": "10" }, { "input": "4\n170 30 10 150", "output": "20" }, { "input": "6\n90 30 90 30 90 30", "output": "60" }, { "input": "4\n70 80 110 100", "output": "20" }, { "input": "7\n35 45 70 100 10 10 90", "output": "0" }, { "input": "6\n50 90 10 90 20 100", "output": "20" }, { "input": "6\n10 155 162 1 26 6", "output": "18" }, { "input": "7\n80 90 80 45 10 10 45", "output": "20" }, { "input": "4\n18 36 162 144", "output": "36" }, { "input": "5\n20 50 50 160 80", "output": "40" }, { "input": "5\n10 30 140 20 160", "output": "0" }, { "input": "6\n90 80 60 50 40 40", "output": "20" }, { "input": "9\n40 20 20 20 20 20 20 40 160", "output": "40" }, { "input": "4\n90 54 90 126", "output": "72" }, { "input": "4\n150 170 30 10", "output": "20" }, { "input": "8\n130 12 13 85 41 67 5 7", "output": "26" }, { "input": "7\n70 170 20 10 30 30 30", "output": "20" }, { "input": "8\n100 100 50 50 15 15 15 15", "output": "40" }, { "input": "4\n100 70 80 110", "output": "20" }, { "input": "5\n160 130 40 20 10", "output": "20" }, { "input": "4\n20 149 151 40", "output": "22" }, { "input": "4\n100 10 100 150", "output": "60" }, { "input": "6\n19 64 105 168 1 3", "output": "16" }, { "input": "8\n10 10 70 70 90 90 10 10", "output": "0" } ]
1,516,306,691
2,147,483,647
Python 3
OK
TESTS
93
93
5,632,000
n = int(input()) a = list(map(int, input().split())) r = 180 for i in range(n): s = 0 for j in range(i,n): s += a[j] r = min(abs(s - 180), r) print(2 * r)
Title: Pizza Separation Time Limit: None seconds Memory Limit: None megabytes Problem Description: Students Vasya and Petya are studying at the BSU (Byteland State University). At one of the breaks they decided to order a pizza. In this problem pizza is a circle of some radius. The pizza was delivered already cut into *n* pieces. The *i*-th piece is a sector of angle equal to *a**i*. Vasya and Petya want to divide all pieces of pizza into two continuous sectors in such way that the difference between angles of these sectors is minimal. Sector angle is sum of angles of all pieces in it. Pay attention, that one of sectors can be empty. Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=360)  — the number of pieces into which the delivered pizza was cut. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=360)  — the angles of the sectors into which the pizza was cut. The sum of all *a**i* is 360. Output Specification: Print one integer  — the minimal difference between angles of sectors that will go to Vasya and Petya. Demo Input: ['4\n90 90 90 90\n', '3\n100 100 160\n', '1\n360\n', '4\n170 30 150 10\n'] Demo Output: ['0\n', '40\n', '360\n', '0\n'] Note: In first sample Vasya can take 1 and 2 pieces, Petya can take 3 and 4 pieces. Then the answer is |(90 + 90) - (90 + 90)| = 0. In third sample there is only one piece of pizza that can be taken by only one from Vasya and Petya. So the answer is |360 - 0| = 360. In fourth sample Vasya can take 1 and 4 pieces, then Petya will take 2 and 3 pieces. So the answer is |(170 + 10) - (30 + 150)| = 0. Picture explaning fourth sample: <img class="tex-graphics" src="https://espresso.codeforces.com/4bb3450aca241f92fedcba5479bf1b6d22cf813d.png" style="max-width: 100.0%;max-height: 100.0%;"/> Both red and green sectors consist of two adjacent pieces of pizza. So Vasya can take green sector, then Petya will take red sector.
```python n = int(input()) a = list(map(int, input().split())) r = 180 for i in range(n): s = 0 for j in range(i,n): s += a[j] r = min(abs(s - 180), r) print(2 * r) ```
3
466
A
Cheap Travel
PROGRAMMING
1,200
[ "implementation" ]
null
null
Ann has recently started commuting by subway. We know that a one ride subway ticket costs *a* rubles. Besides, Ann found out that she can buy a special ticket for *m* rides (she can buy it several times). It costs *b* rubles. Ann did the math; she will need to use subway *n* times. Help Ann, tell her what is the minimum sum of money she will have to spend to make *n* rides?
The single line contains four space-separated integers *n*, *m*, *a*, *b* (1<=≤<=*n*,<=*m*,<=*a*,<=*b*<=≤<=1000) — the number of rides Ann has planned, the number of rides covered by the *m* ride ticket, the price of a one ride ticket and the price of an *m* ride ticket.
Print a single integer — the minimum sum in rubles that Ann will need to spend.
[ "6 2 1 2\n", "5 2 2 3\n" ]
[ "6\n", "8\n" ]
In the first sample one of the optimal solutions is: each time buy a one ride ticket. There are other optimal solutions. For example, buy three *m* ride tickets.
500
[ { "input": "6 2 1 2", "output": "6" }, { "input": "5 2 2 3", "output": "8" }, { "input": "10 3 5 1", "output": "4" }, { "input": "1000 1 1000 1000", "output": "1000000" }, { "input": "1000 3 1000 1000", "output": "334000" }, { "input": "1 1 1 1", "output": "1" }, { "input": "10 2 1 1", "output": "5" }, { "input": "1 1000 1 2", "output": "1" }, { "input": "1 1000 3 2", "output": "2" }, { "input": "10 3 1 2", "output": "7" }, { "input": "995 1 2 1", "output": "995" }, { "input": "556 2 16 15", "output": "4170" }, { "input": "477 2 16 14", "output": "3346" }, { "input": "101 110 1 100", "output": "100" }, { "input": "9 3 3 10", "output": "27" }, { "input": "100 8 10 1", "output": "13" }, { "input": "6 4 1 3", "output": "5" }, { "input": "8 5 2 8", "output": "14" }, { "input": "1000 2 1 1000", "output": "1000" } ]
1,694,104,118
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
31
0
a=list(map(int, input().split())) if a[0]*a[2]<(a[0]*a[3])/a[2]: print(a[0]*a[2]) else: print(round((a[0]*a[3])/a[2]))
Title: Cheap Travel Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ann has recently started commuting by subway. We know that a one ride subway ticket costs *a* rubles. Besides, Ann found out that she can buy a special ticket for *m* rides (she can buy it several times). It costs *b* rubles. Ann did the math; she will need to use subway *n* times. Help Ann, tell her what is the minimum sum of money she will have to spend to make *n* rides? Input Specification: The single line contains four space-separated integers *n*, *m*, *a*, *b* (1<=≤<=*n*,<=*m*,<=*a*,<=*b*<=≤<=1000) — the number of rides Ann has planned, the number of rides covered by the *m* ride ticket, the price of a one ride ticket and the price of an *m* ride ticket. Output Specification: Print a single integer — the minimum sum in rubles that Ann will need to spend. Demo Input: ['6 2 1 2\n', '5 2 2 3\n'] Demo Output: ['6\n', '8\n'] Note: In the first sample one of the optimal solutions is: each time buy a one ride ticket. There are other optimal solutions. For example, buy three *m* ride tickets.
```python a=list(map(int, input().split())) if a[0]*a[2]<(a[0]*a[3])/a[2]: print(a[0]*a[2]) else: print(round((a[0]*a[3])/a[2])) ```
0
467
A
George and Accommodation
PROGRAMMING
800
[ "implementation" ]
null
null
George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory. George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms. The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity.
Print a single integer — the number of rooms where George and Alex can move in.
[ "3\n1 1\n2 2\n3 3\n", "3\n1 10\n0 10\n10 10\n" ]
[ "0\n", "2\n" ]
none
500
[ { "input": "3\n1 1\n2 2\n3 3", "output": "0" }, { "input": "3\n1 10\n0 10\n10 10", "output": "2" }, { "input": "2\n36 67\n61 69", "output": "2" }, { "input": "3\n21 71\n10 88\n43 62", "output": "3" }, { "input": "3\n1 2\n2 3\n3 4", "output": "0" }, { "input": "10\n0 10\n0 20\n0 30\n0 40\n0 50\n0 60\n0 70\n0 80\n0 90\n0 100", "output": "10" }, { "input": "13\n14 16\n30 31\n45 46\n19 20\n15 17\n66 67\n75 76\n95 97\n29 30\n37 38\n0 2\n36 37\n8 9", "output": "4" }, { "input": "19\n66 67\n97 98\n89 91\n67 69\n67 68\n18 20\n72 74\n28 30\n91 92\n27 28\n75 77\n17 18\n74 75\n28 30\n16 18\n90 92\n9 11\n22 24\n52 54", "output": "12" }, { "input": "15\n55 57\n95 97\n57 59\n34 36\n50 52\n96 98\n39 40\n13 15\n13 14\n74 76\n47 48\n56 58\n24 25\n11 13\n67 68", "output": "10" }, { "input": "17\n68 69\n47 48\n30 31\n52 54\n41 43\n33 35\n38 40\n56 58\n45 46\n92 93\n73 74\n61 63\n65 66\n37 39\n67 68\n77 78\n28 30", "output": "8" }, { "input": "14\n64 66\n43 44\n10 12\n76 77\n11 12\n25 27\n87 88\n62 64\n39 41\n58 60\n10 11\n28 29\n57 58\n12 14", "output": "7" }, { "input": "38\n74 76\n52 54\n78 80\n48 49\n40 41\n64 65\n28 30\n6 8\n49 51\n68 70\n44 45\n57 59\n24 25\n46 48\n49 51\n4 6\n63 64\n76 78\n57 59\n18 20\n63 64\n71 73\n88 90\n21 22\n89 90\n65 66\n89 91\n96 98\n42 44\n1 1\n74 76\n72 74\n39 40\n75 76\n29 30\n48 49\n87 89\n27 28", "output": "22" }, { "input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "26\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2", "output": "0" }, { "input": "68\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2", "output": "68" }, { "input": "7\n0 1\n1 5\n2 4\n3 5\n4 6\n5 6\n6 8", "output": "5" }, { "input": "1\n0 0", "output": "0" }, { "input": "1\n100 100", "output": "0" }, { "input": "44\n0 8\n1 11\n2 19\n3 5\n4 29\n5 45\n6 6\n7 40\n8 19\n9 22\n10 18\n11 26\n12 46\n13 13\n14 27\n15 48\n16 25\n17 20\n18 29\n19 27\n20 45\n21 39\n22 29\n23 39\n24 42\n25 37\n26 52\n27 36\n28 43\n29 35\n30 38\n31 70\n32 47\n33 38\n34 61\n35 71\n36 51\n37 71\n38 59\n39 77\n40 70\n41 80\n42 77\n43 73", "output": "42" }, { "input": "3\n1 3\n2 7\n8 9", "output": "2" }, { "input": "53\n0 1\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53", "output": "0" }, { "input": "55\n0 0\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54", "output": "0" }, { "input": "51\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 62\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 82\n55 68\n55 70\n55 63\n55 55\n55 55\n55 55\n55 75\n55 75\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 82\n55 99\n55 60", "output": "12" }, { "input": "14\n1 1\n1 1\n1 55\n1 16\n1 1\n1 1\n1 55\n1 62\n1 53\n1 26\n1 1\n1 36\n1 2\n1 3", "output": "8" } ]
1,697,955,273
2,147,483,647
PyPy 3-64
OK
TESTS
27
62
0
# 467A - George and Accommodation number_of_rooms = int(input()) i = 0 rooms_they_can_move_into = 0 while i < number_of_rooms: response = input() new_l = response.split(" ") if (int(new_l[0]) + 2) <= int(new_l[1]): rooms_they_can_move_into +=1 i += 1 print(rooms_they_can_move_into)
Title: George and Accommodation Time Limit: None seconds Memory Limit: None megabytes Problem Description: George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory. George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms. The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity. Output Specification: Print a single integer — the number of rooms where George and Alex can move in. Demo Input: ['3\n1 1\n2 2\n3 3\n', '3\n1 10\n0 10\n10 10\n'] Demo Output: ['0\n', '2\n'] Note: none
```python # 467A - George and Accommodation number_of_rooms = int(input()) i = 0 rooms_they_can_move_into = 0 while i < number_of_rooms: response = input() new_l = response.split(" ") if (int(new_l[0]) + 2) <= int(new_l[1]): rooms_they_can_move_into +=1 i += 1 print(rooms_they_can_move_into) ```
3
330
B
Road Construction
PROGRAMMING
1,300
[ "constructive algorithms", "graphs" ]
null
null
A country has *n* cities. Initially, there is no road in the country. One day, the king decides to construct some roads connecting pairs of cities. Roads can be traversed either way. He wants those roads to be constructed in such a way that it is possible to go from each city to any other city by traversing at most two roads. You are also given *m* pairs of cities — roads cannot be constructed between these pairs of cities. Your task is to construct the minimum number of roads that still satisfy the above conditions. The constraints will guarantee that this is always possible.
The first line consists of two integers *n* and *m* . Then *m* lines follow, each consisting of two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*), which means that it is not possible to construct a road connecting cities *a**i* and *b**i*. Consider the cities are numbered from 1 to *n*. It is guaranteed that every pair of cities will appear at most once in the input.
You should print an integer *s*: the minimum number of roads that should be constructed, in the first line. Then *s* lines should follow, each consisting of two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=*a**i*<=≠<=*b**i*), which means that a road should be constructed between cities *a**i* and *b**i*. If there are several solutions, you may print any of them.
[ "4 1\n1 3\n" ]
[ "3\n1 2\n4 2\n2 3\n" ]
This is one possible solution of the example: These are examples of wrong solutions:
1,000
[ { "input": "4 1\n1 3", "output": "3\n1 2\n4 2\n2 3" }, { "input": "1000 0", "output": "999\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..." }, { "input": "484 11\n414 97\n414 224\n444 414\n414 483\n414 399\n414 484\n414 189\n414 246\n414 115\n89 414\n14 414", "output": "483\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..." }, { "input": "150 3\n112 30\n61 45\n37 135", "output": "149\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..." }, { "input": "34 7\n10 28\n10 19\n10 13\n24 10\n10 29\n20 10\n10 26", "output": "33\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34" }, { "input": "1000 48\n816 885\n576 357\n878 659\n610 647\n37 670\n192 184\n393 407\n598 160\n547 995\n177 276\n788 44\n14 184\n604 281\n176 97\n176 293\n10 57\n852 579\n223 669\n313 260\n476 691\n667 22\n851 792\n411 489\n526 66\n233 566\n35 396\n964 815\n672 123\n148 210\n163 339\n379 598\n382 675\n132 955\n221 441\n253 490\n856 532\n135 119\n276 319\n525 835\n996 270\n92 778\n434 369\n351 927\n758 983\n798 267\n272 830\n539 728\n166 26", "output": "999\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..." }, { "input": "534 0", "output": "533\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..." }, { "input": "226 54\n80 165\n2 53\n191 141\n107 207\n95 196\n61 82\n42 168\n118 94\n205 182\n172 160\n84 224\n113 143\n122 93\n37 209\n176 32\n56 83\n151 81\n70 190\n99 171\n68 204\n212 48\n4 67\n116 7\n206 199\n105 62\n158 51\n178 147\n17 129\n22 47\n72 162\n188 77\n24 111\n184 26\n175 128\n110 89\n139 120\n127 92\n121 39\n217 75\n145 69\n20 161\n30 220\n222 154\n54 46\n21 87\n144 185\n164 115\n73 202\n173 35\n9 132\n74 180\n137 5\n157 117\n31 177", "output": "225\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..." }, { "input": "84 3\n39 19\n55 73\n42 43", "output": "83\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84" }, { "input": "207 35\n34 116\n184 5\n90 203\n12 195\n138 101\n40 150\n189 109\n115 91\n93 201\n106 18\n51 187\n139 197\n168 130\n182 64\n31 42\n86 107\n158 111\n159 132\n119 191\n53 127\n81 13\n153 112\n38 2\n87 84\n121 82\n120 22\n21 177\n151 202\n23 58\n68 192\n29 46\n105 70\n8 167\n56 54\n149 15", "output": "206\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..." }, { "input": "91 37\n50 90\n26 82\n61 1\n50 17\n51 73\n45 9\n39 53\n78 35\n12 45\n43 47\n83 20\n9 59\n18 48\n68 31\n47 33\n10 25\n15 78\n5 3\n73 65\n77 4\n62 31\n73 3\n53 7\n29 58\n52 14\n56 20\n6 87\n71 16\n17 19\n77 86\n1 50\n74 79\n15 54\n55 80\n13 77\n4 69\n24 69", "output": "90\n2 1\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n2 11\n2 12\n2 13\n2 14\n2 15\n2 16\n2 17\n2 18\n2 19\n2 20\n2 21\n2 22\n2 23\n2 24\n2 25\n2 26\n2 27\n2 28\n2 29\n2 30\n2 31\n2 32\n2 33\n2 34\n2 35\n2 36\n2 37\n2 38\n2 39\n2 40\n2 41\n2 42\n2 43\n2 44\n2 45\n2 46\n2 47\n2 48\n2 49\n2 50\n2 51\n2 52\n2 53\n2 54\n2 55\n2 56\n2 57\n2 58\n2 59\n2 60\n2 61\n2 62\n2 63\n2 64\n2 65\n2 66\n2 67\n2 68\n2 69\n2 70\n2 71\n2 72\n2 73\n2 74\n2 75\n2 76\n2 77\n2 78\n2 79\n2 80\n2 81\n2 82\n2 83\n2 84\n2 85\n2 86\n2 87\n..." }, { "input": "226 54\n197 107\n181 146\n218 115\n36 169\n199 196\n116 93\n152 75\n213 164\n156 95\n165 58\n90 42\n141 58\n203 221\n179 204\n186 69\n27 127\n76 189\n40 195\n111 29\n85 189\n45 88\n84 135\n82 186\n185 17\n156 217\n8 123\n179 112\n92 137\n114 89\n10 152\n132 24\n135 36\n61 218\n10 120\n155 102\n222 79\n150 92\n184 34\n102 180\n154 196\n171 9\n217 105\n84 207\n56 189\n152 179\n43 165\n115 209\n208 167\n52 14\n92 47\n197 95\n13 78\n222 138\n75 36", "output": "225\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..." }, { "input": "207 35\n154 79\n174 101\n189 86\n137 56\n66 23\n199 69\n18 28\n32 53\n13 179\n182 170\n199 12\n24 158\n105 133\n25 10\n40 162\n64 72\n108 9\n172 125\n43 190\n15 39\n128 150\n102 129\n90 97\n64 196\n70 123\n163 41\n12 126\n127 186\n107 23\n182 51\n29 46\n46 123\n89 35\n59 80\n206 171", "output": "206\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..." }, { "input": "84 0", "output": "83\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84" }, { "input": "226 54\n5 29\n130 29\n55 29\n19 29\n29 92\n29 38\n185 29\n29 150\n29 202\n29 25\n29 66\n184 29\n29 189\n177 29\n50 29\n87 29\n138 29\n29 48\n151 29\n125 29\n16 29\n42 29\n29 157\n90 29\n21 29\n29 45\n29 80\n29 67\n29 26\n29 173\n74 29\n29 193\n29 40\n172 29\n29 85\n29 102\n88 29\n29 182\n116 29\n180 29\n161 29\n10 29\n171 29\n144 29\n29 218\n190 29\n213 29\n29 71\n29 191\n29 160\n29 137\n29 58\n29 135\n127 29", "output": "225\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..." }, { "input": "207 35\n25 61\n188 61\n170 61\n113 61\n35 61\n61 177\n77 61\n61 39\n61 141\n116 61\n61 163\n30 61\n192 61\n19 61\n61 162\n61 133\n185 61\n8 61\n118 61\n61 115\n7 61\n61 105\n107 61\n61 11\n161 61\n61 149\n136 61\n82 61\n20 61\n151 61\n156 61\n12 61\n87 61\n61 205\n61 108", "output": "206\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..." }, { "input": "34 7\n11 32\n33 29\n17 16\n15 5\n13 25\n8 19\n20 4", "output": "33\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34" }, { "input": "43 21\n38 19\n43 8\n40 31\n3 14\n24 21\n12 17\n1 9\n5 27\n25 37\n11 6\n13 26\n16 22\n10 32\n36 7\n30 29\n42 35\n20 33\n4 23\n18 15\n41 34\n2 28", "output": "42\n39 1\n39 2\n39 3\n39 4\n39 5\n39 6\n39 7\n39 8\n39 9\n39 10\n39 11\n39 12\n39 13\n39 14\n39 15\n39 16\n39 17\n39 18\n39 19\n39 20\n39 21\n39 22\n39 23\n39 24\n39 25\n39 26\n39 27\n39 28\n39 29\n39 30\n39 31\n39 32\n39 33\n39 34\n39 35\n39 36\n39 37\n39 38\n39 40\n39 41\n39 42\n39 43" }, { "input": "34 7\n22 4\n5 25\n15 7\n5 9\n27 7\n34 21\n3 13", "output": "33\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34" }, { "input": "50 7\n19 37\n30 32\n43 20\n48 14\n30 29\n18 36\n9 46", "output": "49\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50" }, { "input": "41 12\n41 12\n29 13\n3 37\n2 20\n4 24\n27 6\n39 20\n28 41\n30 1\n35 9\n5 39\n12 31", "output": "40\n7 1\n7 2\n7 3\n7 4\n7 5\n7 6\n7 8\n7 9\n7 10\n7 11\n7 12\n7 13\n7 14\n7 15\n7 16\n7 17\n7 18\n7 19\n7 20\n7 21\n7 22\n7 23\n7 24\n7 25\n7 26\n7 27\n7 28\n7 29\n7 30\n7 31\n7 32\n7 33\n7 34\n7 35\n7 36\n7 37\n7 38\n7 39\n7 40\n7 41" }, { "input": "26 2\n22 1\n14 10", "output": "25\n2 1\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n2 11\n2 12\n2 13\n2 14\n2 15\n2 16\n2 17\n2 18\n2 19\n2 20\n2 21\n2 22\n2 23\n2 24\n2 25\n2 26" }, { "input": "7 3\n4 7\n4 6\n6 5", "output": "6\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7" }, { "input": "484 11\n459 166\n12 217\n14 231\n477 111\n365 225\n62 412\n221 223\n258 184\n266 404\n425 236\n83 269", "output": "483\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..." }, { "input": "50 24\n18 36\n11 18\n22 18\n18 47\n18 10\n45 18\n18 29\n13 18\n8 18\n18 30\n26 18\n18 6\n5 18\n18 7\n46 18\n50 18\n18 3\n18 32\n4 18\n18 24\n18 19\n23 18\n35 18\n31 18", "output": "49\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50" }, { "input": "7 3\n3 4\n7 3\n3 2", "output": "6\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7" }, { "input": "1 0", "output": "0" }, { "input": "2 0", "output": "1\n1 2" }, { "input": "4 1\n1 2", "output": "3\n3 1\n3 2\n3 4" }, { "input": "3 1\n1 2", "output": "2\n3 1\n3 2" }, { "input": "5 1\n1 5", "output": "4\n2 1\n2 3\n2 4\n2 5" } ]
1,589,042,587
2,147,483,647
PyPy 3
OK
TESTS
43
434
23,654,400
import math import time from collections import defaultdict,deque from sys import stdin,stdout from bisect import bisect_left,bisect_right n,m=map(int,input().split()) done=defaultdict(lambda:False) for _ in range(m): a,b=map(int,input().split()) done[a]=True done[b]=True for i in range(1,n+1): if(not done[i]): print(n-1) for j in range(1,n+1): if(j!=i): print(i,j) break
Title: Road Construction Time Limit: None seconds Memory Limit: None megabytes Problem Description: A country has *n* cities. Initially, there is no road in the country. One day, the king decides to construct some roads connecting pairs of cities. Roads can be traversed either way. He wants those roads to be constructed in such a way that it is possible to go from each city to any other city by traversing at most two roads. You are also given *m* pairs of cities — roads cannot be constructed between these pairs of cities. Your task is to construct the minimum number of roads that still satisfy the above conditions. The constraints will guarantee that this is always possible. Input Specification: The first line consists of two integers *n* and *m* . Then *m* lines follow, each consisting of two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*), which means that it is not possible to construct a road connecting cities *a**i* and *b**i*. Consider the cities are numbered from 1 to *n*. It is guaranteed that every pair of cities will appear at most once in the input. Output Specification: You should print an integer *s*: the minimum number of roads that should be constructed, in the first line. Then *s* lines should follow, each consisting of two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=*a**i*<=≠<=*b**i*), which means that a road should be constructed between cities *a**i* and *b**i*. If there are several solutions, you may print any of them. Demo Input: ['4 1\n1 3\n'] Demo Output: ['3\n1 2\n4 2\n2 3\n'] Note: This is one possible solution of the example: These are examples of wrong solutions:
```python import math import time from collections import defaultdict,deque from sys import stdin,stdout from bisect import bisect_left,bisect_right n,m=map(int,input().split()) done=defaultdict(lambda:False) for _ in range(m): a,b=map(int,input().split()) done[a]=True done[b]=True for i in range(1,n+1): if(not done[i]): print(n-1) for j in range(1,n+1): if(j!=i): print(i,j) break ```
3
883
E
Field of Wonders
PROGRAMMING
1,500
[ "implementation", "strings" ]
null
null
Polycarpus takes part in the "Field of Wonders" TV show. The participants of the show have to guess a hidden word as fast as possible. Initially all the letters of the word are hidden. The game consists of several turns. At each turn the participant tells a letter and the TV show host responds if there is such letter in the word or not. If there is such letter then the host reveals all such letters. For example, if the hidden word is "abacaba" and the player tells the letter "a", the host will reveal letters at all positions, occupied by "a": 1, 3, 5 and 7 (positions are numbered from left to right starting from 1). Polycarpus knows *m* words of exactly the same length as the hidden word. The hidden word is also known to him and appears as one of these *m* words. At current moment a number of turns have already been made and some letters (possibly zero) of the hidden word are already revealed. Previously Polycarp has told exactly the letters which are currently revealed. It is Polycarpus' turn. He wants to tell a letter in such a way, that the TV show host will assuredly reveal at least one more letter. Polycarpus cannot tell the letters, which are already revealed. Your task is to help Polycarpus and find out the number of letters he can tell so that the show host will assuredly reveal at least one of the remaining letters.
The first line contains one integer *n* (1<=≤<=*n*<=≤<=50) — the length of the hidden word. The following line describes already revealed letters. It contains the string of length *n*, which consists of lowercase Latin letters and symbols "*". If there is a letter at some position, then this letter was already revealed. If the position contains symbol "*", then the letter at this position has not been revealed yet. It is guaranteed, that at least one letter is still closed. The third line contains an integer *m* (1<=≤<=*m*<=≤<=1000) — the number of words of length *n*, which Polycarpus knows. The following *m* lines contain the words themselves — *n*-letter strings of lowercase Latin letters. All words are distinct. It is guaranteed that the hidden word appears as one of the given *m* words. Before the current move Polycarp has told exactly the letters which are currently revealed.
Output the single integer — the number of letters Polycarpus can tell so that the TV show host definitely reveals at least one more letter. It is possible that this number is zero.
[ "4\na**d\n2\nabcd\nacbd\n", "5\nlo*er\n2\nlover\nloser\n", "3\na*a\n2\naaa\naba\n" ]
[ "2\n", "0\n", "1\n" ]
In the first example Polycarpus can tell letters "b" and "c", which assuredly will be revealed. The second example contains no letters which can be told as it is not clear, which of the letters "v" or "s" is located at the third position of the hidden word. In the third example Polycarpus exactly knows that the hidden word is "aba", because in case it was "aaa", then the second letter "a" would have already been revealed in one of previous turns.
0
[ { "input": "4\na**d\n2\nabcd\nacbd", "output": "2" }, { "input": "5\nlo*er\n2\nlover\nloser", "output": "0" }, { "input": "3\na*a\n2\naaa\naba", "output": "1" }, { "input": "1\n*\n1\na", "output": "1" }, { "input": "1\n*\n1\nz", "output": "1" }, { "input": "1\n*\n2\na\nz", "output": "0" }, { "input": "2\n**\n1\naa", "output": "1" }, { "input": "2\n**\n1\nfx", "output": "2" }, { "input": "2\n**\n2\nfx\nab", "output": "0" }, { "input": "2\n**\n2\nfx\naf", "output": "1" }, { "input": "2\na*\n2\naa\nab", "output": "1" }, { "input": "4\na*b*\n2\nabbc\nadbd", "output": "1" }, { "input": "4\na*b*\n3\nabbc\nadbd\nacbe", "output": "0" }, { "input": "4\na*b*\n3\nabbc\nadbd\nacbd", "output": "1" }, { "input": "3\n***\n2\naaa\nbbb", "output": "0" }, { "input": "3\n***\n2\naab\nabb", "output": "2" }, { "input": "3\n*a*\n4\naaa\ncac\naab\nbaa", "output": "1" }, { "input": "42\n*****o*******t********************oo******\n10\nvcrccobltkeidtxhsxhccaslkjhfyeqsetoowaemso\nuimjsoxifamvctkgqmrwhyjrgmlydczzqjoobnnwch\nuvmjsoqizfavctkxemrpaycngmlyemzzqjoobszwbh\nusmjsoviskzvctkljmrlmylugmlydfzzqvoobzawgh\nfeqweodinkhiatqmfokaxwcmlmbmvskssyookgcrax\ntackfosjhxeqftkgjynbbedrczegtimuvooosypczy\nxanuvoeismzmctruyplxgmfcpyrpqopyctoozlquvg\nurmjsouirdrvctkepmrwjyaxgmlyzvzzqcoobjgwih\nuymjsogivzivctkydmrgwyavgmlyphzzquoobclwhh\nkodyeoyihylgrtrdwudrsyonmuhtxaqklcoolsaclu", "output": "18" }, { "input": "50\n***********************************o**************\n5\nwrubnrgpqmduhgxtlxymsmcaiimivvypkkeouspglhzkfbpzcu\nfrubkrgplrduhgjuuxdmsgeaiimavvypkkeousulbhnkebpzcu\nwrubkrgpdrduhgfanxdmsufaiimgvvypkkeouwvsshikhbpzcu\nvhyfvnnobcguishyvuswkaxhkesgatuvbkyodxdrvlwwifiimd\nwrubwrgpvaduhgfnqxtmsjqaiimcvvypkkeouiqpyhckkbpzcu", "output": "20" }, { "input": "10\n**********\n10\nmvsthotcmi\nhmivtctsmo\nmmcostthiv\ntmomihtsvc\nmottsivmch\nhtomvcsmit\nsvhmotmcti\nmitotmvhcs\nvomcttmish\ncmostitvmh", "output": "8" }, { "input": "20\n********************\n1\nlaizpfbafxrugjcytfbs", "output": "16" }, { "input": "50\n**************************************************\n1\nqgaeytghzvvtgeitpovqozyclectzcohivbggudhiylaecbdzq", "output": "17" }, { "input": "50\n**************************************************\n2\nhvjbrfkhdaobruoptrrachzuvkxvvsckycfiroipqicoqvcqpr\nuirvabciccxdvpryroisvpoqvthrpurkzhoovcfqcjbhkarkqf", "output": "20" }, { "input": "26\n**************************\n10\nevfsnczuiodgbhqmlypkjatxrw\nuapqfdtoxkzynlbrehgwismvjc\nwjuyacngtzmvhqelikxoprdfbs\nyjgstlkvrhoqadxwfbiucpznem\nvebnxtrlocgkajqmwfuiszhypd\nroaqchwlpvtzxymnbkjigfedsu\noxmwaqpcendihzkutsybrjgfvl\nbnfzlwcsagxojdiyktqvruemhp\npdjahwnvmouxgqlciktzrfeysb\nbznurcyefxiapgktmqwjvsdloh", "output": "26" }, { "input": "26\n**************************\n1\nayvguplhjsoiencbkxdrfwmqtz", "output": "26" }, { "input": "26\n*lmnotuvwxyzjkabcdehiqfgrs\n2\nblmnotuvwxyzjkabcdehiqfgrs\nplmnotuvwxyzjkabcdehiqfgrs", "output": "1" }, { "input": "16\nx*d**s******xd*u\n22\nxfdeoshogyqjxdmu\nxvdvdsnwfwakxdyu\nxfdjoshftykjxdmu\nxfdcoshfwyajxdmu\nxfdfoshkmyajxdmu\nxfdyoshpoycjxdmu\nxmdhcswqnhxjxdtu\nxxdxwsoogqzwxdcu\nxxdhhsxqzciuxdfu\nxddcmswqzksqxdhu\nxfdtoshioyvjxdmu\nxsdxmsfmgjbyxdgu\nxadfssplfnlbxdru\nxndcasykmqmbxdru\nxrdxgszaisicxdlu\nxfdfoshhmypjxdmu\nxfdioshfiyhjxdmu\nxvdzysydlmyuxdnu\nxjdbqszgkuwhxdmu\nxfdfoshjyymjxdmu\nxgdjksubrmrfxdpu\nxkdshsfszixmxdcu", "output": "2" }, { "input": "3\n*vt\n2\ncvt\nqvb", "output": "1" }, { "input": "3\ntv*\n2\ntvc\nbvq", "output": "1" }, { "input": "41\n*z*hjcxxdgkny*tc*rmaov***fra**efs*lbi*puw\n1\nqzqhjcxxdgknyqtcqrmaovqqqfraqqefsqlbiqpuw", "output": "1" }, { "input": "48\n*h*i**ag**um**fuxvmxlj*dsyt*gb*dxkzp*brnelctkq*w\n1\nohoiooagooumoofuxvmxljodsytogbodxkzpobrnelctkqow", "output": "1" } ]
1,509,278,627
2,147,483,647
Python 3
OK
TESTS
95
77
0
n, word = int(input()), input() stars_index, lttr_index = [], [] lttrs = set() for i in range(len(word)): if word[i] == '*': stars_index.append(i) else: lttr_index.append(i) lttrs.add(word[i]) m = int(input()) pssbl_lttrs = None for i in range(m): p_word = input() f = False for j in stars_index: if p_word[j] in lttrs: f = True break for j in lttr_index: if p_word[j] != word[j]: f = True break if f: continue if pssbl_lttrs is None: pssbl_lttrs = set(p_word[i] for i in stars_index) else: u = set(p_word[i] for i in stars_index) pssbl_lttrs = pssbl_lttrs.intersection(u) print(len(pssbl_lttrs))
Title: Field of Wonders Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarpus takes part in the "Field of Wonders" TV show. The participants of the show have to guess a hidden word as fast as possible. Initially all the letters of the word are hidden. The game consists of several turns. At each turn the participant tells a letter and the TV show host responds if there is such letter in the word or not. If there is such letter then the host reveals all such letters. For example, if the hidden word is "abacaba" and the player tells the letter "a", the host will reveal letters at all positions, occupied by "a": 1, 3, 5 and 7 (positions are numbered from left to right starting from 1). Polycarpus knows *m* words of exactly the same length as the hidden word. The hidden word is also known to him and appears as one of these *m* words. At current moment a number of turns have already been made and some letters (possibly zero) of the hidden word are already revealed. Previously Polycarp has told exactly the letters which are currently revealed. It is Polycarpus' turn. He wants to tell a letter in such a way, that the TV show host will assuredly reveal at least one more letter. Polycarpus cannot tell the letters, which are already revealed. Your task is to help Polycarpus and find out the number of letters he can tell so that the show host will assuredly reveal at least one of the remaining letters. Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=50) — the length of the hidden word. The following line describes already revealed letters. It contains the string of length *n*, which consists of lowercase Latin letters and symbols "*". If there is a letter at some position, then this letter was already revealed. If the position contains symbol "*", then the letter at this position has not been revealed yet. It is guaranteed, that at least one letter is still closed. The third line contains an integer *m* (1<=≤<=*m*<=≤<=1000) — the number of words of length *n*, which Polycarpus knows. The following *m* lines contain the words themselves — *n*-letter strings of lowercase Latin letters. All words are distinct. It is guaranteed that the hidden word appears as one of the given *m* words. Before the current move Polycarp has told exactly the letters which are currently revealed. Output Specification: Output the single integer — the number of letters Polycarpus can tell so that the TV show host definitely reveals at least one more letter. It is possible that this number is zero. Demo Input: ['4\na**d\n2\nabcd\nacbd\n', '5\nlo*er\n2\nlover\nloser\n', '3\na*a\n2\naaa\naba\n'] Demo Output: ['2\n', '0\n', '1\n'] Note: In the first example Polycarpus can tell letters "b" and "c", which assuredly will be revealed. The second example contains no letters which can be told as it is not clear, which of the letters "v" or "s" is located at the third position of the hidden word. In the third example Polycarpus exactly knows that the hidden word is "aba", because in case it was "aaa", then the second letter "a" would have already been revealed in one of previous turns.
```python n, word = int(input()), input() stars_index, lttr_index = [], [] lttrs = set() for i in range(len(word)): if word[i] == '*': stars_index.append(i) else: lttr_index.append(i) lttrs.add(word[i]) m = int(input()) pssbl_lttrs = None for i in range(m): p_word = input() f = False for j in stars_index: if p_word[j] in lttrs: f = True break for j in lttr_index: if p_word[j] != word[j]: f = True break if f: continue if pssbl_lttrs is None: pssbl_lttrs = set(p_word[i] for i in stars_index) else: u = set(p_word[i] for i in stars_index) pssbl_lttrs = pssbl_lttrs.intersection(u) print(len(pssbl_lttrs)) ```
3
883
F
Lost in Transliteration
PROGRAMMING
1,300
[ "implementation" ]
null
null
There are some ambiguities when one writes Berland names with the letters of the Latin alphabet. For example, the Berland sound u can be written in the Latin alphabet as "u", and can be written as "oo". For this reason, two words "ulyana" and "oolyana" denote the same name. The second ambiguity is about the Berland sound h: one can use both "h" and "kh" to write it. For example, the words "mihail" and "mikhail" denote the same name. There are *n* users registered on the Polycarp's website. Each of them indicated a name represented by the Latin letters. How many distinct names are there among them, if two ambiguities described above are taken into account? Formally, we assume that two words denote the same name, if using the replacements "u"  "oo" and "h"  "kh", you can make the words equal. One can make replacements in both directions, in any of the two words an arbitrary number of times. A letter that resulted from the previous replacement can participate in the next replacements. For example, the following pairs of words denote the same name: - "koouper" and "kuooper". Making the replacements described above, you can make both words to be equal: "koouper" "kuuper" and "kuooper" "kuuper". - "khun" and "kkkhoon". With the replacements described above you can make both words to be equal: "khun" "khoon" and "kkkhoon" "kkhoon" "khoon". For a given list of words, find the minimal number of groups where the words in each group denote the same name.
The first line contains integer number *n* (2<=≤<=*n*<=≤<=400) — number of the words in the list. The following *n* lines contain words, one word per line. Each word consists of only lowercase Latin letters. The length of each word is between 1 and 20 letters inclusive.
Print the minimal number of groups where the words in each group denote the same name.
[ "10\nmihail\noolyana\nkooooper\nhoon\nulyana\nkoouper\nmikhail\nkhun\nkuooper\nkkkhoon\n", "9\nhariton\nhkariton\nbuoi\nkkkhariton\nboooi\nbui\nkhariton\nboui\nboi\n", "2\nalex\nalex\n" ]
[ "4\n", "5\n", "1\n" ]
There are four groups of words in the first example. Words in each group denote same name: 1. "mihail", "mikhail" 1. "oolyana", "ulyana" 1. "kooooper", "koouper" 1. "hoon", "khun", "kkkhoon" There are five groups of words in the second example. Words in each group denote same name: 1. "hariton", "kkkhariton", "khariton" 1. "hkariton" 1. "buoi", "boooi", "boui" 1. "bui" 1. "boi" In the third example the words are equal, so they denote the same name.
0
[ { "input": "10\nmihail\noolyana\nkooooper\nhoon\nulyana\nkoouper\nmikhail\nkhun\nkuooper\nkkkhoon", "output": "4" }, { "input": "9\nhariton\nhkariton\nbuoi\nkkkhariton\nboooi\nbui\nkhariton\nboui\nboi", "output": "5" }, { "input": "2\nalex\nalex", "output": "1" }, { "input": "40\nuok\nkuu\nku\no\nkku\nuh\nu\nu\nhh\nk\nkh\nh\nh\nou\nokh\nukk\nou\nuhk\nuo\nuko\nu\nuu\nh\nh\nhk\nuhu\nuoh\nooo\nk\nh\nuk\nk\nkku\nh\nku\nok\nk\nkuu\nou\nhh", "output": "21" }, { "input": "40\noooo\nhu\no\nhoh\nkhk\nuuh\nhu\nou\nuuoh\no\nkouk\nuouo\nu\nok\nuu\nuuuo\nhoh\nuu\nkuu\nh\nu\nkkoh\nkhh\nuoh\nouuk\nkuo\nk\nu\nuku\nh\nu\nk\nhuho\nku\nh\noo\nuh\nk\nuo\nou", "output": "25" }, { "input": "100\nuh\nu\nou\nhk\nokh\nuou\nk\no\nuhh\nk\noku\nk\nou\nhuh\nkoo\nuo\nkk\nkok\nhhu\nuu\noou\nk\nk\noh\nhk\nk\nu\no\nuo\no\no\no\nhoh\nkuo\nhuh\nkhu\nuu\nk\noku\nk\nh\nuu\nuo\nhuo\noo\nhu\nukk\nok\no\noh\nuo\nkko\nok\nouh\nkoh\nhhu\nku\nko\nhho\nkho\nkho\nkhk\nho\nhk\nuko\nukh\nh\nkh\nkk\nuku\nkkk\no\nuo\no\nouh\nou\nuhk\nou\nk\nh\nkko\nuko\no\nu\nho\nu\nooo\nuo\no\nko\noh\nkh\nuk\nohk\noko\nuko\nh\nh\noo\no", "output": "36" }, { "input": "101\nukuu\nh\nouuo\no\nkkuo\nko\nu\nh\nhku\nh\nh\nhuo\nuhoh\nkuu\nhu\nhkko\nuhuk\nkoho\nh\nhukk\noohu\nkk\nkko\nou\noou\nh\nuuu\nuh\nkhuk\nokoo\nouou\nuo\nkk\noo\nhuok\no\nu\nhok\nhu\nhhuu\nkuu\nooho\noku\nhuoh\nhhkh\nuuuh\nouo\nhou\nhhu\nh\no\nokou\nuo\nh\nukk\nu\nhook\nh\noouk\nokuo\nkuuu\nk\nuuk\nu\nukk\nkk\nu\nuhk\nh\nk\nokuu\nuoho\nkhuk\nhukk\nhoo\nouko\nu\nuu\nu\nh\nhuo\nh\nukk\nhk\nk\nuoh\nhk\nko\nou\nho\nu\nhhhk\nkuo\nhuo\nhkh\nku\nhok\nho\nkok\nhk\nouuh", "output": "50" }, { "input": "2\nkkkhkkh\nhh", "output": "1" }, { "input": "2\nkkhookkhoo\nhuhu", "output": "1" } ]
1,515,671,406
2,147,483,647
Python 3
OK
TESTS
81
93
6,348,800
import re print(len(set(re.sub('k+h', 'h', input().replace('u', 'oo')) for i in range(int(input())))))
Title: Lost in Transliteration Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are some ambiguities when one writes Berland names with the letters of the Latin alphabet. For example, the Berland sound u can be written in the Latin alphabet as "u", and can be written as "oo". For this reason, two words "ulyana" and "oolyana" denote the same name. The second ambiguity is about the Berland sound h: one can use both "h" and "kh" to write it. For example, the words "mihail" and "mikhail" denote the same name. There are *n* users registered on the Polycarp's website. Each of them indicated a name represented by the Latin letters. How many distinct names are there among them, if two ambiguities described above are taken into account? Formally, we assume that two words denote the same name, if using the replacements "u"  "oo" and "h"  "kh", you can make the words equal. One can make replacements in both directions, in any of the two words an arbitrary number of times. A letter that resulted from the previous replacement can participate in the next replacements. For example, the following pairs of words denote the same name: - "koouper" and "kuooper". Making the replacements described above, you can make both words to be equal: "koouper" "kuuper" and "kuooper" "kuuper". - "khun" and "kkkhoon". With the replacements described above you can make both words to be equal: "khun" "khoon" and "kkkhoon" "kkhoon" "khoon". For a given list of words, find the minimal number of groups where the words in each group denote the same name. Input Specification: The first line contains integer number *n* (2<=≤<=*n*<=≤<=400) — number of the words in the list. The following *n* lines contain words, one word per line. Each word consists of only lowercase Latin letters. The length of each word is between 1 and 20 letters inclusive. Output Specification: Print the minimal number of groups where the words in each group denote the same name. Demo Input: ['10\nmihail\noolyana\nkooooper\nhoon\nulyana\nkoouper\nmikhail\nkhun\nkuooper\nkkkhoon\n', '9\nhariton\nhkariton\nbuoi\nkkkhariton\nboooi\nbui\nkhariton\nboui\nboi\n', '2\nalex\nalex\n'] Demo Output: ['4\n', '5\n', '1\n'] Note: There are four groups of words in the first example. Words in each group denote same name: 1. "mihail", "mikhail" 1. "oolyana", "ulyana" 1. "kooooper", "koouper" 1. "hoon", "khun", "kkkhoon" There are five groups of words in the second example. Words in each group denote same name: 1. "hariton", "kkkhariton", "khariton" 1. "hkariton" 1. "buoi", "boooi", "boui" 1. "bui" 1. "boi" In the third example the words are equal, so they denote the same name.
```python import re print(len(set(re.sub('k+h', 'h', input().replace('u', 'oo')) for i in range(int(input()))))) ```
3
478
B
Random Teams
PROGRAMMING
1,300
[ "combinatorics", "constructive algorithms", "greedy", "math" ]
null
null
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends. Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
[ "5 1\n", "3 2\n", "6 3\n" ]
[ "10 10\n", "1 1\n", "3 6\n" ]
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends. In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one. In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
1,000
[ { "input": "5 1", "output": "10 10" }, { "input": "3 2", "output": "1 1" }, { "input": "6 3", "output": "3 6" }, { "input": "5 3", "output": "2 3" }, { "input": "10 2", "output": "20 36" }, { "input": "10 6", "output": "4 10" }, { "input": "1000000000 1", "output": "499999999500000000 499999999500000000" }, { "input": "5000000 12", "output": "1041664166668 12499942500066" }, { "input": "1833 195", "output": "7722 1342341" }, { "input": "1000000000 1000000000", "output": "0 0" }, { "input": "1000000000 1000000", "output": "499500000000 499000500499500000" }, { "input": "1000000000 32170", "output": "15541930838100 499967831017438365" }, { "input": "1000000 1000", "output": "499500000 499000999500" }, { "input": "1234 1123", "output": "111 6216" }, { "input": "599222887 298488", "output": "601178656545 179355218158217800" }, { "input": "999999999 500000000", "output": "499999999 124999999750000000" }, { "input": "1000000000 384842119", "output": "845473643 189209609585784021" }, { "input": "1000000000 384842119", "output": "845473643 189209609585784021" }, { "input": "1000000000 2", "output": "249999999500000000 499999998500000001" }, { "input": "1000000000 999999999", "output": "1 1" }, { "input": "38447 383", "output": "1910550 724453080" }, { "input": "100000000 99999799", "output": "201 20301" }, { "input": "1 1", "output": "0 0" }, { "input": "2 1", "output": "1 1" }, { "input": "2 2", "output": "0 0" }, { "input": "10 10", "output": "0 0" } ]
1,669,390,985
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
31
0
def pairs(n): return n * (n - 1) / 2 n, m = [int(x) for x in input().split()] a = n / m b = n % m min = pairs(a) * (m - b) + pairs(a + 1) * b max = pairs(n - m + 1) print(f"{int(min)} {int(max)}")
Title: Random Teams Time Limit: None seconds Memory Limit: None megabytes Problem Description: *n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends. Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition. Input Specification: The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively. Output Specification: The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively. Demo Input: ['5 1\n', '3 2\n', '6 3\n'] Demo Output: ['10 10\n', '1 1\n', '3 6\n'] Note: In the first sample all the participants get into one team, so there will be exactly ten pairs of friends. In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one. In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
```python def pairs(n): return n * (n - 1) / 2 n, m = [int(x) for x in input().split()] a = n / m b = n % m min = pairs(a) * (m - b) + pairs(a + 1) * b max = pairs(n - m + 1) print(f"{int(min)} {int(max)}") ```
0
460
A
Vasya and Socks
PROGRAMMING
900
[ "brute force", "implementation", "math" ]
null
null
Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks?
The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space.
Print a single integer — the answer to the problem.
[ "2 2\n", "9 3\n" ]
[ "3\n", "13\n" ]
In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two. In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day.
500
[ { "input": "2 2", "output": "3" }, { "input": "9 3", "output": "13" }, { "input": "1 2", "output": "1" }, { "input": "2 3", "output": "2" }, { "input": "1 99", "output": "1" }, { "input": "4 4", "output": "5" }, { "input": "10 2", "output": "19" }, { "input": "10 9", "output": "11" }, { "input": "100 100", "output": "101" }, { "input": "2 27", "output": "2" }, { "input": "99 100", "output": "99" }, { "input": "99 2", "output": "197" }, { "input": "100 3", "output": "149" }, { "input": "98 3", "output": "146" }, { "input": "4 4", "output": "5" }, { "input": "100 2", "output": "199" }, { "input": "62 4", "output": "82" }, { "input": "99 10", "output": "109" }, { "input": "100 5", "output": "124" }, { "input": "80 80", "output": "81" }, { "input": "95 16", "output": "101" }, { "input": "75 16", "output": "79" }, { "input": "99 74", "output": "100" }, { "input": "20 21", "output": "20" }, { "input": "52 96", "output": "52" }, { "input": "24 5", "output": "29" } ]
1,650,388,479
2,147,483,647
Python 3
OK
TESTS
26
46
0
n,m=map(int,input().split()) k=0 if m>n: print(n) else: while n>0: k+=1 n-=1 if(k%m==0): n+=1 print(k)
Title: Vasya and Socks Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks? Input Specification: The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space. Output Specification: Print a single integer — the answer to the problem. Demo Input: ['2 2\n', '9 3\n'] Demo Output: ['3\n', '13\n'] Note: In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two. In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day.
```python n,m=map(int,input().split()) k=0 if m>n: print(n) else: while n>0: k+=1 n-=1 if(k%m==0): n+=1 print(k) ```
3