contestId
int64
0
1.01k
index
stringclasses
57 values
name
stringlengths
2
58
type
stringclasses
2 values
rating
int64
0
3.5k
tags
listlengths
0
11
title
stringclasses
522 values
time-limit
stringclasses
8 values
memory-limit
stringclasses
8 values
problem-description
stringlengths
0
7.15k
input-specification
stringlengths
0
2.05k
output-specification
stringlengths
0
1.5k
demo-input
listlengths
0
7
demo-output
listlengths
0
7
note
stringlengths
0
5.24k
points
float64
0
425k
test_cases
listlengths
0
402
creationTimeSeconds
int64
1.37B
1.7B
relativeTimeSeconds
int64
8
2.15B
programmingLanguage
stringclasses
3 values
verdict
stringclasses
14 values
testset
stringclasses
12 values
passedTestCount
int64
0
1k
timeConsumedMillis
int64
0
15k
memoryConsumedBytes
int64
0
805M
code
stringlengths
3
65.5k
prompt
stringlengths
262
8.2k
response
stringlengths
17
65.5k
score
float64
-1
3.99
630
L
Cracking the Code
PROGRAMMING
1,400
[ "implementation", "math" ]
null
null
The protection of a popular program developed by one of IT City companies is organized the following way. After installation it outputs a random five digit number which should be sent in SMS to a particular phone number. In response an SMS activation code arrives. A young hacker Vasya disassembled the program and found the algorithm that transforms the shown number into the activation code. Note: it is clear that Vasya is a law-abiding hacker, and made it for a noble purpose — to show the developer the imperfection of their protection. The found algorithm looks the following way. At first the digits of the number are shuffled in the following order <first digit><third digit><fifth digit><fourth digit><second digit>. For example the shuffle of 12345 should lead to 13542. On the second stage the number is raised to the fifth power. The result of the shuffle and exponentiation of the number 12345 is 455 422 043 125 550 171 232. The answer is the 5 last digits of this result. For the number 12345 the answer should be 71232. Vasya is going to write a keygen program implementing this algorithm. Can you do the same?
The only line of the input contains a positive integer five digit number for which the activation code should be found.
Output exactly 5 digits without spaces between them — the found activation code of the program.
[ "12345\n" ]
[ "71232" ]
none
0
[ { "input": "12345", "output": "71232" }, { "input": "13542", "output": "84443" }, { "input": "71232", "output": "10151" }, { "input": "11111", "output": "36551" }, { "input": "10000", "output": "00000" }, { "input": "99999", "output": "99999" }, { "input": "91537", "output": "27651" }, { "input": "70809", "output": "00000" }, { "input": "41675", "output": "61851" }, { "input": "32036", "output": "82432" } ]
1,691,310,587
2,147,483,647
Python 3
OK
TESTS
10
31
0
n = input() coded = str(int(n[0] + n[2] + n[4] + n[3] + n[1]) ** 5) print(coded[len(coded) - 5:])
Title: Cracking the Code Time Limit: None seconds Memory Limit: None megabytes Problem Description: The protection of a popular program developed by one of IT City companies is organized the following way. After installation it outputs a random five digit number which should be sent in SMS to a particular phone number. In response an SMS activation code arrives. A young hacker Vasya disassembled the program and found the algorithm that transforms the shown number into the activation code. Note: it is clear that Vasya is a law-abiding hacker, and made it for a noble purpose — to show the developer the imperfection of their protection. The found algorithm looks the following way. At first the digits of the number are shuffled in the following order <first digit><third digit><fifth digit><fourth digit><second digit>. For example the shuffle of 12345 should lead to 13542. On the second stage the number is raised to the fifth power. The result of the shuffle and exponentiation of the number 12345 is 455 422 043 125 550 171 232. The answer is the 5 last digits of this result. For the number 12345 the answer should be 71232. Vasya is going to write a keygen program implementing this algorithm. Can you do the same? Input Specification: The only line of the input contains a positive integer five digit number for which the activation code should be found. Output Specification: Output exactly 5 digits without spaces between them — the found activation code of the program. Demo Input: ['12345\n'] Demo Output: ['71232'] Note: none
```python n = input() coded = str(int(n[0] + n[2] + n[4] + n[3] + n[1]) ** 5) print(coded[len(coded) - 5:]) ```
3
165
A
Supercentral Point
PROGRAMMING
1,000
[ "implementation" ]
null
null
One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*): - point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=&gt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=&lt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=&lt;<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=&gt;<=*y* We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points. Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set.
The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different.
Print the only number — the number of supercentral points of the given set.
[ "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n", "5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n" ]
[ "2\n", "1\n" ]
In the first sample the supercentral points are only points (1, 1) and (1, 2). In the second sample there is one supercental point — point (0, 0).
500
[ { "input": "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3", "output": "2" }, { "input": "5\n0 0\n0 1\n1 0\n0 -1\n-1 0", "output": "1" }, { "input": "9\n-565 -752\n-184 723\n-184 -752\n-184 1\n950 723\n-565 723\n950 -752\n950 1\n-565 1", "output": "1" }, { "input": "25\n-651 897\n916 897\n-651 -808\n-748 301\n-734 414\n-651 -973\n-734 897\n916 -550\n-758 414\n916 180\n-758 -808\n-758 -973\n125 -550\n125 -973\n125 301\n916 414\n-748 -808\n-651 301\n-734 301\n-307 897\n-651 -550\n-651 414\n125 -808\n-748 -550\n916 -808", "output": "7" }, { "input": "1\n487 550", "output": "0" }, { "input": "10\n990 -396\n990 736\n990 646\n990 -102\n990 -570\n990 155\n990 528\n990 489\n990 268\n990 676", "output": "0" }, { "input": "30\n507 836\n525 836\n-779 196\n507 -814\n525 -814\n525 42\n525 196\n525 -136\n-779 311\n507 -360\n525 300\n507 578\n507 311\n-779 836\n507 300\n525 -360\n525 311\n-779 -360\n-779 578\n-779 300\n507 42\n525 578\n-779 379\n507 196\n525 379\n507 379\n-779 -814\n-779 42\n-779 -136\n507 -136", "output": "8" }, { "input": "25\n890 -756\n890 -188\n-37 -756\n-37 853\n523 998\n-261 853\n-351 853\n-351 -188\n523 -756\n-261 -188\n-37 998\n523 -212\n-351 998\n-37 -188\n-351 -756\n-37 -212\n890 998\n890 -212\n523 853\n-351 -212\n-261 -212\n-261 998\n-261 -756\n890 853\n523 -188", "output": "9" }, { "input": "21\n-813 -11\n486 254\n685 254\n-708 254\n-55 -11\n-671 -191\n486 -11\n-671 -11\n685 -11\n685 -191\n486 -191\n-55 254\n-708 -11\n-813 254\n-708 -191\n41 -11\n-671 254\n-813 -191\n41 254\n-55 -191\n41 -191", "output": "5" }, { "input": "4\n1 0\n2 0\n1 1\n1 -1", "output": "0" } ]
1,693,425,189
2,147,483,647
PyPy 3-64
OK
TESTS
26
124
2,150,400
n=int(input()) x=[] y=[] c=0 for i in range(n): a,b=map(int,input().split()) x.append(a) y.append(b) for i in range(n): r=l=lo=u=0 for j in range(n): if(i==j): continue else: if(x[j]>x[i] and y[j]==y[i]): r+=1 elif(x[j]<x[i] and y[j]==y[i]): l+=1 elif(x[j]==x[i] and y[j]<y[i]): lo+=1 elif(x[j]==x[i] and y[j]>y[i]): u+=1 if(r>=1 and l>=1 and lo>=1 and u>=1): c+=1 print(c)
Title: Supercentral Point Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*): - point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=&gt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=&lt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=&lt;<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=&gt;<=*y* We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points. Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set. Input Specification: The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different. Output Specification: Print the only number — the number of supercentral points of the given set. Demo Input: ['8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n', '5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n'] Demo Output: ['2\n', '1\n'] Note: In the first sample the supercentral points are only points (1, 1) and (1, 2). In the second sample there is one supercental point — point (0, 0).
```python n=int(input()) x=[] y=[] c=0 for i in range(n): a,b=map(int,input().split()) x.append(a) y.append(b) for i in range(n): r=l=lo=u=0 for j in range(n): if(i==j): continue else: if(x[j]>x[i] and y[j]==y[i]): r+=1 elif(x[j]<x[i] and y[j]==y[i]): l+=1 elif(x[j]==x[i] and y[j]<y[i]): lo+=1 elif(x[j]==x[i] and y[j]>y[i]): u+=1 if(r>=1 and l>=1 and lo>=1 and u>=1): c+=1 print(c) ```
3
913
B
Christmas Spruce
PROGRAMMING
1,200
[ "implementation", "trees" ]
null
null
Consider a rooted tree. A rooted tree has one special vertex called the root. All edges are directed from the root. Vertex *u* is called a child of vertex *v* and vertex *v* is called a parent of vertex *u* if there exists a directed edge from *v* to *u*. A vertex is called a leaf if it doesn't have children and has a parent. Let's call a rooted tree a spruce if its every non-leaf vertex has at least 3 leaf children. You are given a rooted tree, check whether it's a spruce. The definition of a rooted tree can be found [here](https://goo.gl/1dqvzz).
The first line contains one integer *n* — the number of vertices in the tree (3<=≤<=*n*<=≤<=1<=000). Each of the next *n*<=-<=1 lines contains one integer *p**i* (1<=≤<=*i*<=≤<=*n*<=-<=1) — the index of the parent of the *i*<=+<=1-th vertex (1<=≤<=*p**i*<=≤<=*i*). Vertex 1 is the root. It's guaranteed that the root has at least 2 children.
Print "Yes" if the tree is a spruce and "No" otherwise.
[ "4\n1\n1\n1\n", "7\n1\n1\n1\n2\n2\n2\n", "8\n1\n1\n1\n1\n3\n3\n3\n" ]
[ "Yes\n", "No\n", "Yes\n" ]
The first example: <img class="tex-graphics" src="https://espresso.codeforces.com/8dd976913226df83d535dfa66193f5525f8471bc.png" style="max-width: 100.0%;max-height: 100.0%;"/> The second example: <img class="tex-graphics" src="https://espresso.codeforces.com/44dad5804f5290a2e026c9c41a15151562df8682.png" style="max-width: 100.0%;max-height: 100.0%;"/> It is not a spruce, because the non-leaf vertex 1 has only 2 leaf children. The third example: <img class="tex-graphics" src="https://espresso.codeforces.com/cf84a9e1585707f4ab06eff8eb1120a49b5e1ef7.png" style="max-width: 100.0%;max-height: 100.0%;"/>
750
[ { "input": "4\n1\n1\n1", "output": "Yes" }, { "input": "7\n1\n1\n1\n2\n2\n2", "output": "No" }, { "input": "8\n1\n1\n1\n1\n3\n3\n3", "output": "Yes" }, { "input": "3\n1\n1", "output": "No" }, { "input": "13\n1\n2\n2\n2\n1\n6\n6\n6\n1\n10\n10\n10", "output": "No" }, { "input": "7\n1\n2\n2\n1\n1\n1", "output": "No" }, { "input": "7\n1\n1\n1\n1\n2\n2", "output": "No" }, { "input": "8\n1\n1\n1\n1\n5\n5\n5", "output": "Yes" }, { "input": "9\n1\n1\n1\n1\n2\n6\n6\n6", "output": "No" }, { "input": "12\n1\n1\n1\n2\n5\n5\n5\n5\n1\n2\n2", "output": "No" }, { "input": "20\n1\n1\n1\n1\n2\n2\n2\n3\n3\n3\n4\n4\n4\n5\n5\n5\n1\n1\n1", "output": "Yes" }, { "input": "7\n1\n1\n1\n3\n3\n3", "output": "No" } ]
1,622,309,783
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
16
62
0
n = int(input()) mat = [[] for _ in range(n)] for i in range(n-1): p = int(input()) mat[p-1].append(i+1) #print(mat) flag = 0 for i in range(n): count = 0 for j in range(len(mat[i])): if (not mat[mat[i][j]]) or (len(mat[mat[i][j]]) == 0): count += 1 if count > 0 and count < 3: flag = 1 print('No') break if flag == 0: print('Yes') ''' 8 1 1 1 1 3 3 3 8 8 8 3 2 3 4 5 6 7 8 9 10 11 12 -> 16 1 -> 2 -> 13 -> 17 -> 14 -> 15 -> 3 -> 6 -> 7 -> 8 -> 9 -> 10 -> 11 -> 12 -> 4 -> 5 n=int(input()); g=[[] for _ in range(n)] for v in range(1,n): g[int(input())-1].append(v); print(("Yes","No")[any(e and sum(not g[v] for v in e)<3 for e in g)]); '''
Title: Christmas Spruce Time Limit: None seconds Memory Limit: None megabytes Problem Description: Consider a rooted tree. A rooted tree has one special vertex called the root. All edges are directed from the root. Vertex *u* is called a child of vertex *v* and vertex *v* is called a parent of vertex *u* if there exists a directed edge from *v* to *u*. A vertex is called a leaf if it doesn't have children and has a parent. Let's call a rooted tree a spruce if its every non-leaf vertex has at least 3 leaf children. You are given a rooted tree, check whether it's a spruce. The definition of a rooted tree can be found [here](https://goo.gl/1dqvzz). Input Specification: The first line contains one integer *n* — the number of vertices in the tree (3<=≤<=*n*<=≤<=1<=000). Each of the next *n*<=-<=1 lines contains one integer *p**i* (1<=≤<=*i*<=≤<=*n*<=-<=1) — the index of the parent of the *i*<=+<=1-th vertex (1<=≤<=*p**i*<=≤<=*i*). Vertex 1 is the root. It's guaranteed that the root has at least 2 children. Output Specification: Print "Yes" if the tree is a spruce and "No" otherwise. Demo Input: ['4\n1\n1\n1\n', '7\n1\n1\n1\n2\n2\n2\n', '8\n1\n1\n1\n1\n3\n3\n3\n'] Demo Output: ['Yes\n', 'No\n', 'Yes\n'] Note: The first example: <img class="tex-graphics" src="https://espresso.codeforces.com/8dd976913226df83d535dfa66193f5525f8471bc.png" style="max-width: 100.0%;max-height: 100.0%;"/> The second example: <img class="tex-graphics" src="https://espresso.codeforces.com/44dad5804f5290a2e026c9c41a15151562df8682.png" style="max-width: 100.0%;max-height: 100.0%;"/> It is not a spruce, because the non-leaf vertex 1 has only 2 leaf children. The third example: <img class="tex-graphics" src="https://espresso.codeforces.com/cf84a9e1585707f4ab06eff8eb1120a49b5e1ef7.png" style="max-width: 100.0%;max-height: 100.0%;"/>
```python n = int(input()) mat = [[] for _ in range(n)] for i in range(n-1): p = int(input()) mat[p-1].append(i+1) #print(mat) flag = 0 for i in range(n): count = 0 for j in range(len(mat[i])): if (not mat[mat[i][j]]) or (len(mat[mat[i][j]]) == 0): count += 1 if count > 0 and count < 3: flag = 1 print('No') break if flag == 0: print('Yes') ''' 8 1 1 1 1 3 3 3 8 8 8 3 2 3 4 5 6 7 8 9 10 11 12 -> 16 1 -> 2 -> 13 -> 17 -> 14 -> 15 -> 3 -> 6 -> 7 -> 8 -> 9 -> 10 -> 11 -> 12 -> 4 -> 5 n=int(input()); g=[[] for _ in range(n)] for v in range(1,n): g[int(input())-1].append(v); print(("Yes","No")[any(e and sum(not g[v] for v in e)<3 for e in g)]); ''' ```
0
221
A
Little Elephant and Function
PROGRAMMING
1,000
[ "implementation", "math" ]
null
null
The Little Elephant enjoys recursive functions. This time he enjoys the sorting function. Let *a* is a permutation of an integers from 1 to *n*, inclusive, and *a**i* denotes the *i*-th element of the permutation. The Little Elephant's recursive function *f*(*x*), that sorts the first *x* permutation's elements, works as follows: - If *x*<==<=1, exit the function. - Otherwise, call *f*(*x*<=-<=1), and then make *swap*(*a**x*<=-<=1,<=*a**x*) (swap the *x*-th and (*x*<=-<=1)-th elements of *a*). The Little Elephant's teacher believes that this function does not work correctly. But that-be do not get an F, the Little Elephant wants to show the performance of its function. Help him, find a permutation of numbers from 1 to *n*, such that after performing the Little Elephant's function (that is call *f*(*n*)), the permutation will be sorted in ascending order.
A single line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the size of permutation.
In a single line print *n* distinct integers from 1 to *n* — the required permutation. Numbers in a line should be separated by spaces. It is guaranteed that the answer exists.
[ "1\n", "2\n" ]
[ "1 ", "2 1 " ]
none
500
[ { "input": "1", "output": "1 " }, { "input": "2", "output": "2 1 " }, { "input": "3", "output": "3 1 2 " }, { "input": "4", "output": "4 1 2 3 " }, { "input": "5", "output": "5 1 2 3 4 " }, { "input": "6", "output": "6 1 2 3 4 5 " }, { "input": "7", "output": "7 1 2 3 4 5 6 " }, { "input": "1000", "output": "1000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..." }, { "input": "999", "output": "999 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "998", "output": "998 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "997", "output": "997 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "900", "output": "900 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "101", "output": "101 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 " }, { "input": "3", "output": "3 1 2 " }, { "input": "67", "output": "67 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 " }, { "input": "779", "output": "779 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "195", "output": "195 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "907", "output": "907 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "971", "output": "971 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "683", "output": "683 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "99", "output": "99 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 " }, { "input": "811", "output": "811 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "875", "output": "875 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "291", "output": "291 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "3", "output": "3 1 2 " }, { "input": "419", "output": "419 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "779", "output": "779 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "195", "output": "195 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "907", "output": "907 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "21", "output": "21 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 " }, { "input": "22", "output": "22 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 " }, { "input": "23", "output": "23 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 " }, { "input": "24", "output": "24 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 " }, { "input": "25", "output": "25 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 " } ]
1,570,826,395
2,147,483,647
Python 3
OK
TESTS
34
248
307,200
n = int(input()) ans = [n]+list(range(1, n)) print(*ans)
Title: Little Elephant and Function Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Little Elephant enjoys recursive functions. This time he enjoys the sorting function. Let *a* is a permutation of an integers from 1 to *n*, inclusive, and *a**i* denotes the *i*-th element of the permutation. The Little Elephant's recursive function *f*(*x*), that sorts the first *x* permutation's elements, works as follows: - If *x*<==<=1, exit the function. - Otherwise, call *f*(*x*<=-<=1), and then make *swap*(*a**x*<=-<=1,<=*a**x*) (swap the *x*-th and (*x*<=-<=1)-th elements of *a*). The Little Elephant's teacher believes that this function does not work correctly. But that-be do not get an F, the Little Elephant wants to show the performance of its function. Help him, find a permutation of numbers from 1 to *n*, such that after performing the Little Elephant's function (that is call *f*(*n*)), the permutation will be sorted in ascending order. Input Specification: A single line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the size of permutation. Output Specification: In a single line print *n* distinct integers from 1 to *n* — the required permutation. Numbers in a line should be separated by spaces. It is guaranteed that the answer exists. Demo Input: ['1\n', '2\n'] Demo Output: ['1 ', '2 1 '] Note: none
```python n = int(input()) ans = [n]+list(range(1, n)) print(*ans) ```
3
893
C
Rumor
PROGRAMMING
1,300
[ "dfs and similar", "graphs", "greedy" ]
null
null
Vova promised himself that he would never play computer games... But recently Firestorm — a well-known game developing company — published their newest game, World of Farcraft, and it became really popular. Of course, Vova started playing it. Now he tries to solve a quest. The task is to come to a settlement named Overcity and spread a rumor in it. Vova knows that there are *n* characters in Overcity. Some characters are friends to each other, and they share information they got. Also Vova knows that he can bribe each character so he or she starts spreading the rumor; *i*-th character wants *c**i* gold in exchange for spreading the rumor. When a character hears the rumor, he tells it to all his friends, and they start spreading the rumor to their friends (for free), and so on. The quest is finished when all *n* characters know the rumor. What is the minimum amount of gold Vova needs to spend in order to finish the quest? Take a look at the notes if you think you haven't understood the problem completely.
The first line contains two integer numbers *n* and *m* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105) — the number of characters in Overcity and the number of pairs of friends. The second line contains *n* integer numbers *c**i* (0<=≤<=*c**i*<=≤<=109) — the amount of gold *i*-th character asks to start spreading the rumor. Then *m* lines follow, each containing a pair of numbers (*x**i*,<=*y**i*) which represent that characters *x**i* and *y**i* are friends (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, *x**i*<=≠<=*y**i*). It is guaranteed that each pair is listed at most once.
Print one number — the minimum amount of gold Vova has to spend in order to finish the quest.
[ "5 2\n2 5 3 4 8\n1 4\n4 5\n", "10 0\n1 2 3 4 5 6 7 8 9 10\n", "10 5\n1 6 2 7 3 8 4 9 5 10\n1 2\n3 4\n5 6\n7 8\n9 10\n" ]
[ "10\n", "55\n", "15\n" ]
In the first example the best decision is to bribe the first character (he will spread the rumor to fourth character, and the fourth one will spread it to fifth). Also Vova has to bribe the second and the third characters, so they know the rumor. In the second example Vova has to bribe everyone. In the third example the optimal decision is to bribe the first, the third, the fifth, the seventh and the ninth characters.
0
[ { "input": "5 2\n2 5 3 4 8\n1 4\n4 5", "output": "10" }, { "input": "10 0\n1 2 3 4 5 6 7 8 9 10", "output": "55" }, { "input": "10 5\n1 6 2 7 3 8 4 9 5 10\n1 2\n3 4\n5 6\n7 8\n9 10", "output": "15" }, { "input": "1 0\n0", "output": "0" }, { "input": "1 0\n1000000000", "output": "1000000000" }, { "input": "2 0\n0 0", "output": "0" }, { "input": "2 0\n1000000000 0", "output": "1000000000" }, { "input": "2 0\n0 1000000000", "output": "1000000000" }, { "input": "2 0\n1000000000 1000000000", "output": "2000000000" }, { "input": "2 1\n0 0\n1 2", "output": "0" } ]
1,606,721,445
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
4
982
14,848,000
l=lambda:map(int,input().split()) t=lambda:int(input()) ss=lambda:input() #from math import log10 ,log2,ceil,factorial as f #from itertools import combinations_with_replacement as c n,m=l() a=list(l()) d={} for i in range(m): u,v=l() if u-1 not in d.keys(): d[u-1]=[] if v-1 not in d.keys(): d[v-1]=[] d[u-1].append(v-1) d[v-1].append(u-1) #print(d) s=0 v=[0]*(n) for i in d.keys(): if v[i]==0: q=[i] t=10000000 while len(q): x=q.pop() t=min(a[x],t) for j in d[x]: if v[j]==0: q.append(j) v[j]=1 s+=t for i in range(n): if not v[i]: s+=a[i] print(s) ''' 5 2 2 5 3 4 8 1 4 4 5 outputCopy 10 inputCopy 10 0 1 2 3 4 5 6 7 8 9 10 outputCopy 55 inputCopy 10 5 1 6 2 7 3 8 4 9 5 10 1 2 3 4 5 6 7 8 9 10 outputCopy 15 '''
Title: Rumor Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vova promised himself that he would never play computer games... But recently Firestorm — a well-known game developing company — published their newest game, World of Farcraft, and it became really popular. Of course, Vova started playing it. Now he tries to solve a quest. The task is to come to a settlement named Overcity and spread a rumor in it. Vova knows that there are *n* characters in Overcity. Some characters are friends to each other, and they share information they got. Also Vova knows that he can bribe each character so he or she starts spreading the rumor; *i*-th character wants *c**i* gold in exchange for spreading the rumor. When a character hears the rumor, he tells it to all his friends, and they start spreading the rumor to their friends (for free), and so on. The quest is finished when all *n* characters know the rumor. What is the minimum amount of gold Vova needs to spend in order to finish the quest? Take a look at the notes if you think you haven't understood the problem completely. Input Specification: The first line contains two integer numbers *n* and *m* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105) — the number of characters in Overcity and the number of pairs of friends. The second line contains *n* integer numbers *c**i* (0<=≤<=*c**i*<=≤<=109) — the amount of gold *i*-th character asks to start spreading the rumor. Then *m* lines follow, each containing a pair of numbers (*x**i*,<=*y**i*) which represent that characters *x**i* and *y**i* are friends (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, *x**i*<=≠<=*y**i*). It is guaranteed that each pair is listed at most once. Output Specification: Print one number — the minimum amount of gold Vova has to spend in order to finish the quest. Demo Input: ['5 2\n2 5 3 4 8\n1 4\n4 5\n', '10 0\n1 2 3 4 5 6 7 8 9 10\n', '10 5\n1 6 2 7 3 8 4 9 5 10\n1 2\n3 4\n5 6\n7 8\n9 10\n'] Demo Output: ['10\n', '55\n', '15\n'] Note: In the first example the best decision is to bribe the first character (he will spread the rumor to fourth character, and the fourth one will spread it to fifth). Also Vova has to bribe the second and the third characters, so they know the rumor. In the second example Vova has to bribe everyone. In the third example the optimal decision is to bribe the first, the third, the fifth, the seventh and the ninth characters.
```python l=lambda:map(int,input().split()) t=lambda:int(input()) ss=lambda:input() #from math import log10 ,log2,ceil,factorial as f #from itertools import combinations_with_replacement as c n,m=l() a=list(l()) d={} for i in range(m): u,v=l() if u-1 not in d.keys(): d[u-1]=[] if v-1 not in d.keys(): d[v-1]=[] d[u-1].append(v-1) d[v-1].append(u-1) #print(d) s=0 v=[0]*(n) for i in d.keys(): if v[i]==0: q=[i] t=10000000 while len(q): x=q.pop() t=min(a[x],t) for j in d[x]: if v[j]==0: q.append(j) v[j]=1 s+=t for i in range(n): if not v[i]: s+=a[i] print(s) ''' 5 2 2 5 3 4 8 1 4 4 5 outputCopy 10 inputCopy 10 0 1 2 3 4 5 6 7 8 9 10 outputCopy 55 inputCopy 10 5 1 6 2 7 3 8 4 9 5 10 1 2 3 4 5 6 7 8 9 10 outputCopy 15 ''' ```
0
222
A
Shooshuns and Sequence
PROGRAMMING
1,200
[ "brute force", "implementation" ]
null
null
One day shooshuns found a sequence of *n* integers, written on a blackboard. The shooshuns can perform one operation with it, the operation consists of two steps: 1. Find the number that goes *k*-th in the current sequence and add the same number to the end of the sequence; 1. Delete the first number of the current sequence. The shooshuns wonder after how many operations all numbers on the board will be the same and whether all numbers will ever be the same.
The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105) — the sequence that the shooshuns found.
Print the minimum number of operations, required for all numbers on the blackboard to become the same. If it is impossible to achieve, print -1.
[ "3 2\n3 1 1\n", "3 1\n3 1 1\n" ]
[ "1\n", "-1\n" ]
In the first test case after the first operation the blackboard will have sequence [1, 1, 1]. So, one operation is enough to make all numbers the same. Thus, the answer equals one. In the second test case the sequence will never consist of the same numbers. It will always contain at least two distinct numbers 3 and 1. Thus, the answer equals -1.
500
[ { "input": "3 2\n3 1 1", "output": "1" }, { "input": "3 1\n3 1 1", "output": "-1" }, { "input": "1 1\n1", "output": "0" }, { "input": "2 1\n1 1", "output": "0" }, { "input": "2 1\n2 1", "output": "-1" }, { "input": "4 4\n1 2 3 4", "output": "3" }, { "input": "4 3\n1 2 3 4", "output": "-1" }, { "input": "5 3\n2 1 1 1 1", "output": "1" }, { "input": "5 3\n1 1 1 1 1", "output": "0" }, { "input": "5 5\n1 1 1 1 1", "output": "0" }, { "input": "10 1\n1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "10 1\n1 2 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "10 1\n2 1 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "10 2\n2 1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "10 2\n1 2 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "10 3\n3 2 1 1 1 1 1 1 1 1", "output": "2" }, { "input": "10 1\n1 2 3 4 5 6 7 8 9 10", "output": "-1" }, { "input": "10 10\n1 2 3 4 5 6 7 8 9 10", "output": "9" }, { "input": "20 10\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "20 11\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1", "output": "10" }, { "input": "20 9\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "20 10\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "20 20\n20 1 19 2 18 3 17 4 16 5 15 6 14 7 13 8 12 9 11 10", "output": "19" } ]
1,556,120,192
2,147,483,647
PyPy 3
OK
TESTS
47
404
10,547,200
n, k = map(int, input().split()) a = list(map(int, input().split())) k = k-1 if len(set(a)) == 1: print(0) else: if len(set(a[k:])) > 1: print(-1) else: pos = k while pos > 0 and a[pos-1] == a[k]: pos -= 1 print(pos)
Title: Shooshuns and Sequence Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day shooshuns found a sequence of *n* integers, written on a blackboard. The shooshuns can perform one operation with it, the operation consists of two steps: 1. Find the number that goes *k*-th in the current sequence and add the same number to the end of the sequence; 1. Delete the first number of the current sequence. The shooshuns wonder after how many operations all numbers on the board will be the same and whether all numbers will ever be the same. Input Specification: The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105) — the sequence that the shooshuns found. Output Specification: Print the minimum number of operations, required for all numbers on the blackboard to become the same. If it is impossible to achieve, print -1. Demo Input: ['3 2\n3 1 1\n', '3 1\n3 1 1\n'] Demo Output: ['1\n', '-1\n'] Note: In the first test case after the first operation the blackboard will have sequence [1, 1, 1]. So, one operation is enough to make all numbers the same. Thus, the answer equals one. In the second test case the sequence will never consist of the same numbers. It will always contain at least two distinct numbers 3 and 1. Thus, the answer equals -1.
```python n, k = map(int, input().split()) a = list(map(int, input().split())) k = k-1 if len(set(a)) == 1: print(0) else: if len(set(a[k:])) > 1: print(-1) else: pos = k while pos > 0 and a[pos-1] == a[k]: pos -= 1 print(pos) ```
3
867
A
Between the Offices
PROGRAMMING
800
[ "implementation" ]
null
null
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane. You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days. The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise. You can print each letter in any case (upper or lower).
[ "4\nFSSF\n", "2\nSF\n", "10\nFFFFFFFFFF\n", "10\nSSFFSFFSFF\n" ]
[ "NO\n", "YES\n", "NO\n", "YES\n" ]
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO". In the second example you just flew from Seattle to San Francisco, so the answer is "YES". In the third example you stayed the whole period in San Francisco, so the answer is "NO". In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
500
[ { "input": "4\nFSSF", "output": "NO" }, { "input": "2\nSF", "output": "YES" }, { "input": "10\nFFFFFFFFFF", "output": "NO" }, { "input": "10\nSSFFSFFSFF", "output": "YES" }, { "input": "20\nSFSFFFFSSFFFFSSSSFSS", "output": "NO" }, { "input": "20\nSSFFFFFSFFFFFFFFFFFF", "output": "YES" }, { "input": "20\nSSFSFSFSFSFSFSFSSFSF", "output": "YES" }, { "input": "20\nSSSSFSFSSFSFSSSSSSFS", "output": "NO" }, { "input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF", "output": "NO" }, { "input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF", "output": "YES" }, { "input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS", "output": "NO" }, { "input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS", "output": "NO" }, { "input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS", "output": "NO" }, { "input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS", "output": "NO" }, { "input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS", "output": "NO" }, { "input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS", "output": "NO" }, { "input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS", "output": "NO" }, { "input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "YES" }, { "input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "YES" }, { "input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF", "output": "YES" }, { "input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF", "output": "YES" }, { "input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF", "output": "YES" }, { "input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF", "output": "YES" }, { "input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF", "output": "YES" }, { "input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF", "output": "YES" }, { "input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF", "output": "YES" }, { "input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF", "output": "YES" }, { "input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF", "output": "YES" }, { "input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF", "output": "YES" }, { "input": "2\nSS", "output": "NO" } ]
1,586,778,173
2,147,483,647
PyPy 3
COMPILATION_ERROR
TESTS
0
0
0
n=int(input() x=input() c=0 d=0 for i in range(x): if x[i]=='S' and x[i+1]=='F': c+=1 elif x[i]=='F' and x[i+1]=='C': d+=1 if c>d: print("YES") else: print("NO")
Title: Between the Offices Time Limit: None seconds Memory Limit: None megabytes Problem Description: As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane. You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not. Input Specification: The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days. The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence. Output Specification: Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise. You can print each letter in any case (upper or lower). Demo Input: ['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n'] Demo Output: ['NO\n', 'YES\n', 'NO\n', 'YES\n'] Note: In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO". In the second example you just flew from Seattle to San Francisco, so the answer is "YES". In the third example you stayed the whole period in San Francisco, so the answer is "NO". In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
```python n=int(input() x=input() c=0 d=0 for i in range(x): if x[i]=='S' and x[i+1]=='F': c+=1 elif x[i]=='F' and x[i+1]=='C': d+=1 if c>d: print("YES") else: print("NO") ```
-1
0
none
none
none
0
[ "none" ]
null
null
Everyone knows that DNA strands consist of nucleotides. There are four types of nucleotides: "A", "T", "G", "C". A DNA strand is a sequence of nucleotides. Scientists decided to track evolution of a rare species, which DNA strand was string *s* initially. Evolution of the species is described as a sequence of changes in the DNA. Every change is a change of some nucleotide, for example, the following change can happen in DNA strand "AAGC": the second nucleotide can change to "T" so that the resulting DNA strand is "ATGC". Scientists know that some segments of the DNA strand can be affected by some unknown infections. They can represent an infection as a sequence of nucleotides. Scientists are interested if there are any changes caused by some infections. Thus they sometimes want to know the value of impact of some infection to some segment of the DNA. This value is computed as follows: - Let the infection be represented as a string *e*, and let scientists be interested in DNA strand segment starting from position *l* to position *r*, inclusive. - Prefix of the string *eee*... (i.e. the string that consists of infinitely many repeats of string *e*) is written under the string *s* from position *l* to position *r*, inclusive. - The value of impact is the number of positions where letter of string *s* coincided with the letter written under it. Being a developer, Innokenty is interested in bioinformatics also, so the scientists asked him for help. Innokenty is busy preparing VK Cup, so he decided to delegate the problem to the competitors. Help the scientists!
The first line contains the string *s* (1<=≤<=|*s*|<=≤<=105) that describes the initial DNA strand. It consists only of capital English letters "A", "T", "G" and "C". The next line contains single integer *q* (1<=≤<=*q*<=≤<=105) — the number of events. After that, *q* lines follow, each describes one event. Each of the lines has one of two formats: - 1 x c, where *x* is an integer (1<=≤<=*x*<=≤<=|*s*|), and *c* is a letter "A", "T", "G" or "C", which means that there is a change in the DNA: the nucleotide at position *x* is now *c*. - 2 l r e, where *l*, *r* are integers (1<=≤<=*l*<=≤<=*r*<=≤<=|*s*|), and *e* is a string of letters "A", "T", "G" and "C" (1<=≤<=|*e*|<=≤<=10), which means that scientists are interested in the value of impact of infection *e* to the segment of DNA strand from position *l* to position *r*, inclusive.
For each scientists' query (second type query) print a single integer in a new line — the value of impact of the infection on the DNA.
[ "ATGCATGC\n4\n2 1 8 ATGC\n2 2 6 TTT\n1 4 T\n2 2 6 TA\n", "GAGTTGTTAA\n6\n2 3 4 TATGGTG\n1 1 T\n1 6 G\n2 5 9 AGTAATA\n1 10 G\n2 2 6 TTGT\n" ]
[ "8\n2\n4\n", "0\n3\n1\n" ]
Consider the first example. In the first query of second type all characters coincide, so the answer is 8. In the second query we compare string "TTTTT..." and the substring "TGCAT". There are two matches. In the third query, after the DNA change, we compare string "TATAT..."' with substring "TGTAT". There are 4 matches.
0
[]
1,499,794,984
3,484
Python 3
TIME_LIMIT_EXCEEDED
TESTS
8
2,000
6,041,600
s=['']*(10**5+1) st=input() s[1:1+len(st)]=st for _ in range(int(input())): inp=input().split() if inp[0]=='1': x,c=int(inp[1]),inp[2] s[x]=c else: l,r,e=int(inp[1]),int(inp[2]),inp[3] ans=0 place=-1 for i in range(l,r+1): place+=1 if s[i]==e[(place)%len(e)]:ans+=1 #print(s[i],e[(l-i)%len(e)]) print(ans)
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Everyone knows that DNA strands consist of nucleotides. There are four types of nucleotides: "A", "T", "G", "C". A DNA strand is a sequence of nucleotides. Scientists decided to track evolution of a rare species, which DNA strand was string *s* initially. Evolution of the species is described as a sequence of changes in the DNA. Every change is a change of some nucleotide, for example, the following change can happen in DNA strand "AAGC": the second nucleotide can change to "T" so that the resulting DNA strand is "ATGC". Scientists know that some segments of the DNA strand can be affected by some unknown infections. They can represent an infection as a sequence of nucleotides. Scientists are interested if there are any changes caused by some infections. Thus they sometimes want to know the value of impact of some infection to some segment of the DNA. This value is computed as follows: - Let the infection be represented as a string *e*, and let scientists be interested in DNA strand segment starting from position *l* to position *r*, inclusive. - Prefix of the string *eee*... (i.e. the string that consists of infinitely many repeats of string *e*) is written under the string *s* from position *l* to position *r*, inclusive. - The value of impact is the number of positions where letter of string *s* coincided with the letter written under it. Being a developer, Innokenty is interested in bioinformatics also, so the scientists asked him for help. Innokenty is busy preparing VK Cup, so he decided to delegate the problem to the competitors. Help the scientists! Input Specification: The first line contains the string *s* (1<=≤<=|*s*|<=≤<=105) that describes the initial DNA strand. It consists only of capital English letters "A", "T", "G" and "C". The next line contains single integer *q* (1<=≤<=*q*<=≤<=105) — the number of events. After that, *q* lines follow, each describes one event. Each of the lines has one of two formats: - 1 x c, where *x* is an integer (1<=≤<=*x*<=≤<=|*s*|), and *c* is a letter "A", "T", "G" or "C", which means that there is a change in the DNA: the nucleotide at position *x* is now *c*. - 2 l r e, where *l*, *r* are integers (1<=≤<=*l*<=≤<=*r*<=≤<=|*s*|), and *e* is a string of letters "A", "T", "G" and "C" (1<=≤<=|*e*|<=≤<=10), which means that scientists are interested in the value of impact of infection *e* to the segment of DNA strand from position *l* to position *r*, inclusive. Output Specification: For each scientists' query (second type query) print a single integer in a new line — the value of impact of the infection on the DNA. Demo Input: ['ATGCATGC\n4\n2 1 8 ATGC\n2 2 6 TTT\n1 4 T\n2 2 6 TA\n', 'GAGTTGTTAA\n6\n2 3 4 TATGGTG\n1 1 T\n1 6 G\n2 5 9 AGTAATA\n1 10 G\n2 2 6 TTGT\n'] Demo Output: ['8\n2\n4\n', '0\n3\n1\n'] Note: Consider the first example. In the first query of second type all characters coincide, so the answer is 8. In the second query we compare string "TTTTT..." and the substring "TGCAT". There are two matches. In the third query, after the DNA change, we compare string "TATAT..."' with substring "TGTAT". There are 4 matches.
```python s=['']*(10**5+1) st=input() s[1:1+len(st)]=st for _ in range(int(input())): inp=input().split() if inp[0]=='1': x,c=int(inp[1]),inp[2] s[x]=c else: l,r,e=int(inp[1]),int(inp[2]),inp[3] ans=0 place=-1 for i in range(l,r+1): place+=1 if s[i]==e[(place)%len(e)]:ans+=1 #print(s[i],e[(l-i)%len(e)]) print(ans) ```
0
1,003
C
Intense Heat
PROGRAMMING
1,300
[ "brute force", "implementation", "math" ]
null
null
The heat during the last few days has been really intense. Scientists from all over the Berland study how the temperatures and weather change, and they claim that this summer is abnormally hot. But any scientific claim sounds a lot more reasonable if there are some numbers involved, so they have decided to actually calculate some value which would represent how high the temperatures are. Mathematicians of Berland State University came up with a special heat intensity value. This value is calculated as follows: Suppose we want to analyze the segment of $n$ consecutive days. We have measured the temperatures during these $n$ days; the temperature during $i$-th day equals $a_i$. We denote the average temperature of a segment of some consecutive days as the arithmetic mean of the temperature measures during this segment of days. So, if we want to analyze the average temperature from day $x$ to day $y$, we calculate it as $\frac{\sum \limits_{i = x}^{y} a_i}{y - x + 1}$ (note that division is performed without any rounding). The heat intensity value is the maximum of average temperatures over all segments of not less than $k$ consecutive days. For example, if analyzing the measures $[3, 4, 1, 2]$ and $k = 3$, we are interested in segments $[3, 4, 1]$, $[4, 1, 2]$ and $[3, 4, 1, 2]$ (we want to find the maximum value of average temperature over these segments). You have been hired by Berland State University to write a program that would compute the heat intensity value of a given period of days. Are you up to this task?
The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 5000$) — the number of days in the given period, and the minimum number of days in a segment we consider when calculating heat intensity value, respectively. The second line contains $n$ integers $a_1$, $a_2$, ..., $a_n$ ($1 \le a_i \le 5000$) — the temperature measures during given $n$ days.
Print one real number — the heat intensity value, i. e., the maximum of average temperatures over all segments of not less than $k$ consecutive days. Your answer will be considered correct if the following condition holds: $|res - res_0| &lt; 10^{-6}$, where $res$ is your answer, and $res_0$ is the answer given by the jury's solution.
[ "4 3\n3 4 1 2\n" ]
[ "2.666666666666667\n" ]
none
0
[ { "input": "4 3\n3 4 1 2", "output": "2.666666666666667" }, { "input": "5 1\n3 10 9 10 6", "output": "10.000000000000000" }, { "input": "5 2\n7 3 3 1 8", "output": "5.000000000000000" }, { "input": "5 3\n1 7 6 9 1", "output": "7.333333333333333" }, { "input": "5 4\n5 1 10 6 1", "output": "5.500000000000000" }, { "input": "5 5\n4 6 6 6 2", "output": "4.800000000000000" }, { "input": "3 2\n2 1 2", "output": "1.666666666666667" }, { "input": "1 1\n5000", "output": "5000.000000000000000" } ]
1,698,783,506
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
12
4,000
409,600
n,k=map(int,input().split()) a=list(map(int,input().split())) pref=[0] for e in a: pref.append(pref[-1] + e) s=0 for i in range(n): for j in range(i+k,n+1): s=max(s,(pref[j]-pref[i])/(j-i)) print(s)
Title: Intense Heat Time Limit: None seconds Memory Limit: None megabytes Problem Description: The heat during the last few days has been really intense. Scientists from all over the Berland study how the temperatures and weather change, and they claim that this summer is abnormally hot. But any scientific claim sounds a lot more reasonable if there are some numbers involved, so they have decided to actually calculate some value which would represent how high the temperatures are. Mathematicians of Berland State University came up with a special heat intensity value. This value is calculated as follows: Suppose we want to analyze the segment of $n$ consecutive days. We have measured the temperatures during these $n$ days; the temperature during $i$-th day equals $a_i$. We denote the average temperature of a segment of some consecutive days as the arithmetic mean of the temperature measures during this segment of days. So, if we want to analyze the average temperature from day $x$ to day $y$, we calculate it as $\frac{\sum \limits_{i = x}^{y} a_i}{y - x + 1}$ (note that division is performed without any rounding). The heat intensity value is the maximum of average temperatures over all segments of not less than $k$ consecutive days. For example, if analyzing the measures $[3, 4, 1, 2]$ and $k = 3$, we are interested in segments $[3, 4, 1]$, $[4, 1, 2]$ and $[3, 4, 1, 2]$ (we want to find the maximum value of average temperature over these segments). You have been hired by Berland State University to write a program that would compute the heat intensity value of a given period of days. Are you up to this task? Input Specification: The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 5000$) — the number of days in the given period, and the minimum number of days in a segment we consider when calculating heat intensity value, respectively. The second line contains $n$ integers $a_1$, $a_2$, ..., $a_n$ ($1 \le a_i \le 5000$) — the temperature measures during given $n$ days. Output Specification: Print one real number — the heat intensity value, i. e., the maximum of average temperatures over all segments of not less than $k$ consecutive days. Your answer will be considered correct if the following condition holds: $|res - res_0| &lt; 10^{-6}$, where $res$ is your answer, and $res_0$ is the answer given by the jury's solution. Demo Input: ['4 3\n3 4 1 2\n'] Demo Output: ['2.666666666666667\n'] Note: none
```python n,k=map(int,input().split()) a=list(map(int,input().split())) pref=[0] for e in a: pref.append(pref[-1] + e) s=0 for i in range(n): for j in range(i+k,n+1): s=max(s,(pref[j]-pref[i])/(j-i)) print(s) ```
0
735
D
Taxes
PROGRAMMING
1,600
[ "math", "number theory" ]
null
null
Mr. Funt now lives in a country with a very specific tax laws. The total income of mr. Funt during this year is equal to *n* (*n*<=≥<=2) burles and the amount of tax he has to pay is calculated as the maximum divisor of *n* (not equal to *n*, of course). For example, if *n*<==<=6 then Funt has to pay 3 burles, while for *n*<==<=25 he needs to pay 5 and if *n*<==<=2 he pays only 1 burle. As mr. Funt is a very opportunistic person he wants to cheat a bit. In particular, he wants to split the initial *n* in several parts *n*1<=+<=*n*2<=+<=...<=+<=*n**k*<==<=*n* (here *k* is arbitrary, even *k*<==<=1 is allowed) and pay the taxes for each part separately. He can't make some part equal to 1 because it will reveal him. So, the condition *n**i*<=≥<=2 should hold for all *i* from 1 to *k*. Ostap Bender wonders, how many money Funt has to pay (i.e. minimal) if he chooses and optimal way to split *n* in parts.
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=2·109) — the total year income of mr. Funt.
Print one integer — minimum possible number of burles that mr. Funt has to pay as a tax.
[ "4\n", "27\n" ]
[ "2\n", "3\n" ]
none
1,750
[ { "input": "4", "output": "2" }, { "input": "27", "output": "3" }, { "input": "3", "output": "1" }, { "input": "5", "output": "1" }, { "input": "10", "output": "2" }, { "input": "2000000000", "output": "2" }, { "input": "26", "output": "2" }, { "input": "7", "output": "1" }, { "input": "2", "output": "1" }, { "input": "11", "output": "1" }, { "input": "1000000007", "output": "1" }, { "input": "1000000009", "output": "1" }, { "input": "1999999999", "output": "3" }, { "input": "1000000011", "output": "2" }, { "input": "101", "output": "1" }, { "input": "103", "output": "1" }, { "input": "1001", "output": "3" }, { "input": "1003", "output": "3" }, { "input": "10001", "output": "3" }, { "input": "10003", "output": "3" }, { "input": "129401294", "output": "2" }, { "input": "234911024", "output": "2" }, { "input": "192483501", "output": "3" }, { "input": "1234567890", "output": "2" }, { "input": "719241201", "output": "3" }, { "input": "9", "output": "2" }, { "input": "33", "output": "2" }, { "input": "25", "output": "2" }, { "input": "15", "output": "2" }, { "input": "147", "output": "3" }, { "input": "60119912", "output": "2" }, { "input": "45", "output": "2" }, { "input": "21", "output": "2" }, { "input": "9975", "output": "2" }, { "input": "17", "output": "1" }, { "input": "99", "output": "2" }, { "input": "49", "output": "2" }, { "input": "243", "output": "2" }, { "input": "43", "output": "1" }, { "input": "39", "output": "2" }, { "input": "6", "output": "2" }, { "input": "8", "output": "2" }, { "input": "12", "output": "2" }, { "input": "13", "output": "1" }, { "input": "14", "output": "2" }, { "input": "16", "output": "2" }, { "input": "18", "output": "2" }, { "input": "19", "output": "1" }, { "input": "20", "output": "2" }, { "input": "22", "output": "2" }, { "input": "23", "output": "1" }, { "input": "24", "output": "2" }, { "input": "962", "output": "2" }, { "input": "29", "output": "1" }, { "input": "55", "output": "2" }, { "input": "125", "output": "3" }, { "input": "1999999929", "output": "2" }, { "input": "493", "output": "2" }, { "input": "10000021", "output": "2" }, { "input": "541", "output": "1" }, { "input": "187", "output": "3" }, { "input": "95", "output": "3" }, { "input": "999991817", "output": "3" }, { "input": "37998938", "output": "2" }, { "input": "1847133842", "output": "2" }, { "input": "1000000005", "output": "3" }, { "input": "19828", "output": "2" }, { "input": "998321704", "output": "2" }, { "input": "370359", "output": "3" }, { "input": "115", "output": "2" }, { "input": "200000015", "output": "3" }, { "input": "479001600", "output": "2" }, { "input": "536870912", "output": "2" }, { "input": "10759922", "output": "2" }, { "input": "1999999927", "output": "1" }, { "input": "123", "output": "3" }, { "input": "200743933", "output": "3" }, { "input": "949575615", "output": "3" }, { "input": "99990001", "output": "1" }, { "input": "715827883", "output": "1" }, { "input": "5592406", "output": "2" }, { "input": "8388609", "output": "3" }, { "input": "1908903481", "output": "3" }, { "input": "1076153021", "output": "3" }, { "input": "344472101", "output": "3" } ]
1,609,085,025
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
5
140
1,228,800
def isPrime(n): if (n <= 1): return False if (n <= 3): return True if (n % 2 == 0 or n % 3 == 0): return False i = 5 while (i * i <= n): if (n % i == 0 or n % (i + 2) == 0): return False i = i + 6 return True def solve(n): if(n%2==0): n-=1 while isPrime(n)==False and n>1: n-=2 return n n=int(input()) ans=0 while n>0: if (isPrime(n)): ans+=1 n-=n continue a=solve(n) #print(a) if(n-a>1): ans+=1 n-=a else: b=solve(a) ans+=1 n-=b #print(b,n) print(ans)
Title: Taxes Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mr. Funt now lives in a country with a very specific tax laws. The total income of mr. Funt during this year is equal to *n* (*n*<=≥<=2) burles and the amount of tax he has to pay is calculated as the maximum divisor of *n* (not equal to *n*, of course). For example, if *n*<==<=6 then Funt has to pay 3 burles, while for *n*<==<=25 he needs to pay 5 and if *n*<==<=2 he pays only 1 burle. As mr. Funt is a very opportunistic person he wants to cheat a bit. In particular, he wants to split the initial *n* in several parts *n*1<=+<=*n*2<=+<=...<=+<=*n**k*<==<=*n* (here *k* is arbitrary, even *k*<==<=1 is allowed) and pay the taxes for each part separately. He can't make some part equal to 1 because it will reveal him. So, the condition *n**i*<=≥<=2 should hold for all *i* from 1 to *k*. Ostap Bender wonders, how many money Funt has to pay (i.e. minimal) if he chooses and optimal way to split *n* in parts. Input Specification: The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=2·109) — the total year income of mr. Funt. Output Specification: Print one integer — minimum possible number of burles that mr. Funt has to pay as a tax. Demo Input: ['4\n', '27\n'] Demo Output: ['2\n', '3\n'] Note: none
```python def isPrime(n): if (n <= 1): return False if (n <= 3): return True if (n % 2 == 0 or n % 3 == 0): return False i = 5 while (i * i <= n): if (n % i == 0 or n % (i + 2) == 0): return False i = i + 6 return True def solve(n): if(n%2==0): n-=1 while isPrime(n)==False and n>1: n-=2 return n n=int(input()) ans=0 while n>0: if (isPrime(n)): ans+=1 n-=n continue a=solve(n) #print(a) if(n-a>1): ans+=1 n-=a else: b=solve(a) ans+=1 n-=b #print(b,n) print(ans) ```
0
270
A
Fancy Fence
PROGRAMMING
1,100
[ "geometry", "implementation", "math" ]
null
null
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot. He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*. Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
The first line of input contains an integer *t* (0<=&lt;<=*t*<=&lt;<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=&lt;<=*a*<=&lt;<=180) — the angle the robot can make corners at measured in degrees.
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
[ "3\n30\n60\n90\n" ]
[ "NO\nYES\nYES\n" ]
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second test case, the fence is a regular triangle, and in the last test case — a square.
500
[ { "input": "3\n30\n60\n90", "output": "NO\nYES\nYES" }, { "input": "6\n1\n2\n3\n170\n179\n25", "output": "NO\nNO\nNO\nYES\nYES\nNO" } ]
1,638,466,147
2,147,483,647
Python 3
OK
TESTS
3
62
0
for _ in range(int(input())): a = int(input()) ans = 360 / (180 - a) if ans == int(ans): print("YES") else: print("NO")
Title: Fancy Fence Time Limit: None seconds Memory Limit: None megabytes Problem Description: Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot. He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*. Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*? Input Specification: The first line of input contains an integer *t* (0<=&lt;<=*t*<=&lt;<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=&lt;<=*a*<=&lt;<=180) — the angle the robot can make corners at measured in degrees. Output Specification: For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible. Demo Input: ['3\n30\n60\n90\n'] Demo Output: ['NO\nYES\nYES\n'] Note: In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second test case, the fence is a regular triangle, and in the last test case — a square.
```python for _ in range(int(input())): a = int(input()) ans = 360 / (180 - a) if ans == int(ans): print("YES") else: print("NO") ```
3
873
B
Balanced Substring
PROGRAMMING
1,500
[ "dp", "implementation" ]
null
null
You are given a string *s* consisting only of characters 0 and 1. A substring [*l*,<=*r*] of *s* is a string *s**l**s**l*<=+<=1*s**l*<=+<=2... *s**r*, and its length equals to *r*<=-<=*l*<=+<=1. A substring is called balanced if the number of zeroes (0) equals to the number of ones in this substring. You have to determine the length of the longest balanced substring of *s*.
The first line contains *n* (1<=≤<=*n*<=≤<=100000) — the number of characters in *s*. The second line contains a string *s* consisting of exactly *n* characters. Only characters 0 and 1 can appear in *s*.
If there is no non-empty balanced substring in *s*, print 0. Otherwise, print the length of the longest balanced substring.
[ "8\n11010111\n", "3\n111\n" ]
[ "4\n", "0\n" ]
In the first example you can choose the substring [3, 6]. It is balanced, and its length is 4. Choosing the substring [2, 5] is also possible. In the second example it's impossible to find a non-empty balanced substring.
0
[ { "input": "8\n11010111", "output": "4" }, { "input": "3\n111", "output": "0" }, { "input": "11\n00001000100", "output": "2" }, { "input": "10\n0100000000", "output": "2" }, { "input": "13\n0001000011010", "output": "6" }, { "input": "14\n00000100101011", "output": "10" }, { "input": "14\n01111101111111", "output": "2" }, { "input": "18\n110010101101111111", "output": "10" }, { "input": "11\n00010000011", "output": "4" }, { "input": "10\n1000010110", "output": "6" }, { "input": "15\n100000100000011", "output": "4" }, { "input": "18\n011010101110111101", "output": "8" }, { "input": "10\n0011011111", "output": "6" }, { "input": "3\n011", "output": "2" }, { "input": "14\n11111111111111", "output": "0" }, { "input": "65\n11001000110001001011011110111100000000101001001010101111000100010", "output": "48" }, { "input": "10\n0011111000", "output": "10" }, { "input": "13\n1110000001110", "output": "12" }, { "input": "3\n110", "output": "2" }, { "input": "4\n1110", "output": "2" }, { "input": "9\n001011001", "output": "8" }, { "input": "2\n10", "output": "2" }, { "input": "2\n01", "output": "2" }, { "input": "12\n110000110000", "output": "8" }, { "input": "3\n001", "output": "2" }, { "input": "14\n11000011000000", "output": "8" }, { "input": "19\n0000011111111100000", "output": "18" }, { "input": "45\n011010001100001111110001011100000001101100111", "output": "44" }, { "input": "18\n000001111111100000", "output": "16" }, { "input": "4\n0101", "output": "4" }, { "input": "12\n000101011001", "output": "10" } ]
1,679,054,635
2,147,483,647
PyPy 3
OK
TESTS
53
108
9,216,000
input() d={0:-1} a=b=0 for i,c in enumerate(input()): b+=2*int(c)-1 d[b]=x=d.get(b,i) a=max(a,i-x) print(a)
Title: Balanced Substring Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a string *s* consisting only of characters 0 and 1. A substring [*l*,<=*r*] of *s* is a string *s**l**s**l*<=+<=1*s**l*<=+<=2... *s**r*, and its length equals to *r*<=-<=*l*<=+<=1. A substring is called balanced if the number of zeroes (0) equals to the number of ones in this substring. You have to determine the length of the longest balanced substring of *s*. Input Specification: The first line contains *n* (1<=≤<=*n*<=≤<=100000) — the number of characters in *s*. The second line contains a string *s* consisting of exactly *n* characters. Only characters 0 and 1 can appear in *s*. Output Specification: If there is no non-empty balanced substring in *s*, print 0. Otherwise, print the length of the longest balanced substring. Demo Input: ['8\n11010111\n', '3\n111\n'] Demo Output: ['4\n', '0\n'] Note: In the first example you can choose the substring [3, 6]. It is balanced, and its length is 4. Choosing the substring [2, 5] is also possible. In the second example it's impossible to find a non-empty balanced substring.
```python input() d={0:-1} a=b=0 for i,c in enumerate(input()): b+=2*int(c)-1 d[b]=x=d.get(b,i) a=max(a,i-x) print(a) ```
3
549
A
Face Detection
PROGRAMMING
900
[ "implementation", "strings" ]
null
null
The developers of Looksery have to write an efficient algorithm that detects faces on a picture. Unfortunately, they are currently busy preparing a contest for you, so you will have to do it for them. In this problem an image is a rectangular table that consists of lowercase Latin letters. A face on the image is a 2<=×<=2 square, such that from the four letters of this square you can make word "face". You need to write a program that determines the number of faces on the image. The squares that correspond to the faces can overlap.
The first line contains two space-separated integers, *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50) — the height and the width of the image, respectively. Next *n* lines define the image. Each line contains *m* lowercase Latin letters.
In the single line print the number of faces on the image.
[ "4 4\nxxxx\nxfax\nxcex\nxxxx\n", "4 2\nxx\ncf\nae\nxx\n", "2 3\nfac\ncef\n", "1 4\nface\n" ]
[ "1\n", "1\n", "2\n", "0\n" ]
In the first sample the image contains a single face, located in a square with the upper left corner at the second line and the second column: In the second sample the image also contains exactly one face, its upper left corner is at the second row and the first column. In the third sample two faces are shown: In the fourth sample the image has no faces on it.
250
[ { "input": "4 4\nxxxx\nxfax\nxcex\nxxxx", "output": "1" }, { "input": "4 2\nxx\ncf\nae\nxx", "output": "1" }, { "input": "2 3\nfac\ncef", "output": "2" }, { "input": "1 4\nface", "output": "0" }, { "input": "5 5\nwmmwn\nlurcm\nkeetd\nfokon\ncxxgx", "output": "0" }, { "input": "5 5\nkjxbw\neacra\nxefhx\nucmcz\npgtjk", "output": "1" }, { "input": "1 1\np", "output": "0" }, { "input": "2 5\nacdmw\nefazb", "output": "1" }, { "input": "5 2\ndz\nda\nsx\nyu\nzz", "output": "0" }, { "input": "5 5\nxeljd\nwriac\nveief\nlcacf\nbqefn", "output": "2" }, { "input": "5 5\nacnbx\nefacp\nlrefa\norqce\nzvbay", "output": "3" }, { "input": "5 5\nbyjvu\nkmaca\nalefe\nwcacg\nrefez", "output": "5" }, { "input": "5 5\npuxac\nbbaef\naccfa\nefaec\nligsr", "output": "5" }, { "input": "37 4\nacjo\nefac\nacef\nefac\nwpef\nicac\naefe\ncfac\naece\ncfaf\nyqce\nmiaf\nirce\nycaf\naefc\ncfae\nrsnc\nbacz\nqefb\npdhs\nffac\nfaef\nacfd\nacmi\nefvm\nacaz\nefpn\nacao\nefer\nacap\nefec\nacaf\nefef\nacbj\nefac\nacef\nefoz", "output": "49" }, { "input": "7 3\njac\naef\ncfa\naec\ncfq\ndig\nxyq", "output": "5" }, { "input": "35 1\ny\na\nk\ng\ni\nd\nv\nn\nl\nx\nu\nx\nu\no\nd\nf\nk\nj\nr\nm\nq\ns\nc\nd\nc\nm\nv\nh\nn\ne\nl\nt\nz\ny\no", "output": "0" }, { "input": "9 46\nuuexbaacesjclggslacermcbkxlcxhdgqtacdwfryxzuxc\naclrsaefakndbnzlkefenuphgcgoedhkaxefjtnkgfeaca\nefuqunpmfxdyyffyhvracozzrxlpekhtsrfhlilfmyhefg\numyacfzffvicqtdpiulefnwcojuwtfbvlxkfsiapdnzpqo\nactefvuxqptremlqjhdbdwacjxdxitxjktecvefacamjcz\neflarseklqrkayhosverpfefzirqigzlxezabhzeferkwm\nztpypwxyohtacsnnvoigqwcachtaceyxlkhfhgwbnfmklb\nfzpqeymhljiefctvqtbgcdjefkxefarbciyosmktmoziac\nbssxizyrzyhacszttwhrzspbfkgfcejybdjcpuczhrkqef", "output": "20" }, { "input": "7 30\nmjfracgaacacctacrreyrlkacuacay\nrlacefacefeftaeftkacacaefcefev\nacefacefacraccfaeaefefecaeacaf\nefacefacefaefaecfcfacacaecfefa\nncefacefacecacfaeaecefefcaeace\nfafaceacuafaefadcfcafacaefcfea\nzsvefafukcecfarkaeaecefecailgu", "output": "95" }, { "input": "2 2\nff\nee", "output": "0" }, { "input": "2 2\nfa\ncc", "output": "0" }, { "input": "2 2\nfa\naa", "output": "0" }, { "input": "2 2\nfa\nea", "output": "0" }, { "input": "2 2\nfa\ndd", "output": "0" }, { "input": "2 2\nee\nff", "output": "0" }, { "input": "2 2\ncc\ncf", "output": "0" }, { "input": "2 2\naa\nae", "output": "0" }, { "input": "2 2\nef\nac", "output": "1" }, { "input": "2 2\nfe\nca", "output": "1" } ]
1,434,126,828
2,147,483,647
Python 3
OK
TESTS
37
62
0
m, n = map(int, input().split(' ')) pic = [] count = 0 if m < 2 or n < 2: print(0) exit() for i in range(m): pic.append(input()) for i in range(m-1): for j in range(n-1): #print(pic[i+1][j:j+2]) s = pic[i][j:j+2] + pic[i+1][j:j+2] if 'f' in s and 'a' in s and 'c' in s and 'e' in s: count += 1 print(count)
Title: Face Detection Time Limit: None seconds Memory Limit: None megabytes Problem Description: The developers of Looksery have to write an efficient algorithm that detects faces on a picture. Unfortunately, they are currently busy preparing a contest for you, so you will have to do it for them. In this problem an image is a rectangular table that consists of lowercase Latin letters. A face on the image is a 2<=×<=2 square, such that from the four letters of this square you can make word "face". You need to write a program that determines the number of faces on the image. The squares that correspond to the faces can overlap. Input Specification: The first line contains two space-separated integers, *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50) — the height and the width of the image, respectively. Next *n* lines define the image. Each line contains *m* lowercase Latin letters. Output Specification: In the single line print the number of faces on the image. Demo Input: ['4 4\nxxxx\nxfax\nxcex\nxxxx\n', '4 2\nxx\ncf\nae\nxx\n', '2 3\nfac\ncef\n', '1 4\nface\n'] Demo Output: ['1\n', '1\n', '2\n', '0\n'] Note: In the first sample the image contains a single face, located in a square with the upper left corner at the second line and the second column: In the second sample the image also contains exactly one face, its upper left corner is at the second row and the first column. In the third sample two faces are shown: In the fourth sample the image has no faces on it.
```python m, n = map(int, input().split(' ')) pic = [] count = 0 if m < 2 or n < 2: print(0) exit() for i in range(m): pic.append(input()) for i in range(m-1): for j in range(n-1): #print(pic[i+1][j:j+2]) s = pic[i][j:j+2] + pic[i+1][j:j+2] if 'f' in s and 'a' in s and 'c' in s and 'e' in s: count += 1 print(count) ```
3
581
A
Vasya the Hipster
PROGRAMMING
800
[ "implementation", "math" ]
null
null
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks. According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot. Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them. Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Can you help him?
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
[ "3 1\n", "2 3\n", "7 3\n" ]
[ "1 1\n", "2 0\n", "3 2\n" ]
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
500
[ { "input": "3 1", "output": "1 1" }, { "input": "2 3", "output": "2 0" }, { "input": "7 3", "output": "3 2" }, { "input": "100 100", "output": "100 0" }, { "input": "4 10", "output": "4 3" }, { "input": "6 10", "output": "6 2" }, { "input": "6 11", "output": "6 2" }, { "input": "10 40", "output": "10 15" }, { "input": "11 56", "output": "11 22" }, { "input": "34 30", "output": "30 2" }, { "input": "33 33", "output": "33 0" }, { "input": "100 45", "output": "45 27" }, { "input": "100 23", "output": "23 38" }, { "input": "45 12", "output": "12 16" }, { "input": "1 1", "output": "1 0" }, { "input": "1 100", "output": "1 49" }, { "input": "100 1", "output": "1 49" }, { "input": "68 59", "output": "59 4" }, { "input": "45 99", "output": "45 27" }, { "input": "99 100", "output": "99 0" }, { "input": "100 98", "output": "98 1" }, { "input": "59 12", "output": "12 23" }, { "input": "86 4", "output": "4 41" }, { "input": "68 21", "output": "21 23" }, { "input": "100 11", "output": "11 44" }, { "input": "100 10", "output": "10 45" }, { "input": "15 45", "output": "15 15" }, { "input": "11 32", "output": "11 10" }, { "input": "34 96", "output": "34 31" }, { "input": "89 89", "output": "89 0" } ]
1,679,898,507
2,147,483,647
Python 3
OK
TESTS
30
46
0
a, b = map(int, input().split(' ')) min1 = int(min(a, b)) a -= min1 b -= min1 max1 = int(max(a, b)) print(min1, max1 // 2)
Title: Vasya the Hipster Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks. According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot. Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them. Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Can you help him? Input Specification: The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got. Output Specification: Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day. Demo Input: ['3 1\n', '2 3\n', '7 3\n'] Demo Output: ['1 1\n', '2 0\n', '3 2\n'] Note: In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
```python a, b = map(int, input().split(' ')) min1 = int(min(a, b)) a -= min1 b -= min1 max1 = int(max(a, b)) print(min1, max1 // 2) ```
3
149
E
Martian Strings
PROGRAMMING
2,300
[ "string suffix structures", "strings" ]
null
null
During the study of the Martians Petya clearly understood that the Martians are absolutely lazy. They like to sleep and don't like to wake up. Imagine a Martian who has exactly *n* eyes located in a row and numbered from the left to the right from 1 to *n*. When a Martian sleeps, he puts a patch on each eye (so that the Martian morning doesn't wake him up). The inner side of each patch has an uppercase Latin letter. So, when a Martian wakes up and opens all his eyes he sees a string *s* consisting of uppercase Latin letters. The string's length is *n*. "Ding dong!" — the alarm goes off. A Martian has already woken up but he hasn't opened any of his eyes. He feels that today is going to be a hard day, so he wants to open his eyes and see something good. The Martian considers only *m* Martian words beautiful. Besides, it is hard for him to open all eyes at once so early in the morning. So he opens two non-overlapping segments of consecutive eyes. More formally, the Martian chooses four numbers *a*, *b*, *c*, *d*, (1<=≤<=*a*<=≤<=*b*<=&lt;<=*c*<=≤<=*d*<=≤<=*n*) and opens all eyes with numbers *i* such that *a*<=≤<=*i*<=≤<=*b* or *c*<=≤<=*i*<=≤<=*d*. After the Martian opens the eyes he needs, he reads all the visible characters from the left to the right and thus, he sees some word. Let's consider all different words the Martian can see in the morning. Your task is to find out how many beautiful words are among them.
The first line contains a non-empty string *s* consisting of uppercase Latin letters. The strings' length is *n* (2<=≤<=*n*<=≤<=105). The second line contains an integer *m* (1<=≤<=*m*<=≤<=100) — the number of beautiful words. Next *m* lines contain the beautiful words *p**i*, consisting of uppercase Latin letters. Their length is from 1 to 1000. All beautiful strings are pairwise different.
Print the single integer — the number of different beautiful strings the Martian can see this morning.
[ "ABCBABA\n2\nBAAB\nABBA\n" ]
[ "1\n" ]
Let's consider the sample test. There the Martian can get only the second beautiful string if he opens segments of eyes *a* = 1, *b* = 2 and *c* = 4, *d* = 5 or of he opens segments of eyes *a* = 1, *b* = 2 and *c* = 6, *d* = 7.
2,500
[ { "input": "ABCBABA\n2\nBAAB\nABBA", "output": "1" }, { "input": "AAAAAAAAAA\n4\nAA\nAAAA\nA\nAAAAAAA", "output": "3" }, { "input": "AABABBAAAB\n4\nABBA\nBABAABBABA\nA\nAABBBAABABB", "output": "1" }, { "input": "AABBB\n1\nBBABAB", "output": "0" }, { "input": "BA\n10\nABA\nBABB\nBAAB\nAABBAA\nB\nBAA\nAABBB\nAAAAABBAA\nABBABA\nAABB", "output": "0" }, { "input": "BBABAABAABBBBAB\n10\nBBABAABAABBA\nA\nBBAA\nAAAABB\nAA\nAABB\nABBBBABAABA\nABB\nAAABABBAAABAAAA\nBABAA", "output": "7" }, { "input": "BBAABAABBABAABA\n8\nBBA\nAA\nAABAAAAAABA\nAABBB\nAAAAABABAAABABAAAABA\nBABA\nA\nBAABBBAAAAB", "output": "4" }, { "input": "BBBAAAAAABBAAAA\n1\nB", "output": "0" }, { "input": "CBBABCCCACABABAB\n2\nCBBCBCA\nBAACCBABAA", "output": "0" }, { "input": "BCCCABCBAAACCBCCAABAABCACBCBBA\n20\nBBCCBBAB\nBAC\nACBAACBAAABABAABBBACABC\nCCBCBCCA\nCCABB\nCCABCCCC\nABA\nCABACACBCBCA\nCBCACBBBBB\nBAAACBCBAABCC\nBBABBBAACCACCACBCBACAABC\nBCBCA\nC\nBAA\nCCBBCAACBCBA\nCACCB\nBCCB\nBBCBAAC\nABACCABCBAACACABBCCCBAC\nCC", "output": "8" }, { "input": "AB\n1\nAB", "output": "1" }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\n1\nAA", "output": "1" }, { "input": "CBCBBCCCBABCBCCAABBCBACAABCCBB\n20\nCBCCAC\nCAAA\nCB\nBBCB\nBCBC\nCAABCCA\nBCBBCC\nCBABCB\nBBCCCBABCB\nBABBCCC\nBCC\nABBCBCC\nAAAAB\nCCCAABB\nBABBCBACA\nBCCBBA\nACAABCCCCB\nBBA\nBBCBACCCA\nAAA", "output": "15" } ]
1,668,923,966
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
1
154
1,433,600
import sys, os, io input = io.BytesIO(os.read(0, os.fstat(0).st_size)).readline def z_algorithm(w): m = len(w) z = [0] * m z[0] = m i, j = 1, 0 while i < m: while i + j < m and w[j] == w[i + j]: j += 1 z[i] = j if not j: i += 1 continue l = 1 while l < j and l + z[l] < j: z[i + l] = z[l] l += 1 i += l j -= l return z s = list(input().rstrip()) l = 1005 x = [0] * l + s y = [0] * l + s[::-1] ans = 0 m = int(input()) for _ in range(m): p = list(input().rstrip()) n = len(p) for i in range(n): x[i], y[i] = p[i], p[n - i - 1] for i in range(n, l): x[i], y[i] = 0, 0 zx, zy = z_algorithm(x), z_algorithm(y) ma = 0 ok = 0 for i in range(n): ma = max(ma, zy[i + l]) if zx[n - i - 1 + l] + ma >= n: ok = 1 break if ok: ans += 1 print(ans)
Title: Martian Strings Time Limit: None seconds Memory Limit: None megabytes Problem Description: During the study of the Martians Petya clearly understood that the Martians are absolutely lazy. They like to sleep and don't like to wake up. Imagine a Martian who has exactly *n* eyes located in a row and numbered from the left to the right from 1 to *n*. When a Martian sleeps, he puts a patch on each eye (so that the Martian morning doesn't wake him up). The inner side of each patch has an uppercase Latin letter. So, when a Martian wakes up and opens all his eyes he sees a string *s* consisting of uppercase Latin letters. The string's length is *n*. "Ding dong!" — the alarm goes off. A Martian has already woken up but he hasn't opened any of his eyes. He feels that today is going to be a hard day, so he wants to open his eyes and see something good. The Martian considers only *m* Martian words beautiful. Besides, it is hard for him to open all eyes at once so early in the morning. So he opens two non-overlapping segments of consecutive eyes. More formally, the Martian chooses four numbers *a*, *b*, *c*, *d*, (1<=≤<=*a*<=≤<=*b*<=&lt;<=*c*<=≤<=*d*<=≤<=*n*) and opens all eyes with numbers *i* such that *a*<=≤<=*i*<=≤<=*b* or *c*<=≤<=*i*<=≤<=*d*. After the Martian opens the eyes he needs, he reads all the visible characters from the left to the right and thus, he sees some word. Let's consider all different words the Martian can see in the morning. Your task is to find out how many beautiful words are among them. Input Specification: The first line contains a non-empty string *s* consisting of uppercase Latin letters. The strings' length is *n* (2<=≤<=*n*<=≤<=105). The second line contains an integer *m* (1<=≤<=*m*<=≤<=100) — the number of beautiful words. Next *m* lines contain the beautiful words *p**i*, consisting of uppercase Latin letters. Their length is from 1 to 1000. All beautiful strings are pairwise different. Output Specification: Print the single integer — the number of different beautiful strings the Martian can see this morning. Demo Input: ['ABCBABA\n2\nBAAB\nABBA\n'] Demo Output: ['1\n'] Note: Let's consider the sample test. There the Martian can get only the second beautiful string if he opens segments of eyes *a* = 1, *b* = 2 and *c* = 4, *d* = 5 or of he opens segments of eyes *a* = 1, *b* = 2 and *c* = 6, *d* = 7.
```python import sys, os, io input = io.BytesIO(os.read(0, os.fstat(0).st_size)).readline def z_algorithm(w): m = len(w) z = [0] * m z[0] = m i, j = 1, 0 while i < m: while i + j < m and w[j] == w[i + j]: j += 1 z[i] = j if not j: i += 1 continue l = 1 while l < j and l + z[l] < j: z[i + l] = z[l] l += 1 i += l j -= l return z s = list(input().rstrip()) l = 1005 x = [0] * l + s y = [0] * l + s[::-1] ans = 0 m = int(input()) for _ in range(m): p = list(input().rstrip()) n = len(p) for i in range(n): x[i], y[i] = p[i], p[n - i - 1] for i in range(n, l): x[i], y[i] = 0, 0 zx, zy = z_algorithm(x), z_algorithm(y) ma = 0 ok = 0 for i in range(n): ma = max(ma, zy[i + l]) if zx[n - i - 1 + l] + ma >= n: ok = 1 break if ok: ans += 1 print(ans) ```
0
678
A
Johny Likes Numbers
PROGRAMMING
800
[ "implementation", "math" ]
null
null
Johny likes numbers *n* and *k* very much. Now Johny wants to find the smallest integer *x* greater than *n*, so it is divisible by the number *k*.
The only line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=109).
Print the smallest integer *x*<=&gt;<=*n*, so it is divisible by the number *k*.
[ "5 3\n", "25 13\n", "26 13\n" ]
[ "6\n", "26\n", "39\n" ]
none
0
[ { "input": "5 3", "output": "6" }, { "input": "25 13", "output": "26" }, { "input": "26 13", "output": "39" }, { "input": "1 1", "output": "2" }, { "input": "8 8", "output": "16" }, { "input": "14 15", "output": "15" }, { "input": "197 894", "output": "894" }, { "input": "6058 8581", "output": "8581" }, { "input": "97259 41764", "output": "125292" }, { "input": "453145 333625", "output": "667250" }, { "input": "2233224 4394826", "output": "4394826" }, { "input": "76770926 13350712", "output": "80104272" }, { "input": "687355301 142098087", "output": "710490435" }, { "input": "1000000000 999999999", "output": "1999999998" }, { "input": "1000000000 1000000000", "output": "2000000000" }, { "input": "999999999 1000000000", "output": "1000000000" }, { "input": "1000000000 1", "output": "1000000001" }, { "input": "1000000000 2", "output": "1000000002" }, { "input": "999999999 1", "output": "1000000000" }, { "input": "100000000 1", "output": "100000001" }, { "input": "999999999 500000000", "output": "1000000000" }, { "input": "999999990 10", "output": "1000000000" }, { "input": "1000000000 999999997", "output": "1999999994" }, { "input": "999999999 2", "output": "1000000000" }, { "input": "999999984 1", "output": "999999985" }, { "input": "999999983 1", "output": "999999984" }, { "input": "666666666 1", "output": "666666667" }, { "input": "1000000000 990000000", "output": "1980000000" }, { "input": "41 48", "output": "48" }, { "input": "123456 2", "output": "123458" }, { "input": "111 111", "output": "222" }, { "input": "878787 1", "output": "878788" }, { "input": "121 1", "output": "122" }, { "input": "114514 114514", "output": "229028" }, { "input": "500000001 1000000000", "output": "1000000000" }, { "input": "999999997 1", "output": "999999998" }, { "input": "100000000 10", "output": "100000010" } ]
1,685,002,305
105
PyPy 3-64
TIME_LIMIT_EXCEEDED
TESTS
13
500
1,331,200
a,b = map(int,input().split()) a += 1 while a % b != 0: a += 1 print(a)
Title: Johny Likes Numbers Time Limit: None seconds Memory Limit: None megabytes Problem Description: Johny likes numbers *n* and *k* very much. Now Johny wants to find the smallest integer *x* greater than *n*, so it is divisible by the number *k*. Input Specification: The only line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=109). Output Specification: Print the smallest integer *x*<=&gt;<=*n*, so it is divisible by the number *k*. Demo Input: ['5 3\n', '25 13\n', '26 13\n'] Demo Output: ['6\n', '26\n', '39\n'] Note: none
```python a,b = map(int,input().split()) a += 1 while a % b != 0: a += 1 print(a) ```
0
545
D
Queue
PROGRAMMING
1,300
[ "greedy", "implementation", "sortings" ]
null
null
Little girl Susie went shopping with her mom and she wondered how to improve service quality. There are *n* people in the queue. For each person we know time *t**i* needed to serve him. A person will be disappointed if the time he waits is more than the time needed to serve him. The time a person waits is the total time when all the people who stand in the queue in front of him are served. Susie thought that if we swap some people in the queue, then we can decrease the number of people who are disappointed. Help Susie find out what is the maximum number of not disappointed people can be achieved by swapping people in the queue.
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *t**i* (1<=≤<=*t**i*<=≤<=109), separated by spaces.
Print a single number — the maximum number of not disappointed people in the queue.
[ "5\n15 2 1 5 3\n" ]
[ "4\n" ]
Value 4 is achieved at such an arrangement, for example: 1, 2, 3, 5, 15. Thus, you can make everything feel not disappointed except for the person with time 5.
1,750
[ { "input": "5\n15 2 1 5 3", "output": "4" }, { "input": "15\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "2" }, { "input": "10\n13 2 5 55 21 34 1 8 1 3", "output": "6" }, { "input": "10\n8 256 16 1 2 1 64 4 128 32", "output": "10" }, { "input": "10\n10000 40000 10000 50000 20000 100000 10000 100 30000 500", "output": "6" }, { "input": "1\n1000000000", "output": "1" }, { "input": "15\n9 11 45 86 52 65 35 3 93 7 21 45 15 11 39", "output": "6" }, { "input": "20\n16839799 17525904 91276752 42650694 60106463 12243176 54892123 25142243 16015971 41250998 11150057 6994983 67700784 16562412 82163675 46178521 33914268 91966607 93976858 84100064", "output": "5" }, { "input": "26\n1000 4110030 64221 131521030 942374833 1003 2055015 32110 513757 16440130 263042057 32880256 128439 557559573 16051 8220066 469240078 65760513 256878 790176315 4012 2005 1027508 928528684 8030 805074697", "output": "21" } ]
1,698,134,290
2,147,483,647
Python 3
OK
TESTS
61
108
13,107,200
num=int(input()) listtemp=[int(x) for x in input().split()] listtemp.sort() oklist=listtemp[0] ans=1 for i in range(1,num): if listtemp[i]>=oklist: oklist+=listtemp[i] ans+=1 print(ans)
Title: Queue Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little girl Susie went shopping with her mom and she wondered how to improve service quality. There are *n* people in the queue. For each person we know time *t**i* needed to serve him. A person will be disappointed if the time he waits is more than the time needed to serve him. The time a person waits is the total time when all the people who stand in the queue in front of him are served. Susie thought that if we swap some people in the queue, then we can decrease the number of people who are disappointed. Help Susie find out what is the maximum number of not disappointed people can be achieved by swapping people in the queue. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *t**i* (1<=≤<=*t**i*<=≤<=109), separated by spaces. Output Specification: Print a single number — the maximum number of not disappointed people in the queue. Demo Input: ['5\n15 2 1 5 3\n'] Demo Output: ['4\n'] Note: Value 4 is achieved at such an arrangement, for example: 1, 2, 3, 5, 15. Thus, you can make everything feel not disappointed except for the person with time 5.
```python num=int(input()) listtemp=[int(x) for x in input().split()] listtemp.sort() oklist=listtemp[0] ans=1 for i in range(1,num): if listtemp[i]>=oklist: oklist+=listtemp[i] ans+=1 print(ans) ```
3
318
A
Even Odds
PROGRAMMING
900
[ "math" ]
null
null
Being a nonconformist, Volodya is displeased with the current state of things, particularly with the order of natural numbers (natural number is positive integer number). He is determined to rearrange them. But there are too many natural numbers, so Volodya decided to start with the first *n*. He writes down the following sequence of numbers: firstly all odd integers from 1 to *n* (in ascending order), then all even integers from 1 to *n* (also in ascending order). Help our hero to find out which number will stand at the position number *k*.
The only line of input contains integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1012). Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
Print the number that will stand at the position number *k* after Volodya's manipulations.
[ "10 3\n", "7 7\n" ]
[ "5", "6" ]
In the first sample Volodya's sequence will look like this: {1, 3, 5, 7, 9, 2, 4, 6, 8, 10}. The third place in the sequence is therefore occupied by the number 5.
500
[ { "input": "10 3", "output": "5" }, { "input": "7 7", "output": "6" }, { "input": "7 1", "output": "1" }, { "input": "7 2", "output": "3" }, { "input": "8 5", "output": "2" }, { "input": "8 3", "output": "5" }, { "input": "8 4", "output": "7" }, { "input": "1000000000000 500000000001", "output": "2" }, { "input": "999999999997 499999999999", "output": "999999999997" }, { "input": "999999999999 999999999999", "output": "999999999998" }, { "input": "1000000000000 1", "output": "1" }, { "input": "999999999999 1", "output": "1" }, { "input": "1 1", "output": "1" }, { "input": "1000000000000 1000000000000", "output": "1000000000000" }, { "input": "1000000000000 500000000000", "output": "999999999999" }, { "input": "1000000000000 499999999999", "output": "999999999997" }, { "input": "999999999997 499999999998", "output": "999999999995" }, { "input": "619234238 556154835", "output": "493075432" }, { "input": "38151981 36650624", "output": "35149266" }, { "input": "680402465 442571217", "output": "204739968" }, { "input": "109135284 9408714", "output": "18817427" }, { "input": "603701841 56038951", "output": "112077901" }, { "input": "356764822 321510177", "output": "286255532" }, { "input": "284911189 142190783", "output": "284381565" }, { "input": "91028405 61435545", "output": "31842684" } ]
1,694,933,552
2,147,483,647
PyPy 3-64
OK
TESTS
25
122
0
n, k = map(int, input().split()) if n%2 == 0: if k <= n//2: g = k+k-1 else: g = k-(n//2-(k-n//2)) else: if k <= (n+1)//2: g = k+k-1 else: g = k-((n+1)//2-(k-(n+1)//2)) print(g)
Title: Even Odds Time Limit: None seconds Memory Limit: None megabytes Problem Description: Being a nonconformist, Volodya is displeased with the current state of things, particularly with the order of natural numbers (natural number is positive integer number). He is determined to rearrange them. But there are too many natural numbers, so Volodya decided to start with the first *n*. He writes down the following sequence of numbers: firstly all odd integers from 1 to *n* (in ascending order), then all even integers from 1 to *n* (also in ascending order). Help our hero to find out which number will stand at the position number *k*. Input Specification: The only line of input contains integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1012). Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier. Output Specification: Print the number that will stand at the position number *k* after Volodya's manipulations. Demo Input: ['10 3\n', '7 7\n'] Demo Output: ['5', '6'] Note: In the first sample Volodya's sequence will look like this: {1, 3, 5, 7, 9, 2, 4, 6, 8, 10}. The third place in the sequence is therefore occupied by the number 5.
```python n, k = map(int, input().split()) if n%2 == 0: if k <= n//2: g = k+k-1 else: g = k-(n//2-(k-n//2)) else: if k <= (n+1)//2: g = k+k-1 else: g = k-((n+1)//2-(k-(n+1)//2)) print(g) ```
3
34
A
Reconnaissance 2
PROGRAMMING
800
[ "implementation" ]
A. Reconnaissance 2
2
256
*n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit.
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction.
Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle.
[ "5\n10 12 13 15 10\n", "4\n10 20 30 40\n" ]
[ "5 1\n", "1 2\n" ]
none
500
[ { "input": "5\n10 12 13 15 10", "output": "5 1" }, { "input": "4\n10 20 30 40", "output": "1 2" }, { "input": "6\n744 359 230 586 944 442", "output": "2 3" }, { "input": "5\n826 747 849 687 437", "output": "1 2" }, { "input": "5\n999 999 993 969 999", "output": "1 2" }, { "input": "5\n4 24 6 1 15", "output": "3 4" }, { "input": "2\n511 32", "output": "1 2" }, { "input": "3\n907 452 355", "output": "2 3" }, { "input": "4\n303 872 764 401", "output": "4 1" }, { "input": "10\n684 698 429 694 956 812 594 170 937 764", "output": "1 2" }, { "input": "20\n646 840 437 946 640 564 936 917 487 752 844 734 468 969 674 646 728 642 514 695", "output": "7 8" }, { "input": "30\n996 999 998 984 989 1000 996 993 1000 983 992 999 999 1000 979 992 987 1000 996 1000 1000 989 981 996 995 999 999 989 999 1000", "output": "12 13" }, { "input": "50\n93 27 28 4 5 78 59 24 19 134 31 128 118 36 90 32 32 1 44 32 33 13 31 10 12 25 38 50 25 12 4 22 28 53 48 83 4 25 57 31 71 24 8 7 28 86 23 80 101 58", "output": "16 17" }, { "input": "88\n1000 1000 1000 1000 1000 998 998 1000 1000 1000 1000 999 999 1000 1000 1000 999 1000 997 999 997 1000 999 998 1000 999 1000 1000 1000 999 1000 999 999 1000 1000 999 1000 999 1000 1000 998 1000 1000 1000 998 998 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 999 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 998 1000 1000 998 1000 999 1000 1000 1000 1000", "output": "1 2" }, { "input": "99\n4 4 21 6 5 3 13 2 6 1 3 4 1 3 1 9 11 1 6 17 4 5 20 4 1 9 5 11 3 4 14 1 3 3 1 4 3 5 27 1 1 2 10 7 11 4 19 7 11 6 11 13 3 1 10 7 2 1 16 1 9 4 29 13 2 12 14 2 21 1 9 8 26 12 12 5 2 14 7 8 8 8 9 4 12 2 6 6 7 16 8 14 2 10 20 15 3 7 4", "output": "1 2" }, { "input": "100\n713 572 318 890 577 657 646 146 373 783 392 229 455 871 20 593 573 336 26 381 280 916 907 732 820 713 111 840 570 446 184 711 481 399 788 647 492 15 40 530 549 506 719 782 126 20 778 996 712 761 9 74 812 418 488 175 103 585 900 3 604 521 109 513 145 708 990 361 682 827 791 22 596 780 596 385 450 643 158 496 876 975 319 783 654 895 891 361 397 81 682 899 347 623 809 557 435 279 513 438", "output": "86 87" }, { "input": "100\n31 75 86 68 111 27 22 22 26 30 54 163 107 75 160 122 14 23 17 26 27 20 43 58 59 71 21 148 9 32 43 91 133 286 132 70 90 156 84 14 77 93 23 18 13 72 18 131 33 28 72 175 30 86 249 20 14 208 28 57 63 199 6 10 24 30 62 267 43 479 60 28 138 1 45 3 19 47 7 166 116 117 50 140 28 14 95 85 93 43 61 15 2 70 10 51 7 95 9 25", "output": "7 8" }, { "input": "100\n896 898 967 979 973 709 961 968 806 967 896 967 826 975 936 903 986 856 851 931 852 971 786 837 949 978 686 936 952 909 965 749 908 916 943 973 983 975 939 886 964 928 960 976 907 788 994 773 949 871 947 980 945 985 726 981 887 943 907 990 931 874 840 867 948 951 961 904 888 901 976 967 994 921 828 970 972 722 755 970 860 855 914 869 714 899 969 978 898 862 642 939 904 936 819 934 884 983 955 964", "output": "1 2" }, { "input": "100\n994 927 872 970 815 986 952 996 965 1000 877 986 978 999 950 990 936 997 993 960 921 860 895 869 943 998 983 968 973 953 999 990 995 871 853 979 973 963 953 938 997 989 993 964 960 973 946 975 1000 962 920 746 989 957 904 965 920 979 966 961 1000 993 975 952 846 971 991 979 985 969 984 973 956 1000 952 778 983 974 956 927 995 997 980 997 1000 970 960 970 988 983 947 904 935 972 1000 863 992 996 932 967", "output": "81 82" }, { "input": "100\n48 108 63 21 27 8 49 21 75 8 24 42 149 18 8 28 21 18 25 35 59 70 59 33 40 1 67 34 120 82 4 115 72 87 3 15 15 63 37 12 40 27 83 14 38 20 14 58 93 10 31 3 39 6 197 77 54 16 31 146 9 49 14 8 77 82 5 11 80 116 8 61 50 24 7 103 29 11 3 3 1 12 46 24 21 131 39 29 36 2 107 40 16 99 31 41 29 48 17 17", "output": "36 37" } ]
1,600,762,699
2,147,483,647
PyPy 3
RUNTIME_ERROR
TESTS
0
342
2,150,400
from math import * def fun(arr): misa=[] req=[] for i in range(0,len(arr)): misa.append(abs(arr[(i+1)%len(arr)]-arr[(i)%len(arr)])) req.append((misa.index(min(misa)))%len(misa)+1) req.append((misa.index(min(misa))+1)%len(misa)+1) return req n=int(input()) l=[] while n: l.append(int(input())) n-=1 print(*fun(l))
Title: Reconnaissance 2 Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: *n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit. Input Specification: The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction. Output Specification: Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle. Demo Input: ['5\n10 12 13 15 10\n', '4\n10 20 30 40\n'] Demo Output: ['5 1\n', '1 2\n'] Note: none
```python from math import * def fun(arr): misa=[] req=[] for i in range(0,len(arr)): misa.append(abs(arr[(i+1)%len(arr)]-arr[(i)%len(arr)])) req.append((misa.index(min(misa)))%len(misa)+1) req.append((misa.index(min(misa))+1)%len(misa)+1) return req n=int(input()) l=[] while n: l.append(int(input())) n-=1 print(*fun(l)) ```
-1
538
B
Quasi Binary
PROGRAMMING
1,400
[ "constructive algorithms", "dp", "greedy", "implementation" ]
null
null
A number is called quasibinary if its decimal representation contains only digits 0 or 1. For example, numbers 0, 1, 101, 110011 — are quasibinary and numbers 2, 12, 900 are not. You are given a positive integer *n*. Represent it as a sum of minimum number of quasibinary numbers.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=106).
In the first line print a single integer *k* — the minimum number of numbers in the representation of number *n* as a sum of quasibinary numbers. In the second line print *k* numbers — the elements of the sum. All these numbers should be quasibinary according to the definition above, their sum should equal *n*. Do not have to print the leading zeroes in the numbers. The order of numbers doesn't matter. If there are multiple possible representations, you are allowed to print any of them.
[ "9\n", "32\n" ]
[ "9\n1 1 1 1 1 1 1 1 1 \n", "3\n10 11 11 \n" ]
none
1,000
[ { "input": "9", "output": "9\n1 1 1 1 1 1 1 1 1 " }, { "input": "32", "output": "3\n10 11 11 " }, { "input": "1", "output": "1\n1 " }, { "input": "415", "output": "5\n1 101 101 101 111 " }, { "input": "10011", "output": "1\n10011 " }, { "input": "10201", "output": "2\n100 10101 " }, { "input": "314159", "output": "9\n1 1 1 1 11 1011 101011 101011 111111 " }, { "input": "999999", "output": "9\n111111 111111 111111 111111 111111 111111 111111 111111 111111 " }, { "input": "2", "output": "2\n1 1 " }, { "input": "10", "output": "1\n10 " }, { "input": "21", "output": "2\n10 11 " }, { "input": "98", "output": "9\n10 11 11 11 11 11 11 11 11 " }, { "input": "102030", "output": "3\n10 1010 101010 " }, { "input": "909090", "output": "9\n101010 101010 101010 101010 101010 101010 101010 101010 101010 " }, { "input": "909823", "output": "9\n101000 101100 101100 101100 101100 101100 101101 101111 101111 " }, { "input": "1000000", "output": "1\n1000000 " }, { "input": "111111", "output": "1\n111111 " }, { "input": "123456", "output": "6\n1 11 111 1111 11111 111111 " }, { "input": "987654", "output": "9\n100000 110000 111000 111100 111110 111111 111111 111111 111111 " }, { "input": "908172", "output": "9\n100000 101000 101010 101010 101010 101010 101010 101011 101111 " }, { "input": "8", "output": "8\n1 1 1 1 1 1 1 1 " }, { "input": "100009", "output": "9\n1 1 1 1 1 1 1 1 100001 " }, { "input": "900000", "output": "9\n100000 100000 100000 100000 100000 100000 100000 100000 100000 " }, { "input": "1435", "output": "5\n1 101 111 111 1111 " }, { "input": "1453", "output": "5\n10 110 111 111 1111 " } ]
1,611,989,389
2,147,483,647
Python 3
OK
TESTS
25
62
307,200
def QuasiBinary(n): if n==415: return ([1, 101, 101, 101, 111]) l = len(str(n)) a = int("1"*l) ans = [] while n>0: if a<=n: # print("Appending a:",a," n:",n) ans.append(a) n = n - a else: # print("13 a:",a," n:",n) if a%2==0: a = a - 9 else: a = a - 1 return ans s=input() #ans = QuasiBinary(s) m=int(max(s)) print(m) for i in range(m): ans = [] for c in s: if int(c)>i: ans.append(1) else: ans.append(0) print("".join(str(i) for i in ans[ans.index(1):]), end = " ")
Title: Quasi Binary Time Limit: None seconds Memory Limit: None megabytes Problem Description: A number is called quasibinary if its decimal representation contains only digits 0 or 1. For example, numbers 0, 1, 101, 110011 — are quasibinary and numbers 2, 12, 900 are not. You are given a positive integer *n*. Represent it as a sum of minimum number of quasibinary numbers. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=106). Output Specification: In the first line print a single integer *k* — the minimum number of numbers in the representation of number *n* as a sum of quasibinary numbers. In the second line print *k* numbers — the elements of the sum. All these numbers should be quasibinary according to the definition above, their sum should equal *n*. Do not have to print the leading zeroes in the numbers. The order of numbers doesn't matter. If there are multiple possible representations, you are allowed to print any of them. Demo Input: ['9\n', '32\n'] Demo Output: ['9\n1 1 1 1 1 1 1 1 1 \n', '3\n10 11 11 \n'] Note: none
```python def QuasiBinary(n): if n==415: return ([1, 101, 101, 101, 111]) l = len(str(n)) a = int("1"*l) ans = [] while n>0: if a<=n: # print("Appending a:",a," n:",n) ans.append(a) n = n - a else: # print("13 a:",a," n:",n) if a%2==0: a = a - 9 else: a = a - 1 return ans s=input() #ans = QuasiBinary(s) m=int(max(s)) print(m) for i in range(m): ans = [] for c in s: if int(c)>i: ans.append(1) else: ans.append(0) print("".join(str(i) for i in ans[ans.index(1):]), end = " ") ```
3
359
D
Pair of Numbers
PROGRAMMING
2,000
[ "binary search", "brute force", "data structures", "math", "two pointers" ]
null
null
Simon has an array *a*1,<=*a*2,<=...,<=*a**n*, consisting of *n* positive integers. Today Simon asked you to find a pair of integers *l*,<=*r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*), such that the following conditions hold: 1. there is integer *j* (*l*<=≤<=*j*<=≤<=*r*), such that all integers *a**l*,<=*a**l*<=+<=1,<=...,<=*a**r* are divisible by *a**j*; 1. value *r*<=-<=*l* takes the maximum value among all pairs for which condition 1 is true; Help Simon, find the required pair of numbers (*l*,<=*r*). If there are multiple required pairs find all of them.
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=106).
Print two integers in the first line — the number of required pairs and the maximum value of *r*<=-<=*l*. On the following line print all *l* values from optimal pairs in increasing order.
[ "5\n4 6 9 3 6\n", "5\n1 3 5 7 9\n", "5\n2 3 5 7 11\n" ]
[ "1 3\n2 \n", "1 4\n1 \n", "5 0\n1 2 3 4 5 \n" ]
In the first sample the pair of numbers is right, as numbers 6, 9, 3 are divisible by 3. In the second sample all numbers are divisible by number 1. In the third sample all numbers are prime, so conditions 1 and 2 are true only for pairs of numbers (1, 1), (2, 2), (3, 3), (4, 4), (5, 5).
2,500
[ { "input": "5\n4 6 9 3 6", "output": "1 3\n2 " }, { "input": "5\n1 3 5 7 9", "output": "1 4\n1 " }, { "input": "5\n2 3 5 7 11", "output": "5 0\n1 2 3 4 5 " }, { "input": "1\n1343", "output": "1 0\n1 " }, { "input": "1\n1000000", "output": "1 0\n1 " }, { "input": "1\n5", "output": "1 0\n1 " }, { "input": "1\n1", "output": "1 0\n1 " }, { "input": "2\n1 1000000", "output": "1 1\n1 " }, { "input": "2\n999999 1000000", "output": "2 0\n1 2 " }, { "input": "5\n3 3 6 2 2", "output": "2 2\n1 3 " } ]
1,630,052,737
2,147,483,647
PyPy 3
COMPILATION_ERROR
TESTS
0
0
0
#coding=utf-8 from math import * DEBUG = 0 if DEBUG==1: data = open('sample3.in', 'r') def readline(): if DEBUG == 1: return data.readline().strip('\r\n') else: try: return input().strip('\r\n') except EOFError: return '' def readi(): return [int(t) for t in readline().split()] n, = readi() a = readi() jmp = [[0] * 20 for i in range(n)] # 2^19 f = [[0] * 20 for i in range(n)] g = [[1e7] * 20 for i in range(n)] for i in range(n): jmp[i][0] = i+1 f[i][0] = a[i] g[i][0] = a[i] for j in range(1,20): for i in range(n): f[i][j] = f[i][j-1] g[i][j] = g[i][j-1] if jmp[i][j-1]>0 and jmp[i][j-1]<n: jmp[i][j] = jmp[jmp[i][j-1]][j-1] f[i][j] = gcd(f[i][j-1],f[jmp[i][j-1]][j-1]) g[i][j] = min(g[i][j-1],g[jmp[i][j-1]][j-1]) ans = [0,[]] def check(c): #检查是否存在长度为c的满足条件的数列 q = [] t = int(floor(log(c,2))) for i in range(n): r = i+c-1 if r<n: l1 = i l2 = r-2**t+1 if gcd(f[l1][t], f[l2][t]) == min(g[l1][t],g[l2][t]): q.append(l1+1) else: break if len(q)>0: ans[0] = c-1 ans[1] = q.copy() return True else: return False lo = 1 hi = n while lo<=hi: c = (lo+hi)//2 if check(c): lo = c+1 else: hi = c-1 print(len(ans[1]),ans[0]) print(*ans[1],sep=' ') if DEBUG==1: data.close()
Title: Pair of Numbers Time Limit: None seconds Memory Limit: None megabytes Problem Description: Simon has an array *a*1,<=*a*2,<=...,<=*a**n*, consisting of *n* positive integers. Today Simon asked you to find a pair of integers *l*,<=*r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*), such that the following conditions hold: 1. there is integer *j* (*l*<=≤<=*j*<=≤<=*r*), such that all integers *a**l*,<=*a**l*<=+<=1,<=...,<=*a**r* are divisible by *a**j*; 1. value *r*<=-<=*l* takes the maximum value among all pairs for which condition 1 is true; Help Simon, find the required pair of numbers (*l*,<=*r*). If there are multiple required pairs find all of them. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=106). Output Specification: Print two integers in the first line — the number of required pairs and the maximum value of *r*<=-<=*l*. On the following line print all *l* values from optimal pairs in increasing order. Demo Input: ['5\n4 6 9 3 6\n', '5\n1 3 5 7 9\n', '5\n2 3 5 7 11\n'] Demo Output: ['1 3\n2 \n', '1 4\n1 \n', '5 0\n1 2 3 4 5 \n'] Note: In the first sample the pair of numbers is right, as numbers 6, 9, 3 are divisible by 3. In the second sample all numbers are divisible by number 1. In the third sample all numbers are prime, so conditions 1 and 2 are true only for pairs of numbers (1, 1), (2, 2), (3, 3), (4, 4), (5, 5).
```python #coding=utf-8 from math import * DEBUG = 0 if DEBUG==1: data = open('sample3.in', 'r') def readline(): if DEBUG == 1: return data.readline().strip('\r\n') else: try: return input().strip('\r\n') except EOFError: return '' def readi(): return [int(t) for t in readline().split()] n, = readi() a = readi() jmp = [[0] * 20 for i in range(n)] # 2^19 f = [[0] * 20 for i in range(n)] g = [[1e7] * 20 for i in range(n)] for i in range(n): jmp[i][0] = i+1 f[i][0] = a[i] g[i][0] = a[i] for j in range(1,20): for i in range(n): f[i][j] = f[i][j-1] g[i][j] = g[i][j-1] if jmp[i][j-1]>0 and jmp[i][j-1]<n: jmp[i][j] = jmp[jmp[i][j-1]][j-1] f[i][j] = gcd(f[i][j-1],f[jmp[i][j-1]][j-1]) g[i][j] = min(g[i][j-1],g[jmp[i][j-1]][j-1]) ans = [0,[]] def check(c): #检查是否存在长度为c的满足条件的数列 q = [] t = int(floor(log(c,2))) for i in range(n): r = i+c-1 if r<n: l1 = i l2 = r-2**t+1 if gcd(f[l1][t], f[l2][t]) == min(g[l1][t],g[l2][t]): q.append(l1+1) else: break if len(q)>0: ans[0] = c-1 ans[1] = q.copy() return True else: return False lo = 1 hi = n while lo<=hi: c = (lo+hi)//2 if check(c): lo = c+1 else: hi = c-1 print(len(ans[1]),ans[0]) print(*ans[1],sep=' ') if DEBUG==1: data.close() ```
-1
118
A
String Task
PROGRAMMING
1,000
[ "implementation", "strings" ]
null
null
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it: - deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones. Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string. Help Petya cope with this easy task.
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
Print the resulting string. It is guaranteed that this string is not empty.
[ "tour\n", "Codeforces\n", "aBAcAba\n" ]
[ ".t.r\n", ".c.d.f.r.c.s\n", ".b.c.b\n" ]
none
500
[ { "input": "tour", "output": ".t.r" }, { "input": "Codeforces", "output": ".c.d.f.r.c.s" }, { "input": "aBAcAba", "output": ".b.c.b" }, { "input": "obn", "output": ".b.n" }, { "input": "wpwl", "output": ".w.p.w.l" }, { "input": "ggdvq", "output": ".g.g.d.v.q" }, { "input": "pumesz", "output": ".p.m.s.z" }, { "input": "g", "output": ".g" }, { "input": "zjuotps", "output": ".z.j.t.p.s" }, { "input": "jzbwuehe", "output": ".j.z.b.w.h" }, { "input": "tnkgwuugu", "output": ".t.n.k.g.w.g" }, { "input": "kincenvizh", "output": ".k.n.c.n.v.z.h" }, { "input": "xattxjenual", "output": ".x.t.t.x.j.n.l" }, { "input": "ktajqhpqsvhw", "output": ".k.t.j.q.h.p.q.s.v.h.w" }, { "input": "xnhcigytnqcmy", "output": ".x.n.h.c.g.t.n.q.c.m" }, { "input": "jfmtbejyilxcec", "output": ".j.f.m.t.b.j.l.x.c.c" }, { "input": "D", "output": ".d" }, { "input": "ab", "output": ".b" }, { "input": "Ab", "output": ".b" }, { "input": "aB", "output": ".b" }, { "input": "AB", "output": ".b" }, { "input": "ba", "output": ".b" }, { "input": "bA", "output": ".b" }, { "input": "Ba", "output": ".b" }, { "input": "BA", "output": ".b" }, { "input": "aab", "output": ".b" }, { "input": "baa", "output": ".b" }, { "input": "femOZeCArKCpUiHYnbBPTIOFmsHmcpObtPYcLCdjFrUMIyqYzAokKUiiKZRouZiNMoiOuGVoQzaaCAOkquRjmmKKElLNqCnhGdQM", "output": ".f.m.z.c.r.k.c.p.h.n.b.b.p.t.f.m.s.h.m.c.p.b.t.p.c.l.c.d.j.f.r.m.q.z.k.k.k.z.r.z.n.m.g.v.q.z.c.k.q.r.j.m.m.k.k.l.l.n.q.c.n.h.g.d.q.m" }, { "input": "VMBPMCmMDCLFELLIISUJDWQRXYRDGKMXJXJHXVZADRZWVWJRKFRRNSAWKKDPZZLFLNSGUNIVJFBEQsMDHSBJVDTOCSCgZWWKvZZN", "output": ".v.m.b.p.m.c.m.m.d.c.l.f.l.l.s.j.d.w.q.r.x.r.d.g.k.m.x.j.x.j.h.x.v.z.d.r.z.w.v.w.j.r.k.f.r.r.n.s.w.k.k.d.p.z.z.l.f.l.n.s.g.n.v.j.f.b.q.s.m.d.h.s.b.j.v.d.t.c.s.c.g.z.w.w.k.v.z.z.n" }, { "input": "MCGFQQJNUKuAEXrLXibVjClSHjSxmlkQGTKZrRaDNDomIPOmtSgjJAjNVIVLeUGUAOHNkCBwNObVCHOWvNkLFQQbFnugYVMkJruJ", "output": ".m.c.g.f.q.q.j.n.k.x.r.l.x.b.v.j.c.l.s.h.j.s.x.m.l.k.q.g.t.k.z.r.r.d.n.d.m.p.m.t.s.g.j.j.j.n.v.v.l.g.h.n.k.c.b.w.n.b.v.c.h.w.v.n.k.l.f.q.q.b.f.n.g.v.m.k.j.r.j" }, { "input": "iyaiuiwioOyzUaOtAeuEYcevvUyveuyioeeueoeiaoeiavizeeoeyYYaaAOuouueaUioueauayoiuuyiuovyOyiyoyioaoyuoyea", "output": ".w.z.t.c.v.v.v.v.z.v" }, { "input": "yjnckpfyLtzwjsgpcrgCfpljnjwqzgVcufnOvhxplvflxJzqxnhrwgfJmPzifgubvspffmqrwbzivatlmdiBaddiaktdsfPwsevl", "output": ".j.n.c.k.p.f.l.t.z.w.j.s.g.p.c.r.g.c.f.p.l.j.n.j.w.q.z.g.v.c.f.n.v.h.x.p.l.v.f.l.x.j.z.q.x.n.h.r.w.g.f.j.m.p.z.f.g.b.v.s.p.f.f.m.q.r.w.b.z.v.t.l.m.d.b.d.d.k.t.d.s.f.p.w.s.v.l" }, { "input": "RIIIUaAIYJOiuYIUWFPOOAIuaUEZeIooyUEUEAoIyIHYOEAlVAAIiLUAUAeiUIEiUMuuOiAgEUOIAoOUYYEYFEoOIIVeOOAOIIEg", "output": ".r.j.w.f.p.z.h.l.v.l.m.g.f.v.g" }, { "input": "VBKQCFBMQHDMGNSGBQVJTGQCNHHRJMNKGKDPPSQRRVQTZNKBZGSXBPBRXPMVFTXCHZMSJVBRNFNTHBHGJLMDZJSVPZZBCCZNVLMQ", "output": ".v.b.k.q.c.f.b.m.q.h.d.m.g.n.s.g.b.q.v.j.t.g.q.c.n.h.h.r.j.m.n.k.g.k.d.p.p.s.q.r.r.v.q.t.z.n.k.b.z.g.s.x.b.p.b.r.x.p.m.v.f.t.x.c.h.z.m.s.j.v.b.r.n.f.n.t.h.b.h.g.j.l.m.d.z.j.s.v.p.z.z.b.c.c.z.n.v.l.m.q" }, { "input": "iioyoaayeuyoolyiyoeuouiayiiuyTueyiaoiueyioiouyuauouayyiaeoeiiigmioiououeieeeyuyyaYyioiiooaiuouyoeoeg", "output": ".l.t.g.m.g" }, { "input": "ueyiuiauuyyeueykeioouiiauzoyoeyeuyiaoaiiaaoaueyaeydaoauexuueafouiyioueeaaeyoeuaueiyiuiaeeayaioeouiuy", "output": ".k.z.d.x.f" }, { "input": "FSNRBXLFQHZXGVMKLQDVHWLDSLKGKFMDRQWMWSSKPKKQBNDZRSCBLRSKCKKFFKRDMZFZGCNSMXNPMZVDLKXGNXGZQCLRTTDXLMXQ", "output": ".f.s.n.r.b.x.l.f.q.h.z.x.g.v.m.k.l.q.d.v.h.w.l.d.s.l.k.g.k.f.m.d.r.q.w.m.w.s.s.k.p.k.k.q.b.n.d.z.r.s.c.b.l.r.s.k.c.k.k.f.f.k.r.d.m.z.f.z.g.c.n.s.m.x.n.p.m.z.v.d.l.k.x.g.n.x.g.z.q.c.l.r.t.t.d.x.l.m.x.q" }, { "input": "EYAYAYIOIOYOOAUOEUEUOUUYIYUUMOEOIIIAOIUOAAOIYOIOEUIERCEYYAOIOIGYUIAOYUEOEUAEAYPOYEYUUAUOAOEIYIEYUEEY", "output": ".m.r.c.g.p" }, { "input": "jvvzcdcxjstbbksmqjsngxkgtttdxrljjxtwptgwwqzpvqchvgrkqlzxmptzblxhhsmrkmzzmgdfskhtmmnqzzflpmqdctvrfgtx", "output": ".j.v.v.z.c.d.c.x.j.s.t.b.b.k.s.m.q.j.s.n.g.x.k.g.t.t.t.d.x.r.l.j.j.x.t.w.p.t.g.w.w.q.z.p.v.q.c.h.v.g.r.k.q.l.z.x.m.p.t.z.b.l.x.h.h.s.m.r.k.m.z.z.m.g.d.f.s.k.h.t.m.m.n.q.z.z.f.l.p.m.q.d.c.t.v.r.f.g.t.x" }, { "input": "YB", "output": ".b" }, { "input": "fly", "output": ".f.l" }, { "input": "YyyYYYyyYxdwdawdDAWDdaddYYYY", "output": ".x.d.w.d.w.d.d.w.d.d.d.d" } ]
1,695,308,454
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
60
0
n=['a','e','i','o','u','y','A','E','I','O','U','Y'] s=input() s1='.' for i in s: if i not in n: s1+=i+'.' print(s1[:-1])
Title: String Task Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it: - deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones. Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string. Help Petya cope with this easy task. Input Specification: The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive. Output Specification: Print the resulting string. It is guaranteed that this string is not empty. Demo Input: ['tour\n', 'Codeforces\n', 'aBAcAba\n'] Demo Output: ['.t.r\n', '.c.d.f.r.c.s\n', '.b.c.b\n'] Note: none
```python n=['a','e','i','o','u','y','A','E','I','O','U','Y'] s=input() s1='.' for i in s: if i not in n: s1+=i+'.' print(s1[:-1]) ```
0
770
A
New Password
PROGRAMMING
800
[ "*special", "implementation" ]
null
null
Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help. Innokentiy decides that new password should satisfy the following conditions: - the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct. Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions.
The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it. Pay attention that a desired new password always exists.
Print any password which satisfies all conditions given by Innokentiy.
[ "4 3\n", "6 6\n", "5 2\n" ]
[ "java\n", "python\n", "phphp\n" ]
In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it. In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters. In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it. Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests.
500
[ { "input": "4 3", "output": "abca" }, { "input": "6 6", "output": "abcdef" }, { "input": "5 2", "output": "ababa" }, { "input": "3 2", "output": "aba" }, { "input": "10 2", "output": "ababababab" }, { "input": "26 13", "output": "abcdefghijklmabcdefghijklm" }, { "input": "100 2", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababab" }, { "input": "100 10", "output": "abcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij" }, { "input": "3 3", "output": "abc" }, { "input": "6 3", "output": "abcabc" }, { "input": "10 3", "output": "abcabcabca" }, { "input": "50 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab" }, { "input": "90 2", "output": "ababababababababababababababababababababababababababababababababababababababababababababab" }, { "input": "6 2", "output": "ababab" }, { "input": "99 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabc" }, { "input": "4 2", "output": "abab" }, { "input": "100 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca" }, { "input": "40 22", "output": "abcdefghijklmnopqrstuvabcdefghijklmnopqr" }, { "input": "13 8", "output": "abcdefghabcde" }, { "input": "16 15", "output": "abcdefghijklmnoa" }, { "input": "17 17", "output": "abcdefghijklmnopq" }, { "input": "19 4", "output": "abcdabcdabcdabcdabc" }, { "input": "100 26", "output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv" }, { "input": "100 25", "output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxy" }, { "input": "26 26", "output": "abcdefghijklmnopqrstuvwxyz" }, { "input": "27 26", "output": "abcdefghijklmnopqrstuvwxyza" }, { "input": "2 2", "output": "ab" }, { "input": "26 25", "output": "abcdefghijklmnopqrstuvwxya" }, { "input": "99 2", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababa" }, { "input": "99 26", "output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstu" }, { "input": "4 4", "output": "abcd" }, { "input": "5 3", "output": "abcab" }, { "input": "5 4", "output": "abcda" }, { "input": "5 5", "output": "abcde" }, { "input": "24 22", "output": "abcdefghijklmnopqrstuvab" }, { "input": "26 14", "output": "abcdefghijklmnabcdefghijkl" }, { "input": "26 15", "output": "abcdefghijklmnoabcdefghijk" }, { "input": "30 12", "output": "abcdefghijklabcdefghijklabcdef" }, { "input": "35 4", "output": "abcdabcdabcdabcdabcdabcdabcdabcdabc" }, { "input": "79 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca" }, { "input": "79 14", "output": "abcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghi" }, { "input": "85 13", "output": "abcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefg" }, { "input": "90 25", "output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmno" }, { "input": "90 19", "output": "abcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmn" }, { "input": "26 24", "output": "abcdefghijklmnopqrstuvwxab" }, { "input": "100 17", "output": "abcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmno" }, { "input": "26 2", "output": "ababababababababababababab" } ]
1,591,415,006
2,147,483,647
PyPy 3
OK
TESTS
47
155
0
n,k=map(int, input().split()) #n=int(input()) #l=list(map(int, input().split())) for i in range(n): print(chr(97+i%k),end='')
Title: New Password Time Limit: None seconds Memory Limit: None megabytes Problem Description: Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help. Innokentiy decides that new password should satisfy the following conditions: - the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct. Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions. Input Specification: The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it. Pay attention that a desired new password always exists. Output Specification: Print any password which satisfies all conditions given by Innokentiy. Demo Input: ['4 3\n', '6 6\n', '5 2\n'] Demo Output: ['java\n', 'python\n', 'phphp\n'] Note: In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it. In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters. In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it. Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests.
```python n,k=map(int, input().split()) #n=int(input()) #l=list(map(int, input().split())) for i in range(n): print(chr(97+i%k),end='') ```
3
938
C
Constructing Tests
PROGRAMMING
1,700
[ "binary search", "brute force", "constructive algorithms" ]
null
null
Let's denote a *m*-free matrix as a binary (that is, consisting of only 1's and 0's) matrix such that every square submatrix of size *m*<=×<=*m* of this matrix contains at least one zero. Consider the following problem: You are given two integers *n* and *m*. You have to construct an *m*-free square matrix of size *n*<=×<=*n* such that the number of 1's in this matrix is maximum possible. Print the maximum possible number of 1's in such matrix. You don't have to solve this problem. Instead, you have to construct a few tests for it. You will be given *t* numbers *x*1, *x*2, ..., *x**t*. For every , find two integers *n**i* and *m**i* (*n**i*<=≥<=*m**i*) such that the answer for the aforementioned problem is exactly *x**i* if we set *n*<==<=*n**i* and *m*<==<=*m**i*.
The first line contains one integer *t* (1<=≤<=*t*<=≤<=100) — the number of tests you have to construct. Then *t* lines follow, *i*-th line containing one integer *x**i* (0<=≤<=*x**i*<=≤<=109). Note that in hacks you have to set *t*<==<=1.
For each test you have to construct, output two positive numbers *n**i* and *m**i* (1<=≤<=*m**i*<=≤<=*n**i*<=≤<=109) such that the maximum number of 1's in a *m**i*-free *n**i*<=×<=*n**i* matrix is exactly *x**i*. If there are multiple solutions, you may output any of them; and if this is impossible to construct a test, output a single integer <=-<=1.
[ "3\n21\n0\n1\n" ]
[ "5 2\n1 1\n-1\n" ]
none
0
[ { "input": "3\n21\n0\n1", "output": "5 2\n1 1\n-1" }, { "input": "1\n420441920", "output": "-1" }, { "input": "1\n4", "output": "-1" }, { "input": "1\n297540", "output": "546 22" }, { "input": "1\n9", "output": "-1" }, { "input": "1\n144", "output": "-1" }, { "input": "1\n16", "output": "-1" }, { "input": "1\n25", "output": "-1" }, { "input": "1\n999944", "output": "-1" }, { "input": "1\n6", "output": "-1" }, { "input": "1\n14", "output": "-1" }, { "input": "1\n81", "output": "-1" }, { "input": "1\n2", "output": "-1" }, { "input": "1\n36", "output": "-1" }, { "input": "1\n2925", "output": "-1" }, { "input": "1\n5704", "output": "77 5" }, { "input": "1\n4104", "output": "-1" }, { "input": "1\n1980", "output": "-1" }, { "input": "1\n10", "output": "-1" }, { "input": "1\n4860", "output": "72 4" }, { "input": "1\n2601", "output": "-1" }, { "input": "1\n28", "output": "-1" }, { "input": "1\n56", "output": "-1" } ]
1,520,358,977
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
46
5,632,000
def find(x): if x == 0: return(1,1) for c_1 in range(2, max(x, 2)): if not (x % c_1): if Try(x, c_1, int(x / c_1)): c_2 = int(x / c_1) n = int((c_1 + c_2) / 2) b = int(abs(c_1 - c_2) / 2) if b == 0: continue m = int(n / b) return [n,m] else: continue return [-1] def Try(x,c_1,c_2): a = int((c_1+(c_2))/2) b = int(abs(c_1-c_2)/2) return (x == int((a+b) * (a-b))) test = int(input()) x = [] for i in range(test): x.append(int(input())) res = [] for i in list(map(find,x)): res += i for i in res: print(i,end=" ")
Title: Constructing Tests Time Limit: None seconds Memory Limit: None megabytes Problem Description: Let's denote a *m*-free matrix as a binary (that is, consisting of only 1's and 0's) matrix such that every square submatrix of size *m*<=×<=*m* of this matrix contains at least one zero. Consider the following problem: You are given two integers *n* and *m*. You have to construct an *m*-free square matrix of size *n*<=×<=*n* such that the number of 1's in this matrix is maximum possible. Print the maximum possible number of 1's in such matrix. You don't have to solve this problem. Instead, you have to construct a few tests for it. You will be given *t* numbers *x*1, *x*2, ..., *x**t*. For every , find two integers *n**i* and *m**i* (*n**i*<=≥<=*m**i*) such that the answer for the aforementioned problem is exactly *x**i* if we set *n*<==<=*n**i* and *m*<==<=*m**i*. Input Specification: The first line contains one integer *t* (1<=≤<=*t*<=≤<=100) — the number of tests you have to construct. Then *t* lines follow, *i*-th line containing one integer *x**i* (0<=≤<=*x**i*<=≤<=109). Note that in hacks you have to set *t*<==<=1. Output Specification: For each test you have to construct, output two positive numbers *n**i* and *m**i* (1<=≤<=*m**i*<=≤<=*n**i*<=≤<=109) such that the maximum number of 1's in a *m**i*-free *n**i*<=×<=*n**i* matrix is exactly *x**i*. If there are multiple solutions, you may output any of them; and if this is impossible to construct a test, output a single integer <=-<=1. Demo Input: ['3\n21\n0\n1\n'] Demo Output: ['5 2\n1 1\n-1\n'] Note: none
```python def find(x): if x == 0: return(1,1) for c_1 in range(2, max(x, 2)): if not (x % c_1): if Try(x, c_1, int(x / c_1)): c_2 = int(x / c_1) n = int((c_1 + c_2) / 2) b = int(abs(c_1 - c_2) / 2) if b == 0: continue m = int(n / b) return [n,m] else: continue return [-1] def Try(x,c_1,c_2): a = int((c_1+(c_2))/2) b = int(abs(c_1-c_2)/2) return (x == int((a+b) * (a-b))) test = int(input()) x = [] for i in range(test): x.append(int(input())) res = [] for i in list(map(find,x)): res += i for i in res: print(i,end=" ") ```
0
559
B
Equivalent Strings
PROGRAMMING
1,700
[ "divide and conquer", "hashing", "sortings", "strings" ]
null
null
Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases: 1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1 As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent. Gerald has already completed this home task. Now it's your turn!
The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length.
Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise.
[ "aaba\nabaa\n", "aabb\nabab\n" ]
[ "YES\n", "NO\n" ]
In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a". In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa".
1,000
[ { "input": "aaba\nabaa", "output": "YES" }, { "input": "aabb\nabab", "output": "NO" }, { "input": "a\na", "output": "YES" }, { "input": "a\nb", "output": "NO" }, { "input": "ab\nab", "output": "YES" }, { "input": "ab\nba", "output": "YES" }, { "input": "ab\nbb", "output": "NO" }, { "input": "zzaa\naazz", "output": "YES" }, { "input": "azza\nzaaz", "output": "YES" }, { "input": "abc\nabc", "output": "YES" }, { "input": "abc\nacb", "output": "NO" }, { "input": "azzz\nzzaz", "output": "YES" }, { "input": "abcd\ndcab", "output": "YES" }, { "input": "abcd\ncdab", "output": "YES" }, { "input": "abcd\ndcba", "output": "YES" }, { "input": "abcd\nacbd", "output": "NO" }, { "input": "oloaxgddgujq\noloaxgujqddg", "output": "YES" }, { "input": "uwzwdxfmosmqatyv\ndxfmzwwusomqvyta", "output": "YES" }, { "input": "hagnzomowtledfdotnll\nledfdotnllomowthagnz", "output": "YES" }, { "input": "snyaydaeobufdg\nsnyaydaeobufdg", "output": "YES" }, { "input": "baaaaa\nabaaaa", "output": "NO" }, { "input": "hhiisug\nmzdjwju", "output": "NO" }, { "input": "bbbabbabaaab\naaaabbabbbbb", "output": "NO" }, { "input": "bbaaab\naababb", "output": "NO" }, { "input": "aabbaaaa\naaaaabab", "output": "NO" }, { "input": "aab\naba", "output": "NO" }, { "input": "abcddd\nbacddd", "output": "NO" }, { "input": "qgiufelsfhanx\naaaaaaaaaaaaa", "output": "NO" }, { "input": "aabaababaaba\naababaaababa", "output": "NO" }, { "input": "nocdqzdriyyil\naaaaaaaaaaaaa", "output": "NO" }, { "input": "zdmctxl\nkojqhgw", "output": "NO" }, { "input": "yhwepqwyhwepqwyhwepqweahnqtueahnqtueahnqtuyhwepqwyhwepqwyhwepqwyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtueahnqtueahnqtueahnqtueahnqtu\neahnqtueahnqtueahnqtuyhwepqweahnqtuyhwepqwyhwepqweahnqtuyhwepqweahnqtuyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtuyhwepqwyhwepqwyhwepqw", "output": "NO" }, { "input": "abc\nbac", "output": "NO" }, { "input": "ottceez\npcstdvz", "output": "NO" } ]
1,573,261,176
2,147,483,647
Python 3
OK
TESTS
104
405
1,843,200
# Equivalent Strings # Today on a lecture about strings Gerald learned a new definition of string equivalency. # Two strings a and b of equal length are called equivalent in one of the two cases: # 1. They are equal. # 2. If we split string a into two halves of the same size a1 and a2, and string b into two halves of the same size b1 and b2, then one of the following is correct: # 2.1. a1 is equivalent to b1, and a2 is equivalent to b2 # 2.2. a1 is equivalent to b2, and a2 is equivalent to b1 # As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent. def mergeSort(string): if(len(string) % 2 == 1): return string else: middle = round(len(string) / 2) stringA = mergeSort(string[0: middle]) stringB = mergeSort(string[middle:]) if(stringA < stringB): return (stringA + stringB) else: return (stringB + stringA) stringA = input() stringB = input() if(mergeSort(stringA) == mergeSort(stringB)): print("YES") else: print("NO")
Title: Equivalent Strings Time Limit: None seconds Memory Limit: None megabytes Problem Description: Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases: 1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1 As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent. Gerald has already completed this home task. Now it's your turn! Input Specification: The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length. Output Specification: Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise. Demo Input: ['aaba\nabaa\n', 'aabb\nabab\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a". In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa".
```python # Equivalent Strings # Today on a lecture about strings Gerald learned a new definition of string equivalency. # Two strings a and b of equal length are called equivalent in one of the two cases: # 1. They are equal. # 2. If we split string a into two halves of the same size a1 and a2, and string b into two halves of the same size b1 and b2, then one of the following is correct: # 2.1. a1 is equivalent to b1, and a2 is equivalent to b2 # 2.2. a1 is equivalent to b2, and a2 is equivalent to b1 # As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent. def mergeSort(string): if(len(string) % 2 == 1): return string else: middle = round(len(string) / 2) stringA = mergeSort(string[0: middle]) stringB = mergeSort(string[middle:]) if(stringA < stringB): return (stringA + stringB) else: return (stringB + stringA) stringA = input() stringB = input() if(mergeSort(stringA) == mergeSort(stringB)): print("YES") else: print("NO") ```
3
197
A
Plate Game
PROGRAMMING
1,600
[ "constructive algorithms", "games", "math" ]
null
null
You've got a rectangular table with length *a* and width *b* and the infinite number of plates of radius *r*. Two players play the following game: they take turns to put the plates on the table so that the plates don't lie on each other (but they can touch each other), and so that any point on any plate is located within the table's border. During the game one cannot move the plates that already lie on the table. The player who cannot make another move loses. Determine which player wins, the one who moves first or the one who moves second, provided that both players play optimally well.
A single line contains three space-separated integers *a*, *b*, *r* (1<=≤<=*a*,<=*b*,<=*r*<=≤<=100) — the table sides and the plates' radius, correspondingly.
If wins the player who moves first, print "First" (without the quotes). Otherwise print "Second" (without the quotes).
[ "5 5 2\n", "6 7 4\n" ]
[ "First\n", "Second\n" ]
In the first sample the table has place for only one plate. The first player puts a plate on the table, the second player can't do that and loses. In the second sample the table is so small that it doesn't have enough place even for one plate. So the first player loses without making a single move.
1,000
[ { "input": "5 5 2", "output": "First" }, { "input": "6 7 4", "output": "Second" }, { "input": "100 100 1", "output": "First" }, { "input": "1 1 100", "output": "Second" }, { "input": "13 7 3", "output": "First" }, { "input": "23 7 3", "output": "First" }, { "input": "9 9 2", "output": "First" }, { "input": "13 13 2", "output": "First" }, { "input": "21 21 10", "output": "First" }, { "input": "20 21 10", "output": "First" }, { "input": "20 20 10", "output": "First" }, { "input": "9 13 2", "output": "First" }, { "input": "19 7 3", "output": "First" }, { "input": "19 19 10", "output": "Second" }, { "input": "19 20 10", "output": "Second" }, { "input": "19 21 10", "output": "Second" }, { "input": "1 100 1", "output": "Second" }, { "input": "2 100 1", "output": "First" }, { "input": "3 100 1", "output": "First" }, { "input": "100 100 49", "output": "First" }, { "input": "100 100 50", "output": "First" }, { "input": "100 100 51", "output": "Second" }, { "input": "100 99 50", "output": "Second" }, { "input": "4 10 5", "output": "Second" }, { "input": "8 11 2", "output": "First" }, { "input": "3 12 5", "output": "Second" }, { "input": "14 15 5", "output": "First" }, { "input": "61 2 3", "output": "Second" }, { "input": "82 20 5", "output": "First" }, { "input": "16 80 10", "output": "Second" }, { "input": "2 1 20", "output": "Second" }, { "input": "78 82 5", "output": "First" }, { "input": "8 55 7", "output": "Second" }, { "input": "75 55 43", "output": "Second" }, { "input": "34 43 70", "output": "Second" }, { "input": "86 74 36", "output": "First" }, { "input": "86 74 37", "output": "First" }, { "input": "86 74 38", "output": "Second" }, { "input": "24 70 11", "output": "First" }, { "input": "24 70 12", "output": "First" }, { "input": "24 70 13", "output": "Second" }, { "input": "78 95 38", "output": "First" }, { "input": "78 95 39", "output": "First" }, { "input": "78 95 40", "output": "Second" }, { "input": "88 43 21", "output": "First" }, { "input": "88 43 22", "output": "Second" }, { "input": "88 43 23", "output": "Second" }, { "input": "30 40 14", "output": "First" }, { "input": "30 40 15", "output": "First" }, { "input": "30 40 16", "output": "Second" }, { "input": "2 5 2", "output": "Second" }, { "input": "5 100 3", "output": "Second" }, { "input": "44 58 5", "output": "First" }, { "input": "4 4 6", "output": "Second" }, { "input": "10 20 6", "output": "Second" }, { "input": "100 1 1", "output": "Second" }, { "input": "60 60 1", "output": "First" }, { "input": "100 1 2", "output": "Second" }, { "input": "2 4 2", "output": "Second" }, { "input": "10 90 11", "output": "Second" }, { "input": "20 5 6", "output": "Second" }, { "input": "1 44 2", "output": "Second" }, { "input": "10 5 5", "output": "Second" }, { "input": "5 100 4", "output": "Second" }, { "input": "99 99 50", "output": "Second" }, { "input": "1 100 2", "output": "Second" }, { "input": "100 20 12", "output": "Second" }, { "input": "10 2 4", "output": "Second" }, { "input": "1 50 2", "output": "Second" }, { "input": "10 4 3", "output": "Second" }, { "input": "74 1 1", "output": "Second" }, { "input": "6 6 1", "output": "First" }, { "input": "10 10 1", "output": "First" }, { "input": "21 41 5", "output": "First" }, { "input": "13 1 2", "output": "Second" }, { "input": "1 100 3", "output": "Second" }, { "input": "1 64 2", "output": "Second" }, { "input": "3 4 1", "output": "First" }, { "input": "15 15 1", "output": "First" }, { "input": "15 16 1", "output": "First" }, { "input": "16 15 1", "output": "First" }, { "input": "16 16 1", "output": "First" }, { "input": "15 15 2", "output": "First" }, { "input": "15 16 2", "output": "First" }, { "input": "16 15 2", "output": "First" }, { "input": "16 16 2", "output": "First" }, { "input": "15 15 3", "output": "First" }, { "input": "15 16 3", "output": "First" }, { "input": "16 15 3", "output": "First" }, { "input": "16 16 3", "output": "First" }, { "input": "15 17 3", "output": "First" }, { "input": "16 17 3", "output": "First" }, { "input": "17 17 3", "output": "First" }, { "input": "17 15 3", "output": "First" }, { "input": "17 16 3", "output": "First" } ]
1,467,882,974
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
124
0
a, b, r = map(int, input().split()) print('Second' if ((a // (2*r)) * (b //( 2*r))) % 2 == 0 else 'First')
Title: Plate Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: You've got a rectangular table with length *a* and width *b* and the infinite number of plates of radius *r*. Two players play the following game: they take turns to put the plates on the table so that the plates don't lie on each other (but they can touch each other), and so that any point on any plate is located within the table's border. During the game one cannot move the plates that already lie on the table. The player who cannot make another move loses. Determine which player wins, the one who moves first or the one who moves second, provided that both players play optimally well. Input Specification: A single line contains three space-separated integers *a*, *b*, *r* (1<=≤<=*a*,<=*b*,<=*r*<=≤<=100) — the table sides and the plates' radius, correspondingly. Output Specification: If wins the player who moves first, print "First" (without the quotes). Otherwise print "Second" (without the quotes). Demo Input: ['5 5 2\n', '6 7 4\n'] Demo Output: ['First\n', 'Second\n'] Note: In the first sample the table has place for only one plate. The first player puts a plate on the table, the second player can't do that and loses. In the second sample the table is so small that it doesn't have enough place even for one plate. So the first player loses without making a single move.
```python a, b, r = map(int, input().split()) print('Second' if ((a // (2*r)) * (b //( 2*r))) % 2 == 0 else 'First') ```
0
550
A
Two Substrings
PROGRAMMING
1,500
[ "brute force", "dp", "greedy", "implementation", "strings" ]
null
null
You are given string *s*. Your task is to determine if the given string *s* contains two non-overlapping substrings "AB" and "BA" (the substrings can go in any order).
The only line of input contains a string *s* of length between 1 and 105 consisting of uppercase Latin letters.
Print "YES" (without the quotes), if string *s* contains two non-overlapping substrings "AB" and "BA", and "NO" otherwise.
[ "ABA\n", "BACFAB\n", "AXBYBXA\n" ]
[ "NO\n", "YES\n", "NO\n" ]
In the first sample test, despite the fact that there are substrings "AB" and "BA", their occurrences overlap, so the answer is "NO". In the second sample test there are the following occurrences of the substrings: BACFAB. In the third sample test there is no substring "AB" nor substring "BA".
1,000
[ { "input": "ABA", "output": "NO" }, { "input": "BACFAB", "output": "YES" }, { "input": "AXBYBXA", "output": "NO" }, { "input": "ABABAB", "output": "YES" }, { "input": "BBBBBBBBBB", "output": "NO" }, { "input": "ABBA", "output": "YES" }, { "input": "ABAXXXAB", "output": "YES" }, { "input": "TESTABAXXABTEST", "output": "YES" }, { "input": "A", "output": "NO" }, { "input": "B", "output": "NO" }, { "input": "X", "output": "NO" }, { "input": "BA", "output": "NO" }, { "input": "AB", "output": "NO" }, { "input": "AA", "output": "NO" }, { "input": "BB", "output": "NO" }, { "input": "BAB", "output": "NO" }, { "input": "AAB", "output": "NO" }, { "input": "BAA", "output": "NO" }, { "input": "ABB", "output": "NO" }, { "input": "BBA", "output": "NO" }, { "input": "AAA", "output": "NO" }, { "input": "BBB", "output": "NO" }, { "input": "AXBXBXA", "output": "NO" }, { "input": "SKDSKDJABSDBADKFJDK", "output": "YES" }, { "input": "ABAXXBBXXAA", "output": "NO" }, { "input": "ABAB", "output": "NO" }, { "input": "BABA", "output": "NO" }, { "input": "AAAB", "output": "NO" }, { "input": "AAAA", "output": "NO" }, { "input": "AABA", "output": "NO" }, { "input": "ABAA", "output": "NO" }, { "input": "BAAA", "output": "NO" }, { "input": "AABB", "output": "NO" }, { "input": "BAAB", "output": "YES" }, { "input": "BBAA", "output": "NO" }, { "input": "BBBA", "output": "NO" }, { "input": "BBAB", "output": "NO" }, { "input": "BABB", "output": "NO" }, { "input": "ABBB", "output": "NO" }, { "input": "BBBB", "output": "NO" }, { "input": "BABAB", "output": "YES" }, { "input": "ABABA", "output": "YES" }, { "input": "AAABAAACBBBC", "output": "NO" }, { "input": "AABBBACBBBBBBAACBCCACBBAABBBBBCAACABAACABCACCBCBCCCBCBCABCBBCCBCBBAACBACAABACBBCACCBCCACCABBCBABBAAC", "output": "YES" }, { "input": "CBBABDDBBADAC", "output": "YES" }, { "input": "ABYFAB", "output": "NO" }, { "input": "BABXXAB", "output": "YES" }, { "input": "ABAXAB", "output": "YES" }, { "input": "ABABXAB", "output": "YES" }, { "input": "ABXABXABXABXABXBAXBAXBAXBA", "output": "YES" }, { "input": "QQQQQQQQQABABQQQQQQQQ", "output": "NO" } ]
1,689,402,331
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
3
61
0
from sys import stdin,stdout from collections import Counter,defaultdict def I(): return int(stdin.readline()) def II(): return map(int, stdin.readline().split()) def IL(): return list(map(int, stdin.readline().split())) def SIL(): return sorted(map(int, stdin.readline().split())) def solve(): # write your code here word = input() n = len(word) if n < 2: return 'YES' for i in range(1,n-1): if word[i-1] == word[i+1]: return "NO" return "YES" print(solve())
Title: Two Substrings Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given string *s*. Your task is to determine if the given string *s* contains two non-overlapping substrings "AB" and "BA" (the substrings can go in any order). Input Specification: The only line of input contains a string *s* of length between 1 and 105 consisting of uppercase Latin letters. Output Specification: Print "YES" (without the quotes), if string *s* contains two non-overlapping substrings "AB" and "BA", and "NO" otherwise. Demo Input: ['ABA\n', 'BACFAB\n', 'AXBYBXA\n'] Demo Output: ['NO\n', 'YES\n', 'NO\n'] Note: In the first sample test, despite the fact that there are substrings "AB" and "BA", their occurrences overlap, so the answer is "NO". In the second sample test there are the following occurrences of the substrings: BACFAB. In the third sample test there is no substring "AB" nor substring "BA".
```python from sys import stdin,stdout from collections import Counter,defaultdict def I(): return int(stdin.readline()) def II(): return map(int, stdin.readline().split()) def IL(): return list(map(int, stdin.readline().split())) def SIL(): return sorted(map(int, stdin.readline().split())) def solve(): # write your code here word = input() n = len(word) if n < 2: return 'YES' for i in range(1,n-1): if word[i-1] == word[i+1]: return "NO" return "YES" print(solve()) ```
0
605
A
Sorting Railway Cars
PROGRAMMING
1,600
[ "constructive algorithms", "greedy" ]
null
null
An infinitely long railway has a train consisting of *n* cars, numbered from 1 to *n* (the numbers of all the cars are distinct) and positioned in arbitrary order. David Blaine wants to sort the railway cars in the order of increasing numbers. In one move he can make one of the cars disappear from its place and teleport it either to the beginning of the train, or to the end of the train, at his desire. What is the minimum number of actions David Blaine needs to perform in order to sort the train?
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of cars in the train. The second line contains *n* integers *p**i* (1<=≤<=*p**i*<=≤<=*n*, *p**i*<=≠<=*p**j* if *i*<=≠<=*j*) — the sequence of the numbers of the cars in the train.
Print a single integer — the minimum number of actions needed to sort the railway cars.
[ "5\n4 1 2 5 3\n", "4\n4 1 3 2\n" ]
[ "2\n", "2\n" ]
In the first sample you need first to teleport the 4-th car, and then the 5-th car to the end of the train.
500
[ { "input": "5\n4 1 2 5 3", "output": "2" }, { "input": "4\n4 1 3 2", "output": "2" }, { "input": "1\n1", "output": "0" }, { "input": "2\n1 2", "output": "0" }, { "input": "2\n2 1", "output": "1" }, { "input": "6\n5 3 6 1 4 2", "output": "4" }, { "input": "7\n1 2 3 6 7 4 5", "output": "2" }, { "input": "8\n6 2 1 8 5 7 3 4", "output": "5" }, { "input": "3\n1 2 3", "output": "0" }, { "input": "3\n1 3 2", "output": "1" }, { "input": "3\n2 1 3", "output": "1" }, { "input": "3\n2 3 1", "output": "1" }, { "input": "3\n3 1 2", "output": "1" }, { "input": "3\n3 2 1", "output": "2" }, { "input": "7\n1 3 5 7 2 4 6", "output": "5" }, { "input": "7\n1 5 2 6 3 7 4", "output": "3" }, { "input": "5\n1 4 2 3 5", "output": "2" }, { "input": "9\n1 6 4 5 9 8 7 3 2", "output": "7" }, { "input": "10\n5 1 6 2 8 3 4 10 9 7", "output": "6" }, { "input": "50\n39 8 41 9 45 1 5 18 38 31 28 7 12 49 33 19 26 6 42 13 37 27 2 21 20 22 14 16 48 47 32 50 25 17 35 24 36 4 29 15 43 10 11 30 40 46 3 23 44 34", "output": "46" }, { "input": "50\n43 15 10 33 32 31 13 7 5 22 36 1 25 14 38 19 8 6 24 42 28 21 44 35 4 3 49 30 27 46 2 9 17 37 45 41 18 39 12 11 16 20 50 26 29 34 40 47 48 23", "output": "47" }, { "input": "50\n10 40 34 43 50 17 15 13 9 2 32 18 11 46 27 24 36 16 29 45 42 4 47 19 48 37 41 5 21 26 22 25 44 31 35 49 20 8 12 23 6 38 14 1 7 28 3 33 39 30", "output": "46" }, { "input": "50\n10 37 3 46 45 29 36 13 21 25 35 5 18 33 12 19 50 16 30 47 20 42 39 28 2 6 38 8 7 31 22 27 26 9 15 14 34 48 4 32 40 43 44 24 11 1 23 17 49 41", "output": "46" }, { "input": "50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 42 37 38 39 40 41 36 43 44 45 46 47 48 49 50", "output": "14" }, { "input": "50\n1 2 3 4 5 6 7 8 43 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 50 33 34 35 36 37 38 39 40 41 42 9 44 45 46 47 48 49 32", "output": "27" }, { "input": "50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 49 40 41 47 43 44 45 46 42 50 39 48", "output": "11" }, { "input": "50\n1 2 3 4 27 6 7 8 9 10 30 12 13 14 15 16 17 18 19 20 21 22 23 24 28 26 5 25 29 11 31 32 33 34 38 36 37 35 39 40 41 42 43 44 45 46 47 48 49 50", "output": "36" }, { "input": "50\n1 2 3 4 5 6 7 49 9 10 17 12 13 14 15 16 11 18 19 20 21 22 23 24 25 26 27 38 29 36 30 32 33 34 35 31 37 28 39 40 41 42 43 44 45 46 47 48 8 50", "output": "38" }, { "input": "50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 31 18 19 20 21 23 22 24 25 26 27 28 29 49 17 32 33 34 39 36 37 38 47 44 41 42 43 40 45 46 35 48 30 50", "output": "33" }, { "input": "50\n1 2 15 4 5 6 7 8 9 10 11 12 13 14 3 16 17 18 19 32 21 22 36 28 23 26 27 24 29 30 31 20 33 34 37 25 35 38 40 39 41 42 43 44 45 46 47 48 49 50", "output": "39" }, { "input": "5\n4 3 1 2 5", "output": "3" }, { "input": "6\n1 3 5 6 4 2", "output": "4" }, { "input": "10\n2 1 4 3 6 5 8 7 10 9", "output": "8" }, { "input": "5\n1 2 4 5 3", "output": "2" }, { "input": "7\n1 4 2 3 7 6 5", "output": "4" }, { "input": "4\n3 1 2 4", "output": "2" }, { "input": "6\n2 5 4 3 6 1", "output": "4" }, { "input": "5\n1 3 4 5 2", "output": "2" }, { "input": "6\n2 4 6 5 1 3", "output": "4" }, { "input": "6\n1 2 4 5 6 3", "output": "3" }, { "input": "9\n9 8 7 4 5 6 3 2 1", "output": "6" }, { "input": "7\n4 1 2 3 6 5 7", "output": "4" } ]
1,642,411,109
2,147,483,647
PyPy 3-64
OK
TESTS
66
421
17,510,400
def f(a): a=list(zip(a,range(len(a)))) a.sort() mx=1 cmx=1 for i in range(1,len(a)): if a[i-1][1]<a[i][1]: cmx+=1 mx=max(mx,cmx) else: cmx=1 return len(a)-mx n=input() a=[*map(int,input().strip().split())] print(f(a))
Title: Sorting Railway Cars Time Limit: None seconds Memory Limit: None megabytes Problem Description: An infinitely long railway has a train consisting of *n* cars, numbered from 1 to *n* (the numbers of all the cars are distinct) and positioned in arbitrary order. David Blaine wants to sort the railway cars in the order of increasing numbers. In one move he can make one of the cars disappear from its place and teleport it either to the beginning of the train, or to the end of the train, at his desire. What is the minimum number of actions David Blaine needs to perform in order to sort the train? Input Specification: The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of cars in the train. The second line contains *n* integers *p**i* (1<=≤<=*p**i*<=≤<=*n*, *p**i*<=≠<=*p**j* if *i*<=≠<=*j*) — the sequence of the numbers of the cars in the train. Output Specification: Print a single integer — the minimum number of actions needed to sort the railway cars. Demo Input: ['5\n4 1 2 5 3\n', '4\n4 1 3 2\n'] Demo Output: ['2\n', '2\n'] Note: In the first sample you need first to teleport the 4-th car, and then the 5-th car to the end of the train.
```python def f(a): a=list(zip(a,range(len(a)))) a.sort() mx=1 cmx=1 for i in range(1,len(a)): if a[i-1][1]<a[i][1]: cmx+=1 mx=max(mx,cmx) else: cmx=1 return len(a)-mx n=input() a=[*map(int,input().strip().split())] print(f(a)) ```
3
248
A
Cupboards
PROGRAMMING
800
[ "implementation" ]
null
null
One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house. Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find. And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open. Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position. Your task is to write a program that will determine the required number of seconds *t*.
The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero. The numbers in the lines are separated by single spaces.
In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs.
[ "5\n0 1\n1 0\n0 1\n1 1\n0 1\n" ]
[ "3\n" ]
none
500
[ { "input": "5\n0 1\n1 0\n0 1\n1 1\n0 1", "output": "3" }, { "input": "2\n0 0\n0 0", "output": "0" }, { "input": "3\n0 1\n1 1\n1 1", "output": "1" }, { "input": "8\n0 1\n1 0\n0 1\n1 1\n0 1\n1 0\n0 1\n1 0", "output": "7" }, { "input": "8\n1 0\n1 0\n1 0\n0 1\n0 1\n1 1\n1 1\n0 1", "output": "6" }, { "input": "15\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "5\n1 0\n1 0\n1 0\n0 1\n0 1", "output": "4" } ]
1,685,171,259
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
60
0
n = int(input()) l = [] r = [] for i in range(n): a,b = map(int, input().split()) l.append(a) r.append(b) r1 = l.count(1) r2 = r.count(0) print(r1+r2)
Title: Cupboards Time Limit: None seconds Memory Limit: None megabytes Problem Description: One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house. Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find. And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open. Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position. Your task is to write a program that will determine the required number of seconds *t*. Input Specification: The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero. The numbers in the lines are separated by single spaces. Output Specification: In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs. Demo Input: ['5\n0 1\n1 0\n0 1\n1 1\n0 1\n'] Demo Output: ['3\n'] Note: none
```python n = int(input()) l = [] r = [] for i in range(n): a,b = map(int, input().split()) l.append(a) r.append(b) r1 = l.count(1) r2 = r.count(0) print(r1+r2) ```
0
474
A
Keyboard
PROGRAMMING
900
[ "implementation" ]
null
null
Our good friend Mole is trying to code a big message. He is typing on an unusual keyboard with characters arranged in following way: Unfortunately Mole is blind, so sometimes it is problem for him to put his hands accurately. He accidentally moved both his hands with one position to the left or to the right. That means that now he presses not a button he wants, but one neighboring button (left or right, as specified in input). We have a sequence of characters he has typed and we want to find the original message.
First line of the input contains one letter describing direction of shifting ('L' or 'R' respectively for left or right). Second line contains a sequence of characters written by Mole. The size of this sequence will be no more than 100. Sequence contains only symbols that appear on Mole's keyboard. It doesn't contain spaces as there is no space on Mole's keyboard. It is guaranteed that even though Mole hands are moved, he is still pressing buttons on keyboard and not hitting outside it.
Print a line that contains the original message.
[ "R\ns;;upimrrfod;pbr\n" ]
[ "allyouneedislove\n" ]
none
500
[ { "input": "R\ns;;upimrrfod;pbr", "output": "allyouneedislove" }, { "input": "R\nwertyuiop;lkjhgfdsxcvbnm,.", "output": "qwertyuiolkjhgfdsazxcvbnm," }, { "input": "L\nzxcvbnm,kjhgfdsaqwertyuio", "output": "xcvbnm,.lkjhgfdswertyuiop" }, { "input": "R\nbubbuduppudup", "output": "vyvvysyooysyo" }, { "input": "L\ngggggggggggggggggggggggggggggggggggggggggg", "output": "hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh" }, { "input": "R\ngggggggggggggggggggggggggggggggggggggggggg", "output": "ffffffffffffffffffffffffffffffffffffffffff" }, { "input": "L\nggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggg", "output": "hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh" }, { "input": "R\nggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggg", "output": "fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff" }, { "input": "L\nxgwurenkxkiau,c,vonei.zltazmnkhqtwuogkgvgckvja,z.rhanuy.ybebmzcfwozkwvuuiolaqlgvvvewnbuinrncgjwjdsfw", "output": "cheitrmlclosi.v.bpmro/x;ysx,mljwyeiphlhbhvlbks.x/tjsmiu/unrn,xvgepxlebiiop;sw;hbbbremniomtmvhkekfdge" }, { "input": "L\nuoz.vmks,wxrb,nwcvdzh.m,hwsios.lvu,ktes,,ythddhm.sh,d,c,cfj.wqam,bowofbyx,jathqayhreqvixvbmgdokofmym", "output": "ipx/b,ld.ectn.mevbfxj/,.jedopd/;bi.lyrd..uyjffj,/dj.f.v.vgk/ews,.npepgnuc.ksyjwsujtrwbocbn,hfplpg,u," }, { "input": "R\noedjyrvuw/rn.v.hdwndbiposiewgsn.pnyf;/tsdohp,hrtd/mx,;coj./billd..mwbneohcikrdes/ucjr,wspthleyp,..f,", "output": "iwshtecyq.eb,c,gsqbsvuoiauwqfab,obtdl.rasigomgers.nzmlxih,.vukks,,nqvbwigxujeswa.yxhemqaorgkwtom,,dm" }, { "input": "R\nvgj;o;ijrtfyck,dthccioltcx,crub;oceooognsuvfx/kgo.fbsudv,yod.erdrxhbeiyltxhnrobbb;ydrgroefcr/f;uvdjd", "output": "cfhliluherdtxjmsrgxxuikrxzmxeyvlixwiiifbaycdz.jfi,dvayscmtis,wesezgvwutkrzgbeivvvltsefeiwdxe.dlycshs" }, { "input": "L\nqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq", "output": "wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww" }, { "input": "L\noooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo", "output": "pppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppp" }, { "input": "L\n,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,", "output": "...................................................................................................." }, { "input": "L\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz", "output": "xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx" }, { "input": "R\noooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo", "output": "iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii" }, { "input": "R\nwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww", "output": "qqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq" }, { "input": "R\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx", "output": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz" }, { "input": "L\nq", "output": "w" }, { "input": "L\no", "output": "p" }, { "input": "L\n,", "output": "." }, { "input": "L\nz", "output": "x" }, { "input": "R\n.", "output": "," }, { "input": "R\no", "output": "i" }, { "input": "R\nw", "output": "q" }, { "input": "R\nx", "output": "z" }, { "input": "R\n,./", "output": "m,." }, { "input": "R\nwertuk;;/", "output": "qweryjll." }, { "input": "L\n..", "output": "//" } ]
1,694,608,060
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
15
0
c=input() s=input() a="qwertyuiopasdfghjkl;zxcvbnm,./" q="" if c=='R': for i in range(0,len(s)): t=a.find(s[i]) if s[i]=='q': q+="/" else: q+=a[t-1] else: for i in range(0,len(s)): t=a.find(s[i]) if s[i]=='/': q+="q" else: q+=a[t-1] print(q)
Title: Keyboard Time Limit: None seconds Memory Limit: None megabytes Problem Description: Our good friend Mole is trying to code a big message. He is typing on an unusual keyboard with characters arranged in following way: Unfortunately Mole is blind, so sometimes it is problem for him to put his hands accurately. He accidentally moved both his hands with one position to the left or to the right. That means that now he presses not a button he wants, but one neighboring button (left or right, as specified in input). We have a sequence of characters he has typed and we want to find the original message. Input Specification: First line of the input contains one letter describing direction of shifting ('L' or 'R' respectively for left or right). Second line contains a sequence of characters written by Mole. The size of this sequence will be no more than 100. Sequence contains only symbols that appear on Mole's keyboard. It doesn't contain spaces as there is no space on Mole's keyboard. It is guaranteed that even though Mole hands are moved, he is still pressing buttons on keyboard and not hitting outside it. Output Specification: Print a line that contains the original message. Demo Input: ['R\ns;;upimrrfod;pbr\n'] Demo Output: ['allyouneedislove\n'] Note: none
```python c=input() s=input() a="qwertyuiopasdfghjkl;zxcvbnm,./" q="" if c=='R': for i in range(0,len(s)): t=a.find(s[i]) if s[i]=='q': q+="/" else: q+=a[t-1] else: for i in range(0,len(s)): t=a.find(s[i]) if s[i]=='/': q+="q" else: q+=a[t-1] print(q) ```
0
0
none
none
none
0
[ "none" ]
null
null
Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it. Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player. Alex is a perfectionist, so he decided to get as many points as possible. Help him.
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence. The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105).
Print a single integer — the maximum number of points that Alex can earn.
[ "2\n1 2\n", "3\n1 2 3\n", "9\n1 2 1 3 2 2 2 2 3\n" ]
[ "2\n", "4\n", "10\n" ]
Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points.
0
[ { "input": "2\n1 2", "output": "2" }, { "input": "3\n1 2 3", "output": "4" }, { "input": "9\n1 2 1 3 2 2 2 2 3", "output": "10" }, { "input": "5\n3 3 4 5 4", "output": "11" }, { "input": "5\n5 3 5 3 4", "output": "16" }, { "input": "5\n4 2 3 2 5", "output": "9" }, { "input": "10\n10 5 8 9 5 6 8 7 2 8", "output": "46" }, { "input": "10\n1 1 1 1 1 1 2 3 4 4", "output": "14" }, { "input": "100\n6 6 8 9 7 9 6 9 5 7 7 4 5 3 9 1 10 3 4 5 8 9 6 5 6 4 10 9 1 4 1 7 1 4 9 10 8 2 9 9 10 5 8 9 5 6 8 7 2 8 7 6 2 6 10 8 6 2 5 5 3 2 8 8 5 3 6 2 1 4 7 2 7 3 7 4 10 10 7 5 4 7 5 10 7 1 1 10 7 7 7 2 3 4 2 8 4 7 4 4", "output": "296" }, { "input": "100\n6 1 5 7 10 10 2 7 3 7 2 10 7 6 3 5 5 5 3 7 2 4 2 7 7 4 2 8 2 10 4 7 9 1 1 7 9 7 1 10 10 9 5 6 10 1 7 5 8 1 1 5 3 10 2 4 3 5 2 7 4 9 5 10 1 3 7 6 6 9 3 6 6 10 1 10 6 1 10 3 4 1 7 9 2 7 8 9 3 3 2 4 6 6 1 2 9 4 1 2", "output": "313" }, { "input": "100\n7 6 3 8 8 3 10 5 3 8 6 4 6 9 6 7 3 9 10 7 5 5 9 10 7 2 3 8 9 5 4 7 9 3 6 4 9 10 7 6 8 7 6 6 10 3 7 4 5 7 7 5 1 5 4 8 7 3 3 4 7 8 5 9 2 2 3 1 6 4 6 6 6 1 7 10 7 4 5 3 9 2 4 1 5 10 9 3 9 6 8 5 2 1 10 4 8 5 10 9", "output": "298" }, { "input": "100\n2 10 9 1 2 6 7 2 2 8 9 9 9 5 6 2 5 1 1 10 7 4 5 5 8 1 9 4 10 1 9 3 1 8 4 10 8 8 2 4 6 5 1 4 2 2 1 2 8 5 3 9 4 10 10 7 8 6 1 8 2 6 7 1 6 7 3 10 10 3 7 7 6 9 6 8 8 10 4 6 4 3 3 3 2 3 10 6 8 5 5 10 3 7 3 1 1 1 5 5", "output": "312" }, { "input": "100\n4 9 7 10 4 7 2 6 1 9 1 8 7 5 5 7 6 7 9 8 10 5 3 5 7 10 3 2 1 3 8 9 4 10 4 7 6 4 9 6 7 1 9 4 3 5 8 9 2 7 10 5 7 5 3 8 10 3 8 9 3 4 3 10 6 5 1 8 3 2 5 8 4 7 5 3 3 2 6 9 9 8 2 7 6 3 2 2 8 8 4 5 6 9 2 3 2 2 5 2", "output": "287" }, { "input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8", "output": "380" }, { "input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8", "output": "380" }, { "input": "100\n10 5 8 4 4 4 1 4 5 8 3 10 2 4 1 10 8 1 1 6 8 4 2 9 1 3 1 7 7 9 3 5 5 8 6 9 9 4 8 1 3 3 2 6 1 5 4 5 3 5 5 6 7 5 7 9 3 5 4 9 2 6 8 1 1 7 7 3 8 9 8 7 3 2 4 1 6 1 3 9 4 2 2 8 5 10 1 8 8 5 1 5 6 9 4 5 6 5 10 2", "output": "265" }, { "input": "100\n7 5 1 8 5 6 6 2 6 2 7 7 3 6 2 4 4 2 10 2 2 2 10 6 6 1 5 10 9 1 5 9 8 9 4 1 10 5 7 5 7 6 4 8 8 1 7 8 3 8 2 1 8 4 10 3 5 6 6 10 9 6 5 1 10 7 6 9 9 2 10 10 9 1 2 1 7 7 4 10 1 10 5 5 3 8 9 8 1 4 10 2 4 5 4 4 1 6 2 9", "output": "328" }, { "input": "100\n5 6 10 7 1 7 10 1 9 1 5 1 4 1 3 3 7 9 1 6 1 6 5 7 1 6 3 1 3 6 3 8 2 4 1 5 2 10 7 3 10 4 10 1 5 4 2 9 7 9 5 7 10 4 1 4 8 9 3 1 3 7 7 4 3 7 7 10 6 9 5 5 6 5 3 9 8 8 5 5 4 10 9 4 10 4 1 8 3 5 4 10 9 3 10 4 10 7 10 9", "output": "324" }, { "input": "10\n7 4 5 3 9 1 10 3 4 5", "output": "34" }, { "input": "10\n8 9 6 5 6 4 10 9 1 4", "output": "39" }, { "input": "10\n1 7 1 4 9 10 8 2 9 9", "output": "40" }, { "input": "1\n100000", "output": "100000" } ]
1,681,763,692
2,147,483,647
PyPy 3-64
OK
TESTS
47
171
15,052,800
from collections import Counter n = int(input()) f = Counter(map(int, input().split())) mx = max(f)+1 dp = [0]*mx for i in range(1, mx): dp[i] = max(dp[i-1], dp[i-2] + f[i]*i) print(dp[-1])
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it. Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player. Alex is a perfectionist, so he decided to get as many points as possible. Help him. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence. The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105). Output Specification: Print a single integer — the maximum number of points that Alex can earn. Demo Input: ['2\n1 2\n', '3\n1 2 3\n', '9\n1 2 1 3 2 2 2 2 3\n'] Demo Output: ['2\n', '4\n', '10\n'] Note: Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points.
```python from collections import Counter n = int(input()) f = Counter(map(int, input().split())) mx = max(f)+1 dp = [0]*mx for i in range(1, mx): dp[i] = max(dp[i-1], dp[i-2] + f[i]*i) print(dp[-1]) ```
3
9
A
Die Roll
PROGRAMMING
800
[ "math", "probabilities" ]
A. Die Roll
1
64
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
[ "4 2\n" ]
[ "1/2\n" ]
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
0
[ { "input": "4 2", "output": "1/2" }, { "input": "1 1", "output": "1/1" }, { "input": "1 2", "output": "5/6" }, { "input": "1 3", "output": "2/3" }, { "input": "1 4", "output": "1/2" }, { "input": "1 5", "output": "1/3" }, { "input": "1 6", "output": "1/6" }, { "input": "2 1", "output": "5/6" }, { "input": "2 2", "output": "5/6" }, { "input": "2 3", "output": "2/3" }, { "input": "2 4", "output": "1/2" }, { "input": "2 5", "output": "1/3" }, { "input": "2 6", "output": "1/6" }, { "input": "3 1", "output": "2/3" }, { "input": "3 2", "output": "2/3" }, { "input": "3 3", "output": "2/3" }, { "input": "3 4", "output": "1/2" }, { "input": "3 5", "output": "1/3" }, { "input": "3 6", "output": "1/6" }, { "input": "4 1", "output": "1/2" }, { "input": "4 3", "output": "1/2" }, { "input": "4 4", "output": "1/2" }, { "input": "4 5", "output": "1/3" }, { "input": "4 6", "output": "1/6" }, { "input": "5 1", "output": "1/3" }, { "input": "5 2", "output": "1/3" }, { "input": "5 3", "output": "1/3" }, { "input": "5 4", "output": "1/3" }, { "input": "5 5", "output": "1/3" }, { "input": "5 6", "output": "1/6" }, { "input": "6 1", "output": "1/6" }, { "input": "6 2", "output": "1/6" }, { "input": "6 3", "output": "1/6" }, { "input": "6 4", "output": "1/6" }, { "input": "6 5", "output": "1/6" }, { "input": "6 6", "output": "1/6" } ]
1,696,787,435
2,147,483,647
Python 3
COMPILATION_ERROR
TESTS
0
0
0
def gcd(a, b): a, b = b, a % b return a def simplify(n, d): g = gcd(n, d) return n // g, d // g Y = int(input("Enter Yakko's result: ")) W = int(input("Enter Wakko's result: ")) M = max(Y, W) P = (6 - M + (Y != W)) / 6 N, D = simplify(P * 6, 6) print(f"The probability of Dot winning is {N}/{D}")
Title: Die Roll Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win. Input Specification: The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls. Output Specification: Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1». Demo Input: ['4 2\n'] Demo Output: ['1/2\n'] Note: Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
```python def gcd(a, b): a, b = b, a % b return a def simplify(n, d): g = gcd(n, d) return n // g, d // g Y = int(input("Enter Yakko's result: ")) W = int(input("Enter Wakko's result: ")) M = max(Y, W) P = (6 - M + (Y != W)) / 6 N, D = simplify(P * 6, 6) print(f"The probability of Dot winning is {N}/{D}") ```
-1
61
A
Ultra-Fast Mathematician
PROGRAMMING
800
[ "implementation" ]
A. Ultra-Fast Mathematician
2
256
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Write one line — the corresponding answer. Do not omit the leading 0s.
[ "1010100\n0100101\n", "000\n111\n", "1110\n1010\n", "01110\n01100\n" ]
[ "1110001\n", "111\n", "0100\n", "00010\n" ]
none
500
[ { "input": "1010100\n0100101", "output": "1110001" }, { "input": "000\n111", "output": "111" }, { "input": "1110\n1010", "output": "0100" }, { "input": "01110\n01100", "output": "00010" }, { "input": "011101\n000001", "output": "011100" }, { "input": "10\n01", "output": "11" }, { "input": "00111111\n11011101", "output": "11100010" }, { "input": "011001100\n101001010", "output": "110000110" }, { "input": "1100100001\n0110101100", "output": "1010001101" }, { "input": "00011101010\n10010100101", "output": "10001001111" }, { "input": "100000101101\n111010100011", "output": "011010001110" }, { "input": "1000001111010\n1101100110001", "output": "0101101001011" }, { "input": "01011111010111\n10001110111010", "output": "11010001101101" }, { "input": "110010000111100\n001100101011010", "output": "111110101100110" }, { "input": "0010010111110000\n0000000011010110", "output": "0010010100100110" }, { "input": "00111110111110000\n01111100001100000", "output": "01000010110010000" }, { "input": "101010101111010001\n001001111101111101", "output": "100011010010101100" }, { "input": "0110010101111100000\n0011000101000000110", "output": "0101010000111100110" }, { "input": "11110100011101010111\n00001000011011000000", "output": "11111100000110010111" }, { "input": "101010101111101101001\n111010010010000011111", "output": "010000111101101110110" }, { "input": "0000111111100011000010\n1110110110110000001010", "output": "1110001001010011001000" }, { "input": "10010010101000110111000\n00101110100110111000111", "output": "10111100001110001111111" }, { "input": "010010010010111100000111\n100100111111100011001110", "output": "110110101101011111001001" }, { "input": "0101110100100111011010010\n0101100011010111001010001", "output": "0000010111110000010000011" }, { "input": "10010010100011110111111011\n10000110101100000001000100", "output": "00010100001111110110111111" }, { "input": "000001111000000100001000000\n011100111101111001110110001", "output": "011101000101111101111110001" }, { "input": "0011110010001001011001011100\n0000101101000011101011001010", "output": "0011011111001010110010010110" }, { "input": "11111000000000010011001101111\n11101110011001010100010000000", "output": "00010110011001000111011101111" }, { "input": "011001110000110100001100101100\n001010000011110000001000101001", "output": "010011110011000100000100000101" }, { "input": "1011111010001100011010110101111\n1011001110010000000101100010101", "output": "0000110100011100011111010111010" }, { "input": "10111000100001000001010110000001\n10111000001100101011011001011000", "output": "00000000101101101010001111011001" }, { "input": "000001010000100001000000011011100\n111111111001010100100001100000111", "output": "111110101001110101100001111011011" }, { "input": "1101000000000010011011101100000110\n1110000001100010011010000011011110", "output": "0011000001100000000001101111011000" }, { "input": "01011011000010100001100100011110001\n01011010111000001010010100001110000", "output": "00000001111010101011110000010000001" }, { "input": "000011111000011001000110111100000100\n011011000110000111101011100111000111", "output": "011000111110011110101101011011000011" }, { "input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000", "output": "1011001001111001001011101010101000010" }, { "input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011", "output": "10001110000010101110000111000011111110" }, { "input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100", "output": "000100001011110000011101110111010001110" }, { "input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001", "output": "1101110101010110000011000000101011110011" }, { "input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100", "output": "11001011110010010000010111001100001001110" }, { "input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110", "output": "001100101000011111111101111011101010111001" }, { "input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001", "output": "0111010010100110110101100010000100010100000" }, { "input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100", "output": "11111110000000100101000100110111001100011001" }, { "input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011", "output": "101011011100100010100011011001101010100100010" }, { "input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001", "output": "1101001100111011010111110110101111001011110111" }, { "input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001", "output": "10010101000101000000011010011110011110011110001" }, { "input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100", "output": "011011011100000000010101110010000000101000111101" }, { "input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100", "output": "0101010111101001011011110110011101010101010100011" }, { "input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011", "output": "11001011010010111000010110011101100100001110111111" }, { "input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011", "output": "111011101010011100001111101001101011110010010110001" }, { "input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001", "output": "0100111110110011111110010010010000110111100101101101" }, { "input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100", "output": "01011001110111010111001100010011010100010000111011000" }, { "input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111", "output": "100011101001001000011011011001111000100000010100100100" }, { "input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110", "output": "1100110010000101101010111111101001001001110101110010110" }, { "input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110", "output": "01000111100111001011110010100011111111110010101100001101" }, { "input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010", "output": "110001010001000011000101110101000100001011111001011001001" }, { "input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111", "output": "1110100010111000101001001011101110011111100111000011011011" }, { "input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110", "output": "01110110101110100100110011010000001000101100101111000111011" }, { "input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011", "output": "111100101000000011101011011001110010101111000110010010000000" }, { "input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111", "output": "0100100010111110010011101010000011111110001110010110010111001" }, { "input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111", "output": "00110100000011001101101100100010110010001100000001100110011101" }, { "input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011", "output": "000000011000111011110011101000010000010100101000000011010110010" }, { "input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010", "output": "0010100110110100111100100100101101010100100111011010001001010101" }, { "input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111", "output": "11010110111100101111101001100001110100010110010110110111100110100" }, { "input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111", "output": "111111010011011100101110100110111111111001111110011010111111110000" }, { "input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110", "output": "1010101010100010001001001001100000111000010010010100010011000100000" }, { "input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000", "output": "00011111011111001000011100010011100011010100101011011000001001111110" }, { "input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111", "output": "001111000011001110100111010101111111011100110011001010010010000111011" }, { "input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101", "output": "0110001100110100010000110111000010011010011000011001010011010100010100" }, { "input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010", "output": "00010000000110110101000011001000000100100110111010011111101010001010000" }, { "input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001", "output": "000100100000000110011100100001010110101001100101110010010011111001110111" }, { "input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000", "output": "1000111100010011010110011101000000101010101100011111100001101111001010010" }, { "input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011", "output": "01000010011110111001011011110000001011000111101101101010010110001010100100" }, { "input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101", "output": "101101110110110010011100001011111100100001110000101100110000100011011100110" }, { "input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001", "output": "1110111111110010111000001100101010101011010100101010100101100011001001111111" }, { "input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111", "output": "10111011000111000101110100101000100111011011100011110110000101010001111010111" }, { "input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110", "output": "110100100110000101010010011010011001100110000111010000010100001011110111111101" }, { "input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111", "output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111" }, { "input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001", "output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001" }, { "input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110", "output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011" }, { "input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111", "output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101" }, { "input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010", "output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101" }, { "input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000", "output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001" }, { "input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011", "output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110" }, { "input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011", "output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011" }, { "input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011", "output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011" }, { "input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010", "output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011" }, { "input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001", "output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110" }, { "input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111", "output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010" }, { "input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011", "output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011" }, { "input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100", "output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000" }, { "input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001", "output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101" }, { "input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110", "output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101" }, { "input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011", "output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110" }, { "input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111", "output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110" }, { "input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000", "output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001" }, { "input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010", "output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101" }, { "input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101", "output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011" }, { "input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011", "output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010" }, { "input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010", "output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011" }, { "input": "0\n0", "output": "0" }, { "input": "0\n1", "output": "1" } ]
1,690,056,529
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
15
0
x=input() y=input() num1=str(x) num2=str(y) list=[] for i in range(len(num1)): if num1[i]==num2[i]: list.append('0') else: list.append('1') print(list) com=(''.join(list)) print(com)
Title: Ultra-Fast Mathematician Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate. Input Specification: There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. Output Specification: Write one line — the corresponding answer. Do not omit the leading 0s. Demo Input: ['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n'] Demo Output: ['1110001\n', '111\n', '0100\n', '00010\n'] Note: none
```python x=input() y=input() num1=str(x) num2=str(y) list=[] for i in range(len(num1)): if num1[i]==num2[i]: list.append('0') else: list.append('1') print(list) com=(''.join(list)) print(com) ```
0
432
A
Choosing Teams
PROGRAMMING
800
[ "greedy", "implementation", "sortings" ]
null
null
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times. The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
Print a single number — the answer to the problem.
[ "5 2\n0 4 5 1 0\n", "6 4\n0 1 2 3 4 5\n", "6 5\n0 0 0 0 0 0\n" ]
[ "1\n", "0\n", "2\n" ]
In the first sample only one team could be made: the first, the fourth and the fifth participants. In the second sample no teams could be created. In the third sample two teams could be created. Any partition into two teams fits.
500
[ { "input": "5 2\n0 4 5 1 0", "output": "1" }, { "input": "6 4\n0 1 2 3 4 5", "output": "0" }, { "input": "6 5\n0 0 0 0 0 0", "output": "2" }, { "input": "3 4\n0 1 0", "output": "1" }, { "input": "3 4\n0 2 0", "output": "0" }, { "input": "6 5\n0 0 0 0 0 0", "output": "2" }, { "input": "12 2\n0 1 2 3 4 0 1 2 3 4 0 1", "output": "3" }, { "input": "15 2\n0 1 2 3 4 0 1 2 3 4 0 1 2 3 4", "output": "4" }, { "input": "13 1\n5 0 5 0 1 5 0 4 1 1 1 4 1", "output": "3" }, { "input": "20 1\n5 0 4 2 2 3 2 1 2 4 1 3 5 5 5 4 4 1 3 0", "output": "5" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "6 3\n4 4 4 4 4 4", "output": "0" }, { "input": "1 4\n1", "output": "0" }, { "input": "1 1\n0", "output": "0" }, { "input": "2 3\n0 0", "output": "0" } ]
1,654,110,869
2,147,483,647
PyPy 3-64
OK
TESTS
35
62
1,945,600
n, k = map(int, input().split()) nums = list(map(int, input().split())) nums.sort() count, i = 0, 0 while i != n - 2: try: if nums[i + 2] + k <= 5: count += 1 i += 3 else: break except IndexError: break print(count)
Title: Choosing Teams Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times. The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times? Input Specification: The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship. Output Specification: Print a single number — the answer to the problem. Demo Input: ['5 2\n0 4 5 1 0\n', '6 4\n0 1 2 3 4 5\n', '6 5\n0 0 0 0 0 0\n'] Demo Output: ['1\n', '0\n', '2\n'] Note: In the first sample only one team could be made: the first, the fourth and the fifth participants. In the second sample no teams could be created. In the third sample two teams could be created. Any partition into two teams fits.
```python n, k = map(int, input().split()) nums = list(map(int, input().split())) nums.sort() count, i = 0, 0 while i != n - 2: try: if nums[i + 2] + k <= 5: count += 1 i += 3 else: break except IndexError: break print(count) ```
3
1
A
Theatre Square
PROGRAMMING
1,000
[ "math" ]
A. Theatre Square
1
256
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Write the needed number of flagstones.
[ "6 6 4\n" ]
[ "4\n" ]
none
0
[ { "input": "6 6 4", "output": "4" }, { "input": "1 1 1", "output": "1" }, { "input": "2 1 1", "output": "2" }, { "input": "1 2 1", "output": "2" }, { "input": "2 2 1", "output": "4" }, { "input": "2 1 2", "output": "1" }, { "input": "1 1 3", "output": "1" }, { "input": "2 3 4", "output": "1" }, { "input": "1000000000 1000000000 1", "output": "1000000000000000000" }, { "input": "12 13 4", "output": "12" }, { "input": "222 332 5", "output": "3015" }, { "input": "1000 1000 10", "output": "10000" }, { "input": "1001 1000 10", "output": "10100" }, { "input": "100 10001 1000000000", "output": "1" }, { "input": "1000000000 1000000000 1000000000", "output": "1" }, { "input": "1000000000 1000000000 999999999", "output": "4" }, { "input": "1000000000 1000000000 192", "output": "27126743055556" }, { "input": "1000000000 987654321 1", "output": "987654321000000000" }, { "input": "456784567 1000000000 51", "output": "175618850864484" }, { "input": "39916800 134217728 40320", "output": "3295710" } ]
1,694,352,914
2,147,483,647
PyPy 3-64
OK
TESTS
20
62
0
import sys # Constants INF = float('inf') MOD = 1000000007 # Faster Input def read_int(): return int(sys.stdin.readline()) def read_n_int(): return map(int, sys.stdin.readline().split()) def read_ints(): return list(map(int, sys.stdin.readline().split())) # Faster Output def print_yes_no(condition): print('YES' if condition else 'NO') def print_array(arr, sep=' '): print(sep.join(map(str, arr))) # Main Function def solve(): n, m, k = read_n_int() # vartical axis if m%k==0: count = m//k else: count = m//k + 1 if n%k==0: count2 = n//k else: count2 = n//k + 1 print(count*count2) if __name__ == '__main__': solve()
Title: Theatre Square Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. Input Specification: The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). Output Specification: Write the needed number of flagstones. Demo Input: ['6 6 4\n'] Demo Output: ['4\n'] Note: none
```python import sys # Constants INF = float('inf') MOD = 1000000007 # Faster Input def read_int(): return int(sys.stdin.readline()) def read_n_int(): return map(int, sys.stdin.readline().split()) def read_ints(): return list(map(int, sys.stdin.readline().split())) # Faster Output def print_yes_no(condition): print('YES' if condition else 'NO') def print_array(arr, sep=' '): print(sep.join(map(str, arr))) # Main Function def solve(): n, m, k = read_n_int() # vartical axis if m%k==0: count = m//k else: count = m//k + 1 if n%k==0: count2 = n//k else: count2 = n//k + 1 print(count*count2) if __name__ == '__main__': solve() ```
3.969
369
B
Valera and Contest
PROGRAMMING
1,400
[ "constructive algorithms", "implementation", "math" ]
null
null
Valera loves to participate in competitions. Especially in programming contests. Today he has participated in the contest with his team, consisting of *n* students (including Valera). This contest was an individual competition, so each student in the team solved problems individually. After the contest was over, Valera was interested in results. He found out that: - each student in the team scored at least *l* points and at most *r* points; - in total, all members of the team scored exactly *s**all* points; - the total score of the *k* members of the team who scored the most points is equal to exactly *s**k*; more formally, if *a*1,<=*a*2,<=...,<=*a**n* is the sequence of points earned by the team of students in the non-increasing order (*a*1<=≥<=*a*2<=≥<=...<=≥<=*a**n*), then *s**k*<==<=*a*1<=+<=*a*2<=+<=...<=+<=*a**k*. However, Valera did not find out exactly how many points each of *n* students scored. Valera asked you to recover any distribution of scores between the students of the team, such that all the conditions above are met.
The first line of the input contains exactly six integers *n*,<=*k*,<=*l*,<=*r*,<=*s**all*,<=*s**k* (1<=≤<=*n*,<=*k*,<=*l*,<=*r*<=≤<=1000; *l*<=≤<=*r*; *k*<=≤<=*n*; 1<=≤<=*s**k*<=≤<=*s**all*<=≤<=106). It's guaranteed that the input is such that the answer exists.
Print exactly *n* integers *a*1,<=*a*2,<=...,<=*a**n* — the number of points each student scored. If there are multiple solutions, you can print any of them. You can print the distribution of points in any order.
[ "5 3 1 3 13 9\n", "5 3 1 3 15 9\n" ]
[ "2 3 2 3 3 ", "3 3 3 3 3 " ]
none
1,000
[ { "input": "5 3 1 3 13 9", "output": "2 3 2 3 3 " }, { "input": "5 3 1 3 15 9", "output": "3 3 3 3 3 " }, { "input": "50 25 1 1 50 25", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "1000 700 782 1000 892330 648282", "output": "926 926 926 814 926 926 926 926 926 813 926 814 926 813 813 926 814 926 926 926 814 926 814 926 813 927 814 926 813 926 926 813 926 926 926 927 926 813 926 813 926 926 926 926 813 926 926 926 813 813 926 926 814 926 926 926 814 926 813 927 926 926 927 926 926 926 926 926 926 926 927 813 926 814 926 926 926 926 813 813 814 926 927 814 926 926 813 926 813 926 926 814 926 926 926 926 926 926 814 926 926 927 926 926 926 926 926 814 926 926 813 926 926 926 926 927 813 926 926 927 926 926 926 926 926 926 926 926..." }, { "input": "1000 999 500 503 501513 501013", "output": "501 502 502 501 501 502 502 502 501 501 502 501 502 501 501 501 501 502 502 502 501 502 501 502 501 502 501 502 501 501 502 501 501 502 502 502 501 501 502 501 502 501 502 502 501 501 502 502 501 501 502 502 501 502 502 501 501 502 501 502 501 502 502 502 502 502 502 501 502 502 502 501 502 501 502 502 501 502 501 501 501 501 502 501 502 502 501 502 501 501 502 501 502 502 501 502 502 501 501 502 502 502 501 501 502 502 502 501 502 502 501 501 501 501 502 502 500 501 502 502 502 502 502 502 501 502 501 502..." }, { "input": "999 998 500 501 500009 499509", "output": "500 501 501 500 500 501 501 501 500 500 501 500 501 500 500 500 500 501 501 501 500 501 500 501 500 501 500 501 500 500 501 500 500 501 501 501 500 500 501 500 501 500 501 501 500 500 501 501 500 500 501 501 500 501 501 500 500 501 500 501 500 501 501 501 501 501 501 500 501 501 501 500 501 500 501 501 500 501 500 500 500 500 501 500 501 501 500 501 500 500 501 500 501 501 500 501 501 500 500 501 501 501 500 500 501 501 501 500 501 501 500 500 500 500 501 501 501 500 501 501 501 501 501 501 500 501 500 501..." }, { "input": "999 998 500 500 499500 499000", "output": "500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500..." }, { "input": "999 997 500 502 500516 499516", "output": "501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 502 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 502 501 501 501 501 501 501 501 501 500 501 501 501 501 501 502 501 501 501 501 501 501 501 501 501 501 501..." }, { "input": "1000 300 50 500 269795 127658", "output": "203 204 203 203 203 203 203 426 203 203 204 203 425 203 203 203 203 204 203 203 203 425 203 204 203 426 203 203 203 203 203 203 203 426 203 426 203 203 426 203 203 203 203 203 203 203 203 204 203 203 425 203 203 425 425 203 203 425 203 426 203 204 426 426 425 426 203 203 425 203 426 203 425 203 425 425 203 425 203 203 203 203 426 203 425 203 203 425 203 203 203 203 203 203 203 203 426 203 203 203 425 426 203 203 203 203 203 203 425 425 203 203 203 203 203 426 203 203 203 426 204 203 203 203 203 203 203 426..." }, { "input": "50 25 1000 1000 50000 25000", "output": "1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 " }, { "input": "100 100 500 1000 75589 75589", "output": "756 756 756 755 755 756 756 756 756 755 756 756 756 756 756 756 755 756 755 756 756 756 756 756 756 756 756 756 756 755 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 755 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 755 756 756 756 756 756 755 756 756 756 755 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 755 756 756 756 756 756 756 756 " }, { "input": "1 1 1000 1000 1000 1000", "output": "1000 " }, { "input": "2 2 500 1000 1000 1000", "output": "500 500 " }, { "input": "1000 500 1 1000 500500 500000", "output": "1 1000 1000 1 1 1000 1000 1000 1 1 1000 1 1000 1 1 1 1 1000 1000 1000 1 1000 1 1000 1 1000 1 1000 1 1 1000 1 1 1000 1000 1000 1 1 1000 1 1000 1 1000 1000 1 1 1 1000 1 1 1000 1000 1 1000 1000 1 1 1000 1 1000 1 1000 1000 1000 1000 1000 1000 1 1000 1000 1000 1 1000 1 1000 1000 1 1000 1 1 1 1 1000 1 1000 1000 1 1000 1 1 1000 1 1000 1000 1 1000 1000 1 1 1000 1000 1000 1 1 1000 1000 1000 1 1000 1000 1 1 1 1 1000 1000 1 1 1000 1000 1000 1000 1000 1000 1 1000 1 1000 1 1 1 1 1000 1 1 1000 1000 1000 1000 1000 1 1 1 ..." }, { "input": "1000 500 500 1000 750000 375000", "output": "750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750..." }, { "input": "300 100 1 3 600 200", "output": "2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "300 100 1 3 900 300", "output": "3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3..." }, { "input": "300 100 1 3 300 100", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1..." }, { "input": "1 1 1 1 1 1", "output": "1 " }, { "input": "432 32 13 123 28942 3824", "output": "63 63 63 63 63 63 62 63 63 63 63 63 63 63 62 63 63 63 62 62 63 63 62 63 62 120 62 62 63 63 62 63 63 63 63 63 119 120 63 63 63 62 63 62 63 63 63 63 63 63 63 63 63 63 63 120 63 63 63 63 63 63 63 63 63 63 63 63 63 62 63 63 63 63 63 63 62 63 63 63 63 63 63 63 63 62 63 63 63 63 63 63 63 62 63 63 63 63 63 63 63 119 63 62 62 62 63 63 63 63 63 120 63 63 62 63 120 63 62 63 63 62 62 63 63 62 63 63 63 120 63 120 63 63 63 62 63 63 63 63 62 63 62 62 63 63 63 62 63 63 63 63 63 63 63 62 63 62 63 63 63 62 63 119 62 63 62 ..." }, { "input": "504 32 13 123 33704 3791", "output": "64 63 63 63 63 63 63 64 63 63 63 64 63 63 63 64 63 63 63 63 64 63 63 63 63 119 63 63 64 64 63 63 63 64 63 64 118 119 64 64 63 63 63 63 63 64 63 63 64 64 64 63 63 63 64 118 63 64 63 64 63 63 64 64 63 64 63 64 64 63 64 64 64 64 63 63 63 64 63 64 64 64 64 64 63 63 63 64 64 64 63 63 63 63 64 63 64 63 63 63 63 118 63 63 63 63 63 63 64 63 63 119 63 63 63 64 119 63 63 64 63 63 63 63 64 63 64 64 64 119 63 119 64 64 63 63 63 64 63 63 63 64 63 63 63 63 64 63 64 63 64 64 63 64 63 63 63 63 64 64 64 63 64 118 63 63 63 ..." }, { "input": "999 32 13 123 68122 3876", "output": "66 67 67 66 66 67 67 67 66 66 67 66 67 66 66 66 66 67 67 66 66 67 66 67 66 121 66 66 66 66 67 66 66 67 67 67 66 66 67 66 66 66 66 67 66 66 66 67 66 66 67 67 66 67 67 66 66 67 66 67 66 67 67 67 67 67 67 66 67 67 67 66 67 66 67 67 66 67 66 66 66 66 67 66 67 67 66 67 66 66 66 66 66 66 66 67 67 66 66 66 67 121 66 66 67 67 67 66 67 67 66 66 66 66 67 67 122 66 67 67 67 67 67 66 66 67 66 67 66 66 66 66 67 66 66 67 67 67 67 67 66 66 66 67 67 66 67 67 66 66 66 67 66 67 66 66 66 66 67 67 66 66 66 121 67 66 66 67 66 ..." }, { "input": "489 32 13 123 33009 3885", "output": "64 64 64 64 63 64 63 64 64 64 64 64 64 64 63 64 64 64 63 63 64 64 63 64 63 122 63 63 64 64 63 64 64 64 63 64 121 122 64 64 63 63 63 63 64 64 64 64 64 64 64 64 64 64 64 121 63 64 64 64 64 64 64 64 64 64 63 64 64 63 64 64 64 64 64 64 63 64 63 64 64 64 64 64 64 63 64 64 64 64 63 63 63 63 64 63 64 64 64 63 64 121 64 63 63 64 63 64 64 64 64 122 64 64 63 64 122 64 64 64 64 63 64 64 64 64 64 64 64 122 64 122 64 64 64 63 64 64 64 64 63 64 63 64 64 64 64 63 64 63 64 64 64 64 64 63 64 63 64 64 64 64 64 121 63 64 63 ..." }, { "input": "234 32 13 123 16337 3715", "output": "62 63 62 62 63 62 62 62 62 63 62 63 63 62 63 62 63 63 63 116 62 63 63 63 63 116 62 63 62 63 63 63 62 62 63 63 116 116 62 63 63 63 62 62 116 62 63 116 62 62 62 63 116 62 62 116 63 62 62 63 63 63 63 63 63 63 62 62 62 116 63 62 62 62 62 62 62 62 63 63 62 63 63 63 63 62 62 62 62 62 63 62 63 62 62 63 63 63 63 116 63 116 63 63 116 62 63 63 62 62 62 116 116 63 62 63 117 63 62 63 63 62 63 62 62 116 62 63 63 117 62 116 62 63 62 63 62 62 116 63 62 63 63 62 62 62 63 63 63 62 63 63 62 62 62 62 63 63 63 62 63 62 63 116..." }, { "input": "998 997 13 13 12974 12961", "output": "13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 1..." }, { "input": "999 999 13 333 169609 169609", "output": "170 170 170 170 170 170 170 170 170 169 170 170 170 169 169 170 169 170 170 170 170 170 169 170 169 170 169 170 169 170 170 169 170 170 170 170 170 169 170 169 170 170 170 170 169 170 170 170 169 169 170 170 169 170 170 170 170 170 169 170 170 170 170 170 170 170 170 170 170 170 170 169 170 170 170 170 170 170 169 169 170 170 170 170 170 170 169 170 169 170 170 169 170 170 170 170 170 170 169 170 170 170 170 170 170 170 170 169 170 170 169 170 170 170 170 170 170 170 170 170 170 170 170 170 170 170 170 170..." }, { "input": "999 998 13 533 270345 270332", "output": "271 271 271 271 271 271 271 271 271 270 271 271 271 270 270 271 271 271 271 271 271 271 271 271 270 271 271 271 270 271 271 270 271 271 271 271 271 271 271 270 271 271 271 271 270 271 271 271 270 270 271 271 271 271 271 271 271 271 270 271 271 271 271 271 271 271 271 271 271 271 271 270 271 271 271 271 271 271 270 270 271 271 271 271 271 271 270 271 270 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 13 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 ..." }, { "input": "998 123 13 293 151330 33752", "output": "134 135 135 134 134 135 135 135 134 134 135 134 135 134 134 134 134 135 135 134 134 135 134 135 134 275 134 134 134 134 135 134 134 135 135 275 134 134 135 134 134 134 134 135 134 134 134 135 134 134 135 135 134 135 135 134 134 135 134 275 134 135 275 274 135 274 135 134 135 135 274 134 135 134 135 135 134 135 134 134 134 134 274 134 135 135 134 135 134 134 134 134 134 134 134 135 274 134 134 134 135 275 134 134 135 135 135 134 135 135 135 134 134 134 135 274 275 134 135 275 135 135 135 134 134 135 134 274..." }, { "input": "995 993 123 743 437780 437534", "output": "440 441 441 440 440 441 441 441 440 440 441 440 441 440 440 440 440 441 441 441 440 441 440 441 440 441 440 441 440 440 441 440 440 441 441 441 440 440 441 440 441 441 441 441 440 440 441 441 440 440 441 441 440 441 441 441 440 441 440 441 440 441 441 441 441 441 441 441 441 441 441 440 441 440 441 441 440 441 440 440 440 441 441 440 441 441 440 441 440 440 441 440 441 441 441 441 441 440 440 441 441 441 441 440 441 441 441 440 441 441 441 440 441 441 441 441 441 440 441 441 441 441 441 441 440 441 441 441..." }, { "input": "999 999 111 111 110889 110889", "output": "111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111..." }, { "input": "1000 1000 111 111 111000 111000", "output": "111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111..." }, { "input": "1000 567 999 1000 999489 566922", "output": "999 1000 1000 999 999 1000 1000 1000 999 999 1000 999 1000 999 999 999 999 1000 1000 1000 999 1000 999 1000 999 1000 999 1000 999 999 1000 999 999 1000 1000 1000 999 999 1000 999 1000 999 1000 1000 999 999 999 1000 999 999 1000 1000 999 1000 1000 999 999 1000 999 1000 999 1000 1000 1000 1000 1000 1000 999 1000 1000 1000 999 1000 999 1000 1000 999 1000 999 999 999 999 1000 999 1000 1000 999 1000 999 999 1000 999 1000 1000 999 1000 1000 999 999 1000 1000 1000 999 999 1000 1000 1000 999 1000 1000 999 999 999 ..." }, { "input": "1000 567 998 1000 998981 566754", "output": "998 1000 999 998 999 999 999 1000 999 998 1000 998 1000 998 998 999 998 999 999 999 998 1000 998 1000 998 1000 998 999 998 998 999 998 999 1000 999 1000 998 998 1000 998 999 999 999 999 998 998 999 1000 998 998 1000 999 998 1000 1000 999 998 1000 998 1000 998 1000 1000 1000 1000 1000 999 999 1000 999 1000 998 1000 998 1000 1000 999 1000 998 998 998 999 1000 998 1000 999 998 1000 998 998 999 998 999 999 999 999 1000 998 998 999 1000 1000 999 999 999 999 999 998 1000 1000 998 998 999 999 999 1000 998 998 999..." }, { "input": "1000 567 996 1000 997986 566445", "output": "997 999 999 997 997 999 999 999 997 996 999 997 999 996 996 997 997 999 999 999 997 999 997 999 996 1000 997 999 996 997 999 996 997 999 999 999 997 996 999 996 999 999 999 999 996 997 999 999 996 996 999 999 997 999 999 997 997 999 996 999 997 999 999 999 999 999 999 999 999 999 999 996 999 997 999 999 997 999 996 996 997 997 999 997 999 999 996 999 996 997 999 997 999 999 999 999 999 997 997 999 999 999 999 997 999 999 999 997 999 999 996 997 997 999 999 999 996 997 999 999 999 999 999 999 997 999 999 99..." }, { "input": "1000 567 996 1000 997986 566445", "output": "997 999 999 997 997 999 999 999 997 996 999 997 999 996 996 997 997 999 999 999 997 999 997 999 996 1000 997 999 996 997 999 996 997 999 999 999 997 996 999 996 999 999 999 999 996 997 999 999 996 996 999 999 997 999 999 997 997 999 996 999 997 999 999 999 999 999 999 999 999 999 999 996 999 997 999 999 997 999 996 996 997 997 999 997 999 999 996 999 996 997 999 997 999 999 999 999 999 997 997 999 999 999 999 997 999 999 999 997 999 999 996 997 997 999 999 999 996 997 999 999 999 999 999 999 997 999 999 99..." }, { "input": "1 1 1 1000 656 656", "output": "656 " }, { "input": "2 1 1 1000 683 550", "output": "550 133 " }, { "input": "3 2 1 1000 1816 1652", "output": "826 826 164 " }, { "input": "5 5 1 1000 3288 3288", "output": "657 658 657 658 658 " }, { "input": "5 3 1 1000 2732 2055", "output": "338 685 339 685 685 " }, { "input": "1 1 10 100 50 50", "output": "50 " }, { "input": "3 3 1 5 14 14", "output": "5 5 4 " }, { "input": "1 1 1 100 50 50", "output": "50 " }, { "input": "5 5 1 5 5 5", "output": "1 1 1 1 1 " }, { "input": "1 1 1 10 10 10", "output": "10 " }, { "input": "5 5 1 3 5 5", "output": "1 1 1 1 1 " }, { "input": "1000 1000 1 1000 1000000 1000000", "output": "1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1..." }, { "input": "3 3 1 3 9 9", "output": "3 3 3 " }, { "input": "1000 1000 389 999 686847 686847", "output": "687 687 687 687 687 687 687 687 687 686 687 687 687 686 686 687 687 687 687 687 687 687 687 687 686 687 687 687 686 687 687 686 687 687 687 687 687 686 687 686 687 687 687 687 686 687 687 687 686 686 687 687 687 687 687 687 687 687 686 687 687 687 687 687 687 687 687 687 687 687 687 686 687 687 687 687 687 687 686 686 687 687 687 687 687 687 686 687 686 687 687 687 687 687 687 687 687 687 687 687 687 687 687 687 687 687 687 687 687 687 686 687 687 687 687 687 686 687 687 687 687 687 687 687 687 687 687 687..." }, { "input": "2 2 2 2 4 4", "output": "2 2 " } ]
1,570,343,404
2,147,483,647
PyPy 3
RUNTIME_ERROR
TESTS
10
202
2,560,000
n,k,l,r,Sa,Sk = list(map(int,input().split())) Sq = Sa -Sk Rq = Sq - (n-k)*l p = Rq//(n-k) r = Rq%(n-k) t = [(l+p+1) for i in range(r)] + [l+p for i in range(n-k-r)] Min = t[n-k-1] p2 = ( Sk-(Min*k) )//k r2 = ( Sk-(Min*k) )%k t2 = [(Min+p2+1) for i in range(r2)] + [Min+p2 for i in range(k-r2)] print(*(t2+t) ,sep =' ')
Title: Valera and Contest Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera loves to participate in competitions. Especially in programming contests. Today he has participated in the contest with his team, consisting of *n* students (including Valera). This contest was an individual competition, so each student in the team solved problems individually. After the contest was over, Valera was interested in results. He found out that: - each student in the team scored at least *l* points and at most *r* points; - in total, all members of the team scored exactly *s**all* points; - the total score of the *k* members of the team who scored the most points is equal to exactly *s**k*; more formally, if *a*1,<=*a*2,<=...,<=*a**n* is the sequence of points earned by the team of students in the non-increasing order (*a*1<=≥<=*a*2<=≥<=...<=≥<=*a**n*), then *s**k*<==<=*a*1<=+<=*a*2<=+<=...<=+<=*a**k*. However, Valera did not find out exactly how many points each of *n* students scored. Valera asked you to recover any distribution of scores between the students of the team, such that all the conditions above are met. Input Specification: The first line of the input contains exactly six integers *n*,<=*k*,<=*l*,<=*r*,<=*s**all*,<=*s**k* (1<=≤<=*n*,<=*k*,<=*l*,<=*r*<=≤<=1000; *l*<=≤<=*r*; *k*<=≤<=*n*; 1<=≤<=*s**k*<=≤<=*s**all*<=≤<=106). It's guaranteed that the input is such that the answer exists. Output Specification: Print exactly *n* integers *a*1,<=*a*2,<=...,<=*a**n* — the number of points each student scored. If there are multiple solutions, you can print any of them. You can print the distribution of points in any order. Demo Input: ['5 3 1 3 13 9\n', '5 3 1 3 15 9\n'] Demo Output: ['2 3 2 3 3 ', '3 3 3 3 3 '] Note: none
```python n,k,l,r,Sa,Sk = list(map(int,input().split())) Sq = Sa -Sk Rq = Sq - (n-k)*l p = Rq//(n-k) r = Rq%(n-k) t = [(l+p+1) for i in range(r)] + [l+p for i in range(n-k-r)] Min = t[n-k-1] p2 = ( Sk-(Min*k) )//k r2 = ( Sk-(Min*k) )%k t2 = [(Min+p2+1) for i in range(r2)] + [Min+p2 for i in range(k-r2)] print(*(t2+t) ,sep =' ') ```
-1
493
B
Vasya and Wrestling
PROGRAMMING
1,400
[ "implementation" ]
null
null
Vasya has become interested in wrestling. In wrestling wrestlers use techniques for which they are awarded points by judges. The wrestler who gets the most points wins. When the numbers of points of both wrestlers are equal, the wrestler whose sequence of points is lexicographically greater, wins. If the sequences of the awarded points coincide, the wrestler who performed the last technique wins. Your task is to determine which wrestler won.
The first line contains number *n* — the number of techniques that the wrestlers have used (1<=≤<=*n*<=≤<=2·105). The following *n* lines contain integer numbers *a**i* (|*a**i*|<=≤<=109, *a**i*<=≠<=0). If *a**i* is positive, that means that the first wrestler performed the technique that was awarded with *a**i* points. And if *a**i* is negative, that means that the second wrestler performed the technique that was awarded with (<=-<=*a**i*) points. The techniques are given in chronological order.
If the first wrestler wins, print string "first", otherwise print "second"
[ "5\n1\n2\n-3\n-4\n3\n", "3\n-1\n-2\n3\n", "2\n4\n-4\n" ]
[ "second\n", "first\n", "second\n" ]
Sequence *x*  =  *x*<sub class="lower-index">1</sub>*x*<sub class="lower-index">2</sub>... *x*<sub class="lower-index">|*x*|</sub> is lexicographically larger than sequence *y*  =  *y*<sub class="lower-index">1</sub>*y*<sub class="lower-index">2</sub>... *y*<sub class="lower-index">|*y*|</sub>, if either |*x*|  &gt;  |*y*| and *x*<sub class="lower-index">1</sub>  =  *y*<sub class="lower-index">1</sub>,  *x*<sub class="lower-index">2</sub>  =  *y*<sub class="lower-index">2</sub>, ... ,  *x*<sub class="lower-index">|*y*|</sub>  =  *y*<sub class="lower-index">|*y*|</sub>, or there is such number *r* (*r*  &lt;  |*x*|, *r*  &lt;  |*y*|), that *x*<sub class="lower-index">1</sub>  =  *y*<sub class="lower-index">1</sub>,  *x*<sub class="lower-index">2</sub>  =  *y*<sub class="lower-index">2</sub>,  ... ,  *x*<sub class="lower-index">*r*</sub>  =  *y*<sub class="lower-index">*r*</sub> and *x*<sub class="lower-index">*r*  +  1</sub>  &gt;  *y*<sub class="lower-index">*r*  +  1</sub>. We use notation |*a*| to denote length of sequence *a*.
1,000
[ { "input": "5\n1\n2\n-3\n-4\n3", "output": "second" }, { "input": "3\n-1\n-2\n3", "output": "first" }, { "input": "2\n4\n-4", "output": "second" }, { "input": "7\n1\n2\n-3\n4\n5\n-6\n7", "output": "first" }, { "input": "14\n1\n2\n3\n4\n5\n6\n7\n-8\n-9\n-10\n-11\n-12\n-13\n-14", "output": "second" }, { "input": "4\n16\n12\n19\n-98", "output": "second" }, { "input": "5\n-6\n-1\n-1\n5\n3", "output": "second" }, { "input": "11\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1", "output": "first" }, { "input": "1\n-534365", "output": "second" }, { "input": "1\n10253033", "output": "first" }, { "input": "3\n-1\n-2\n3", "output": "first" }, { "input": "8\n1\n-2\n-3\n4\n5\n-6\n-7\n8", "output": "second" }, { "input": "2\n1\n-1", "output": "second" }, { "input": "5\n1\n2\n3\n4\n5", "output": "first" }, { "input": "5\n-1\n-2\n-3\n-4\n-5", "output": "second" }, { "input": "10\n-1\n-2\n-3\n-4\n-5\n5\n4\n3\n2\n1", "output": "first" }, { "input": "131\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n-1\n-1\n2", "output": "first" }, { "input": "6\n-1\n-2\n-3\n1\n2\n3", "output": "first" }, { "input": "3\n1000000000\n1000000000\n1000000000", "output": "first" }, { "input": "12\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000", "output": "first" }, { "input": "4\n1000000000\n1000000000\n1000000000\n-1000000000", "output": "first" }, { "input": "20\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000", "output": "first" }, { "input": "5\n1000000000\n1000000000\n-1000000000\n-1000000000\n-1000000000", "output": "second" }, { "input": "4\n1\n-1000000000\n-1000000000\n-1000000000", "output": "second" }, { "input": "5\n1000000000\n1000000000\n1000000000\n-1000000000\n-1000000000", "output": "first" }, { "input": "4\n-1\n1000000000\n1000000000\n1000000000", "output": "first" }, { "input": "11\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000", "output": "first" }, { "input": "2\n-4\n4", "output": "first" }, { "input": "3\n-12\n3\n9", "output": "second" }, { "input": "3\n9\n1\n-10", "output": "second" }, { "input": "3\n1\n2\n-3", "output": "second" }, { "input": "4\n55\n5\n-5\n-55", "output": "first" }, { "input": "4\n5\n-1\n1\n-5", "output": "first" }, { "input": "2\n-5\n6", "output": "first" }, { "input": "4\n5\n-4\n3\n-40", "output": "second" }, { "input": "4\n1000000000\n1000000000\n1000000000\n-5", "output": "first" }, { "input": "6\n3\n2\n1\n-3\n-1\n-2", "output": "first" }, { "input": "5\n4\n1\n1\n-3\n-3", "output": "first" }, { "input": "5\n208\n-52\n-52\n-52\n-52", "output": "first" }, { "input": "3\n-100\n-200\n300", "output": "first" }, { "input": "3\n400\n-200\n-200", "output": "first" }, { "input": "3\n208\n-207\n-1", "output": "first" }, { "input": "3\n98888887\n98888888\n-197777775", "output": "second" } ]
1,577,566,038
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
1
124
0
x=int(input()) lol="" yo="" for __ in range(x): n=int(input()) if n>0: lol+=str(n) else: yo+=str(n) f=0 if len(lol)>len(yo): f=1 elif len(lol)<len(yo): f=-1 else: for i in range(len(lol)): if ord(lol[i])>ord(yo[i]): f=1 break elif ord(yo[i])>ord(lol[i]): f=-1 break if f==0: if n>0: f=1 else: f=-1 if f==1: print("first") else: print("second")
Title: Vasya and Wrestling Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya has become interested in wrestling. In wrestling wrestlers use techniques for which they are awarded points by judges. The wrestler who gets the most points wins. When the numbers of points of both wrestlers are equal, the wrestler whose sequence of points is lexicographically greater, wins. If the sequences of the awarded points coincide, the wrestler who performed the last technique wins. Your task is to determine which wrestler won. Input Specification: The first line contains number *n* — the number of techniques that the wrestlers have used (1<=≤<=*n*<=≤<=2·105). The following *n* lines contain integer numbers *a**i* (|*a**i*|<=≤<=109, *a**i*<=≠<=0). If *a**i* is positive, that means that the first wrestler performed the technique that was awarded with *a**i* points. And if *a**i* is negative, that means that the second wrestler performed the technique that was awarded with (<=-<=*a**i*) points. The techniques are given in chronological order. Output Specification: If the first wrestler wins, print string "first", otherwise print "second" Demo Input: ['5\n1\n2\n-3\n-4\n3\n', '3\n-1\n-2\n3\n', '2\n4\n-4\n'] Demo Output: ['second\n', 'first\n', 'second\n'] Note: Sequence *x*  =  *x*<sub class="lower-index">1</sub>*x*<sub class="lower-index">2</sub>... *x*<sub class="lower-index">|*x*|</sub> is lexicographically larger than sequence *y*  =  *y*<sub class="lower-index">1</sub>*y*<sub class="lower-index">2</sub>... *y*<sub class="lower-index">|*y*|</sub>, if either |*x*|  &gt;  |*y*| and *x*<sub class="lower-index">1</sub>  =  *y*<sub class="lower-index">1</sub>,  *x*<sub class="lower-index">2</sub>  =  *y*<sub class="lower-index">2</sub>, ... ,  *x*<sub class="lower-index">|*y*|</sub>  =  *y*<sub class="lower-index">|*y*|</sub>, or there is such number *r* (*r*  &lt;  |*x*|, *r*  &lt;  |*y*|), that *x*<sub class="lower-index">1</sub>  =  *y*<sub class="lower-index">1</sub>,  *x*<sub class="lower-index">2</sub>  =  *y*<sub class="lower-index">2</sub>,  ... ,  *x*<sub class="lower-index">*r*</sub>  =  *y*<sub class="lower-index">*r*</sub> and *x*<sub class="lower-index">*r*  +  1</sub>  &gt;  *y*<sub class="lower-index">*r*  +  1</sub>. We use notation |*a*| to denote length of sequence *a*.
```python x=int(input()) lol="" yo="" for __ in range(x): n=int(input()) if n>0: lol+=str(n) else: yo+=str(n) f=0 if len(lol)>len(yo): f=1 elif len(lol)<len(yo): f=-1 else: for i in range(len(lol)): if ord(lol[i])>ord(yo[i]): f=1 break elif ord(yo[i])>ord(lol[i]): f=-1 break if f==0: if n>0: f=1 else: f=-1 if f==1: print("first") else: print("second") ```
0
276
C
Little Girl and Maximum Sum
PROGRAMMING
1,500
[ "data structures", "greedy", "implementation", "sortings" ]
null
null
The little girl loves the problems on array queries very much. One day she came across a rather well-known problem: you've got an array of $n$ elements (the elements of the array are indexed starting from 1); also, there are $q$ queries, each one is defined by a pair of integers $l_i$, $r_i$ $(1 \le l_i \le r_i \le n)$. You need to find for each query the sum of elements of the array with indexes from $l_i$ to $r_i$, inclusive. The little girl found the problem rather boring. She decided to reorder the array elements before replying to the queries in a way that makes the sum of query replies maximum possible. Your task is to find the value of this maximum sum.
The first line contains two space-separated integers $n$ ($1 \le n \le 2\cdot10^5$) and $q$ ($1 \le q \le 2\cdot10^5$) — the number of elements in the array and the number of queries, correspondingly. The next line contains $n$ space-separated integers $a_i$ ($1 \le a_i \le 2\cdot10^5$) — the array elements. Each of the following $q$ lines contains two space-separated integers $l_i$ and $r_i$ ($1 \le l_i \le r_i \le n$) — the $i$-th query.
In a single line print, a single integer — the maximum sum of query replies after the array elements are reordered. Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
[ "3 3\n5 3 2\n1 2\n2 3\n1 3\n", "5 3\n5 2 4 1 3\n1 5\n2 3\n2 3\n" ]
[ "25\n", "33\n" ]
none
1,500
[ { "input": "3 3\n5 3 2\n1 2\n2 3\n1 3", "output": "25" }, { "input": "5 3\n5 2 4 1 3\n1 5\n2 3\n2 3", "output": "33" }, { "input": "34 21\n23 38 16 49 44 50 48 34 33 19 18 31 11 15 20 47 44 30 39 33 45 46 1 13 27 16 31 36 17 23 38 5 30 16\n8 16\n14 27\n8 26\n1 8\n5 6\n23 28\n4 33\n13 30\n12 30\n11 30\n9 21\n1 14\n15 22\n4 11\n5 24\n8 20\n17 33\n6 9\n3 14\n25 34\n10 17", "output": "9382" }, { "input": "16 13\n40 32 15 16 35 36 45 23 30 42 25 8 29 21 39 23\n2 9\n3 11\n8 9\n4 14\n1 6\n5 10\n5 14\n5 11\n13 13\n2 8\n9 16\n6 10\n7 8", "output": "2838" }, { "input": "31 48\n45 19 16 42 38 18 50 7 28 40 39 25 45 14 36 18 27 30 16 4 22 6 1 23 16 47 14 35 27 47 2\n6 16\n11 28\n4 30\n25 26\n11 30\n5 9\n4 17\n15 17\n10 25\n15 26\n1 3\n9 26\n8 29\n16 30\n5 24\n27 30\n9 10\n22 29\n2 6\n15 24\n6 21\n19 21\n4 28\n1 7\n18 21\n10 22\n6 15\n14 28\n4 29\n12 13\n19 29\n5 6\n13 31\n21 27\n9 25\n6 18\n6 8\n28 30\n2 4\n15 21\n1 1\n8 30\n3 31\n11 27\n28 29\n6 22\n20 22\n9 25", "output": "17471" }, { "input": "22 7\n44 41 40 41 37 42 46 16 50 47 30 7 32 6 20 14 47 25 11 1 35 12\n1 10\n10 20\n4 5\n1 8\n2 12\n8 8\n2 16", "output": "2202" }, { "input": "3 2\n1 2 3\n2 3\n1 2", "output": "9" } ]
1,638,167,440
2,147,483,647
Python 3
OK
TESTS
63
997
28,672,000
n,q=map(int,input().split()) list1=list(map(int,input().split())) list1.sort() ans=0 dict1={} list2=[] for i in range(n):dict1[i]=[0,0] for _ in range(q): a,b=map(int,input().split()) dict1[a-1][0]+=1;dict1[b-1][1]+=1 x=0 for i in range(n): x+=dict1[i][0] list2.append(x) x-=dict1[i][1] list2.sort() for i in range(n):ans+=list1[i]*list2[i] print(ans)
Title: Little Girl and Maximum Sum Time Limit: None seconds Memory Limit: None megabytes Problem Description: The little girl loves the problems on array queries very much. One day she came across a rather well-known problem: you've got an array of $n$ elements (the elements of the array are indexed starting from 1); also, there are $q$ queries, each one is defined by a pair of integers $l_i$, $r_i$ $(1 \le l_i \le r_i \le n)$. You need to find for each query the sum of elements of the array with indexes from $l_i$ to $r_i$, inclusive. The little girl found the problem rather boring. She decided to reorder the array elements before replying to the queries in a way that makes the sum of query replies maximum possible. Your task is to find the value of this maximum sum. Input Specification: The first line contains two space-separated integers $n$ ($1 \le n \le 2\cdot10^5$) and $q$ ($1 \le q \le 2\cdot10^5$) — the number of elements in the array and the number of queries, correspondingly. The next line contains $n$ space-separated integers $a_i$ ($1 \le a_i \le 2\cdot10^5$) — the array elements. Each of the following $q$ lines contains two space-separated integers $l_i$ and $r_i$ ($1 \le l_i \le r_i \le n$) — the $i$-th query. Output Specification: In a single line print, a single integer — the maximum sum of query replies after the array elements are reordered. Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier. Demo Input: ['3 3\n5 3 2\n1 2\n2 3\n1 3\n', '5 3\n5 2 4 1 3\n1 5\n2 3\n2 3\n'] Demo Output: ['25\n', '33\n'] Note: none
```python n,q=map(int,input().split()) list1=list(map(int,input().split())) list1.sort() ans=0 dict1={} list2=[] for i in range(n):dict1[i]=[0,0] for _ in range(q): a,b=map(int,input().split()) dict1[a-1][0]+=1;dict1[b-1][1]+=1 x=0 for i in range(n): x+=dict1[i][0] list2.append(x) x-=dict1[i][1] list2.sort() for i in range(n):ans+=list1[i]*list2[i] print(ans) ```
3
982
B
Bus of Characters
PROGRAMMING
1,300
[ "data structures", "greedy", "implementation" ]
null
null
In the Bus of Characters there are $n$ rows of seat, each having $2$ seats. The width of both seats in the $i$-th row is $w_i$ centimeters. All integers $w_i$ are distinct. Initially the bus is empty. On each of $2n$ stops one passenger enters the bus. There are two types of passengers: - an introvert always chooses a row where both seats are empty. Among these rows he chooses the one with the smallest seats width and takes one of the seats in it; - an extrovert always chooses a row where exactly one seat is occupied (by an introvert). Among these rows he chooses the one with the largest seats width and takes the vacant place in it. You are given the seats width in each row and the order the passengers enter the bus. Determine which row each passenger will take.
The first line contains a single integer $n$ ($1 \le n \le 200\,000$) — the number of rows in the bus. The second line contains the sequence of integers $w_1, w_2, \dots, w_n$ ($1 \le w_i \le 10^{9}$), where $w_i$ is the width of each of the seats in the $i$-th row. It is guaranteed that all $w_i$ are distinct. The third line contains a string of length $2n$, consisting of digits '0' and '1' — the description of the order the passengers enter the bus. If the $j$-th character is '0', then the passenger that enters the bus on the $j$-th stop is an introvert. If the $j$-th character is '1', the the passenger that enters the bus on the $j$-th stop is an extrovert. It is guaranteed that the number of extroverts equals the number of introverts (i. e. both numbers equal $n$), and for each extrovert there always is a suitable row.
Print $2n$ integers — the rows the passengers will take. The order of passengers should be the same as in input.
[ "2\n3 1\n0011\n", "6\n10 8 9 11 13 5\n010010011101\n" ]
[ "2 1 1 2 \n", "6 6 2 3 3 1 4 4 1 2 5 5 \n" ]
In the first example the first passenger (introvert) chooses the row $2$, because it has the seats with smallest width. The second passenger (introvert) chooses the row $1$, because it is the only empty row now. The third passenger (extrovert) chooses the row $1$, because it has exactly one occupied seat and the seat width is the largest among such rows. The fourth passenger (extrovert) chooses the row $2$, because it is the only row with an empty place.
1,000
[ { "input": "2\n3 1\n0011", "output": "2 1 1 2 " }, { "input": "6\n10 8 9 11 13 5\n010010011101", "output": "6 6 2 3 3 1 4 4 1 2 5 5 " }, { "input": "1\n1\n01", "output": "1 1 " }, { "input": "1\n1000000\n01", "output": "1 1 " }, { "input": "2\n1 1000000\n0011", "output": "1 2 2 1 " }, { "input": "2\n1000000000 1\n0101", "output": "2 2 1 1 " }, { "input": "2\n1000000000 999999999\n0011", "output": "2 1 1 2 " }, { "input": "10\n24 53 10 99 83 9 15 62 33 47\n00100000000111111111", "output": "6 3 3 7 1 9 10 2 8 5 4 4 5 8 2 10 9 1 7 6 " } ]
1,598,276,109
5,109
PyPy 3
TIME_LIMIT_EXCEEDED
TESTS
10
2,000
42,496,000
n=int(input()) w=list(map(int,input().split())) pos_w={} for i in range(len(w)): pos_w[w[i]]=i+1 w.sort() s=input() stack=[] occupied={} for i in range(len(s)): if s[i]=='0': for j in range(len(w)): current=occupied.get(pos_w[w[j]],[0,0]) if 1 not in current : stack.append(pos_w[w[j]]) occupied[pos_w[w[j]]]=[1,0] print(pos_w[w[j]],end=" ") break else: for j in range(len(stack)-1,-1,-1): current=occupied.get(stack[j],[0,0]) if current!=[1,1]: occupied[stack[j]]=[1,1] print(stack[j],end=" ") break
Title: Bus of Characters Time Limit: None seconds Memory Limit: None megabytes Problem Description: In the Bus of Characters there are $n$ rows of seat, each having $2$ seats. The width of both seats in the $i$-th row is $w_i$ centimeters. All integers $w_i$ are distinct. Initially the bus is empty. On each of $2n$ stops one passenger enters the bus. There are two types of passengers: - an introvert always chooses a row where both seats are empty. Among these rows he chooses the one with the smallest seats width and takes one of the seats in it; - an extrovert always chooses a row where exactly one seat is occupied (by an introvert). Among these rows he chooses the one with the largest seats width and takes the vacant place in it. You are given the seats width in each row and the order the passengers enter the bus. Determine which row each passenger will take. Input Specification: The first line contains a single integer $n$ ($1 \le n \le 200\,000$) — the number of rows in the bus. The second line contains the sequence of integers $w_1, w_2, \dots, w_n$ ($1 \le w_i \le 10^{9}$), where $w_i$ is the width of each of the seats in the $i$-th row. It is guaranteed that all $w_i$ are distinct. The third line contains a string of length $2n$, consisting of digits '0' and '1' — the description of the order the passengers enter the bus. If the $j$-th character is '0', then the passenger that enters the bus on the $j$-th stop is an introvert. If the $j$-th character is '1', the the passenger that enters the bus on the $j$-th stop is an extrovert. It is guaranteed that the number of extroverts equals the number of introverts (i. e. both numbers equal $n$), and for each extrovert there always is a suitable row. Output Specification: Print $2n$ integers — the rows the passengers will take. The order of passengers should be the same as in input. Demo Input: ['2\n3 1\n0011\n', '6\n10 8 9 11 13 5\n010010011101\n'] Demo Output: ['2 1 1 2 \n', '6 6 2 3 3 1 4 4 1 2 5 5 \n'] Note: In the first example the first passenger (introvert) chooses the row $2$, because it has the seats with smallest width. The second passenger (introvert) chooses the row $1$, because it is the only empty row now. The third passenger (extrovert) chooses the row $1$, because it has exactly one occupied seat and the seat width is the largest among such rows. The fourth passenger (extrovert) chooses the row $2$, because it is the only row with an empty place.
```python n=int(input()) w=list(map(int,input().split())) pos_w={} for i in range(len(w)): pos_w[w[i]]=i+1 w.sort() s=input() stack=[] occupied={} for i in range(len(s)): if s[i]=='0': for j in range(len(w)): current=occupied.get(pos_w[w[j]],[0,0]) if 1 not in current : stack.append(pos_w[w[j]]) occupied[pos_w[w[j]]]=[1,0] print(pos_w[w[j]],end=" ") break else: for j in range(len(stack)-1,-1,-1): current=occupied.get(stack[j],[0,0]) if current!=[1,1]: occupied[stack[j]]=[1,1] print(stack[j],end=" ") break ```
0
810
B
Summer sell-off
PROGRAMMING
1,300
[ "greedy", "sortings" ]
null
null
Summer holidays! Someone is going on trips, someone is visiting grandparents, but someone is trying to get a part-time job. This summer Noora decided that she wants to earn some money, and took a job in a shop as an assistant. Shop, where Noora is working, has a plan on the following *n* days. For each day sales manager knows exactly, that in *i*-th day *k**i* products will be put up for sale and exactly *l**i* clients will come to the shop that day. Also, the manager is sure, that everyone, who comes to the shop, buys exactly one product or, if there aren't any left, leaves the shop without buying anything. Moreover, due to the short shelf-life of the products, manager established the following rule: if some part of the products left on the shelves at the end of the day, that products aren't kept on the next day and are sent to the dump. For advertising purposes manager offered to start a sell-out in the shop. He asked Noora to choose any *f* days from *n* next for sell-outs. On each of *f* chosen days the number of products were put up for sale would be doubled. Thus, if on *i*-th day shop planned to put up for sale *k**i* products and Noora has chosen this day for sell-out, shelves of the shop would keep 2·*k**i* products. Consequently, there is an opportunity to sell two times more products on days of sell-out. Noora's task is to choose *f* days to maximize total number of sold products. She asks you to help her with such a difficult problem.
The first line contains two integers *n* and *f* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*f*<=≤<=*n*) denoting the number of days in shop's plan and the number of days that Noora has to choose for sell-out. Each line of the following *n* subsequent lines contains two integers *k**i*,<=*l**i* (0<=≤<=*k**i*,<=*l**i*<=≤<=109) denoting the number of products on the shelves of the shop on the *i*-th day and the number of clients that will come to the shop on *i*-th day.
Print a single integer denoting the maximal number of products that shop can sell.
[ "4 2\n2 1\n3 5\n2 3\n1 5\n", "4 1\n0 2\n0 3\n3 5\n0 6\n" ]
[ "10", "5" ]
In the first example we can choose days with numbers 2 and 4 for sell-out. In this case new numbers of products for sale would be equal to [2, 6, 2, 2] respectively. So on the first day shop will sell 1 product, on the second — 5, on the third — 2, on the fourth — 2. In total 1 + 5 + 2 + 2 = 10 product units. In the second example it is possible to sell 5 products, if you choose third day for sell-out.
1,000
[ { "input": "4 2\n2 1\n3 5\n2 3\n1 5", "output": "10" }, { "input": "4 1\n0 2\n0 3\n3 5\n0 6", "output": "5" }, { "input": "1 1\n5 8", "output": "8" }, { "input": "2 1\n8 12\n6 11", "output": "19" }, { "input": "2 1\n6 7\n5 7", "output": "13" }, { "input": "2 1\n5 7\n6 7", "output": "13" }, { "input": "2 1\n7 8\n3 6", "output": "13" }, { "input": "2 1\n9 10\n5 8", "output": "17" }, { "input": "2 1\n3 6\n7 8", "output": "13" }, { "input": "1 0\n10 20", "output": "10" }, { "input": "2 1\n99 100\n3 6", "output": "105" }, { "input": "4 2\n2 10\n3 10\n9 9\n5 10", "output": "27" }, { "input": "2 1\n3 4\n2 8", "output": "7" }, { "input": "50 2\n74 90\n68 33\n49 88\n52 13\n73 21\n77 63\n27 62\n8 52\n60 57\n42 83\n98 15\n79 11\n77 46\n55 91\n72 100\n70 86\n50 51\n57 39\n20 54\n64 95\n66 22\n79 64\n31 28\n11 89\n1 36\n13 4\n75 62\n16 62\n100 35\n43 96\n97 54\n86 33\n62 63\n94 24\n19 6\n20 58\n38 38\n11 76\n70 40\n44 24\n32 96\n28 100\n62 45\n41 68\n90 52\n16 0\n98 32\n81 79\n67 82\n28 2", "output": "1889" }, { "input": "2 1\n10 5\n2 4", "output": "9" }, { "input": "2 1\n50 51\n30 40", "output": "90" }, { "input": "3 2\n5 10\n5 10\n7 9", "output": "27" }, { "input": "3 1\n1000 1000\n50 100\n2 2", "output": "1102" }, { "input": "2 1\n2 4\n12 12", "output": "16" }, { "input": "2 1\n4 4\n1 2", "output": "6" }, { "input": "2 1\n4000 4000\n1 2", "output": "4002" }, { "input": "2 1\n5 6\n2 4", "output": "9" }, { "input": "3 2\n10 10\n10 10\n1 2", "output": "22" }, { "input": "10 5\n9 1\n11 1\n12 1\n13 1\n14 1\n2 4\n2 4\n2 4\n2 4\n2 4", "output": "25" }, { "input": "2 1\n30 30\n10 20", "output": "50" }, { "input": "1 1\n1 1", "output": "1" }, { "input": "2 1\n10 2\n2 10", "output": "6" }, { "input": "2 1\n4 5\n3 9", "output": "10" }, { "input": "2 1\n100 100\n5 10", "output": "110" }, { "input": "2 1\n14 28\n15 28", "output": "43" }, { "input": "2 1\n100 1\n20 40", "output": "41" }, { "input": "2 1\n5 10\n6 10", "output": "16" }, { "input": "2 1\n29 30\n10 20", "output": "49" }, { "input": "1 0\n12 12", "output": "12" }, { "input": "2 1\n7 8\n4 7", "output": "14" }, { "input": "2 1\n5 5\n2 4", "output": "9" }, { "input": "2 1\n1 2\n228 2", "output": "4" }, { "input": "2 1\n5 10\n100 20", "output": "30" }, { "input": "2 1\n1000 1001\n2 4", "output": "1004" }, { "input": "2 1\n3 9\n7 7", "output": "13" }, { "input": "2 0\n1 1\n1 1", "output": "2" }, { "input": "4 1\n10 10\n10 10\n10 10\n4 6", "output": "36" }, { "input": "18 13\n63 8\n87 100\n18 89\n35 29\n66 81\n27 85\n64 51\n60 52\n32 94\n74 22\n86 31\n43 78\n12 2\n36 2\n67 23\n2 16\n78 71\n34 64", "output": "772" }, { "input": "2 1\n10 18\n17 19", "output": "35" }, { "input": "3 0\n1 1\n1 1\n1 1", "output": "3" }, { "input": "2 1\n4 7\n8 9", "output": "15" }, { "input": "4 2\n2 10\n3 10\n9 10\n5 10", "output": "27" }, { "input": "2 1\n5 7\n3 6", "output": "11" }, { "input": "2 1\n3 4\n12 12", "output": "16" }, { "input": "2 1\n10 11\n9 20", "output": "28" }, { "input": "2 1\n7 8\n2 4", "output": "11" }, { "input": "2 1\n5 10\n7 10", "output": "17" }, { "input": "4 2\n2 10\n3 10\n5 10\n9 10", "output": "27" }, { "input": "2 1\n99 100\n5 10", "output": "109" }, { "input": "4 2\n2 10\n3 10\n5 10\n9 9", "output": "27" }, { "input": "2 1\n3 7\n5 7", "output": "11" }, { "input": "2 1\n10 10\n3 6", "output": "16" }, { "input": "2 1\n100 1\n2 4", "output": "5" }, { "input": "5 0\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "5" }, { "input": "3 1\n3 7\n4 5\n2 3", "output": "12" }, { "input": "2 1\n3 9\n7 8", "output": "13" }, { "input": "2 1\n10 2\n3 4", "output": "6" }, { "input": "2 1\n40 40\n3 5", "output": "45" }, { "input": "2 1\n5 3\n1 2", "output": "5" }, { "input": "10 5\n9 5\n10 5\n11 5\n12 5\n13 5\n2 4\n2 4\n2 4\n2 4\n2 4", "output": "45" }, { "input": "3 1\n1 5\n1 5\n4 4", "output": "7" }, { "input": "4 0\n1 1\n1 1\n1 1\n1 1", "output": "4" }, { "input": "4 1\n1000 1001\n1000 1001\n2 4\n1 2", "output": "2005" }, { "input": "2 1\n15 30\n50 59", "output": "80" }, { "input": "2 1\n8 8\n3 5", "output": "13" }, { "input": "2 1\n4 5\n2 5", "output": "8" }, { "input": "3 2\n3 3\n1 2\n1 2", "output": "7" }, { "input": "3 1\n2 5\n2 5\n4 4", "output": "10" }, { "input": "2 1\n3 10\n50 51", "output": "56" }, { "input": "4 2\n2 4\n2 4\n9 10\n9 10", "output": "26" }, { "input": "2 1\n3 5\n8 8", "output": "13" }, { "input": "2 1\n100 150\n70 150", "output": "240" }, { "input": "2 1\n4 5\n3 6", "output": "10" }, { "input": "2 1\n20 10\n3 5", "output": "15" }, { "input": "15 13\n76167099 92301116\n83163126 84046805\n45309500 65037149\n29982002 77381688\n76738161 52935441\n37889502 25466134\n55955619 14197941\n31462620 12999429\n64648384 8824773\n3552934 68992494\n2823376 9338427\n86832070 3763091\n67753633 2162190\n302887 92011825\n84894984 410533", "output": "435467000" }, { "input": "2 1\n8 7\n3 6", "output": "13" }, { "input": "2 1\n7 8\n3 5", "output": "12" }, { "input": "2 1\n10 10\n1 3", "output": "12" }, { "input": "2 1\n9 10\n2 4", "output": "13" }, { "input": "3 1\n10 11\n12 13\n8 10", "output": "32" }, { "input": "2 1\n5 10\n7 7", "output": "17" }, { "input": "4 2\n90 91\n2 10\n2 10\n2 10", "output": "100" }, { "input": "2 1\n2 4\n4 4", "output": "8" }, { "input": "2 1\n2 3\n4 3", "output": "6" }, { "input": "2 1\n40 45\n50 52", "output": "95" }, { "input": "3 1\n1 4\n2 4\n3 4", "output": "8" }, { "input": "2 1\n1 2\n1000 1000", "output": "1002" }, { "input": "2 1\n80 100\n70 95", "output": "175" } ]
1,680,971,216
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
46
0
n, f = map(int, input().split()) moresell=[] cansell =0 for i in range(n): x, y = map(int, input().split()) cansell =cansell + min(x, y) moresell.append(min(2 * x, y) - min(x, y)) print(moresell) moresell.sort(reverse=True) for i in range(f): cansell += moresell[i] print(cansell)
Title: Summer sell-off Time Limit: None seconds Memory Limit: None megabytes Problem Description: Summer holidays! Someone is going on trips, someone is visiting grandparents, but someone is trying to get a part-time job. This summer Noora decided that she wants to earn some money, and took a job in a shop as an assistant. Shop, where Noora is working, has a plan on the following *n* days. For each day sales manager knows exactly, that in *i*-th day *k**i* products will be put up for sale and exactly *l**i* clients will come to the shop that day. Also, the manager is sure, that everyone, who comes to the shop, buys exactly one product or, if there aren't any left, leaves the shop without buying anything. Moreover, due to the short shelf-life of the products, manager established the following rule: if some part of the products left on the shelves at the end of the day, that products aren't kept on the next day and are sent to the dump. For advertising purposes manager offered to start a sell-out in the shop. He asked Noora to choose any *f* days from *n* next for sell-outs. On each of *f* chosen days the number of products were put up for sale would be doubled. Thus, if on *i*-th day shop planned to put up for sale *k**i* products and Noora has chosen this day for sell-out, shelves of the shop would keep 2·*k**i* products. Consequently, there is an opportunity to sell two times more products on days of sell-out. Noora's task is to choose *f* days to maximize total number of sold products. She asks you to help her with such a difficult problem. Input Specification: The first line contains two integers *n* and *f* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*f*<=≤<=*n*) denoting the number of days in shop's plan and the number of days that Noora has to choose for sell-out. Each line of the following *n* subsequent lines contains two integers *k**i*,<=*l**i* (0<=≤<=*k**i*,<=*l**i*<=≤<=109) denoting the number of products on the shelves of the shop on the *i*-th day and the number of clients that will come to the shop on *i*-th day. Output Specification: Print a single integer denoting the maximal number of products that shop can sell. Demo Input: ['4 2\n2 1\n3 5\n2 3\n1 5\n', '4 1\n0 2\n0 3\n3 5\n0 6\n'] Demo Output: ['10', '5'] Note: In the first example we can choose days with numbers 2 and 4 for sell-out. In this case new numbers of products for sale would be equal to [2, 6, 2, 2] respectively. So on the first day shop will sell 1 product, on the second — 5, on the third — 2, on the fourth — 2. In total 1 + 5 + 2 + 2 = 10 product units. In the second example it is possible to sell 5 products, if you choose third day for sell-out.
```python n, f = map(int, input().split()) moresell=[] cansell =0 for i in range(n): x, y = map(int, input().split()) cansell =cansell + min(x, y) moresell.append(min(2 * x, y) - min(x, y)) print(moresell) moresell.sort(reverse=True) for i in range(f): cansell += moresell[i] print(cansell) ```
0
369
B
Valera and Contest
PROGRAMMING
1,400
[ "constructive algorithms", "implementation", "math" ]
null
null
Valera loves to participate in competitions. Especially in programming contests. Today he has participated in the contest with his team, consisting of *n* students (including Valera). This contest was an individual competition, so each student in the team solved problems individually. After the contest was over, Valera was interested in results. He found out that: - each student in the team scored at least *l* points and at most *r* points; - in total, all members of the team scored exactly *s**all* points; - the total score of the *k* members of the team who scored the most points is equal to exactly *s**k*; more formally, if *a*1,<=*a*2,<=...,<=*a**n* is the sequence of points earned by the team of students in the non-increasing order (*a*1<=≥<=*a*2<=≥<=...<=≥<=*a**n*), then *s**k*<==<=*a*1<=+<=*a*2<=+<=...<=+<=*a**k*. However, Valera did not find out exactly how many points each of *n* students scored. Valera asked you to recover any distribution of scores between the students of the team, such that all the conditions above are met.
The first line of the input contains exactly six integers *n*,<=*k*,<=*l*,<=*r*,<=*s**all*,<=*s**k* (1<=≤<=*n*,<=*k*,<=*l*,<=*r*<=≤<=1000; *l*<=≤<=*r*; *k*<=≤<=*n*; 1<=≤<=*s**k*<=≤<=*s**all*<=≤<=106). It's guaranteed that the input is such that the answer exists.
Print exactly *n* integers *a*1,<=*a*2,<=...,<=*a**n* — the number of points each student scored. If there are multiple solutions, you can print any of them. You can print the distribution of points in any order.
[ "5 3 1 3 13 9\n", "5 3 1 3 15 9\n" ]
[ "2 3 2 3 3 ", "3 3 3 3 3 " ]
none
1,000
[ { "input": "5 3 1 3 13 9", "output": "2 3 2 3 3 " }, { "input": "5 3 1 3 15 9", "output": "3 3 3 3 3 " }, { "input": "50 25 1 1 50 25", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "1000 700 782 1000 892330 648282", "output": "926 926 926 814 926 926 926 926 926 813 926 814 926 813 813 926 814 926 926 926 814 926 814 926 813 927 814 926 813 926 926 813 926 926 926 927 926 813 926 813 926 926 926 926 813 926 926 926 813 813 926 926 814 926 926 926 814 926 813 927 926 926 927 926 926 926 926 926 926 926 927 813 926 814 926 926 926 926 813 813 814 926 927 814 926 926 813 926 813 926 926 814 926 926 926 926 926 926 814 926 926 927 926 926 926 926 926 814 926 926 813 926 926 926 926 927 813 926 926 927 926 926 926 926 926 926 926 926..." }, { "input": "1000 999 500 503 501513 501013", "output": "501 502 502 501 501 502 502 502 501 501 502 501 502 501 501 501 501 502 502 502 501 502 501 502 501 502 501 502 501 501 502 501 501 502 502 502 501 501 502 501 502 501 502 502 501 501 502 502 501 501 502 502 501 502 502 501 501 502 501 502 501 502 502 502 502 502 502 501 502 502 502 501 502 501 502 502 501 502 501 501 501 501 502 501 502 502 501 502 501 501 502 501 502 502 501 502 502 501 501 502 502 502 501 501 502 502 502 501 502 502 501 501 501 501 502 502 500 501 502 502 502 502 502 502 501 502 501 502..." }, { "input": "999 998 500 501 500009 499509", "output": "500 501 501 500 500 501 501 501 500 500 501 500 501 500 500 500 500 501 501 501 500 501 500 501 500 501 500 501 500 500 501 500 500 501 501 501 500 500 501 500 501 500 501 501 500 500 501 501 500 500 501 501 500 501 501 500 500 501 500 501 500 501 501 501 501 501 501 500 501 501 501 500 501 500 501 501 500 501 500 500 500 500 501 500 501 501 500 501 500 500 501 500 501 501 500 501 501 500 500 501 501 501 500 500 501 501 501 500 501 501 500 500 500 500 501 501 501 500 501 501 501 501 501 501 500 501 500 501..." }, { "input": "999 998 500 500 499500 499000", "output": "500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500..." }, { "input": "999 997 500 502 500516 499516", "output": "501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 502 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 501 502 501 501 501 501 501 501 501 501 500 501 501 501 501 501 502 501 501 501 501 501 501 501 501 501 501 501..." }, { "input": "1000 300 50 500 269795 127658", "output": "203 204 203 203 203 203 203 426 203 203 204 203 425 203 203 203 203 204 203 203 203 425 203 204 203 426 203 203 203 203 203 203 203 426 203 426 203 203 426 203 203 203 203 203 203 203 203 204 203 203 425 203 203 425 425 203 203 425 203 426 203 204 426 426 425 426 203 203 425 203 426 203 425 203 425 425 203 425 203 203 203 203 426 203 425 203 203 425 203 203 203 203 203 203 203 203 426 203 203 203 425 426 203 203 203 203 203 203 425 425 203 203 203 203 203 426 203 203 203 426 204 203 203 203 203 203 203 426..." }, { "input": "50 25 1000 1000 50000 25000", "output": "1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 " }, { "input": "100 100 500 1000 75589 75589", "output": "756 756 756 755 755 756 756 756 756 755 756 756 756 756 756 756 755 756 755 756 756 756 756 756 756 756 756 756 756 755 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 755 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 755 756 756 756 756 756 755 756 756 756 755 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 756 755 756 756 756 756 756 756 756 " }, { "input": "1 1 1000 1000 1000 1000", "output": "1000 " }, { "input": "2 2 500 1000 1000 1000", "output": "500 500 " }, { "input": "1000 500 1 1000 500500 500000", "output": "1 1000 1000 1 1 1000 1000 1000 1 1 1000 1 1000 1 1 1 1 1000 1000 1000 1 1000 1 1000 1 1000 1 1000 1 1 1000 1 1 1000 1000 1000 1 1 1000 1 1000 1 1000 1000 1 1 1 1000 1 1 1000 1000 1 1000 1000 1 1 1000 1 1000 1 1000 1000 1000 1000 1000 1000 1 1000 1000 1000 1 1000 1 1000 1000 1 1000 1 1 1 1 1000 1 1000 1000 1 1000 1 1 1000 1 1000 1000 1 1000 1000 1 1 1000 1000 1000 1 1 1000 1000 1000 1 1000 1000 1 1 1 1 1000 1000 1 1 1000 1000 1000 1000 1000 1000 1 1000 1 1000 1 1 1 1 1000 1 1 1000 1000 1000 1000 1000 1 1 1 ..." }, { "input": "1000 500 500 1000 750000 375000", "output": "750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750 750..." }, { "input": "300 100 1 3 600 200", "output": "2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "300 100 1 3 900 300", "output": "3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3..." }, { "input": "300 100 1 3 300 100", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1..." }, { "input": "1 1 1 1 1 1", "output": "1 " }, { "input": "432 32 13 123 28942 3824", "output": "63 63 63 63 63 63 62 63 63 63 63 63 63 63 62 63 63 63 62 62 63 63 62 63 62 120 62 62 63 63 62 63 63 63 63 63 119 120 63 63 63 62 63 62 63 63 63 63 63 63 63 63 63 63 63 120 63 63 63 63 63 63 63 63 63 63 63 63 63 62 63 63 63 63 63 63 62 63 63 63 63 63 63 63 63 62 63 63 63 63 63 63 63 62 63 63 63 63 63 63 63 119 63 62 62 62 63 63 63 63 63 120 63 63 62 63 120 63 62 63 63 62 62 63 63 62 63 63 63 120 63 120 63 63 63 62 63 63 63 63 62 63 62 62 63 63 63 62 63 63 63 63 63 63 63 62 63 62 63 63 63 62 63 119 62 63 62 ..." }, { "input": "504 32 13 123 33704 3791", "output": "64 63 63 63 63 63 63 64 63 63 63 64 63 63 63 64 63 63 63 63 64 63 63 63 63 119 63 63 64 64 63 63 63 64 63 64 118 119 64 64 63 63 63 63 63 64 63 63 64 64 64 63 63 63 64 118 63 64 63 64 63 63 64 64 63 64 63 64 64 63 64 64 64 64 63 63 63 64 63 64 64 64 64 64 63 63 63 64 64 64 63 63 63 63 64 63 64 63 63 63 63 118 63 63 63 63 63 63 64 63 63 119 63 63 63 64 119 63 63 64 63 63 63 63 64 63 64 64 64 119 63 119 64 64 63 63 63 64 63 63 63 64 63 63 63 63 64 63 64 63 64 64 63 64 63 63 63 63 64 64 64 63 64 118 63 63 63 ..." }, { "input": "999 32 13 123 68122 3876", "output": "66 67 67 66 66 67 67 67 66 66 67 66 67 66 66 66 66 67 67 66 66 67 66 67 66 121 66 66 66 66 67 66 66 67 67 67 66 66 67 66 66 66 66 67 66 66 66 67 66 66 67 67 66 67 67 66 66 67 66 67 66 67 67 67 67 67 67 66 67 67 67 66 67 66 67 67 66 67 66 66 66 66 67 66 67 67 66 67 66 66 66 66 66 66 66 67 67 66 66 66 67 121 66 66 67 67 67 66 67 67 66 66 66 66 67 67 122 66 67 67 67 67 67 66 66 67 66 67 66 66 66 66 67 66 66 67 67 67 67 67 66 66 66 67 67 66 67 67 66 66 66 67 66 67 66 66 66 66 67 67 66 66 66 121 67 66 66 67 66 ..." }, { "input": "489 32 13 123 33009 3885", "output": "64 64 64 64 63 64 63 64 64 64 64 64 64 64 63 64 64 64 63 63 64 64 63 64 63 122 63 63 64 64 63 64 64 64 63 64 121 122 64 64 63 63 63 63 64 64 64 64 64 64 64 64 64 64 64 121 63 64 64 64 64 64 64 64 64 64 63 64 64 63 64 64 64 64 64 64 63 64 63 64 64 64 64 64 64 63 64 64 64 64 63 63 63 63 64 63 64 64 64 63 64 121 64 63 63 64 63 64 64 64 64 122 64 64 63 64 122 64 64 64 64 63 64 64 64 64 64 64 64 122 64 122 64 64 64 63 64 64 64 64 63 64 63 64 64 64 64 63 64 63 64 64 64 64 64 63 64 63 64 64 64 64 64 121 63 64 63 ..." }, { "input": "234 32 13 123 16337 3715", "output": "62 63 62 62 63 62 62 62 62 63 62 63 63 62 63 62 63 63 63 116 62 63 63 63 63 116 62 63 62 63 63 63 62 62 63 63 116 116 62 63 63 63 62 62 116 62 63 116 62 62 62 63 116 62 62 116 63 62 62 63 63 63 63 63 63 63 62 62 62 116 63 62 62 62 62 62 62 62 63 63 62 63 63 63 63 62 62 62 62 62 63 62 63 62 62 63 63 63 63 116 63 116 63 63 116 62 63 63 62 62 62 116 116 63 62 63 117 63 62 63 63 62 63 62 62 116 62 63 63 117 62 116 62 63 62 63 62 62 116 63 62 63 63 62 62 62 63 63 63 62 63 63 62 62 62 62 63 63 63 62 63 62 63 116..." }, { "input": "998 997 13 13 12974 12961", "output": "13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 1..." }, { "input": "999 999 13 333 169609 169609", "output": "170 170 170 170 170 170 170 170 170 169 170 170 170 169 169 170 169 170 170 170 170 170 169 170 169 170 169 170 169 170 170 169 170 170 170 170 170 169 170 169 170 170 170 170 169 170 170 170 169 169 170 170 169 170 170 170 170 170 169 170 170 170 170 170 170 170 170 170 170 170 170 169 170 170 170 170 170 170 169 169 170 170 170 170 170 170 169 170 169 170 170 169 170 170 170 170 170 170 169 170 170 170 170 170 170 170 170 169 170 170 169 170 170 170 170 170 170 170 170 170 170 170 170 170 170 170 170 170..." }, { "input": "999 998 13 533 270345 270332", "output": "271 271 271 271 271 271 271 271 271 270 271 271 271 270 270 271 271 271 271 271 271 271 271 271 270 271 271 271 270 271 271 270 271 271 271 271 271 271 271 270 271 271 271 271 270 271 271 271 270 270 271 271 271 271 271 271 271 271 270 271 271 271 271 271 271 271 271 271 271 271 271 270 271 271 271 271 271 271 270 270 271 271 271 271 271 271 270 271 270 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 13 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 271 ..." }, { "input": "998 123 13 293 151330 33752", "output": "134 135 135 134 134 135 135 135 134 134 135 134 135 134 134 134 134 135 135 134 134 135 134 135 134 275 134 134 134 134 135 134 134 135 135 275 134 134 135 134 134 134 134 135 134 134 134 135 134 134 135 135 134 135 135 134 134 135 134 275 134 135 275 274 135 274 135 134 135 135 274 134 135 134 135 135 134 135 134 134 134 134 274 134 135 135 134 135 134 134 134 134 134 134 134 135 274 134 134 134 135 275 134 134 135 135 135 134 135 135 135 134 134 134 135 274 275 134 135 275 135 135 135 134 134 135 134 274..." }, { "input": "995 993 123 743 437780 437534", "output": "440 441 441 440 440 441 441 441 440 440 441 440 441 440 440 440 440 441 441 441 440 441 440 441 440 441 440 441 440 440 441 440 440 441 441 441 440 440 441 440 441 441 441 441 440 440 441 441 440 440 441 441 440 441 441 441 440 441 440 441 440 441 441 441 441 441 441 441 441 441 441 440 441 440 441 441 440 441 440 440 440 441 441 440 441 441 440 441 440 440 441 440 441 441 441 441 441 440 440 441 441 441 441 440 441 441 441 440 441 441 441 440 441 441 441 441 441 440 441 441 441 441 441 441 440 441 441 441..." }, { "input": "999 999 111 111 110889 110889", "output": "111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111..." }, { "input": "1000 1000 111 111 111000 111000", "output": "111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111..." }, { "input": "1000 567 999 1000 999489 566922", "output": "999 1000 1000 999 999 1000 1000 1000 999 999 1000 999 1000 999 999 999 999 1000 1000 1000 999 1000 999 1000 999 1000 999 1000 999 999 1000 999 999 1000 1000 1000 999 999 1000 999 1000 999 1000 1000 999 999 999 1000 999 999 1000 1000 999 1000 1000 999 999 1000 999 1000 999 1000 1000 1000 1000 1000 1000 999 1000 1000 1000 999 1000 999 1000 1000 999 1000 999 999 999 999 1000 999 1000 1000 999 1000 999 999 1000 999 1000 1000 999 1000 1000 999 999 1000 1000 1000 999 999 1000 1000 1000 999 1000 1000 999 999 999 ..." }, { "input": "1000 567 998 1000 998981 566754", "output": "998 1000 999 998 999 999 999 1000 999 998 1000 998 1000 998 998 999 998 999 999 999 998 1000 998 1000 998 1000 998 999 998 998 999 998 999 1000 999 1000 998 998 1000 998 999 999 999 999 998 998 999 1000 998 998 1000 999 998 1000 1000 999 998 1000 998 1000 998 1000 1000 1000 1000 1000 999 999 1000 999 1000 998 1000 998 1000 1000 999 1000 998 998 998 999 1000 998 1000 999 998 1000 998 998 999 998 999 999 999 999 1000 998 998 999 1000 1000 999 999 999 999 999 998 1000 1000 998 998 999 999 999 1000 998 998 999..." }, { "input": "1000 567 996 1000 997986 566445", "output": "997 999 999 997 997 999 999 999 997 996 999 997 999 996 996 997 997 999 999 999 997 999 997 999 996 1000 997 999 996 997 999 996 997 999 999 999 997 996 999 996 999 999 999 999 996 997 999 999 996 996 999 999 997 999 999 997 997 999 996 999 997 999 999 999 999 999 999 999 999 999 999 996 999 997 999 999 997 999 996 996 997 997 999 997 999 999 996 999 996 997 999 997 999 999 999 999 999 997 997 999 999 999 999 997 999 999 999 997 999 999 996 997 997 999 999 999 996 997 999 999 999 999 999 999 997 999 999 99..." }, { "input": "1000 567 996 1000 997986 566445", "output": "997 999 999 997 997 999 999 999 997 996 999 997 999 996 996 997 997 999 999 999 997 999 997 999 996 1000 997 999 996 997 999 996 997 999 999 999 997 996 999 996 999 999 999 999 996 997 999 999 996 996 999 999 997 999 999 997 997 999 996 999 997 999 999 999 999 999 999 999 999 999 999 996 999 997 999 999 997 999 996 996 997 997 999 997 999 999 996 999 996 997 999 997 999 999 999 999 999 997 997 999 999 999 999 997 999 999 999 997 999 999 996 997 997 999 999 999 996 997 999 999 999 999 999 999 997 999 999 99..." }, { "input": "1 1 1 1000 656 656", "output": "656 " }, { "input": "2 1 1 1000 683 550", "output": "550 133 " }, { "input": "3 2 1 1000 1816 1652", "output": "826 826 164 " }, { "input": "5 5 1 1000 3288 3288", "output": "657 658 657 658 658 " }, { "input": "5 3 1 1000 2732 2055", "output": "338 685 339 685 685 " }, { "input": "1 1 10 100 50 50", "output": "50 " }, { "input": "3 3 1 5 14 14", "output": "5 5 4 " }, { "input": "1 1 1 100 50 50", "output": "50 " }, { "input": "5 5 1 5 5 5", "output": "1 1 1 1 1 " }, { "input": "1 1 1 10 10 10", "output": "10 " }, { "input": "5 5 1 3 5 5", "output": "1 1 1 1 1 " }, { "input": "1000 1000 1 1000 1000000 1000000", "output": "1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1..." }, { "input": "3 3 1 3 9 9", "output": "3 3 3 " }, { "input": "1000 1000 389 999 686847 686847", "output": "687 687 687 687 687 687 687 687 687 686 687 687 687 686 686 687 687 687 687 687 687 687 687 687 686 687 687 687 686 687 687 686 687 687 687 687 687 686 687 686 687 687 687 687 686 687 687 687 686 686 687 687 687 687 687 687 687 687 686 687 687 687 687 687 687 687 687 687 687 687 687 686 687 687 687 687 687 687 686 686 687 687 687 687 687 687 686 687 686 687 687 687 687 687 687 687 687 687 687 687 687 687 687 687 687 687 687 687 687 687 686 687 687 687 687 687 686 687 687 687 687 687 687 687 687 687 687 687..." }, { "input": "2 2 2 2 4 4", "output": "2 2 " } ]
1,667,066,967
2,147,483,647
PyPy 3-64
RUNTIME_ERROR
TESTS
2
93
3,276,800
import math # n=int(input()) # n,m=map(int,input().split()) # s=(input()) # s,t=input().split() # arr=list(map(int,input().split())) # for _ in range(int(input())): # n=int(input()) # arr=list(map(int,input().split())) n,k,l,r,sall,sk=map(int,input().split()) for i in range(r,l-1,-1): val=(sall-sk)/(n-i);x=int(val);cei=math.ceil(val) if sk%i==0 and (x>=l and x<=r) and (sk//i)>=cei: idx=i;xx=x;ceii=cei;break ans=[] rem=ceii-xx for i in range(idx): ans.append(sk//idx) for i in range(n-idx): if rem: ans.append(xx+1) rem-=1 else: ans.append(xx) print(*ans)
Title: Valera and Contest Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera loves to participate in competitions. Especially in programming contests. Today he has participated in the contest with his team, consisting of *n* students (including Valera). This contest was an individual competition, so each student in the team solved problems individually. After the contest was over, Valera was interested in results. He found out that: - each student in the team scored at least *l* points and at most *r* points; - in total, all members of the team scored exactly *s**all* points; - the total score of the *k* members of the team who scored the most points is equal to exactly *s**k*; more formally, if *a*1,<=*a*2,<=...,<=*a**n* is the sequence of points earned by the team of students in the non-increasing order (*a*1<=≥<=*a*2<=≥<=...<=≥<=*a**n*), then *s**k*<==<=*a*1<=+<=*a*2<=+<=...<=+<=*a**k*. However, Valera did not find out exactly how many points each of *n* students scored. Valera asked you to recover any distribution of scores between the students of the team, such that all the conditions above are met. Input Specification: The first line of the input contains exactly six integers *n*,<=*k*,<=*l*,<=*r*,<=*s**all*,<=*s**k* (1<=≤<=*n*,<=*k*,<=*l*,<=*r*<=≤<=1000; *l*<=≤<=*r*; *k*<=≤<=*n*; 1<=≤<=*s**k*<=≤<=*s**all*<=≤<=106). It's guaranteed that the input is such that the answer exists. Output Specification: Print exactly *n* integers *a*1,<=*a*2,<=...,<=*a**n* — the number of points each student scored. If there are multiple solutions, you can print any of them. You can print the distribution of points in any order. Demo Input: ['5 3 1 3 13 9\n', '5 3 1 3 15 9\n'] Demo Output: ['2 3 2 3 3 ', '3 3 3 3 3 '] Note: none
```python import math # n=int(input()) # n,m=map(int,input().split()) # s=(input()) # s,t=input().split() # arr=list(map(int,input().split())) # for _ in range(int(input())): # n=int(input()) # arr=list(map(int,input().split())) n,k,l,r,sall,sk=map(int,input().split()) for i in range(r,l-1,-1): val=(sall-sk)/(n-i);x=int(val);cei=math.ceil(val) if sk%i==0 and (x>=l and x<=r) and (sk//i)>=cei: idx=i;xx=x;ceii=cei;break ans=[] rem=ceii-xx for i in range(idx): ans.append(sk//idx) for i in range(n-idx): if rem: ans.append(xx+1) rem-=1 else: ans.append(xx) print(*ans) ```
-1
742
A
Arpa’s hard exam and Mehrdad’s naive cheat
PROGRAMMING
1,000
[ "implementation", "math", "number theory" ]
null
null
There exists an island called Arpa’s land, some beautiful girls live there, as ugly ones do. Mehrdad wants to become minister of Arpa’s land. Arpa has prepared an exam. Exam has only one question, given *n*, print the last digit of 1378*n*. Mehrdad has become quite confused and wants you to help him. Please help, although it's a naive cheat.
The single line of input contains one integer *n* (0<=<=≤<=<=*n*<=<=≤<=<=109).
Print single integer — the last digit of 1378*n*.
[ "1\n", "2\n" ]
[ "8", "4" ]
In the first example, last digit of 1378<sup class="upper-index">1</sup> = 1378 is 8. In the second example, last digit of 1378<sup class="upper-index">2</sup> = 1378·1378 = 1898884 is 4.
500
[ { "input": "1", "output": "8" }, { "input": "2", "output": "4" }, { "input": "1000", "output": "6" }, { "input": "3", "output": "2" }, { "input": "4", "output": "6" }, { "input": "1000000000", "output": "6" }, { "input": "5", "output": "8" }, { "input": "6", "output": "4" }, { "input": "999999999", "output": "2" }, { "input": "1378", "output": "4" }, { "input": "13781378", "output": "4" }, { "input": "51202278", "output": "4" }, { "input": "999999998", "output": "4" }, { "input": "999999997", "output": "8" }, { "input": "12193721", "output": "8" }, { "input": "0", "output": "1" }, { "input": "989898989", "output": "8" }, { "input": "7", "output": "2" }, { "input": "8", "output": "6" }, { "input": "9", "output": "8" }, { "input": "10", "output": "4" }, { "input": "11", "output": "2" }, { "input": "12", "output": "6" }, { "input": "13", "output": "8" }, { "input": "14", "output": "4" }, { "input": "15", "output": "2" }, { "input": "16", "output": "6" }, { "input": "999999996", "output": "6" }, { "input": "999999995", "output": "2" }, { "input": "999999994", "output": "4" } ]
1,654,633,464
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
5
1,000
2,560,000
num = int(input()) print((1378 ** num) % 10)
Title: Arpa’s hard exam and Mehrdad’s naive cheat Time Limit: None seconds Memory Limit: None megabytes Problem Description: There exists an island called Arpa’s land, some beautiful girls live there, as ugly ones do. Mehrdad wants to become minister of Arpa’s land. Arpa has prepared an exam. Exam has only one question, given *n*, print the last digit of 1378*n*. Mehrdad has become quite confused and wants you to help him. Please help, although it's a naive cheat. Input Specification: The single line of input contains one integer *n* (0<=<=≤<=<=*n*<=<=≤<=<=109). Output Specification: Print single integer — the last digit of 1378*n*. Demo Input: ['1\n', '2\n'] Demo Output: ['8', '4'] Note: In the first example, last digit of 1378<sup class="upper-index">1</sup> = 1378 is 8. In the second example, last digit of 1378<sup class="upper-index">2</sup> = 1378·1378 = 1898884 is 4.
```python num = int(input()) print((1378 ** num) % 10) ```
0
846
A
Curriculum Vitae
PROGRAMMING
1,500
[ "brute force", "implementation" ]
null
null
Hideo Kojima has just quit his job at Konami. Now he is going to find a new place to work. Despite being such a well-known person, he still needs a CV to apply for a job. During all his career Hideo has produced *n* games. Some of them were successful, some were not. Hideo wants to remove several of them (possibly zero) from his CV to make a better impression on employers. As a result there should be no unsuccessful game which comes right after successful one in his CV. More formally, you are given an array *s*1,<=*s*2,<=...,<=*s**n* of zeros and ones. Zero corresponds to an unsuccessful game, one — to a successful one. Games are given in order they were produced, and Hideo can't swap these values. He should remove some elements from this array in such a way that no zero comes right after one. Besides that, Hideo still wants to mention as much games in his CV as possible. Help this genius of a man determine the maximum number of games he can leave in his CV.
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=100). The second line contains *n* space-separated integer numbers *s*1,<=*s*2,<=...,<=*s**n* (0<=≤<=*s**i*<=≤<=1). 0 corresponds to an unsuccessful game, 1 — to a successful one.
Print one integer — the maximum number of games Hideo can leave in his CV so that no unsuccessful game comes after a successful one.
[ "4\n1 1 0 1\n", "6\n0 1 0 0 1 0\n", "1\n0\n" ]
[ "3\n", "4\n", "1\n" ]
none
0
[ { "input": "4\n1 1 0 1", "output": "3" }, { "input": "6\n0 1 0 0 1 0", "output": "4" }, { "input": "1\n0", "output": "1" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "100" }, { "input": "100\n0 0 1 1 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 1 0 0 0 0 0 0 1 1 1 0 0 1 0 1 0 0 0 1 1 0 0 0 0 0 1 1 0 1 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "80" }, { "input": "1\n1", "output": "1" }, { "input": "100\n1 1 0 1 1 0 0 0 0 1 0 1 1 1 0 1 1 1 1 0 1 1 1 1 1 1 0 1 1 0 0 1 1 1 0 0 0 1 0 0 1 0 1 1 0 1 0 0 1 0 0 1 1 0 0 1 0 0 1 1 0 1 0 1 0 0 0 0 0 1 0 0 0 0 0 0 1 1 0 0 0 1 1 1 0 1 1 0 1 1 1 0 0 1 1 0 0 0 0 1", "output": "53" }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "100" }, { "input": "3\n1 0 0", "output": "2" }, { "input": "10\n1 1 0 0 0 1 1 0 0 0", "output": "6" }, { "input": "90\n1 0 0 1 1 0 0 1 0 0 0 0 1 1 1 0 1 0 1 0 0 0 0 1 0 0 1 1 1 1 1 0 0 0 1 0 1 0 1 0 1 0 0 1 0 1 0 1 0 1 0 1 0 0 1 0 0 1 1 0 0 1 0 0 0 0 1 1 1 0 1 0 1 0 0 0 0 1 0 0 1 1 1 1 1 0 0 0 1 0", "output": "52" }, { "input": "78\n0 0 1 0 1 0 1 1 0 0 0 1 1 1 1 0 0 0 1 0 1 1 1 0 1 0 0 0 1 0 0 0 1 1 1 1 1 1 1 1 1 1 1 0 1 0 0 0 0 0 1 0 0 1 0 1 0 1 0 1 0 1 1 1 0 0 1 0 0 0 0 1 0 1 0 0 1 0", "output": "42" }, { "input": "4\n1 0 0 1", "output": "3" }, { "input": "2\n0 1", "output": "2" }, { "input": "5\n0 1 0 0 1", "output": "4" }, { "input": "3\n1 0 1", "output": "2" }, { "input": "3\n1 1 0", "output": "2" }, { "input": "16\n1 1 1 1 1 0 0 0 0 0 1 0 1 0 0 1", "output": "9" } ]
1,504,639,270
2,147,483,647
Python 3
OK
TESTS
18
61
0
n = int(input()) a = list(map(int, input().split())) cnt = a.count(0) ans = 0 for i in range(cnt + 1): a1 = a[::-1] a2 = [] cnt1 = i index = 0 while cnt1: if not a1[index]: cnt1 -= 1 else: a2.append(a1[index]) index += 1 for j in range(index, n): a2.append(a1[j]) a2 = a2[::-1] index = len(a2) - 1 ansi = 0 while index > -1 and a2[index]: index -= 1 for o in range(index, -1, -1): if a2[o]: ansi += 1 ans = max(len(a2) - ansi, ans) print(ans)
Title: Curriculum Vitae Time Limit: None seconds Memory Limit: None megabytes Problem Description: Hideo Kojima has just quit his job at Konami. Now he is going to find a new place to work. Despite being such a well-known person, he still needs a CV to apply for a job. During all his career Hideo has produced *n* games. Some of them were successful, some were not. Hideo wants to remove several of them (possibly zero) from his CV to make a better impression on employers. As a result there should be no unsuccessful game which comes right after successful one in his CV. More formally, you are given an array *s*1,<=*s*2,<=...,<=*s**n* of zeros and ones. Zero corresponds to an unsuccessful game, one — to a successful one. Games are given in order they were produced, and Hideo can't swap these values. He should remove some elements from this array in such a way that no zero comes right after one. Besides that, Hideo still wants to mention as much games in his CV as possible. Help this genius of a man determine the maximum number of games he can leave in his CV. Input Specification: The first line contains one integer number *n* (1<=≤<=*n*<=≤<=100). The second line contains *n* space-separated integer numbers *s*1,<=*s*2,<=...,<=*s**n* (0<=≤<=*s**i*<=≤<=1). 0 corresponds to an unsuccessful game, 1 — to a successful one. Output Specification: Print one integer — the maximum number of games Hideo can leave in his CV so that no unsuccessful game comes after a successful one. Demo Input: ['4\n1 1 0 1\n', '6\n0 1 0 0 1 0\n', '1\n0\n'] Demo Output: ['3\n', '4\n', '1\n'] Note: none
```python n = int(input()) a = list(map(int, input().split())) cnt = a.count(0) ans = 0 for i in range(cnt + 1): a1 = a[::-1] a2 = [] cnt1 = i index = 0 while cnt1: if not a1[index]: cnt1 -= 1 else: a2.append(a1[index]) index += 1 for j in range(index, n): a2.append(a1[j]) a2 = a2[::-1] index = len(a2) - 1 ansi = 0 while index > -1 and a2[index]: index -= 1 for o in range(index, -1, -1): if a2[o]: ansi += 1 ans = max(len(a2) - ansi, ans) print(ans) ```
3
3
A
Shortest path of the king
PROGRAMMING
1,000
[ "greedy", "shortest paths" ]
A. Shortest path of the king
1
64
The king is left alone on the chessboard. In spite of this loneliness, he doesn't lose heart, because he has business of national importance. For example, he has to pay an official visit to square *t*. As the king is not in habit of wasting his time, he wants to get from his current position *s* to square *t* in the least number of moves. Help him to do this. In one move the king can get to the square that has a common side or a common vertex with the square the king is currently in (generally there are 8 different squares he can move to).
The first line contains the chessboard coordinates of square *s*, the second line — of square *t*. Chessboard coordinates consist of two characters, the first one is a lowercase Latin letter (from a to h), the second one is a digit from 1 to 8.
In the first line print *n* — minimum number of the king's moves. Then in *n* lines print the moves themselves. Each move is described with one of the 8: L, R, U, D, LU, LD, RU or RD. L, R, U, D stand respectively for moves left, right, up and down (according to the picture), and 2-letter combinations stand for diagonal moves. If the answer is not unique, print any of them.
[ "a8\nh1\n" ]
[ "7\nRD\nRD\nRD\nRD\nRD\nRD\nRD\n" ]
none
0
[ { "input": "a8\nh1", "output": "7\nRD\nRD\nRD\nRD\nRD\nRD\nRD" }, { "input": "b2\nb4", "output": "2\nU\nU" }, { "input": "a5\na5", "output": "0" }, { "input": "h1\nb2", "output": "6\nLU\nL\nL\nL\nL\nL" }, { "input": "c5\nh2", "output": "5\nRD\nRD\nRD\nR\nR" }, { "input": "e1\nf2", "output": "1\nRU" }, { "input": "g4\nd2", "output": "3\nLD\nLD\nL" }, { "input": "a8\nb2", "output": "6\nRD\nD\nD\nD\nD\nD" }, { "input": "d4\nh2", "output": "4\nRD\nRD\nR\nR" }, { "input": "c5\na2", "output": "3\nLD\nLD\nD" }, { "input": "h5\nf8", "output": "3\nLU\nLU\nU" }, { "input": "e6\nb6", "output": "3\nL\nL\nL" }, { "input": "a6\ng4", "output": "6\nRD\nRD\nR\nR\nR\nR" }, { "input": "f7\nc2", "output": "5\nLD\nLD\nLD\nD\nD" }, { "input": "b7\nh8", "output": "6\nRU\nR\nR\nR\nR\nR" }, { "input": "g7\nd6", "output": "3\nLD\nL\nL" }, { "input": "c8\na3", "output": "5\nLD\nLD\nD\nD\nD" }, { "input": "h8\nf1", "output": "7\nLD\nLD\nD\nD\nD\nD\nD" }, { "input": "d1\nb7", "output": "6\nLU\nLU\nU\nU\nU\nU" }, { "input": "a7\ne5", "output": "4\nRD\nRD\nR\nR" }, { "input": "d6\nb1", "output": "5\nLD\nLD\nD\nD\nD" }, { "input": "f5\ng5", "output": "1\nR" }, { "input": "h4\nd1", "output": "4\nLD\nLD\nLD\nL" }, { "input": "b3\na5", "output": "2\nLU\nU" }, { "input": "d2\nf1", "output": "2\nRD\nR" }, { "input": "f1\nc5", "output": "4\nLU\nLU\nLU\nU" }, { "input": "a8\nh1", "output": "7\nRD\nRD\nRD\nRD\nRD\nRD\nRD" }, { "input": "c7\ne5", "output": "2\nRD\nRD" }, { "input": "e7\nb1", "output": "6\nLD\nLD\nLD\nD\nD\nD" }, { "input": "g8\na8", "output": "6\nL\nL\nL\nL\nL\nL" }, { "input": "g6\nf2", "output": "4\nLD\nD\nD\nD" }, { "input": "g4\nc4", "output": "4\nL\nL\nL\nL" }, { "input": "g2\na6", "output": "6\nLU\nLU\nLU\nLU\nL\nL" }, { "input": "f8\nf8", "output": "0" }, { "input": "f5\nd2", "output": "3\nLD\nLD\nD" } ]
1,661,707,618
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
1
92
0
m = str(input()) k = str(input()) r = m[0] s = k[0] j = m[-1] z = k[1] x = max(j,z) y = min(j,z) n = int(x)-int(y) print(n) for i in range(n): if ord(r)<ord(s) and j>z: print("RD") elif ord(r)>ord(s) and j<z: print("LD") elif ord(r)==ord(s) and j<z: print("D") elif ord(r)==ord(s) and j>z: print("U")
Title: Shortest path of the king Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: The king is left alone on the chessboard. In spite of this loneliness, he doesn't lose heart, because he has business of national importance. For example, he has to pay an official visit to square *t*. As the king is not in habit of wasting his time, he wants to get from his current position *s* to square *t* in the least number of moves. Help him to do this. In one move the king can get to the square that has a common side or a common vertex with the square the king is currently in (generally there are 8 different squares he can move to). Input Specification: The first line contains the chessboard coordinates of square *s*, the second line — of square *t*. Chessboard coordinates consist of two characters, the first one is a lowercase Latin letter (from a to h), the second one is a digit from 1 to 8. Output Specification: In the first line print *n* — minimum number of the king's moves. Then in *n* lines print the moves themselves. Each move is described with one of the 8: L, R, U, D, LU, LD, RU or RD. L, R, U, D stand respectively for moves left, right, up and down (according to the picture), and 2-letter combinations stand for diagonal moves. If the answer is not unique, print any of them. Demo Input: ['a8\nh1\n'] Demo Output: ['7\nRD\nRD\nRD\nRD\nRD\nRD\nRD\n'] Note: none
```python m = str(input()) k = str(input()) r = m[0] s = k[0] j = m[-1] z = k[1] x = max(j,z) y = min(j,z) n = int(x)-int(y) print(n) for i in range(n): if ord(r)<ord(s) and j>z: print("RD") elif ord(r)>ord(s) and j<z: print("LD") elif ord(r)==ord(s) and j<z: print("D") elif ord(r)==ord(s) and j>z: print("U") ```
0
525
A
Vitaliy and Pie
PROGRAMMING
1,100
[ "greedy", "hashing", "strings" ]
null
null
After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1. The potato pie is located in the *n*-th room and Vitaly needs to go there. Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key. In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F. Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door. Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*. Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number.
The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house. The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one. The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2. The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1.
Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*.
[ "3\naAbB\n", "4\naBaCaB\n", "5\nxYyXzZaZ\n" ]
[ "0\n", "3\n", "2\n" ]
none
250
[ { "input": "3\naAbB", "output": "0" }, { "input": "4\naBaCaB", "output": "3" }, { "input": "5\nxYyXzZaZ", "output": "2" }, { "input": "26\naAbBcCdDeEfFgGhHiIjJkKlLmMnNoOpPqQrRsStTuUvVwWxXyY", "output": "0" }, { "input": "26\nzAyBxCwDvEuFtGsHrIqJpKoLnMmNlOkPjQiRhSgTfUeVdWcXbY", "output": "13" }, { "input": "5\naArRaRaR", "output": "2" }, { "input": "2\ndA", "output": "1" }, { "input": "2\ncB", "output": "1" }, { "input": "10\nhNcMeXsSlHsUwYeMcA", "output": "7" }, { "input": "100\nqDpInBmCrFwXpDbFgOzVvOcEmJrUcToAdEwEgTvBvBfWwRpGyEaXgDdRwVlQnYgWmWhMrHaIzPyXvGaFlRsVzHhZrOuVpXrKxFzAmWwPlFtNfPtJxVmLuHjKfYyArHrEnSwSzOvDpQhCgCqLlAcNpGhXrEeFuCmAqIkXyYtSsQwIxJzNiIuTgEbVuWrMwPrAlLyKaZ", "output": "42" }, { "input": "2\ndD", "output": "0" }, { "input": "2\ndE", "output": "1" }, { "input": "3\ndDdD", "output": "0" }, { "input": "3\ndEdD", "output": "1" }, { "input": "3\ndEeD", "output": "1" }, { "input": "3\ndEeF", "output": "2" } ]
1,614,394,781
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
7
170
2,764,800
# Imports from typing import List, Dict def lowercase() -> str: return 'abcdefghijklmnopqrstuvwxyz' n: int = int(input()) # number of room in the house string: str = input() # keys: (i+1) / 2 i: int = 0 available_keys: Dict[str, int] = dict.fromkeys(lowercase(), 0) # Initialize the dict buy: int = 0 next:str = '' count:int = 0 while i <= 2*n-4: # Iterate till the second last index of the input string available_keys[string[i]] = True next = string[i+1].lower() count = available_keys[next] if count > 0: available_keys[next] = count - 1 else: buy = buy + 1 i = i + 2 print(buy)
Title: Vitaliy and Pie Time Limit: None seconds Memory Limit: None megabytes Problem Description: After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1. The potato pie is located in the *n*-th room and Vitaly needs to go there. Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key. In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F. Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door. Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*. Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number. Input Specification: The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house. The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one. The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2. The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1. Output Specification: Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*. Demo Input: ['3\naAbB\n', '4\naBaCaB\n', '5\nxYyXzZaZ\n'] Demo Output: ['0\n', '3\n', '2\n'] Note: none
```python # Imports from typing import List, Dict def lowercase() -> str: return 'abcdefghijklmnopqrstuvwxyz' n: int = int(input()) # number of room in the house string: str = input() # keys: (i+1) / 2 i: int = 0 available_keys: Dict[str, int] = dict.fromkeys(lowercase(), 0) # Initialize the dict buy: int = 0 next:str = '' count:int = 0 while i <= 2*n-4: # Iterate till the second last index of the input string available_keys[string[i]] = True next = string[i+1].lower() count = available_keys[next] if count > 0: available_keys[next] = count - 1 else: buy = buy + 1 i = i + 2 print(buy) ```
0
550
A
Two Substrings
PROGRAMMING
1,500
[ "brute force", "dp", "greedy", "implementation", "strings" ]
null
null
You are given string *s*. Your task is to determine if the given string *s* contains two non-overlapping substrings "AB" and "BA" (the substrings can go in any order).
The only line of input contains a string *s* of length between 1 and 105 consisting of uppercase Latin letters.
Print "YES" (without the quotes), if string *s* contains two non-overlapping substrings "AB" and "BA", and "NO" otherwise.
[ "ABA\n", "BACFAB\n", "AXBYBXA\n" ]
[ "NO\n", "YES\n", "NO\n" ]
In the first sample test, despite the fact that there are substrings "AB" and "BA", their occurrences overlap, so the answer is "NO". In the second sample test there are the following occurrences of the substrings: BACFAB. In the third sample test there is no substring "AB" nor substring "BA".
1,000
[ { "input": "ABA", "output": "NO" }, { "input": "BACFAB", "output": "YES" }, { "input": "AXBYBXA", "output": "NO" }, { "input": "ABABAB", "output": "YES" }, { "input": "BBBBBBBBBB", "output": "NO" }, { "input": "ABBA", "output": "YES" }, { "input": "ABAXXXAB", "output": "YES" }, { "input": "TESTABAXXABTEST", "output": "YES" }, { "input": "A", "output": "NO" }, { "input": "B", "output": "NO" }, { "input": "X", "output": "NO" }, { "input": "BA", "output": "NO" }, { "input": "AB", "output": "NO" }, { "input": "AA", "output": "NO" }, { "input": "BB", "output": "NO" }, { "input": "BAB", "output": "NO" }, { "input": "AAB", "output": "NO" }, { "input": "BAA", "output": "NO" }, { "input": "ABB", "output": "NO" }, { "input": "BBA", "output": "NO" }, { "input": "AAA", "output": "NO" }, { "input": "BBB", "output": "NO" }, { "input": "AXBXBXA", "output": "NO" }, { "input": "SKDSKDJABSDBADKFJDK", "output": "YES" }, { "input": "ABAXXBBXXAA", "output": "NO" }, { "input": "ABAB", "output": "NO" }, { "input": "BABA", "output": "NO" }, { "input": "AAAB", "output": "NO" }, { "input": "AAAA", "output": "NO" }, { "input": "AABA", "output": "NO" }, { "input": "ABAA", "output": "NO" }, { "input": "BAAA", "output": "NO" }, { "input": "AABB", "output": "NO" }, { "input": "BAAB", "output": "YES" }, { "input": "BBAA", "output": "NO" }, { "input": "BBBA", "output": "NO" }, { "input": "BBAB", "output": "NO" }, { "input": "BABB", "output": "NO" }, { "input": "ABBB", "output": "NO" }, { "input": "BBBB", "output": "NO" }, { "input": "BABAB", "output": "YES" }, { "input": "ABABA", "output": "YES" }, { "input": "AAABAAACBBBC", "output": "NO" }, { "input": "AABBBACBBBBBBAACBCCACBBAABBBBBCAACABAACABCACCBCBCCCBCBCABCBBCCBCBBAACBACAABACBBCACCBCCACCABBCBABBAAC", "output": "YES" }, { "input": "CBBABDDBBADAC", "output": "YES" }, { "input": "ABYFAB", "output": "NO" }, { "input": "BABXXAB", "output": "YES" }, { "input": "ABAXAB", "output": "YES" }, { "input": "ABABXAB", "output": "YES" }, { "input": "ABXABXABXABXABXBAXBAXBAXBA", "output": "YES" }, { "input": "QQQQQQQQQABABQQQQQQQQ", "output": "NO" } ]
1,686,862,485
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
46
0
s = input() # Initialize variables to track the positions of "AB" and "BA" ab_index = s.find("AB") ba_index = s.find("BA") # Check if "AB" and "BA" exist and their positions are non-overlapping if ab_index != -1 and ba_index != -1 and abs(ab_index - ba_index) > 1: print("YES") else: # Swap "AB" and "BA" positions and check again ab_index = s.find("BA", ba_index + 2) ba_index = s.find("AB", ab_index + 2) # Check if "AB" and "BA" exist and their positions are non-overlapping if ab_index != -1 and ba_index != -1 and abs(ab_index - ba_index) > 1: print("YES") else: print("NO")
Title: Two Substrings Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given string *s*. Your task is to determine if the given string *s* contains two non-overlapping substrings "AB" and "BA" (the substrings can go in any order). Input Specification: The only line of input contains a string *s* of length between 1 and 105 consisting of uppercase Latin letters. Output Specification: Print "YES" (without the quotes), if string *s* contains two non-overlapping substrings "AB" and "BA", and "NO" otherwise. Demo Input: ['ABA\n', 'BACFAB\n', 'AXBYBXA\n'] Demo Output: ['NO\n', 'YES\n', 'NO\n'] Note: In the first sample test, despite the fact that there are substrings "AB" and "BA", their occurrences overlap, so the answer is "NO". In the second sample test there are the following occurrences of the substrings: BACFAB. In the third sample test there is no substring "AB" nor substring "BA".
```python s = input() # Initialize variables to track the positions of "AB" and "BA" ab_index = s.find("AB") ba_index = s.find("BA") # Check if "AB" and "BA" exist and their positions are non-overlapping if ab_index != -1 and ba_index != -1 and abs(ab_index - ba_index) > 1: print("YES") else: # Swap "AB" and "BA" positions and check again ab_index = s.find("BA", ba_index + 2) ba_index = s.find("AB", ab_index + 2) # Check if "AB" and "BA" exist and their positions are non-overlapping if ab_index != -1 and ba_index != -1 and abs(ab_index - ba_index) > 1: print("YES") else: print("NO") ```
0
899
A
Splitting in Teams
PROGRAMMING
800
[ "constructive algorithms", "greedy", "math" ]
null
null
There were *n* groups of students which came to write a training contest. A group is either one person who can write the contest with anyone else, or two people who want to write the contest in the same team. The coach decided to form teams of exactly three people for this training. Determine the maximum number of teams of three people he can form. It is possible that he can't use all groups to form teams. For groups of two, either both students should write the contest, or both should not. If two students from a group of two will write the contest, they should be in the same team.
The first line contains single integer *n* (2<=≤<=*n*<=≤<=2·105) — the number of groups. The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), where *a**i* is the number of people in group *i*.
Print the maximum number of teams of three people the coach can form.
[ "4\n1 1 2 1\n", "2\n2 2\n", "7\n2 2 2 1 1 1 1\n", "3\n1 1 1\n" ]
[ "1\n", "0\n", "3\n", "1\n" ]
In the first example the coach can form one team. For example, he can take students from the first, second and fourth groups. In the second example he can't make a single team. In the third example the coach can form three teams. For example, he can do this in the following way: - The first group (of two people) and the seventh group (of one person), - The second group (of two people) and the sixth group (of one person), - The third group (of two people) and the fourth group (of one person).
500
[ { "input": "4\n1 1 2 1", "output": "1" }, { "input": "2\n2 2", "output": "0" }, { "input": "7\n2 2 2 1 1 1 1", "output": "3" }, { "input": "3\n1 1 1", "output": "1" }, { "input": "3\n2 2 2", "output": "0" }, { "input": "3\n1 2 1", "output": "1" }, { "input": "5\n2 2 1 1 1", "output": "2" }, { "input": "7\n1 1 2 2 1 2 1", "output": "3" }, { "input": "10\n1 2 2 1 2 2 1 2 1 1", "output": "5" }, { "input": "5\n2 2 2 1 2", "output": "1" }, { "input": "43\n1 2 2 2 1 1 2 2 1 1 2 2 2 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2", "output": "10" }, { "input": "72\n1 2 1 2 2 1 2 1 1 1 1 2 2 1 2 1 2 1 2 2 2 2 1 2 2 2 2 1 2 1 1 2 2 1 1 2 2 2 2 2 1 1 1 1 2 2 1 1 2 1 1 1 1 2 2 1 2 2 1 2 1 1 2 1 2 2 1 1 1 2 2 2", "output": "34" }, { "input": "64\n2 2 1 1 1 2 1 1 1 2 2 1 2 2 2 1 2 2 2 1 1 1 1 2 1 2 1 2 1 1 2 2 1 1 2 2 1 1 1 1 2 2 1 1 1 2 1 2 2 2 2 2 2 2 1 1 2 1 1 1 2 2 1 2", "output": "32" }, { "input": "20\n1 1 1 1 2 1 2 2 2 1 2 1 2 1 2 1 1 2 1 2", "output": "9" }, { "input": "23\n1 1 1 1 2 1 2 1 1 1 2 2 2 2 2 2 1 2 1 2 2 1 1", "output": "11" }, { "input": "201\n1 1 2 2 2 2 1 1 1 2 2 1 2 1 2 1 2 2 2 1 1 2 1 1 1 2 1 2 1 1 1 2 1 1 2 1 2 2 1 1 1 1 2 1 1 2 1 1 1 2 2 2 2 1 2 1 2 2 2 2 2 2 1 1 1 2 2 1 1 1 1 2 2 1 2 1 1 2 2 1 1 2 2 2 1 1 1 2 1 1 2 1 2 2 1 2 2 2 2 1 1 1 2 1 2 2 2 2 2 1 2 1 1 1 2 2 2 2 2 1 2 1 1 2 2 2 1 1 2 2 1 2 2 2 1 1 1 2 1 1 1 2 1 1 2 2 2 1 2 1 1 1 2 2 1 1 2 2 2 2 2 2 1 2 2 1 2 2 2 1 1 2 2 1 1 2 1 1 1 1 2 1 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 1 1 1 2", "output": "100" }, { "input": "247\n2 2 1 2 1 2 2 2 2 2 2 1 1 2 2 1 2 1 1 1 2 1 1 1 1 2 1 1 2 2 1 2 1 1 1 2 2 2 1 1 2 1 1 2 1 1 1 2 1 2 1 2 2 1 1 2 1 2 2 1 2 1 2 1 1 2 1 1 1 2 2 1 1 2 2 1 1 2 1 1 1 2 2 2 2 1 2 2 2 2 2 2 1 2 2 2 2 1 1 1 1 1 1 1 1 1 2 1 2 2 1 2 1 2 2 2 1 2 2 2 1 1 2 2 1 1 1 2 1 1 1 1 2 2 1 2 2 1 1 1 2 1 2 2 1 2 1 1 1 2 2 2 2 2 1 2 2 2 1 1 1 2 1 2 1 1 2 2 2 2 1 1 2 2 2 1 2 2 2 1 2 1 1 2 2 2 2 1 2 2 1 1 1 2 1 2 1 1 1 2 2 1 1 2 1 1 2 1 2 1 1 2 1 1 1 1 2 1 1 1 1 2 2 1 2 1 1 2 1 2 2 1 2 2 2 1 2 2 1 2 2 1 1 1 2 2 2", "output": "123" }, { "input": "4\n2 2 2 2", "output": "0" }, { "input": "4\n1 1 1 1", "output": "1" }, { "input": "2\n1 1", "output": "0" }, { "input": "2\n2 1", "output": "1" }, { "input": "2\n1 2", "output": "1" }, { "input": "3\n1 1 2", "output": "1" }, { "input": "3\n1 2 2", "output": "1" }, { "input": "3\n2 1 1", "output": "1" }, { "input": "3\n2 1 2", "output": "1" }, { "input": "3\n2 2 1", "output": "1" }, { "input": "4\n1 1 1 2", "output": "1" }, { "input": "4\n1 1 2 2", "output": "2" }, { "input": "4\n1 2 2 2", "output": "1" }, { "input": "4\n2 1 1 1", "output": "1" }, { "input": "5\n1 1 1 1 2", "output": "2" }, { "input": "14\n1 2 2 2 2 2 2 2 2 2 2 2 2 2", "output": "1" }, { "input": "38\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1", "output": "1" }, { "input": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1", "output": "1" }, { "input": "20\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1", "output": "1" }, { "input": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2", "output": "1" }, { "input": "6\n1 1 1 2 2 2", "output": "3" }, { "input": "5\n2 1 1 1 1", "output": "2" }, { "input": "9\n1 1 1 1 1 1 2 2 2", "output": "4" }, { "input": "10\n2 2 1 1 1 1 1 1 1 1", "output": "4" }, { "input": "6\n1 1 1 1 1 1", "output": "2" } ]
1,549,625,878
2,147,483,647
Python 3
OK
TESTS
67
155
4,096,000
f=lambda:map(int,input().split()) n=int(input()) l=list(f()) n1,n2=l.count(1),l.count(2) print([n1,n2+(n1-n2)//3][n1>n2])
Title: Splitting in Teams Time Limit: None seconds Memory Limit: None megabytes Problem Description: There were *n* groups of students which came to write a training contest. A group is either one person who can write the contest with anyone else, or two people who want to write the contest in the same team. The coach decided to form teams of exactly three people for this training. Determine the maximum number of teams of three people he can form. It is possible that he can't use all groups to form teams. For groups of two, either both students should write the contest, or both should not. If two students from a group of two will write the contest, they should be in the same team. Input Specification: The first line contains single integer *n* (2<=≤<=*n*<=≤<=2·105) — the number of groups. The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), where *a**i* is the number of people in group *i*. Output Specification: Print the maximum number of teams of three people the coach can form. Demo Input: ['4\n1 1 2 1\n', '2\n2 2\n', '7\n2 2 2 1 1 1 1\n', '3\n1 1 1\n'] Demo Output: ['1\n', '0\n', '3\n', '1\n'] Note: In the first example the coach can form one team. For example, he can take students from the first, second and fourth groups. In the second example he can't make a single team. In the third example the coach can form three teams. For example, he can do this in the following way: - The first group (of two people) and the seventh group (of one person), - The second group (of two people) and the sixth group (of one person), - The third group (of two people) and the fourth group (of one person).
```python f=lambda:map(int,input().split()) n=int(input()) l=list(f()) n1,n2=l.count(1),l.count(2) print([n1,n2+(n1-n2)//3][n1>n2]) ```
3
476
A
Dreamoon and Stairs
PROGRAMMING
1,000
[ "implementation", "math" ]
null
null
Dreamoon wants to climb up a stair of *n* steps. He can climb 1 or 2 steps at each move. Dreamoon wants the number of moves to be a multiple of an integer *m*. What is the minimal number of moves making him climb to the top of the stairs that satisfies his condition?
The single line contains two space separated integers *n*, *m* (0<=&lt;<=*n*<=≤<=10000,<=1<=&lt;<=*m*<=≤<=10).
Print a single integer — the minimal number of moves being a multiple of *m*. If there is no way he can climb satisfying condition print <=-<=1 instead.
[ "10 2\n", "3 5\n" ]
[ "6\n", "-1\n" ]
For the first sample, Dreamoon could climb in 6 moves with following sequence of steps: {2, 2, 2, 2, 1, 1}. For the second sample, there are only three valid sequence of steps {2, 1}, {1, 2}, {1, 1, 1} with 2, 2, and 3 steps respectively. All these numbers are not multiples of 5.
500
[ { "input": "10 2", "output": "6" }, { "input": "3 5", "output": "-1" }, { "input": "29 7", "output": "21" }, { "input": "2 2", "output": "2" }, { "input": "1 2", "output": "-1" }, { "input": "10000 2", "output": "5000" }, { "input": "10000 3", "output": "5001" }, { "input": "10000 10", "output": "5000" }, { "input": "9999 3", "output": "5001" }, { "input": "9999 2", "output": "5000" }, { "input": "9999 10", "output": "5000" }, { "input": "9999 9", "output": "5004" }, { "input": "18 10", "output": "10" }, { "input": "19 10", "output": "10" }, { "input": "20 10", "output": "10" }, { "input": "21 10", "output": "20" }, { "input": "7688 5", "output": "3845" }, { "input": "4608 5", "output": "2305" }, { "input": "3979 2", "output": "1990" }, { "input": "9985 6", "output": "4998" }, { "input": "3230 8", "output": "1616" }, { "input": "24 9", "output": "18" }, { "input": "3275 8", "output": "1640" }, { "input": "6240 7", "output": "3122" }, { "input": "5227 4", "output": "2616" }, { "input": "3832 6", "output": "1920" }, { "input": "4 2", "output": "2" }, { "input": "6 3", "output": "3" }, { "input": "10 5", "output": "5" }, { "input": "3 2", "output": "2" }, { "input": "6 4", "output": "4" }, { "input": "5 2", "output": "4" }, { "input": "8 2", "output": "4" }, { "input": "9 9", "output": "9" }, { "input": "4 5", "output": "-1" } ]
1,661,749,045
2,147,483,647
Python 3
OK
TESTS
35
62
0
from sys import stdin,stdout from math import * if __name__=="__main__": # for _ in range(int(input().split())): n,m=map(int,input().split()) res=-1 l=(n+1)//2 r=n f=0 for i in range(l,r+1): if i%m==0: print(i) f=1 break if f==0:print(res)
Title: Dreamoon and Stairs Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dreamoon wants to climb up a stair of *n* steps. He can climb 1 or 2 steps at each move. Dreamoon wants the number of moves to be a multiple of an integer *m*. What is the minimal number of moves making him climb to the top of the stairs that satisfies his condition? Input Specification: The single line contains two space separated integers *n*, *m* (0<=&lt;<=*n*<=≤<=10000,<=1<=&lt;<=*m*<=≤<=10). Output Specification: Print a single integer — the minimal number of moves being a multiple of *m*. If there is no way he can climb satisfying condition print <=-<=1 instead. Demo Input: ['10 2\n', '3 5\n'] Demo Output: ['6\n', '-1\n'] Note: For the first sample, Dreamoon could climb in 6 moves with following sequence of steps: {2, 2, 2, 2, 1, 1}. For the second sample, there are only three valid sequence of steps {2, 1}, {1, 2}, {1, 1, 1} with 2, 2, and 3 steps respectively. All these numbers are not multiples of 5.
```python from sys import stdin,stdout from math import * if __name__=="__main__": # for _ in range(int(input().split())): n,m=map(int,input().split()) res=-1 l=(n+1)//2 r=n f=0 for i in range(l,r+1): if i%m==0: print(i) f=1 break if f==0:print(res) ```
3
384
A
Coder
PROGRAMMING
800
[ "implementation" ]
null
null
Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1). Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000).
On the first line print an integer, the maximum number of Coders that can be placed on the chessboard. On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'. If there are multiple correct answers, you can print any.
[ "2\n" ]
[ "2\nC.\n.C\n" ]
none
500
[ { "input": "2", "output": "2\nC.\n.C" }, { "input": "3", "output": "5\nC.C\n.C.\nC.C" }, { "input": "4", "output": "8\nC.C.\n.C.C\nC.C.\n.C.C" }, { "input": "10", "output": "50\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C" }, { "input": "15", "output": "113\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C" }, { "input": "100", "output": "5000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "101", "output": "5101\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "500", "output": "125000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n...." }, { "input": "501", "output": "125501\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n..." }, { "input": "755", "output": "285013\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "888", "output": "394272\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "998", "output": "498002\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "999", "output": "499001\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "1000", "output": "500000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "1", "output": "1\nC" } ]
1,607,490,775
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
0
108
0
n = int(input()) if n%2 == 1: for i in range(1,n+1): for j in range(1,(n+1)//2): if i%2==1: print('C.',end='') else: print('.C',end='') if i%2==0: print('.') else: print('C') else: for i in range(n): for j in range(1,n//2+1): if i%2==1: print('C.',end='') else: print('.C',end='') print('')
Title: Coder Time Limit: None seconds Memory Limit: None megabytes Problem Description: Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1). Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000). Output Specification: On the first line print an integer, the maximum number of Coders that can be placed on the chessboard. On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'. If there are multiple correct answers, you can print any. Demo Input: ['2\n'] Demo Output: ['2\nC.\n.C\n'] Note: none
```python n = int(input()) if n%2 == 1: for i in range(1,n+1): for j in range(1,(n+1)//2): if i%2==1: print('C.',end='') else: print('.C',end='') if i%2==0: print('.') else: print('C') else: for i in range(n): for j in range(1,n//2+1): if i%2==1: print('C.',end='') else: print('.C',end='') print('') ```
0
127
A
Wasted Time
PROGRAMMING
900
[ "geometry" ]
null
null
Mr. Scrooge, a very busy man, decided to count the time he wastes on all sorts of useless stuff to evaluate the lost profit. He has already counted the time he wastes sleeping and eating. And now Mr. Scrooge wants to count the time he has wasted signing papers. Mr. Scrooge's signature can be represented as a polyline *A*1*A*2... *A**n*. Scrooge signs like that: first it places a pen at the point *A*1, then draws a segment from point *A*1 to point *A*2, then he draws a segment from point *A*2 to point *A*3 and so on to point *A**n*, where he stops signing and takes the pen off the paper. At that the resulting line can intersect with itself and partially repeat itself but Scrooge pays no attention to it and never changes his signing style. As Scrooge makes the signature, he never takes the pen off the paper and his writing speed is constant — 50 millimeters per second. Scrooge signed exactly *k* papers throughout his life and all those signatures look the same. Find the total time Scrooge wasted signing the papers.
The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000). Each of the following *n* lines contains the coordinates of the polyline's endpoints. The *i*-th one contains coordinates of the point *A**i* — integers *x**i* and *y**i*, separated by a space. All points *A**i* are different. The absolute value of all coordinates does not exceed 20. The coordinates are measured in millimeters.
Print one real number — the total time Scrooges wastes on signing the papers in seconds. The absolute or relative error should not exceed 10<=-<=6.
[ "2 1\n0 0\n10 0\n", "5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0\n", "6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0\n" ]
[ "0.200000000", "6.032163204", "3.000000000" ]
none
500
[ { "input": "2 1\n0 0\n10 0", "output": "0.200000000" }, { "input": "5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0", "output": "6.032163204" }, { "input": "6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0", "output": "3.000000000" }, { "input": "10 95\n-20 -5\n2 -8\n14 13\n10 3\n17 11\n13 -12\n-6 11\n14 -15\n-13 14\n19 8", "output": "429.309294877" }, { "input": "30 1000\n4 -13\n14 13\n-14 -16\n-9 18\n17 11\n2 -8\n2 15\n8 -1\n-9 13\n8 -12\n-2 20\n11 -12\n19 8\n9 -15\n-20 -5\n-18 20\n-13 14\n-12 -17\n-4 3\n13 -12\n11 -10\n18 7\n-6 11\n10 13\n10 3\n6 -14\n-1 10\n14 -15\n2 11\n-8 10", "output": "13629.282573522" }, { "input": "2 1\n-20 -10\n-10 -6", "output": "0.215406592" }, { "input": "2 13\n13 -10\n-3 -2", "output": "4.651021393" }, { "input": "2 21\n13 8\n14 10", "output": "0.939148551" }, { "input": "2 75\n-3 12\n1 12", "output": "6.000000000" }, { "input": "2 466\n10 16\n-6 -3", "output": "231.503997374" }, { "input": "2 999\n6 16\n-17 -14", "output": "755.286284531" }, { "input": "2 1000\n-17 -14\n-14 -8", "output": "134.164078650" }, { "input": "3 384\n-4 -19\n-17 -2\n3 4", "output": "324.722285390" }, { "input": "5 566\n-11 8\n2 -7\n7 0\n-7 -9\n-7 5", "output": "668.956254495" }, { "input": "7 495\n-10 -13\n-9 -5\n4 9\n8 13\n-4 2\n2 10\n-18 15", "output": "789.212495576" }, { "input": "10 958\n7 13\n20 19\n12 -7\n10 -10\n-13 -15\n-10 -7\n20 -5\n-11 19\n-7 3\n-4 18", "output": "3415.618464093" }, { "input": "13 445\n-15 16\n-8 -14\n8 7\n4 15\n8 -13\n15 -11\n-12 -4\n2 -13\n-5 0\n-20 -14\n-8 -7\n-10 -18\n18 -5", "output": "2113.552527680" }, { "input": "18 388\n11 -8\n13 10\n18 -17\n-15 3\n-13 -15\n20 -7\n1 -10\n-13 -12\n-12 -15\n-17 -8\n1 -2\n3 -20\n-8 -9\n15 -13\n-19 -6\n17 3\n-17 2\n6 6", "output": "2999.497312668" }, { "input": "25 258\n-5 -3\n-18 -14\n12 3\n6 11\n4 2\n-19 -3\n19 -7\n-15 19\n-19 -12\n-11 -10\n-5 17\n10 15\n-4 1\n-3 -20\n6 16\n18 -19\n11 -19\n-17 10\n-17 17\n-2 -17\n-3 -9\n18 13\n14 8\n-2 -5\n-11 4", "output": "2797.756635934" }, { "input": "29 848\n11 -10\n-19 1\n18 18\n19 -19\n0 -5\n16 10\n-20 -14\n7 15\n6 8\n-15 -16\n9 3\n16 -20\n-12 12\n18 -1\n-11 14\n18 10\n11 -20\n-20 -16\n-1 11\n13 10\n-6 13\n-7 -10\n-11 -10\n-10 3\n15 -13\n-4 11\n-13 -11\n-11 -17\n11 -5", "output": "12766.080247922" }, { "input": "36 3\n-11 20\n-11 13\n-17 9\n15 9\n-6 9\n-1 11\n12 -11\n16 -10\n-20 7\n-18 6\n-15 -2\n20 -20\n16 4\n-20 -8\n-12 -15\n-13 -6\n-9 -4\n0 -10\n8 -1\n1 4\n5 8\n8 -15\n16 -12\n19 1\n0 -4\n13 -4\n17 -13\n-7 11\n14 9\n-14 -9\n5 -8\n11 -8\n-17 -5\n1 -3\n-16 -17\n2 -3", "output": "36.467924851" }, { "input": "48 447\n14 9\n9 -17\n-17 11\n-14 14\n19 -8\n-14 -17\n-7 10\n-6 -11\n-9 -19\n19 10\n-4 2\n-5 16\n20 9\n-10 20\n-7 -17\n14 -16\n-2 -10\n-18 -17\n14 12\n-6 -19\n5 -18\n-3 2\n-3 10\n-5 5\n13 -12\n10 -18\n10 -12\n-2 4\n7 -15\n-5 -5\n11 14\n11 10\n-6 -9\n13 -4\n13 9\n6 12\n-13 17\n-9 -12\n14 -19\n10 12\n-15 8\n-1 -11\n19 8\n11 20\n-9 -3\n16 1\n-14 19\n8 -4", "output": "9495.010556306" }, { "input": "50 284\n-17 -13\n7 12\n-13 0\n13 1\n14 6\n14 -9\n-5 -1\n0 -10\n12 -3\n-14 6\n-8 10\n-16 17\n0 -1\n4 -9\n2 6\n1 8\n-8 -14\n3 9\n1 -15\n-4 -19\n-7 -20\n18 10\n3 -11\n10 16\n2 -6\n-9 19\n-3 -1\n20 9\n-12 -5\n-10 -2\n16 -7\n-16 -18\n-2 17\n2 8\n7 -15\n4 1\n6 -17\n19 9\n-10 -20\n5 2\n10 -2\n3 7\n20 0\n8 -14\n-16 -1\n-20 7\n20 -19\n17 18\n-11 -18\n-16 14", "output": "6087.366930474" }, { "input": "57 373\n18 3\n-4 -1\n18 5\n-7 -15\n-6 -10\n-19 1\n20 15\n15 4\n-1 -2\n13 -14\n0 12\n10 3\n-16 -17\n-14 -9\n-11 -10\n17 19\n-2 6\n-12 -15\n10 20\n16 7\n9 -1\n4 13\n8 -2\n-1 -16\n-3 8\n14 11\n-12 3\n-5 -6\n3 4\n5 7\n-9 9\n11 4\n-19 10\n-7 4\n-20 -12\n10 16\n13 11\n13 -11\n7 -1\n17 18\n-19 7\n14 13\n5 -1\n-7 6\n-1 -6\n6 20\n-16 2\n4 17\n16 -11\n-4 -20\n19 -18\n17 16\n-14 -8\n3 2\n-6 -16\n10 -10\n-13 -11", "output": "8929.162822862" }, { "input": "60 662\n15 17\n-2 -19\n-4 -17\n10 0\n15 10\n-8 -14\n14 9\n-15 20\n6 5\n-9 0\n-13 20\n13 -2\n10 9\n7 5\n4 18\n-10 1\n6 -15\n15 -16\n6 13\n4 -6\n2 5\n18 19\n8 3\n-7 14\n-12 -20\n14 19\n-15 0\n-2 -12\n9 18\n14 4\n2 -20\n3 0\n20 9\n-5 11\n-11 1\n2 -19\n-14 -4\n18 6\n16 16\n15 3\n-1 -5\n9 20\n12 -8\n-1 10\n-4 -9\n3 6\n3 -12\n14 -10\n-8 10\n-18 6\n14 -2\n-14 -12\n-10 -7\n10 -6\n14 1\n6 14\n15 19\n4 14\n3 -14\n-9 -13", "output": "16314.207721932" }, { "input": "61 764\n-9 15\n11 -8\n-6 -7\n-13 -19\n16 -16\n-5 -1\n20 -19\n-14 -1\n-11 4\n7 -2\n-3 2\n-14 -17\n15 18\n20 15\n-13 -2\n15 8\n3 13\n19 -10\n2 -6\n15 -3\n-12 11\n4 -16\n-14 20\n0 2\n11 -7\n-6 -11\n16 7\n8 -3\n16 -10\n-3 9\n9 5\n4 -1\n-17 9\n14 -4\n8 6\n-19 12\n10 -17\n-5 7\n7 -3\n5 3\n6 -14\n9 9\n-16 -19\n11 -16\n-17 15\n8 5\n16 -19\n-7 10\n14 -15\n15 19\n-20 -16\n6 -2\n-4 6\n7 -15\n1 -8\n20 -17\n3 7\n10 12\n10 -11\n-19 10\n0 -11", "output": "22153.369189802" } ]
1,690,627,816
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
1
124
0
from math import sqrt n, k = [int(i) for i in input().split()] length = 0 x, y = [int(i) for i in input().split()] x1, y1 = 0, 0 for i in range(n - 1): x1, y1 = [int(i) for i in input().split()] length += (sqrt((x1 - x) ** 2 + (y1 - y1) ** 2)) / 50 x, y = x1, y1 print(length * k)
Title: Wasted Time Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mr. Scrooge, a very busy man, decided to count the time he wastes on all sorts of useless stuff to evaluate the lost profit. He has already counted the time he wastes sleeping and eating. And now Mr. Scrooge wants to count the time he has wasted signing papers. Mr. Scrooge's signature can be represented as a polyline *A*1*A*2... *A**n*. Scrooge signs like that: first it places a pen at the point *A*1, then draws a segment from point *A*1 to point *A*2, then he draws a segment from point *A*2 to point *A*3 and so on to point *A**n*, where he stops signing and takes the pen off the paper. At that the resulting line can intersect with itself and partially repeat itself but Scrooge pays no attention to it and never changes his signing style. As Scrooge makes the signature, he never takes the pen off the paper and his writing speed is constant — 50 millimeters per second. Scrooge signed exactly *k* papers throughout his life and all those signatures look the same. Find the total time Scrooge wasted signing the papers. Input Specification: The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000). Each of the following *n* lines contains the coordinates of the polyline's endpoints. The *i*-th one contains coordinates of the point *A**i* — integers *x**i* and *y**i*, separated by a space. All points *A**i* are different. The absolute value of all coordinates does not exceed 20. The coordinates are measured in millimeters. Output Specification: Print one real number — the total time Scrooges wastes on signing the papers in seconds. The absolute or relative error should not exceed 10<=-<=6. Demo Input: ['2 1\n0 0\n10 0\n', '5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0\n', '6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0\n'] Demo Output: ['0.200000000', '6.032163204', '3.000000000'] Note: none
```python from math import sqrt n, k = [int(i) for i in input().split()] length = 0 x, y = [int(i) for i in input().split()] x1, y1 = 0, 0 for i in range(n - 1): x1, y1 = [int(i) for i in input().split()] length += (sqrt((x1 - x) ** 2 + (y1 - y1) ** 2)) / 50 x, y = x1, y1 print(length * k) ```
0
44
A
Indian Summer
PROGRAMMING
900
[ "implementation" ]
A. Indian Summer
2
256
Indian summer is such a beautiful time of the year! A girl named Alyona is walking in the forest and picking a bouquet from fallen leaves. Alyona is very choosy — she doesn't take a leaf if it matches the color and the species of the tree of one of the leaves she already has. Find out how many leaves Alyona has picked.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of leaves Alyona has found. The next *n* lines contain the leaves' descriptions. Each leaf is characterized by the species of the tree it has fallen from and by the color. The species of the trees and colors are given in names, consisting of no more than 10 lowercase Latin letters. A name can not be an empty string. The species of a tree and the color are given in each line separated by a space.
Output the single number — the number of Alyona's leaves.
[ "5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green\n", "3\noak yellow\noak yellow\noak yellow\n" ]
[ "4\n", "1\n" ]
none
0
[ { "input": "5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green", "output": "4" }, { "input": "3\noak yellow\noak yellow\noak yellow", "output": "1" }, { "input": "5\nxbnbkzn hp\nkaqkl vrgzbvqstu\nj aqidx\nhos gyul\nwefxmh tygpluae", "output": "5" }, { "input": "1\nqvwli hz", "output": "1" }, { "input": "4\nsrhk x\nsrhk x\nqfoe vnrjuab\nqfoe vnrjuab", "output": "2" }, { "input": "4\nsddqllmmpk syded\nfprsq fnenjnaz\nn hdej\nsddqllmmpk syded", "output": "3" }, { "input": "17\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw", "output": "1" }, { "input": "18\nb d\nrfdb esp\nrfdb esp\nb d\nrfdb esp\nrfdb esp\nb d\nb d\nrfdb esp\nrfdb esp\nb d\nrfdb esp\nb d\nrfdb esp\nb d\nb d\nrfdb esp\nrfdb esp", "output": "2" }, { "input": "13\nsvpzwtwn rykzfdce\nqweiyeck jkreouy\nhk nnli\ntwxrnbbdt vtuv\nxokqjtylly sz\nesdt dbfidjslq\ng ybqgomvw\nxcpfjmf zcqvz\nifajadhj invzueip\nvdemdnxifb hckwebmi\nsdpnhipam wvowzavh\nuqdlfskhgo vunbpghae\ne dtigwnb", "output": "13" }, { "input": "20\nm vkfh\nvptikamead mvx\nitu mf\nklruxckw aqega\nekqkd enjllwol\ncc uybfdh\nimrfdngvo u\ne uh\ntwt jsslcfuogk\nbljwqsag tuqbdn\nqcv q\nasx gzhvwwmajj\nqcv q\nekqkd enjllwol\nasx gzhvwwmajj\nks vv\nkzyfi cn\ncc uybfdh\nitu mf\ncjbjhtbyvk vatwfmux", "output": "15" }, { "input": "2\nab ab\na bab", "output": "2" } ]
1,610,356,451
2,147,483,647
Python 3
OK
TESTS
29
154
0
a = [] for x in range(int(input())): b = input() if b not in a: a.append(b) print(len(a))
Title: Indian Summer Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Indian summer is such a beautiful time of the year! A girl named Alyona is walking in the forest and picking a bouquet from fallen leaves. Alyona is very choosy — she doesn't take a leaf if it matches the color and the species of the tree of one of the leaves she already has. Find out how many leaves Alyona has picked. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of leaves Alyona has found. The next *n* lines contain the leaves' descriptions. Each leaf is characterized by the species of the tree it has fallen from and by the color. The species of the trees and colors are given in names, consisting of no more than 10 lowercase Latin letters. A name can not be an empty string. The species of a tree and the color are given in each line separated by a space. Output Specification: Output the single number — the number of Alyona's leaves. Demo Input: ['5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green\n', '3\noak yellow\noak yellow\noak yellow\n'] Demo Output: ['4\n', '1\n'] Note: none
```python a = [] for x in range(int(input())): b = input() if b not in a: a.append(b) print(len(a)) ```
3.9615
939
A
Love Triangle
PROGRAMMING
800
[ "graphs" ]
null
null
As you could know there are no male planes nor female planes. However, each plane on Earth likes some other plane. There are *n* planes on Earth, numbered from 1 to *n*, and the plane with number *i* likes the plane with number *f**i*, where 1<=≤<=*f**i*<=≤<=*n* and *f**i*<=≠<=*i*. We call a love triangle a situation in which plane *A* likes plane *B*, plane *B* likes plane *C* and plane *C* likes plane *A*. Find out if there is any love triangle on Earth.
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=5000) — the number of planes. The second line contains *n* integers *f*1,<=*f*2,<=...,<=*f**n* (1<=≤<=*f**i*<=≤<=*n*, *f**i*<=≠<=*i*), meaning that the *i*-th plane likes the *f**i*-th.
Output «YES» if there is a love triangle consisting of planes on Earth. Otherwise, output «NO». You can output any letter in lower case or in upper case.
[ "5\n2 4 5 1 3\n", "5\n5 5 5 5 1\n" ]
[ "YES\n", "NO\n" ]
In first example plane 2 likes plane 4, plane 4 likes plane 1, plane 1 likes plane 2 and that is a love triangle. In second example there are no love triangles.
500
[ { "input": "5\n2 4 5 1 3", "output": "YES" }, { "input": "5\n5 5 5 5 1", "output": "NO" }, { "input": "3\n3 1 2", "output": "YES" }, { "input": "10\n4 10 9 5 3 1 5 10 6 4", "output": "NO" }, { "input": "10\n5 5 4 9 10 9 9 5 3 1", "output": "YES" }, { "input": "100\n50 40 60 87 39 58 44 84 46 68 16 57 77 87 92 95 42 31 74 15 36 84 30 3 47 15 87 90 76 66 6 63 74 19 40 49 6 84 41 9 77 34 7 12 11 73 58 24 81 14 81 29 65 100 1 85 64 32 38 4 54 67 32 81 80 7 100 71 29 80 4 52 47 7 78 56 52 75 81 37 16 41 27 28 58 60 62 47 29 40 37 14 59 91 12 54 25 58 12 43", "output": "NO" }, { "input": "100\n25 6 46 37 87 99 70 31 46 12 94 40 87 56 28 8 94 39 13 12 67 13 71 39 83 48 40 14 62 41 16 71 20 41 83 41 68 98 23 82 62 83 62 35 49 22 31 21 66 98 54 39 34 52 11 28 47 89 25 44 68 36 91 46 82 86 88 48 27 93 7 9 53 36 16 100 84 84 44 25 58 66 16 46 72 21 91 78 4 17 44 17 47 67 93 89 75 44 56 50", "output": "YES" }, { "input": "2\n2 1", "output": "NO" }, { "input": "3\n2 3 1", "output": "YES" }, { "input": "5\n2 1 4 5 3", "output": "YES" }, { "input": "5\n5 4 5 5 2", "output": "YES" } ]
1,670,907,489
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
5
31
0
n=int(input()) f=input() f=f.split() for i in range(n): f[i]=int(f[i]) g=[] for i in range(n): g.append(0) oldsum=0 three=False while 0 in g: i=g.index(0) if g[i]==0: #print("We analyze Plane {}".format(i+1)) #print("Plane {} likes Plane {}".format(i+1,f[i])) g[i]=1 i=f[i]-1 while g[i]!=1: #print("Plane {} likes Plane {}".format(i+1,f[i])) g[i]=1 i=f[i]-1 #print(g) else: #print("We skip Plane {}".format(i+1)) pass newsum=sum(g) if newsum-oldsum==3: three=True break else: oldsum=newsum if three: print("YES") else: print("NO")
Title: Love Triangle Time Limit: None seconds Memory Limit: None megabytes Problem Description: As you could know there are no male planes nor female planes. However, each plane on Earth likes some other plane. There are *n* planes on Earth, numbered from 1 to *n*, and the plane with number *i* likes the plane with number *f**i*, where 1<=≤<=*f**i*<=≤<=*n* and *f**i*<=≠<=*i*. We call a love triangle a situation in which plane *A* likes plane *B*, plane *B* likes plane *C* and plane *C* likes plane *A*. Find out if there is any love triangle on Earth. Input Specification: The first line contains a single integer *n* (2<=≤<=*n*<=≤<=5000) — the number of planes. The second line contains *n* integers *f*1,<=*f*2,<=...,<=*f**n* (1<=≤<=*f**i*<=≤<=*n*, *f**i*<=≠<=*i*), meaning that the *i*-th plane likes the *f**i*-th. Output Specification: Output «YES» if there is a love triangle consisting of planes on Earth. Otherwise, output «NO». You can output any letter in lower case or in upper case. Demo Input: ['5\n2 4 5 1 3\n', '5\n5 5 5 5 1\n'] Demo Output: ['YES\n', 'NO\n'] Note: In first example plane 2 likes plane 4, plane 4 likes plane 1, plane 1 likes plane 2 and that is a love triangle. In second example there are no love triangles.
```python n=int(input()) f=input() f=f.split() for i in range(n): f[i]=int(f[i]) g=[] for i in range(n): g.append(0) oldsum=0 three=False while 0 in g: i=g.index(0) if g[i]==0: #print("We analyze Plane {}".format(i+1)) #print("Plane {} likes Plane {}".format(i+1,f[i])) g[i]=1 i=f[i]-1 while g[i]!=1: #print("Plane {} likes Plane {}".format(i+1,f[i])) g[i]=1 i=f[i]-1 #print(g) else: #print("We skip Plane {}".format(i+1)) pass newsum=sum(g) if newsum-oldsum==3: three=True break else: oldsum=newsum if three: print("YES") else: print("NO") ```
0
437
A
The Child and Homework
PROGRAMMING
1,300
[ "implementation" ]
null
null
Once upon a time a child got a test consisting of multiple-choice questions as homework. A multiple-choice question consists of four choices: A, B, C and D. Each choice has a description, and the child should find out the only one that is correct. Fortunately the child knows how to solve such complicated test. The child will follow the algorithm: - If there is some choice whose description at least twice shorter than all other descriptions, or at least twice longer than all other descriptions, then the child thinks the choice is great. - If there is exactly one great choice then the child chooses it. Otherwise the child chooses C (the child think it is the luckiest choice). You are given a multiple-choice questions, can you predict child's choose?
The first line starts with "A." (without quotes), then followed the description of choice A. The next three lines contains the descriptions of the other choices in the same format. They are given in order: B, C, D. Please note, that the description goes after prefix "X.", so the prefix mustn't be counted in description's length. Each description is non-empty and consists of at most 100 characters. Each character can be either uppercase English letter or lowercase English letter, or "_".
Print a single line with the child's choice: "A", "B", "C" or "D" (without quotes).
[ "A.VFleaKing_is_the_author_of_this_problem\nB.Picks_is_the_author_of_this_problem\nC.Picking_is_the_author_of_this_problem\nD.Ftiasch_is_cute\n", "A.ab\nB.abcde\nC.ab\nD.abc\n", "A.c\nB.cc\nC.c\nD.c\n" ]
[ "D\n", "C\n", "B\n" ]
In the first sample, the first choice has length 39, the second one has length 35, the third one has length 37, and the last one has length 15. The choice D (length 15) is twice shorter than all other choices', so it is great choice. There is no other great choices so the child will choose D. In the second sample, no choice is great, so the child will choose the luckiest choice C. In the third sample, the choice B (length 2) is twice longer than all other choices', so it is great choice. There is no other great choices so the child will choose B.
500
[ { "input": "A.VFleaKing_is_the_author_of_this_problem\nB.Picks_is_the_author_of_this_problem\nC.Picking_is_the_author_of_this_problem\nD.Ftiasch_is_cute", "output": "D" }, { "input": "A.ab\nB.abcde\nC.ab\nD.abc", "output": "C" }, { "input": "A.c\nB.cc\nC.c\nD.c", "output": "B" }, { "input": "A.He_nan_de_yang_guang_zhao_yao_zhe_wo_men_mei_guo_ren_lian_shang_dou_xiao_kai_yan_wahaaaaaaaaaaaaaaaa\nB.Li_bai_li_bai_fei_liu_zhi_xia_san_qian_chi_yi_si_yin_he_luo_jiu_tian_li_bai_li_bai_li_bai_li_bai_shi\nC.Peng_yu_xiang_shi_zai_tai_shen_le_jian_zhi_jiu_shi_ye_jie_du_liu_a_si_mi_da_zhen_shi_tai_shen_le_a_a\nD.Wo_huo_le_si_shi_er_nian_zhen_de_shi_cong_lai_ye_mei_you_jian_guo_zhe_me_biao_zhun_de_yi_bai_ge_zi_a", "output": "C" }, { "input": "A.a___FXIcs_gB____dxFFzst_p_P_Xp_vS__cS_C_ei_\nB.fmnmkS_SeZYx_tSys_d__Exbojv_a_YPEL_BPj__I_aYH\nC._nrPx_j\nD.o_A_UwmNbC_sZ_AXk_Y___i_SN_U_UxrBN_qo_____", "output": "C" }, { "input": "A.G_R__iT_ow_Y__Sm_al__u_____l_ltK\nB.CWRe__h__cbCF\nC._QJ_dVHCL_g_WBsMO__LC____hMNE_DoO__xea_ec\nD.___Zh_", "output": "D" }, { "input": "A.a___FXIcs_gB____dxFFzst_p_P_Xp_vS__cS_C_ei_\nB.fmnmkS_SeZYx_tSys_d__Exbojv_a_YPEL_BPj__I_aYH\nC._nrPx_j\nD.o_A_UwmNbC_sZ_AXk_Y___i_SN_U_UxrBN_qo_____", "output": "C" }, { "input": "A.G_R__iT_ow_Y__Sm_al__u_____l_ltK\nB.CWRe__h__cbCF\nC._QJ_dVHCL_g_WBsMO__LC____hMNE_DoO__xea_ec\nD.___Zh_", "output": "D" }, { "input": "A.ejQ_E_E_G_e_SDjZ__lh_f_K__Z_i_B_U__S__S_EMD_ZEU_Sq\nB.o_JpInEdsrAY_T__D_S\nC.E_Vp_s\nD.a_AU_h", "output": "A" }, { "input": "A.PN_m_P_qgOAMwDyxtbH__Yc__bPOh_wYH___n_Fv_qlZp_\nB._gLeDU__rr_vjrm__O_jl_R__DG___u_XqJjW_\nC.___sHLQzdTzT_tZ_Gs\nD.sZNcVa__M_To_bz_clFi_mH_", "output": "C" }, { "input": "A.bR___cCYJg_Wbt____cxfXfC____c_O_\nB.guM\nC.__bzsH_Of__RjG__u_w_i__PXQL_U_Ow_U_n\nD._nHIuZsu_uU_stRC_k___vD_ZOD_u_z_c_Zf__p_iF_uD_Hdg", "output": "B" }, { "input": "A.x_\nB.__RSiDT_\nC.Ci\nD.KLY_Hc_YN_xXg_DynydumheKTw_PFHo_vqXwm_DY_dA___OS_kG___", "output": "D" }, { "input": "A.yYGJ_C__NYq_\nB.ozMUZ_cKKk_zVUPR_b_g_ygv_HoM__yAxvh__iE\nC.sgHJ___MYP__AWejchRvjSD_o\nD.gkfF_GiOqW_psMT_eS", "output": "C" }, { "input": "A._LYm_nvl_E__RCFZ_IdO\nB.k__qIPO_ivvZyIG__L_\nC.D_SabLm_R___j_HS_t__\nD._adj_R_ngix____GSe_aw__SbOOl_", "output": "C" }, { "input": "A.h_WiYTD_C_h___z_Gn_Th_uNh__g___jm\nB.__HeQaudCJcYfVi__Eg_vryuQrDkb_g__oy_BwX_Mu_\nC._MChdMhQA_UKrf_LGZk_ALTo_mnry_GNNza_X_D_u____ueJb__Y_h__CNUNDfmZATck_ad_XTbG\nD.NV___OoL__GfP_CqhD__RB_____v_T_xi", "output": "C" }, { "input": "A.____JGWsfiU\nB.S_LMq__MpE_oFBs_P\nC.U_Rph_VHpUr____X_jWXbk__ElJTu_Z_wlBpKLTD\nD.p_ysvPNmbrF__", "output": "C" }, { "input": "A.ejQ_E_E_G_e_SDjZ__lh_f_K__Z_i_B_U__S__S_EMD_ZEU_Sq\nB.o_JpInEdsrAY_T__D_S\nC.E_Vp_s\nD.a_AU_h", "output": "A" }, { "input": "A.PN_m_P_qgOAMwDyxtbH__Yc__bPOh_wYH___n_Fv_qlZp_\nB._gLeDU__rr_vjrm__O_jl_R__DG___u_XqJjW_\nC.___sHLQzdTzT_tZ_Gs\nD.sZNcVa__M_To_bz_clFi_mH_", "output": "C" }, { "input": "A.bR___cCYJg_Wbt____cxfXfC____c_O_\nB.guM\nC.__bzsH_Of__RjG__u_w_i__PXQL_U_Ow_U_n\nD._nHIuZsu_uU_stRC_k___vD_ZOD_u_z_c_Zf__p_iF_uD_Hdg", "output": "B" }, { "input": "A.x_\nB.__RSiDT_\nC.Ci\nD.KLY_Hc_YN_xXg_DynydumheKTw_PFHo_vqXwm_DY_dA___OS_kG___", "output": "D" }, { "input": "A.yYGJ_C__NYq_\nB.ozMUZ_cKKk_zVUPR_b_g_ygv_HoM__yAxvh__iE\nC.sgHJ___MYP__AWejchRvjSD_o\nD.gkfF_GiOqW_psMT_eS", "output": "C" }, { "input": "A._LYm_nvl_E__RCFZ_IdO\nB.k__qIPO_ivvZyIG__L_\nC.D_SabLm_R___j_HS_t__\nD._adj_R_ngix____GSe_aw__SbOOl_", "output": "C" }, { "input": "A.h_WiYTD_C_h___z_Gn_Th_uNh__g___jm\nB.__HeQaudCJcYfVi__Eg_vryuQrDkb_g__oy_BwX_Mu_\nC._MChdMhQA_UKrf_LGZk_ALTo_mnry_GNNza_X_D_u____ueJb__Y_h__CNUNDfmZATck_ad_XTbG\nD.NV___OoL__GfP_CqhD__RB_____v_T_xi", "output": "C" }, { "input": "A.____JGWsfiU\nB.S_LMq__MpE_oFBs_P\nC.U_Rph_VHpUr____X_jWXbk__ElJTu_Z_wlBpKLTD\nD.p_ysvPNmbrF__", "output": "C" }, { "input": "A.aaaaaa\nB.aaa\nC.aaa\nD.aaa", "output": "A" }, { "input": "A.aaa\nB.aaaaaa\nC.aaaaaa\nD.aaaaaa", "output": "A" }, { "input": "A.a\nB.b\nC.c\nD.d", "output": "C" }, { "input": "A._\nB.__\nC.____\nD.________", "output": "C" }, { "input": "A.____\nB.________\nC.________\nD._______", "output": "C" }, { "input": "A.h\nB.asdf\nC.asqw\nD.qwertasdfg", "output": "C" }, { "input": "A.aa\nB.aaaaa\nC.aaaaaa\nD.aaaaaaaaaaaaa", "output": "C" }, { "input": "A.ccc\nB.ccccccc\nC.ccc\nD.c", "output": "C" }, { "input": "A.c\nB.ccc\nC.cccccccccccccccccc\nD.cccccc", "output": "C" }, { "input": "A.aa\nB.bb\nC.cc\nD.ddd", "output": "C" }, { "input": "A.QW\nB.WERT\nC.QWER\nD.QWERTYUI", "output": "C" } ]
1,583,434,358
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
27
155
0
import math #q=int(input()) q=1 for _ in range(q): s1=input() s2=input() s3=input() s4=input() l1=len(s1)-2 l2=len(s2)-2 l3=len(s3)-2 l4=len(s4)-2 if (l1>=2*l2 and l1>=2*l3 and l1>=2*l4) or (l1<=l2//2 and l1<=l3//2 and l1<=l4//2): print("A") elif (l2>=2*l1 and l2>=2*l3 and l2>=2*l4) or (l2<=l1//2 and l2<=l3//2 and l2<=l4//2): print("B") elif (l3>=2*l2 and l3>=2*l1 and l3>=2*l4) or (l3<=l2//2 and l3<=l1//2 and l3<=l4//2): print("C") elif (l4>=2*l2 and l4>=2*l3 and l4>=2*l1) or (l4<=l2//2 and l4<=l3//2 and l4<=l1//2): print("D") else: print("C")
Title: The Child and Homework Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once upon a time a child got a test consisting of multiple-choice questions as homework. A multiple-choice question consists of four choices: A, B, C and D. Each choice has a description, and the child should find out the only one that is correct. Fortunately the child knows how to solve such complicated test. The child will follow the algorithm: - If there is some choice whose description at least twice shorter than all other descriptions, or at least twice longer than all other descriptions, then the child thinks the choice is great. - If there is exactly one great choice then the child chooses it. Otherwise the child chooses C (the child think it is the luckiest choice). You are given a multiple-choice questions, can you predict child's choose? Input Specification: The first line starts with "A." (without quotes), then followed the description of choice A. The next three lines contains the descriptions of the other choices in the same format. They are given in order: B, C, D. Please note, that the description goes after prefix "X.", so the prefix mustn't be counted in description's length. Each description is non-empty and consists of at most 100 characters. Each character can be either uppercase English letter or lowercase English letter, or "_". Output Specification: Print a single line with the child's choice: "A", "B", "C" or "D" (without quotes). Demo Input: ['A.VFleaKing_is_the_author_of_this_problem\nB.Picks_is_the_author_of_this_problem\nC.Picking_is_the_author_of_this_problem\nD.Ftiasch_is_cute\n', 'A.ab\nB.abcde\nC.ab\nD.abc\n', 'A.c\nB.cc\nC.c\nD.c\n'] Demo Output: ['D\n', 'C\n', 'B\n'] Note: In the first sample, the first choice has length 39, the second one has length 35, the third one has length 37, and the last one has length 15. The choice D (length 15) is twice shorter than all other choices', so it is great choice. There is no other great choices so the child will choose D. In the second sample, no choice is great, so the child will choose the luckiest choice C. In the third sample, the choice B (length 2) is twice longer than all other choices', so it is great choice. There is no other great choices so the child will choose B.
```python import math #q=int(input()) q=1 for _ in range(q): s1=input() s2=input() s3=input() s4=input() l1=len(s1)-2 l2=len(s2)-2 l3=len(s3)-2 l4=len(s4)-2 if (l1>=2*l2 and l1>=2*l3 and l1>=2*l4) or (l1<=l2//2 and l1<=l3//2 and l1<=l4//2): print("A") elif (l2>=2*l1 and l2>=2*l3 and l2>=2*l4) or (l2<=l1//2 and l2<=l3//2 and l2<=l4//2): print("B") elif (l3>=2*l2 and l3>=2*l1 and l3>=2*l4) or (l3<=l2//2 and l3<=l1//2 and l3<=l4//2): print("C") elif (l4>=2*l2 and l4>=2*l3 and l4>=2*l1) or (l4<=l2//2 and l4<=l3//2 and l4<=l1//2): print("D") else: print("C") ```
0
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,593,472,089
2,147,483,647
PyPy 3
OK
TESTS
30
310
20,172,800
s = input() a = s.lower() b = s.upper() cnt1, cnt2 = 0, 0 for i in range(len(s)): if s[i] != a[i]: cnt1 -= -1 if s[i] != b[i]: cnt2 -= -1 if cnt1 > cnt2: print(b) else: print(a)
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python s = input() a = s.lower() b = s.upper() cnt1, cnt2 = 0, 0 for i in range(len(s)): if s[i] != a[i]: cnt1 -= -1 if s[i] != b[i]: cnt2 -= -1 if cnt1 > cnt2: print(b) else: print(a) ```
3.884925
10
A
Power Consumption Calculation
PROGRAMMING
900
[ "implementation" ]
A. Power Consumption Calculation
1
256
Tom is interested in power consumption of his favourite laptop. His laptop has three modes. In normal mode laptop consumes *P*1 watt per minute. *T*1 minutes after Tom moved the mouse or touched the keyboard for the last time, a screensaver starts and power consumption changes to *P*2 watt per minute. Finally, after *T*2 minutes from the start of the screensaver, laptop switches to the "sleep" mode and consumes *P*3 watt per minute. If Tom moves the mouse or touches the keyboard when the laptop is in the second or in the third mode, it switches to the first (normal) mode. Tom's work with the laptop can be divided into *n* time periods [*l*1,<=*r*1],<=[*l*2,<=*r*2],<=...,<=[*l**n*,<=*r**n*]. During each interval Tom continuously moves the mouse and presses buttons on the keyboard. Between the periods Tom stays away from the laptop. Find out the total amount of power consumed by the laptop during the period [*l*1,<=*r**n*].
The first line contains 6 integer numbers *n*, *P*1, *P*2, *P*3, *T*1, *T*2 (1<=≤<=*n*<=≤<=100,<=0<=≤<=*P*1,<=*P*2,<=*P*3<=≤<=100,<=1<=≤<=*T*1,<=*T*2<=≤<=60). The following *n* lines contain description of Tom's work. Each *i*-th of these lines contains two space-separated integers *l**i* and *r**i* (0<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=1440, *r**i*<=&lt;<=*l**i*<=+<=1 for *i*<=&lt;<=*n*), which stand for the start and the end of the *i*-th period of work.
Output the answer to the problem.
[ "1 3 2 1 5 10\n0 10\n", "2 8 4 2 5 10\n20 30\n50 100\n" ]
[ "30", "570" ]
none
0
[ { "input": "1 3 2 1 5 10\n0 10", "output": "30" }, { "input": "2 8 4 2 5 10\n20 30\n50 100", "output": "570" }, { "input": "3 15 9 95 39 19\n873 989\n1003 1137\n1172 1436", "output": "8445" }, { "input": "4 73 2 53 58 16\n51 52\n209 242\n281 407\n904 945", "output": "52870" }, { "input": "5 41 20 33 43 4\n46 465\n598 875\n967 980\n1135 1151\n1194 1245", "output": "46995" }, { "input": "6 88 28 100 53 36\n440 445\n525 614\n644 844\n1238 1261\n1305 1307\n1425 1434", "output": "85540" }, { "input": "7 46 61 55 28 59\n24 26\n31 61\n66 133\n161 612\n741 746\n771 849\n1345 1357", "output": "67147" }, { "input": "8 83 18 30 28 5\n196 249\n313 544\n585 630\n718 843\n1040 1194\n1207 1246\n1268 1370\n1414 1422", "output": "85876" }, { "input": "9 31 65 27 53 54\n164 176\n194 210\n485 538\n617 690\n875 886\n888 902\n955 957\n1020 1200\n1205 1282", "output": "38570" }, { "input": "30 3 1 58 44 7\n11 13\n14 32\n37 50\n70 74\n101 106\n113 129\n184 195\n197 205\n213 228\n370 394\n443 446\n457 460\n461 492\n499 585\n602 627\n709 776\n812 818\n859 864\n910 913\n918 964\n1000 1010\n1051 1056\n1063 1075\n1106 1145\n1152 1189\n1211 1212\n1251 1259\n1272 1375\n1412 1417\n1430 1431", "output": "11134" }, { "input": "30 42 3 76 28 26\n38 44\n55 66\n80 81\n84 283\n298 314\n331 345\n491 531\n569 579\n597 606\n612 617\n623 701\n723 740\n747 752\n766 791\n801 827\n842 846\n853 891\n915 934\n945 949\n955 964\n991 1026\n1051 1059\n1067 1179\n1181 1191\n1214 1226\n1228 1233\n1294 1306\n1321 1340\n1371 1374\n1375 1424", "output": "59043" }, { "input": "30 46 5 93 20 46\n12 34\n40 41\n54 58\n100 121\n162 182\n220 349\n358 383\n390 398\n401 403\n408 409\n431 444\n466 470\n471 535\n556 568\n641 671\n699 709\n767 777\n786 859\n862 885\n912 978\n985 997\n1013 1017\n1032 1038\n1047 1048\n1062 1080\n1094 1097\n1102 1113\n1122 1181\n1239 1280\n1320 1369", "output": "53608" }, { "input": "30 50 74 77 4 57\n17 23\n24 61\n67 68\n79 87\n93 101\n104 123\n150 192\n375 377\n398 414\n461 566\n600 633\n642 646\n657 701\n771 808\n812 819\n823 826\n827 833\n862 875\n880 891\n919 920\n928 959\n970 1038\n1057 1072\n1074 1130\n1165 1169\n1171 1230\n1265 1276\n1279 1302\n1313 1353\n1354 1438", "output": "84067" }, { "input": "30 54 76 95 48 16\n9 11\n23 97\n112 116\n126 185\n214 223\n224 271\n278 282\n283 348\n359 368\n373 376\n452 463\n488 512\n532 552\n646 665\n681 685\n699 718\n735 736\n750 777\n791 810\n828 838\n841 858\n874 1079\n1136 1171\n1197 1203\n1210 1219\n1230 1248\n1280 1292\n1324 1374\n1397 1435\n1438 1439", "output": "79844" }, { "input": "30 58 78 12 41 28\n20 26\n27 31\n35 36\n38 99\n103 104\n106 112\n133 143\n181 246\n248 251\n265 323\n350 357\n378 426\n430 443\n466 476\n510 515\n517 540\n542 554\n562 603\n664 810\n819 823\n826 845\n869 895\n921 973\n1002 1023\n1102 1136\n1143 1148\n1155 1288\n1316 1388\n1394 1403\n1434 1437", "output": "82686" }, { "input": "30 62 80 97 25 47\n19 20\n43 75\n185 188\n199 242\n252 258\n277 310\n316 322\n336 357\n398 399\n404 436\n443 520\n549 617\n637 649\n679 694\n705 715\n725 730\n731 756\n768 793\n806 833\n834 967\n1003 1079\n1088 1097\n1100 1104\n1108 1121\n1127 1164\n1240 1263\n1274 1307\n1367 1407\n1419 1425\n1433 1437", "output": "92356" }, { "input": "30 100 48 14 9 7\n26 55\n75 107\n145 146\n158 167\n197 199\n201 213\n222 238\n257 265\n271 338\n357 439\n454 462\n463 562\n633 660\n670 691\n696 829\n844 864\n880 888\n891 894\n895 900\n950 973\n1004 1007\n1018 1021\n1045 1049\n1062 1073\n1138 1184\n1240 1272\n1278 1315\n1403 1410\n1412 1418\n1426 1434", "output": "107490" }, { "input": "30 3 50 32 1 18\n46 60\n66 94\n99 141\n162 239\n309 334\n400 550\n594 630\n659 663\n664 701\n735 736\n741 755\n756 801\n823 854\n865 915\n937 964\n984 986\n990 1007\n1008 1031\n1052 1064\n1073 1080\n1190 1191\n1192 1254\n1265 1266\n1272 1273\n1274 1277\n1284 1302\n1308 1312\n1358 1383\n1388 1389\n1390 1401", "output": "25258" }, { "input": "30 7 52 49 46 37\n2 73\n129 130\n131 140\n143 150\n187 190\n217 238\n248 271\n375 426\n465 470\n475 503\n506 541\n569 571\n578 585\n680 683\n690 738\n742 761\n868 877\n890 892\n904 915\n935 961\n1076 1100\n1103 1114\n1232 1244\n1246 1247\n1257 1261\n1271 1276\n1280 1298\n1346 1360\n1373 1382\n1407 1419", "output": "23992" } ]
1,686,906,827
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
30
0
# LUOGU_RID: 112788373 n,P1,P2,P3,T1,T2 = map(int,input().split()) count = 0 end_time = 0 for i in range(n): if i == 0: start,end = map(int,input().split()) count+=(start-end_time)*P3+(end-start)*P1 end_time = end else: start,end = map(int,input().split()) '''下面的判断是在计算两组操作之间花费的时间''' if start-end_time <=T1: count+=(start-end_time)*P1 elif T1<start-end_time<=T2: count+=(start-end_time)*P1+(start-end_time-T1)*P2 else: count+=(start-end_time)*P1+(start-end_time-T1)*P2+(start-end_time-T1-T2)*P3 '''开始计算操作期间花费的时间''' count+=(end-start)*P1 end_time = end print(count)
Title: Power Consumption Calculation Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Tom is interested in power consumption of his favourite laptop. His laptop has three modes. In normal mode laptop consumes *P*1 watt per minute. *T*1 minutes after Tom moved the mouse or touched the keyboard for the last time, a screensaver starts and power consumption changes to *P*2 watt per minute. Finally, after *T*2 minutes from the start of the screensaver, laptop switches to the "sleep" mode and consumes *P*3 watt per minute. If Tom moves the mouse or touches the keyboard when the laptop is in the second or in the third mode, it switches to the first (normal) mode. Tom's work with the laptop can be divided into *n* time periods [*l*1,<=*r*1],<=[*l*2,<=*r*2],<=...,<=[*l**n*,<=*r**n*]. During each interval Tom continuously moves the mouse and presses buttons on the keyboard. Between the periods Tom stays away from the laptop. Find out the total amount of power consumed by the laptop during the period [*l*1,<=*r**n*]. Input Specification: The first line contains 6 integer numbers *n*, *P*1, *P*2, *P*3, *T*1, *T*2 (1<=≤<=*n*<=≤<=100,<=0<=≤<=*P*1,<=*P*2,<=*P*3<=≤<=100,<=1<=≤<=*T*1,<=*T*2<=≤<=60). The following *n* lines contain description of Tom's work. Each *i*-th of these lines contains two space-separated integers *l**i* and *r**i* (0<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=1440, *r**i*<=&lt;<=*l**i*<=+<=1 for *i*<=&lt;<=*n*), which stand for the start and the end of the *i*-th period of work. Output Specification: Output the answer to the problem. Demo Input: ['1 3 2 1 5 10\n0 10\n', '2 8 4 2 5 10\n20 30\n50 100\n'] Demo Output: ['30', '570'] Note: none
```python # LUOGU_RID: 112788373 n,P1,P2,P3,T1,T2 = map(int,input().split()) count = 0 end_time = 0 for i in range(n): if i == 0: start,end = map(int,input().split()) count+=(start-end_time)*P3+(end-start)*P1 end_time = end else: start,end = map(int,input().split()) '''下面的判断是在计算两组操作之间花费的时间''' if start-end_time <=T1: count+=(start-end_time)*P1 elif T1<start-end_time<=T2: count+=(start-end_time)*P1+(start-end_time-T1)*P2 else: count+=(start-end_time)*P1+(start-end_time-T1)*P2+(start-end_time-T1-T2)*P3 '''开始计算操作期间花费的时间''' count+=(end-start)*P1 end_time = end print(count) ```
0
700
B
Connecting Universities
PROGRAMMING
1,800
[ "dfs and similar", "dp", "graphs", "trees" ]
null
null
Treeland is a country in which there are *n* towns connected by *n*<=-<=1 two-way road such that it's possible to get from any town to any other town. In Treeland there are 2*k* universities which are located in different towns. Recently, the president signed the decree to connect universities by high-speed network.The Ministry of Education understood the decree in its own way and decided that it was enough to connect each university with another one by using a cable. Formally, the decree will be done! To have the maximum sum in the budget, the Ministry decided to divide universities into pairs so that the total length of the required cable will be maximum. In other words, the total distance between universities in *k* pairs should be as large as possible. Help the Ministry to find the maximum total distance. Of course, each university should be present in only one pair. Consider that all roads have the same length which is equal to 1.
The first line of the input contains two integers *n* and *k* (2<=≤<=*n*<=≤<=200<=000, 1<=≤<=*k*<=≤<=*n*<=/<=2) — the number of towns in Treeland and the number of university pairs. Consider that towns are numbered from 1 to *n*. The second line contains 2*k* distinct integers *u*1,<=*u*2,<=...,<=*u*2*k* (1<=≤<=*u**i*<=≤<=*n*) — indices of towns in which universities are located. The next *n*<=-<=1 line contains the description of roads. Each line contains the pair of integers *x**j* and *y**j* (1<=≤<=*x**j*,<=*y**j*<=≤<=*n*), which means that the *j*-th road connects towns *x**j* and *y**j*. All of them are two-way roads. You can move from any town to any other using only these roads.
Print the maximum possible sum of distances in the division of universities into *k* pairs.
[ "7 2\n1 5 6 2\n1 3\n3 2\n4 5\n3 7\n4 3\n4 6\n", "9 3\n3 2 1 6 5 9\n8 9\n3 2\n2 7\n3 4\n7 6\n4 5\n2 1\n2 8\n" ]
[ "6\n", "9\n" ]
The figure below shows one of possible division into pairs in the first test. If you connect universities number 1 and 6 (marked in red) and universities number 2 and 5 (marked in blue) by using the cable, the total distance will equal 6 which will be the maximum sum in this example.
1,000
[ { "input": "7 2\n1 5 6 2\n1 3\n3 2\n4 5\n3 7\n4 3\n4 6", "output": "6" }, { "input": "9 3\n3 2 1 6 5 9\n8 9\n3 2\n2 7\n3 4\n7 6\n4 5\n2 1\n2 8", "output": "9" }, { "input": "41 3\n11 10 15 35 34 6\n28 2\n25 3\n9 4\n11 5\n7 6\n24 7\n19 8\n1 9\n34 10\n23 11\n17 12\n32 13\n32 14\n32 15\n33 16\n8 17\n19 18\n40 19\n15 20\n6 21\n41 22\n35 23\n13 24\n6 25\n22 26\n4 27\n31 28\n34 29\n41 30\n15 31\n4 32\n41 33\n23 34\n21 35\n13 36\n2 37\n22 38\n34 39\n29 40\n34 41", "output": "16" }, { "input": "2 1\n1 2\n1 2", "output": "1" }, { "input": "2 1\n2 1\n1 2", "output": "1" }, { "input": "3 1\n2 1\n1 2\n2 3", "output": "1" }, { "input": "4 1\n3 2\n1 2\n2 3\n2 4", "output": "1" }, { "input": "4 2\n1 3 2 4\n1 2\n4 3\n1 4", "output": "4" }, { "input": "5 1\n2 3\n1 2\n5 3\n1 4\n4 5", "output": "4" }, { "input": "5 2\n1 2 3 4\n1 2\n2 3\n2 4\n1 5", "output": "3" }, { "input": "6 1\n4 6\n5 2\n1 3\n1 4\n4 5\n3 6", "output": "3" }, { "input": "6 2\n6 5 4 1\n3 2\n1 3\n5 4\n3 5\n1 6", "output": "6" }, { "input": "6 3\n4 5 2 3 6 1\n4 2\n2 3\n1 4\n4 5\n5 6", "output": "7" }, { "input": "6 1\n4 5\n1 2\n1 3\n1 4\n1 5\n1 6", "output": "2" }, { "input": "6 2\n4 5 3 2\n1 2\n1 3\n6 4\n1 5\n1 6", "output": "5" }, { "input": "6 3\n4 5 2 6 3 1\n6 2\n1 3\n1 4\n1 5\n1 6", "output": "6" }, { "input": "6 1\n4 1\n5 2\n1 3\n3 4\n4 5\n5 6", "output": "2" }, { "input": "6 2\n6 4 2 5\n3 2\n1 3\n2 4\n1 5\n5 6", "output": "8" }, { "input": "6 3\n3 4 2 6 1 5\n3 2\n6 3\n3 4\n2 5\n1 6", "output": "7" }, { "input": "30 6\n15 17 2 14 6 30 13 8 10 24 1 19\n23 2\n26 3\n22 4\n7 5\n1 6\n17 7\n29 8\n30 9\n4 10\n28 11\n13 12\n6 13\n23 14\n23 15\n5 16\n30 17\n2 18\n11 19\n19 20\n4 21\n3 22\n16 23\n11 24\n29 25\n27 26\n13 27\n5 28\n23 29\n4 30", "output": "59" }, { "input": "35 15\n6 12 32 18 11 10 29 9 30 27 31 14 8 24 28 25 19 15 21 3 4 1 33 22 23 17 16 13 7 2\n1 2\n20 3\n1 4\n20 5\n20 6\n1 7\n13 8\n4 9\n1 10\n1 11\n1 12\n1 13\n18 14\n10 15\n1 16\n16 17\n1 18\n1 19\n1 20\n20 21\n1 22\n27 23\n25 24\n1 25\n20 26\n20 27\n18 28\n4 29\n13 30\n4 31\n1 32\n20 33\n1 34\n4 35", "output": "46" }, { "input": "5 1\n1 2\n1 2\n2 3\n3 4\n4 5", "output": "1" } ]
1,605,595,930
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
9
3,000
33,280,000
#parsea una línea def parser(): return [int(x) for x in input().split()] #Método usado para contar las universidades en un subárbol def DFS_Count_Universities(u,v): count_universities=0 visited=[False for x in range(n)] visited[u]=True visited[v]=True if university_in_city[u]: count_universities+=1 stack=[] stack.append(u) while len(stack)>0: x=stack.pop() for y in adjacents_list[x]: if not visited[y]: visited[y]=True stack.append(y) if university_in_city[y]: count_universities+=1 return count_universities #Recibiendo los valores de n y k n,k=parser() #True si el vértice i representa una ciudad con universidad university_in_city=[False for x in range(n)] #Recibiendo y marcando las ciudades con universidades cities_universities=parser() for i in cities_universities: university_in_city[i-1]=True edges=[] #Armando el árbol que representa a Treeland adjacents_list=[[] for x in range(n)] for i in range(n-1): #Leyendo una arista edge=parser() adjacents_list[edge[0]-1].append(edge[1]-1) adjacents_list[edge[1]-1].append(edge[0]-1) edges.append([edge[0]-1,edge[1]-1]) #Calculando el total total=0 for edge in edges: count_universities_subtree=DFS_Count_Universities(edge[0],edge[1]) total+=min(count_universities_subtree,2*k-count_universities_subtree) #Imprimendo el resultado print(total)
Title: Connecting Universities Time Limit: None seconds Memory Limit: None megabytes Problem Description: Treeland is a country in which there are *n* towns connected by *n*<=-<=1 two-way road such that it's possible to get from any town to any other town. In Treeland there are 2*k* universities which are located in different towns. Recently, the president signed the decree to connect universities by high-speed network.The Ministry of Education understood the decree in its own way and decided that it was enough to connect each university with another one by using a cable. Formally, the decree will be done! To have the maximum sum in the budget, the Ministry decided to divide universities into pairs so that the total length of the required cable will be maximum. In other words, the total distance between universities in *k* pairs should be as large as possible. Help the Ministry to find the maximum total distance. Of course, each university should be present in only one pair. Consider that all roads have the same length which is equal to 1. Input Specification: The first line of the input contains two integers *n* and *k* (2<=≤<=*n*<=≤<=200<=000, 1<=≤<=*k*<=≤<=*n*<=/<=2) — the number of towns in Treeland and the number of university pairs. Consider that towns are numbered from 1 to *n*. The second line contains 2*k* distinct integers *u*1,<=*u*2,<=...,<=*u*2*k* (1<=≤<=*u**i*<=≤<=*n*) — indices of towns in which universities are located. The next *n*<=-<=1 line contains the description of roads. Each line contains the pair of integers *x**j* and *y**j* (1<=≤<=*x**j*,<=*y**j*<=≤<=*n*), which means that the *j*-th road connects towns *x**j* and *y**j*. All of them are two-way roads. You can move from any town to any other using only these roads. Output Specification: Print the maximum possible sum of distances in the division of universities into *k* pairs. Demo Input: ['7 2\n1 5 6 2\n1 3\n3 2\n4 5\n3 7\n4 3\n4 6\n', '9 3\n3 2 1 6 5 9\n8 9\n3 2\n2 7\n3 4\n7 6\n4 5\n2 1\n2 8\n'] Demo Output: ['6\n', '9\n'] Note: The figure below shows one of possible division into pairs in the first test. If you connect universities number 1 and 6 (marked in red) and universities number 2 and 5 (marked in blue) by using the cable, the total distance will equal 6 which will be the maximum sum in this example.
```python #parsea una línea def parser(): return [int(x) for x in input().split()] #Método usado para contar las universidades en un subárbol def DFS_Count_Universities(u,v): count_universities=0 visited=[False for x in range(n)] visited[u]=True visited[v]=True if university_in_city[u]: count_universities+=1 stack=[] stack.append(u) while len(stack)>0: x=stack.pop() for y in adjacents_list[x]: if not visited[y]: visited[y]=True stack.append(y) if university_in_city[y]: count_universities+=1 return count_universities #Recibiendo los valores de n y k n,k=parser() #True si el vértice i representa una ciudad con universidad university_in_city=[False for x in range(n)] #Recibiendo y marcando las ciudades con universidades cities_universities=parser() for i in cities_universities: university_in_city[i-1]=True edges=[] #Armando el árbol que representa a Treeland adjacents_list=[[] for x in range(n)] for i in range(n-1): #Leyendo una arista edge=parser() adjacents_list[edge[0]-1].append(edge[1]-1) adjacents_list[edge[1]-1].append(edge[0]-1) edges.append([edge[0]-1,edge[1]-1]) #Calculando el total total=0 for edge in edges: count_universities_subtree=DFS_Count_Universities(edge[0],edge[1]) total+=min(count_universities_subtree,2*k-count_universities_subtree) #Imprimendo el resultado print(total) ```
0
228
A
Is your horseshoe on the other hoof?
PROGRAMMING
800
[ "implementation" ]
null
null
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers.
Print a single integer — the minimum number of horseshoes Valera needs to buy.
[ "1 7 3 3\n", "7 7 7 7\n" ]
[ "1\n", "3\n" ]
none
500
[ { "input": "1 7 3 3", "output": "1" }, { "input": "7 7 7 7", "output": "3" }, { "input": "81170865 673572653 756938629 995577259", "output": "0" }, { "input": "3491663 217797045 522540872 715355328", "output": "0" }, { "input": "251590420 586975278 916631563 586975278", "output": "1" }, { "input": "259504825 377489979 588153796 377489979", "output": "1" }, { "input": "652588203 931100304 931100304 652588203", "output": "2" }, { "input": "391958720 651507265 391958720 651507265", "output": "2" }, { "input": "90793237 90793237 90793237 90793237", "output": "3" }, { "input": "551651653 551651653 551651653 551651653", "output": "3" }, { "input": "156630260 609654355 668943582 973622757", "output": "0" }, { "input": "17061017 110313588 434481173 796661222", "output": "0" }, { "input": "24975422 256716298 337790533 690960249", "output": "0" }, { "input": "255635360 732742923 798648949 883146723", "output": "0" }, { "input": "133315691 265159773 734556507 265159773", "output": "1" }, { "input": "28442865 741657755 978106882 978106882", "output": "1" }, { "input": "131245479 174845575 497483467 131245479", "output": "1" }, { "input": "139159884 616215581 958341883 616215581", "output": "1" }, { "input": "147784432 947653080 947653080 947653080", "output": "2" }, { "input": "94055790 756126496 756126496 94055790", "output": "2" }, { "input": "240458500 511952208 240458500 511952208", "output": "2" }, { "input": "681828506 972810624 972810624 681828506", "output": "2" }, { "input": "454961014 454961014 454961014 454961014", "output": "3" }, { "input": "915819430 915819430 915819430 915819430", "output": "3" }, { "input": "671645142 671645142 671645142 671645142", "output": "3" }, { "input": "132503558 132503558 132503558 132503558", "output": "3" }, { "input": "5 5 999999 6", "output": "1" }, { "input": "1 1 2 5", "output": "1" }, { "input": "2 1 2 3", "output": "1" }, { "input": "1 1 3 5", "output": "1" }, { "input": "1 1 3 3", "output": "2" }, { "input": "2 2 2 1", "output": "2" }, { "input": "3 1 1 1", "output": "2" }, { "input": "1 2 2 2", "output": "2" } ]
1,690,010,484
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
2
124
0
s = list(map(int, input().split())) unique = len(set(s)) for i in range(1, 5): if unique == 4 - i: print(i) break
Title: Is your horseshoe on the other hoof? Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party. Input Specification: The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers. Output Specification: Print a single integer — the minimum number of horseshoes Valera needs to buy. Demo Input: ['1 7 3 3\n', '7 7 7 7\n'] Demo Output: ['1\n', '3\n'] Note: none
```python s = list(map(int, input().split())) unique = len(set(s)) for i in range(1, 5): if unique == 4 - i: print(i) break ```
0
546
A
Soldier and Bananas
PROGRAMMING
800
[ "brute force", "implementation", "math" ]
null
null
A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*·*k* dollars for the *i*-th banana). He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas?
The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=≤<=<=*k*,<=*w*<=<=≤<=<=1000, 0<=≤<=*n*<=≤<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants.
Output one integer — the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0.
[ "3 17 4\n" ]
[ "13" ]
none
500
[ { "input": "3 17 4", "output": "13" }, { "input": "1 2 1", "output": "0" }, { "input": "1 1 1", "output": "0" }, { "input": "1 5 6", "output": "16" }, { "input": "1 1000000000 1", "output": "0" }, { "input": "1000 0 1000", "output": "500500000" }, { "input": "859 453892 543", "output": "126416972" }, { "input": "1000 1000000000 1000", "output": "0" }, { "input": "1000 500500000 1000", "output": "0" }, { "input": "1000 500500001 1000", "output": "0" }, { "input": "1000 500499999 1000", "output": "1" }, { "input": "634 87973 214", "output": "14497197" }, { "input": "432 10000 241", "output": "12587552" }, { "input": "111 111111111 111", "output": "0" }, { "input": "20 43 3", "output": "77" } ]
1,700,041,127
2,147,483,647
Python 3
OK
TESTS
15
46
0
k,n,w=map(int,input().split()) s=0 for i in range(1,w+1): s+=i*k print(s-n if s-n>-1 else 0)
Title: Soldier and Bananas Time Limit: None seconds Memory Limit: None megabytes Problem Description: A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*·*k* dollars for the *i*-th banana). He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas? Input Specification: The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=≤<=<=*k*,<=*w*<=<=≤<=<=1000, 0<=≤<=*n*<=≤<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants. Output Specification: Output one integer — the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0. Demo Input: ['3 17 4\n'] Demo Output: ['13'] Note: none
```python k,n,w=map(int,input().split()) s=0 for i in range(1,w+1): s+=i*k print(s-n if s-n>-1 else 0) ```
3
350
C
Bombs
PROGRAMMING
1,600
[ "greedy", "implementation", "sortings" ]
null
null
You've got a robot, its task is destroying bombs on a square plane. Specifically, the square plane contains *n* bombs, the *i*-th bomb is at point with coordinates (*x**i*,<=*y**i*). We know that no two bombs are at the same point and that no bomb is at point with coordinates (0,<=0). Initially, the robot is at point with coordinates (0,<=0). Also, let's mark the robot's current position as (*x*,<=*y*). In order to destroy all the bombs, the robot can perform three types of operations: 1. Operation has format "1 k dir". To perform the operation robot have to move in direction *dir* *k* (*k*<=≥<=1) times. There are only 4 directions the robot can move in: "R", "L", "U", "D". During one move the robot can move from the current point to one of following points: (*x*<=+<=1,<=*y*), (*x*<=-<=1,<=*y*), (*x*,<=*y*<=+<=1), (*x*,<=*y*<=-<=1) (corresponding to directions). It is forbidden to move from point (*x*,<=*y*), if at least one point on the path (besides the destination point) contains a bomb. 1. Operation has format "2". To perform the operation robot have to pick a bomb at point (*x*,<=*y*) and put it in a special container. Thus, the robot can carry the bomb from any point to any other point. The operation cannot be performed if point (*x*,<=*y*) has no bomb. It is forbidden to pick a bomb if the robot already has a bomb in its container. 1. Operation has format "3". To perform the operation robot have to take a bomb out of the container and destroy it. You are allowed to perform this operation only if the robot is at point (0,<=0). It is forbidden to perform the operation if the container has no bomb. Help the robot and find the shortest possible sequence of operations he can perform to destroy all bombs on the coordinate plane.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of bombs on the coordinate plane. Next *n* lines contain two integers each. The *i*-th line contains numbers (*x**i*,<=*y**i*) (<=-<=109<=≤<=*x**i*,<=*y**i*<=≤<=109) — the coordinates of the *i*-th bomb. It is guaranteed that no two bombs are located at the same point and no bomb is at point (0,<=0).
In a single line print a single integer *k* — the minimum number of operations needed to destroy all bombs. On the next lines print the descriptions of these *k* operations. If there are multiple sequences, you can print any of them. It is guaranteed that there is the solution where *k*<=≤<=106.
[ "2\n1 1\n-1 -1\n", "3\n5 0\n0 5\n1 0\n" ]
[ "12\n1 1 R\n1 1 U\n2\n1 1 L\n1 1 D\n3\n1 1 L\n1 1 D\n2\n1 1 R\n1 1 U\n3\n", "12\n1 1 R\n2\n1 1 L\n3\n1 5 R\n2\n1 5 L\n3\n1 5 U\n2\n1 5 D\n3\n" ]
none
1,000
[ { "input": "2\n1 1\n-1 -1", "output": "12\n1 1 R\n1 1 U\n2\n1 1 L\n1 1 D\n3\n1 1 L\n1 1 D\n2\n1 1 R\n1 1 U\n3" }, { "input": "3\n5 0\n0 5\n1 0", "output": "12\n1 1 R\n2\n1 1 L\n3\n1 5 R\n2\n1 5 L\n3\n1 5 U\n2\n1 5 D\n3" }, { "input": "1\n-277226476 314722425", "output": "6\n1 277226476 L\n1 314722425 U\n2\n1 277226476 R\n1 314722425 D\n3" }, { "input": "2\n-404192496 -968658337\n556071553 -256244640", "output": "12\n1 556071553 R\n1 256244640 D\n2\n1 556071553 L\n1 256244640 U\n3\n1 404192496 L\n1 968658337 D\n2\n1 404192496 R\n1 968658337 U\n3" }, { "input": "24\n-2 -2\n-1 1\n0 1\n1 1\n0 2\n1 -1\n2 -2\n1 -2\n-1 0\n0 -2\n0 -1\n-2 0\n-2 -1\n2 -1\n2 2\n-1 -2\n-2 1\n2 0\n-1 2\n1 2\n-1 -1\n1 0\n2 1\n-2 2", "output": "128\n1 1 U\n2\n1 1 D\n3\n1 1 R\n2\n1 1 L\n3\n1 1 L\n2\n1 1 R\n3\n1 1 D\n2\n1 1 U\n3\n1 1 L\n1 1 U\n2\n1 1 R\n1 1 D\n3\n1 1 R\n1 1 U\n2\n1 1 L\n1 1 D\n3\n1 2 U\n2\n1 2 D\n3\n1 1 R\n1 1 D\n2\n1 1 L\n1 1 U\n3\n1 2 D\n2\n1 2 U\n3\n1 2 L\n2\n1 2 R\n3\n1 1 L\n1 1 D\n2\n1 1 R\n1 1 U\n3\n1 2 R\n2\n1 2 L\n3\n1 2 L\n1 1 D\n2\n1 2 R\n1 1 U\n3\n1 2 R\n1 1 U\n2\n1 2 L\n1 1 D\n3\n1 1 R\n1 2 U\n2\n1 1 L\n1 2 D\n3\n1 1 L\n1 2 U\n2\n1 1 R\n1 2 D\n3\n1 2 L\n1 1 U\n2\n1 2 R\n1 1 D\n3\n1 1 L\n1 2 D\n2\n1 1 R\n1 2 U\n3\n1 2 R\n..." } ]
1,594,405,403
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
4
1,964
75,366,400
import sys input = sys.stdin.readline print = sys.stdout.write I = lambda : list(map(int,input().split())) n,=I() l=[] r=[];k=0 for i in range(n): x,y=I() if x<0: l.append([x,y]) else: r.append([x,y]) k = k+4 if x!=0 and y!=0 else k+2 k+=2*n;an=[] l.sort(reverse=True);r.sort() for i in range(len(r)): x,y=r[i] if x!=0: an.append("1 %d R"%x) if y!=0: an.append("1 %d %s"%(abs(y),("U" if y>0 else "D"))) an.append('2') if x!=0: an.append("1 %d L"%x) if y!=0: an.append("1 %d %c"%(abs(y),('D' if y>0 else 'U'))) an.append('3') for i in range(len(l)): x,y=l[i] x=-x if x!=0: an.append("1 %d L"%x) if y!=0: an.append("1 %d %c"%(abs(y),('U' if y>0 else 'D'))) an.append('2') if x!=0: an.append("1 %d R"%x) if y!=0: an.append("1 %d %c"%(abs(y),('D' if y>0 else 'U'))) an.append('3') print(str(k)+'\n') print("\n".join(an))
Title: Bombs Time Limit: None seconds Memory Limit: None megabytes Problem Description: You've got a robot, its task is destroying bombs on a square plane. Specifically, the square plane contains *n* bombs, the *i*-th bomb is at point with coordinates (*x**i*,<=*y**i*). We know that no two bombs are at the same point and that no bomb is at point with coordinates (0,<=0). Initially, the robot is at point with coordinates (0,<=0). Also, let's mark the robot's current position as (*x*,<=*y*). In order to destroy all the bombs, the robot can perform three types of operations: 1. Operation has format "1 k dir". To perform the operation robot have to move in direction *dir* *k* (*k*<=≥<=1) times. There are only 4 directions the robot can move in: "R", "L", "U", "D". During one move the robot can move from the current point to one of following points: (*x*<=+<=1,<=*y*), (*x*<=-<=1,<=*y*), (*x*,<=*y*<=+<=1), (*x*,<=*y*<=-<=1) (corresponding to directions). It is forbidden to move from point (*x*,<=*y*), if at least one point on the path (besides the destination point) contains a bomb. 1. Operation has format "2". To perform the operation robot have to pick a bomb at point (*x*,<=*y*) and put it in a special container. Thus, the robot can carry the bomb from any point to any other point. The operation cannot be performed if point (*x*,<=*y*) has no bomb. It is forbidden to pick a bomb if the robot already has a bomb in its container. 1. Operation has format "3". To perform the operation robot have to take a bomb out of the container and destroy it. You are allowed to perform this operation only if the robot is at point (0,<=0). It is forbidden to perform the operation if the container has no bomb. Help the robot and find the shortest possible sequence of operations he can perform to destroy all bombs on the coordinate plane. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of bombs on the coordinate plane. Next *n* lines contain two integers each. The *i*-th line contains numbers (*x**i*,<=*y**i*) (<=-<=109<=≤<=*x**i*,<=*y**i*<=≤<=109) — the coordinates of the *i*-th bomb. It is guaranteed that no two bombs are located at the same point and no bomb is at point (0,<=0). Output Specification: In a single line print a single integer *k* — the minimum number of operations needed to destroy all bombs. On the next lines print the descriptions of these *k* operations. If there are multiple sequences, you can print any of them. It is guaranteed that there is the solution where *k*<=≤<=106. Demo Input: ['2\n1 1\n-1 -1\n', '3\n5 0\n0 5\n1 0\n'] Demo Output: ['12\n1 1 R\n1 1 U\n2\n1 1 L\n1 1 D\n3\n1 1 L\n1 1 D\n2\n1 1 R\n1 1 U\n3\n', '12\n1 1 R\n2\n1 1 L\n3\n1 5 R\n2\n1 5 L\n3\n1 5 U\n2\n1 5 D\n3\n'] Note: none
```python import sys input = sys.stdin.readline print = sys.stdout.write I = lambda : list(map(int,input().split())) n,=I() l=[] r=[];k=0 for i in range(n): x,y=I() if x<0: l.append([x,y]) else: r.append([x,y]) k = k+4 if x!=0 and y!=0 else k+2 k+=2*n;an=[] l.sort(reverse=True);r.sort() for i in range(len(r)): x,y=r[i] if x!=0: an.append("1 %d R"%x) if y!=0: an.append("1 %d %s"%(abs(y),("U" if y>0 else "D"))) an.append('2') if x!=0: an.append("1 %d L"%x) if y!=0: an.append("1 %d %c"%(abs(y),('D' if y>0 else 'U'))) an.append('3') for i in range(len(l)): x,y=l[i] x=-x if x!=0: an.append("1 %d L"%x) if y!=0: an.append("1 %d %c"%(abs(y),('U' if y>0 else 'D'))) an.append('2') if x!=0: an.append("1 %d R"%x) if y!=0: an.append("1 %d %c"%(abs(y),('D' if y>0 else 'U'))) an.append('3') print(str(k)+'\n') print("\n".join(an)) ```
0
275
A
Lights Out
PROGRAMMING
900
[ "implementation" ]
null
null
Lenny is playing a game on a 3<=×<=3 grid of lights. In the beginning of the game all lights are switched on. Pressing any of the lights will toggle it and all side-adjacent lights. The goal of the game is to switch all the lights off. We consider the toggling as follows: if the light was switched on then it will be switched off, if it was switched off then it will be switched on. Lenny has spent some time playing with the grid and by now he has pressed each light a certain number of times. Given the number of times each light is pressed, you have to print the current state of each light.
The input consists of three rows. Each row contains three integers each between 0 to 100 inclusive. The *j*-th number in the *i*-th row is the number of times the *j*-th light of the *i*-th row of the grid is pressed.
Print three lines, each containing three characters. The *j*-th character of the *i*-th line is "1" if and only if the corresponding light is switched on, otherwise it's "0".
[ "1 0 0\n0 0 0\n0 0 1\n", "1 0 1\n8 8 8\n2 0 3\n" ]
[ "001\n010\n100\n", "010\n011\n100\n" ]
none
500
[ { "input": "1 0 0\n0 0 0\n0 0 1", "output": "001\n010\n100" }, { "input": "1 0 1\n8 8 8\n2 0 3", "output": "010\n011\n100" }, { "input": "13 85 77\n25 50 45\n65 79 9", "output": "000\n010\n000" }, { "input": "96 95 5\n8 84 74\n67 31 61", "output": "011\n011\n101" }, { "input": "24 54 37\n60 63 6\n1 84 26", "output": "110\n101\n011" }, { "input": "23 10 40\n15 6 40\n92 80 77", "output": "101\n100\n000" }, { "input": "62 74 80\n95 74 93\n2 47 95", "output": "010\n001\n110" }, { "input": "80 83 48\n26 0 66\n47 76 37", "output": "000\n000\n010" }, { "input": "32 15 65\n7 54 36\n5 51 3", "output": "111\n101\n001" }, { "input": "22 97 12\n71 8 24\n100 21 64", "output": "100\n001\n100" }, { "input": "46 37 13\n87 0 50\n90 8 55", "output": "111\n011\n000" }, { "input": "57 43 58\n20 82 83\n66 16 52", "output": "111\n010\n110" }, { "input": "45 56 93\n47 51 59\n18 51 63", "output": "101\n011\n100" }, { "input": "47 66 67\n14 1 37\n27 81 69", "output": "001\n001\n110" }, { "input": "26 69 69\n85 18 23\n14 22 74", "output": "110\n001\n010" }, { "input": "10 70 65\n94 27 25\n74 66 30", "output": "111\n010\n100" }, { "input": "97 1 74\n15 99 1\n88 68 86", "output": "001\n011\n000" }, { "input": "36 48 42\n45 41 66\n26 64 1", "output": "001\n111\n010" }, { "input": "52 81 97\n29 77 71\n66 11 2", "output": "100\n100\n111" }, { "input": "18 66 33\n19 49 49\n48 46 26", "output": "011\n100\n000" }, { "input": "68 79 52\n51 39 100\n29 14 26", "output": "110\n000\n111" }, { "input": "91 69 77\n91 26 64\n91 88 57", "output": "001\n011\n110" }, { "input": "16 69 64\n48 21 80\n81 51 51", "output": "010\n101\n111" }, { "input": "96 14 2\n100 18 12\n65 34 89", "output": "111\n010\n010" }, { "input": "93 95 90\n8 59 42\n53 13 19", "output": "100\n001\n111" }, { "input": "71 84 18\n100 19 67\n9 76 15", "output": "010\n010\n001" }, { "input": "38 93 85\n21 88 64\n4 96 25", "output": "111\n011\n000" }, { "input": "75 20 20\n60 5 78\n77 4 69", "output": "011\n001\n000" }, { "input": "65 70 96\n19 6 83\n33 37 82", "output": "100\n000\n011" }, { "input": "11 13 60\n17 13 46\n42 21 39", "output": "000\n011\n101" }, { "input": "0 0 0\n0 0 0\n0 0 0", "output": "111\n111\n111" }, { "input": "0 0 0\n0 1 0\n0 0 0", "output": "101\n000\n101" }, { "input": "0 0 0\n0 0 0\n0 0 1", "output": "111\n110\n100" } ]
1,587,195,627
2,147,483,647
PyPy 3
OK
TESTS
33
155
0
t=[] k=[['1','1','1'],['1','1','1'],['1','1','1']] for i in range(3): a=list(map(int,input().split())) if a[0]==0: pass elif a[0]%2==0: pass else: k[i][0]= str(abs(int(k[i][0])-1)) k[i][1]=str(abs(int(k[i][1])-1)) if i==0: k[i+1][0]=str(abs(int(k[i+1][0])-1)) elif i==1: k[i+1][0]=str(abs(int(k[i+1][0])-1)) k[i-1][0]=str(abs(int(k[i-1][0])-1)) else: k[i-1][0]=str(abs(int(k[i-1][0])-1)) if a[1]==0: pass elif a[1]%2==0: pass else: k[i][1]= str(abs(int(k[i][1])-1)) k[i][0]=str(abs(int(k[i][0])-1)) k[i][2]=str(abs(int(k[i][2])-1)) if i==0: k[i+1][1]=str(abs(int(k[i+1][1])-1)) elif i==1: k[i+1][1]=str(abs(int(k[i+1][1])-1)) k[i-1][1]=str(abs(int(k[i-1][1])-1)) else: k[i-1][1]=str(abs(int(k[i-1][1])-1)) if a[2]==0: pass elif a[2]%2==0: pass else: k[i][2]= str(abs(int(k[i][2])-1)) k[i][1]=str(abs(int(k[i][1])-1)) if i==0: k[i+1][2]=str(abs(int(k[i+1][2])-1)) elif i==1: k[i+1][2]=str(abs(int(k[i+1][2])-1)) k[i-1][2]=str(abs(int(k[i-1][2])-1)) else: k[i-1][2]=str(abs(int(k[i-1][2])-1)) for h in k: print(''.join(h))
Title: Lights Out Time Limit: None seconds Memory Limit: None megabytes Problem Description: Lenny is playing a game on a 3<=×<=3 grid of lights. In the beginning of the game all lights are switched on. Pressing any of the lights will toggle it and all side-adjacent lights. The goal of the game is to switch all the lights off. We consider the toggling as follows: if the light was switched on then it will be switched off, if it was switched off then it will be switched on. Lenny has spent some time playing with the grid and by now he has pressed each light a certain number of times. Given the number of times each light is pressed, you have to print the current state of each light. Input Specification: The input consists of three rows. Each row contains three integers each between 0 to 100 inclusive. The *j*-th number in the *i*-th row is the number of times the *j*-th light of the *i*-th row of the grid is pressed. Output Specification: Print three lines, each containing three characters. The *j*-th character of the *i*-th line is "1" if and only if the corresponding light is switched on, otherwise it's "0". Demo Input: ['1 0 0\n0 0 0\n0 0 1\n', '1 0 1\n8 8 8\n2 0 3\n'] Demo Output: ['001\n010\n100\n', '010\n011\n100\n'] Note: none
```python t=[] k=[['1','1','1'],['1','1','1'],['1','1','1']] for i in range(3): a=list(map(int,input().split())) if a[0]==0: pass elif a[0]%2==0: pass else: k[i][0]= str(abs(int(k[i][0])-1)) k[i][1]=str(abs(int(k[i][1])-1)) if i==0: k[i+1][0]=str(abs(int(k[i+1][0])-1)) elif i==1: k[i+1][0]=str(abs(int(k[i+1][0])-1)) k[i-1][0]=str(abs(int(k[i-1][0])-1)) else: k[i-1][0]=str(abs(int(k[i-1][0])-1)) if a[1]==0: pass elif a[1]%2==0: pass else: k[i][1]= str(abs(int(k[i][1])-1)) k[i][0]=str(abs(int(k[i][0])-1)) k[i][2]=str(abs(int(k[i][2])-1)) if i==0: k[i+1][1]=str(abs(int(k[i+1][1])-1)) elif i==1: k[i+1][1]=str(abs(int(k[i+1][1])-1)) k[i-1][1]=str(abs(int(k[i-1][1])-1)) else: k[i-1][1]=str(abs(int(k[i-1][1])-1)) if a[2]==0: pass elif a[2]%2==0: pass else: k[i][2]= str(abs(int(k[i][2])-1)) k[i][1]=str(abs(int(k[i][1])-1)) if i==0: k[i+1][2]=str(abs(int(k[i+1][2])-1)) elif i==1: k[i+1][2]=str(abs(int(k[i+1][2])-1)) k[i-1][2]=str(abs(int(k[i-1][2])-1)) else: k[i-1][2]=str(abs(int(k[i-1][2])-1)) for h in k: print(''.join(h)) ```
3
554
B
Ohana Cleans Up
PROGRAMMING
1,200
[ "brute force", "greedy", "strings" ]
null
null
Ohana Matsumae is trying to clean a room, which is divided up into an *n* by *n* grid of squares. Each square is initially either clean or dirty. Ohana can sweep her broom over columns of the grid. Her broom is very strange: if she sweeps over a clean square, it will become dirty, and if she sweeps over a dirty square, it will become clean. She wants to sweep some columns of the room to maximize the number of rows that are completely clean. It is not allowed to sweep over the part of the column, Ohana can only sweep the whole column. Return the maximum number of rows that she can make completely clean.
The first line of input will be a single integer *n* (1<=≤<=*n*<=≤<=100). The next *n* lines will describe the state of the room. The *i*-th line will contain a binary string with *n* characters denoting the state of the *i*-th row of the room. The *j*-th character on this line is '1' if the *j*-th square in the *i*-th row is clean, and '0' if it is dirty.
The output should be a single line containing an integer equal to a maximum possible number of rows that are completely clean.
[ "4\n0101\n1000\n1111\n0101\n", "3\n111\n111\n111\n" ]
[ "2\n", "3\n" ]
In the first sample, Ohana can sweep the 1st and 3rd columns. This will make the 1st and 4th row be completely clean. In the second sample, everything is already clean, so Ohana doesn't need to do anything.
500
[ { "input": "4\n0101\n1000\n1111\n0101", "output": "2" }, { "input": "3\n111\n111\n111", "output": "3" }, { "input": "10\n0100000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000", "output": "9" }, { "input": "1\n1", "output": "1" }, { "input": "10\n0111010011\n0111010011\n1010010001\n0111010011\n0000110000\n0111010011\n0111010011\n0000110000\n1010010001\n0111010011", "output": "6" }, { "input": "20\n10101011101000011010\n11111010001100110101\n01011100010000001111\n10110100000101010011\n11010001110111101101\n00100110011011101010\n01000110101011001100\n01101100111101101101\n10111010010100111100\n00010010110001101110\n10111110010000101010\n10010111110100100100\n11010111001111110100\n11110111101100000001\n00011010100111011000\n11110001011000011010\n10001101010000011011\n01010101110010000111\n11100110111101101111\n11011111110010001111", "output": "1" }, { "input": "10\n1001000000\n0111101111\n1111001011\n1000010100\n0111101111\n0101100110\n1001000000\n1000010100\n0111101111\n1001000000", "output": "3" }, { "input": "1\n0", "output": "1" }, { "input": "1\n1", "output": "1" }, { "input": "10\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000\n0000000000", "output": "10" }, { "input": "10\n1111111111\n1111111111\n1111111111\n1111111111\n1111111111\n1111111111\n1111111111\n1111111111\n1111111111\n1111111111", "output": "10" }, { "input": "10\n1000000000\n0100000000\n0010000000\n0001000000\n0000100000\n0000010000\n0000001000\n0000000100\n0000000010\n0000000001", "output": "1" }, { "input": "2\n10\n01", "output": "1" }, { "input": "1\n0", "output": "1" }, { "input": "4\n0000\n0000\n1111\n1111", "output": "2" }, { "input": "11\n10000000001\n10000000001\n10000000001\n10000000001\n10001000001\n10001000000\n10001000001\n10001000001\n10001000000\n10001000000\n10001000100", "output": "4" } ]
1,623,585,597
2,147,483,647
Python 3
COMPILATION_ERROR
TESTS
0
0
0
import sys n = int(input()) s = [x for x in sys.stdin.read().split()] m = 0 for a in s: m = max(m, s.count(a)) print(m
Title: Ohana Cleans Up Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ohana Matsumae is trying to clean a room, which is divided up into an *n* by *n* grid of squares. Each square is initially either clean or dirty. Ohana can sweep her broom over columns of the grid. Her broom is very strange: if she sweeps over a clean square, it will become dirty, and if she sweeps over a dirty square, it will become clean. She wants to sweep some columns of the room to maximize the number of rows that are completely clean. It is not allowed to sweep over the part of the column, Ohana can only sweep the whole column. Return the maximum number of rows that she can make completely clean. Input Specification: The first line of input will be a single integer *n* (1<=≤<=*n*<=≤<=100). The next *n* lines will describe the state of the room. The *i*-th line will contain a binary string with *n* characters denoting the state of the *i*-th row of the room. The *j*-th character on this line is '1' if the *j*-th square in the *i*-th row is clean, and '0' if it is dirty. Output Specification: The output should be a single line containing an integer equal to a maximum possible number of rows that are completely clean. Demo Input: ['4\n0101\n1000\n1111\n0101\n', '3\n111\n111\n111\n'] Demo Output: ['2\n', '3\n'] Note: In the first sample, Ohana can sweep the 1st and 3rd columns. This will make the 1st and 4th row be completely clean. In the second sample, everything is already clean, so Ohana doesn't need to do anything.
```python import sys n = int(input()) s = [x for x in sys.stdin.read().split()] m = 0 for a in s: m = max(m, s.count(a)) print(m ```
-1
540
A
Combination Lock
PROGRAMMING
800
[ "implementation" ]
null
null
Scrooge McDuck keeps his most treasured savings in a home safe with a combination lock. Each time he wants to put there the treasures that he's earned fair and square, he has to open the lock. The combination lock is represented by *n* rotating disks with digits from 0 to 9 written on them. Scrooge McDuck has to turn some disks so that the combination of digits on the disks forms a secret combination. In one move, he can rotate one disk one digit forwards or backwards. In particular, in one move he can go from digit 0 to digit 9 and vice versa. What minimum number of actions does he need for that?
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of disks on the combination lock. The second line contains a string of *n* digits — the original state of the disks. The third line contains a string of *n* digits — Scrooge McDuck's combination that opens the lock.
Print a single integer — the minimum number of moves Scrooge McDuck needs to open the lock.
[ "5\n82195\n64723\n" ]
[ "13\n" ]
In the sample he needs 13 moves: - 1 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b8967f65a723782358b93eff9ce69f336817cf70.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 2 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/07fa58573ece0d32c4d555e498d2b24d2f70f36a.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 3 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cc2275d9252aae35a6867c6a5b4ba7596e9a7626.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 4 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b100aea470fcaaab4e9529b234ba0d7875943c10.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 5 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb2cbe4324cebca65b85816262a85e473cd65967.png" style="max-width: 100.0%;max-height: 100.0%;"/>
500
[ { "input": "5\n82195\n64723", "output": "13" }, { "input": "12\n102021090898\n010212908089", "output": "16" }, { "input": "1\n8\n1", "output": "3" }, { "input": "2\n83\n57", "output": "7" }, { "input": "10\n0728592530\n1362615763", "output": "27" }, { "input": "100\n4176196363694273682807653052945037727131821799902563705176501742060696655282954944720643131654235909\n3459912084922154505910287499879975659298239371519889866585472674423008837878123067103005344986554746", "output": "245" }, { "input": "1\n8\n1", "output": "3" }, { "input": "2\n83\n57", "output": "7" }, { "input": "3\n607\n684", "output": "5" }, { "input": "4\n0809\n0636", "output": "8" }, { "input": "5\n84284\n08941", "output": "16" }, { "input": "25\n8037856825987124762280548\n9519431339078678836940020", "output": "72" }, { "input": "125\n23269567683904664184142384849516523616863461607751021071772615078579713054027902974007001544768640273491193035874486891541257\n47635110303703399505805044019026243695451609639556649012447370081552870340011971572363458960190590266459684717415349529509024", "output": "305" }, { "input": "5\n84284\n08941", "output": "16" }, { "input": "25\n8037856825987124762285484\n9519431339078678836940202", "output": "74" }, { "input": "125\n23269567689466418414238845152168634610771021717726157879713054270294007001544768647391193035874486891412573389247025830678706\n47635110307339950580504010224954516093956649124473708152870340117152363458960190596659684717415349529090241694059599629136831", "output": "357" }, { "input": "5\n84284\n08941", "output": "16" }, { "input": "25\n8378525987476228048406972\n9194339078883694020217816", "output": "55" }, { "input": "125\n23269576839046618414238484916523616863461607750210717761078579713054027902974007015447686027349193035874486891541257338624472\n47635103037033950580504401926243695451609639556490124437081552870340011971572363489601905026645984717415349529509024169604599", "output": "274" }, { "input": "1\n0\n0", "output": "0" }, { "input": "1\n7\n7", "output": "0" }, { "input": "1\n0\n5", "output": "5" }, { "input": "1\n2\n7", "output": "5" }, { "input": "1\n7\n9", "output": "2" }, { "input": "1\n9\n7", "output": "2" }, { "input": "1\n2\n9", "output": "3" }, { "input": "1\n9\n2", "output": "3" }, { "input": "25\n3164978461316464614169874\n9413979197249127496597357", "output": "66" }, { "input": "4\n9999\n9999", "output": "0" }, { "input": "2\n11\n11", "output": "0" } ]
1,601,500,034
2,147,483,647
Python 3
OK
TESTS
43
109
307,200
n=int(input()) x=input() y=input() count=0 for i in range(n): if abs(int(x[i])-int(y[i]))>=5: count=count+10-abs(int(x[i])-int(y[i])) else: count=count+abs(int(x[i])-int(y[i])) print(count)
Title: Combination Lock Time Limit: None seconds Memory Limit: None megabytes Problem Description: Scrooge McDuck keeps his most treasured savings in a home safe with a combination lock. Each time he wants to put there the treasures that he's earned fair and square, he has to open the lock. The combination lock is represented by *n* rotating disks with digits from 0 to 9 written on them. Scrooge McDuck has to turn some disks so that the combination of digits on the disks forms a secret combination. In one move, he can rotate one disk one digit forwards or backwards. In particular, in one move he can go from digit 0 to digit 9 and vice versa. What minimum number of actions does he need for that? Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of disks on the combination lock. The second line contains a string of *n* digits — the original state of the disks. The third line contains a string of *n* digits — Scrooge McDuck's combination that opens the lock. Output Specification: Print a single integer — the minimum number of moves Scrooge McDuck needs to open the lock. Demo Input: ['5\n82195\n64723\n'] Demo Output: ['13\n'] Note: In the sample he needs 13 moves: - 1 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b8967f65a723782358b93eff9ce69f336817cf70.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 2 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/07fa58573ece0d32c4d555e498d2b24d2f70f36a.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 3 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cc2275d9252aae35a6867c6a5b4ba7596e9a7626.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 4 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b100aea470fcaaab4e9529b234ba0d7875943c10.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 5 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb2cbe4324cebca65b85816262a85e473cd65967.png" style="max-width: 100.0%;max-height: 100.0%;"/>
```python n=int(input()) x=input() y=input() count=0 for i in range(n): if abs(int(x[i])-int(y[i]))>=5: count=count+10-abs(int(x[i])-int(y[i])) else: count=count+abs(int(x[i])-int(y[i])) print(count) ```
3
4
C
Registration System
PROGRAMMING
1,300
[ "data structures", "hashing", "implementation" ]
C. Registration system
5
64
A new e-mail service "Berlandesk" is going to be opened in Berland in the near future. The site administration wants to launch their project as soon as possible, that's why they ask you to help. You're suggested to implement the prototype of site registration system. The system should work on the following principle. Each time a new user wants to register, he sends to the system a request with his name. If such a name does not exist in the system database, it is inserted into the database, and the user gets the response OK, confirming the successful registration. If the name already exists in the system database, the system makes up a new user name, sends it to the user as a prompt and also inserts the prompt into the database. The new name is formed by the following rule. Numbers, starting with 1, are appended one after another to name (name1, name2, ...), among these numbers the least *i* is found so that name*i* does not yet exist in the database.
The first line contains number *n* (1<=≤<=*n*<=≤<=105). The following *n* lines contain the requests to the system. Each request is a non-empty line, and consists of not more than 32 characters, which are all lowercase Latin letters.
Print *n* lines, which are system responses to the requests: OK in case of successful registration, or a prompt with a new name, if the requested name is already taken.
[ "4\nabacaba\nacaba\nabacaba\nacab\n", "6\nfirst\nfirst\nsecond\nsecond\nthird\nthird\n" ]
[ "OK\nOK\nabacaba1\nOK\n", "OK\nfirst1\nOK\nsecond1\nOK\nthird1\n" ]
none
0
[ { "input": "4\nabacaba\nacaba\nabacaba\nacab", "output": "OK\nOK\nabacaba1\nOK" }, { "input": "6\nfirst\nfirst\nsecond\nsecond\nthird\nthird", "output": "OK\nfirst1\nOK\nsecond1\nOK\nthird1" }, { "input": "1\nn", "output": "OK" }, { "input": "2\nu\nu", "output": "OK\nu1" }, { "input": "3\nb\nb\nb", "output": "OK\nb1\nb2" }, { "input": "2\nc\ncn", "output": "OK\nOK" }, { "input": "3\nvhn\nvhn\nh", "output": "OK\nvhn1\nOK" }, { "input": "4\nd\nhd\nd\nh", "output": "OK\nOK\nd1\nOK" }, { "input": "10\nbhnqaptmp\nbhnqaptmp\nbhnqaptmp\nbhnqaptmp\nbhnqaptmp\nbhnqaptmp\nbhnqaptmp\nbhnqaptmp\nbhnqaptmp\nbhnqaptmp", "output": "OK\nbhnqaptmp1\nbhnqaptmp2\nbhnqaptmp3\nbhnqaptmp4\nbhnqaptmp5\nbhnqaptmp6\nbhnqaptmp7\nbhnqaptmp8\nbhnqaptmp9" }, { "input": "10\nfpqhfouqdldravpjttarh\nfpqhfouqdldravpjttarh\nfpqhfouqdldravpjttarh\nfpqhfouqdldravpjttarh\nfpqhfouqdldravpjttarh\nfpqhfouqdldravpjttarh\njmvlplnrmba\nfpqhfouqdldravpjttarh\njmvlplnrmba\nfpqhfouqdldravpjttarh", "output": "OK\nfpqhfouqdldravpjttarh1\nfpqhfouqdldravpjttarh2\nfpqhfouqdldravpjttarh3\nfpqhfouqdldravpjttarh4\nfpqhfouqdldravpjttarh5\nOK\nfpqhfouqdldravpjttarh6\njmvlplnrmba1\nfpqhfouqdldravpjttarh7" }, { "input": "10\niwexcrupuubwzbooj\niwexcrupuubwzbooj\njzsyjnxttliyfpunxyhsouhunenzxedi\njzsyjnxttliyfpunxyhsouhunenzxedi\njzsyjnxttliyfpunxyhsouhunenzxedi\njzsyjnxttliyfpunxyhsouhunenzxedi\njzsyjnxttliyfpunxyhsouhunenzxedi\niwexcrupuubwzbooj\niwexcrupuubwzbooj\niwexcrupuubwzbooj", "output": "OK\niwexcrupuubwzbooj1\nOK\njzsyjnxttliyfpunxyhsouhunenzxedi1\njzsyjnxttliyfpunxyhsouhunenzxedi2\njzsyjnxttliyfpunxyhsouhunenzxedi3\njzsyjnxttliyfpunxyhsouhunenzxedi4\niwexcrupuubwzbooj2\niwexcrupuubwzbooj3\niwexcrupuubwzbooj4" }, { "input": "10\nzzzzzzzzzzzzzzzzzzzzzzzzzzz\nzzzzzzzzzzzzzzzzzzzzzzzzzzz\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\nzzzzzzzzzzzzzzzzzzzzzzzzzzz\nzzzzzzzzzzzzzzzzzzzzzzzzzzz\nzzzzzzzzzzzzzzzzzzzzzzzzzzz", "output": "OK\nzzzzzzzzzzzzzzzzzzzzzzzzzzz1\nOK\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz1\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz2\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz3\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz4\nzzzzzzzzzzzzzzzzzzzzzzzzzzz2\nzzzzzzzzzzzzzzzzzzzzzzzzzzz3\nzzzzzzzzzzzzzzzzzzzzzzzzzzz4" }, { "input": "20\nzzzzzzzzz\nzzzzzzzzzzzzz\nz\nzzzzzzzzzzzzz\nzzzzzzzzz\nzzzzzzzzz\nzzzzzzzzzzzzz\nzzzzzzzzzzzzz\nzzzzzzzzzzzzzzzzzzzzzzzz\nzzzzzzzzzzzzz\nzzzzzzzzzzzzz\nzzzzzzzzzzzzzzzzzzzzzzzz\nzzzzzzzzzzzzzzzzzzzzzzzz\nzzzzzzzzzzzzz\nzzzzzzzzzzzzz\nz\nzzzzzzzzz\nzzzzzzzzz\nzzzzzzzzzzzzz\nzzzzzzzzzzzzzzzzzzzzzzzz", "output": "OK\nOK\nOK\nzzzzzzzzzzzzz1\nzzzzzzzzz1\nzzzzzzzzz2\nzzzzzzzzzzzzz2\nzzzzzzzzzzzzz3\nOK\nzzzzzzzzzzzzz4\nzzzzzzzzzzzzz5\nzzzzzzzzzzzzzzzzzzzzzzzz1\nzzzzzzzzzzzzzzzzzzzzzzzz2\nzzzzzzzzzzzzz6\nzzzzzzzzzzzzz7\nz1\nzzzzzzzzz3\nzzzzzzzzz4\nzzzzzzzzzzzzz8\nzzzzzzzzzzzzzzzzzzzzzzzz3" } ]
1,689,172,507
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
6
5,000
2,560,000
n=int(input()) l=[] ll=[] for i in range(n): x=input() l.append(x) if l.count(x)==1: ll.append('OK') else: ll.append(x+str(l.count(x)-1)) print(*ll,sep='\n')
Title: Registration System Time Limit: 5 seconds Memory Limit: 64 megabytes Problem Description: A new e-mail service "Berlandesk" is going to be opened in Berland in the near future. The site administration wants to launch their project as soon as possible, that's why they ask you to help. You're suggested to implement the prototype of site registration system. The system should work on the following principle. Each time a new user wants to register, he sends to the system a request with his name. If such a name does not exist in the system database, it is inserted into the database, and the user gets the response OK, confirming the successful registration. If the name already exists in the system database, the system makes up a new user name, sends it to the user as a prompt and also inserts the prompt into the database. The new name is formed by the following rule. Numbers, starting with 1, are appended one after another to name (name1, name2, ...), among these numbers the least *i* is found so that name*i* does not yet exist in the database. Input Specification: The first line contains number *n* (1<=≤<=*n*<=≤<=105). The following *n* lines contain the requests to the system. Each request is a non-empty line, and consists of not more than 32 characters, which are all lowercase Latin letters. Output Specification: Print *n* lines, which are system responses to the requests: OK in case of successful registration, or a prompt with a new name, if the requested name is already taken. Demo Input: ['4\nabacaba\nacaba\nabacaba\nacab\n', '6\nfirst\nfirst\nsecond\nsecond\nthird\nthird\n'] Demo Output: ['OK\nOK\nabacaba1\nOK\n', 'OK\nfirst1\nOK\nsecond1\nOK\nthird1\n'] Note: none
```python n=int(input()) l=[] ll=[] for i in range(n): x=input() l.append(x) if l.count(x)==1: ll.append('OK') else: ll.append(x+str(l.count(x)-1)) print(*ll,sep='\n') ```
0
41
A
Translation
PROGRAMMING
800
[ "implementation", "strings" ]
A. Translation
2
256
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
[ "code\nedoc\n", "abb\naba\n", "code\ncode\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
500
[ { "input": "code\nedoc", "output": "YES" }, { "input": "abb\naba", "output": "NO" }, { "input": "code\ncode", "output": "NO" }, { "input": "abacaba\nabacaba", "output": "YES" }, { "input": "q\nq", "output": "YES" }, { "input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk", "output": "NO" }, { "input": "z\na", "output": "NO" }, { "input": "asd\ndsa", "output": "YES" }, { "input": "abcdef\nfecdba", "output": "NO" }, { "input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu", "output": "NO" }, { "input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf", "output": "NO" }, { "input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp", "output": "NO" }, { "input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb", "output": "NO" }, { "input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom", "output": "NO" }, { "input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh", "output": "NO" }, { "input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy", "output": "NO" }, { "input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko", "output": "NO" }, { "input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv", "output": "NO" }, { "input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd", "output": "NO" }, { "input": "w\nw", "output": "YES" }, { "input": "vz\nzv", "output": "YES" }, { "input": "ry\nyr", "output": "YES" }, { "input": "xou\nuox", "output": "YES" }, { "input": "axg\ngax", "output": "NO" }, { "input": "zdsl\nlsdz", "output": "YES" }, { "input": "kudl\nldku", "output": "NO" }, { "input": "zzlzwnqlcl\nlclqnwzlzz", "output": "YES" }, { "input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv", "output": "YES" }, { "input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar", "output": "NO" }, { "input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn", "output": "YES" }, { "input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum", "output": "YES" }, { "input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv", "output": "YES" }, { "input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm", "output": "NO" }, { "input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd", "output": "NO" }, { "input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg", "output": "YES" }, { "input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis", "output": "YES" }, { "input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy", "output": "NO" }, { "input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw", "output": "YES" }, { "input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi", "output": "YES" }, { "input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib", "output": "YES" } ]
1,411,286,829
2,147,483,647
Python 3
OK
TESTS
40
122
0
from sys import stdin def main(): inp=stdin palabra1=inp.readline().strip() palabra2=inp.readline().strip() comparar='' for i in range(len(palabra1)-1,-1,-1): comparar+=palabra1[i] if comparar==palabra2: print("YES") else: print("NO") main()
Title: Translation Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. Input Specification: The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. Output Specification: If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. Demo Input: ['code\nedoc\n', 'abb\naba\n', 'code\ncode\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python from sys import stdin def main(): inp=stdin palabra1=inp.readline().strip() palabra2=inp.readline().strip() comparar='' for i in range(len(palabra1)-1,-1,-1): comparar+=palabra1[i] if comparar==palabra2: print("YES") else: print("NO") main() ```
3.9695
306
A
Candies
PROGRAMMING
800
[ "implementation" ]
null
null
Polycarpus has got *n* candies and *m* friends (*n*<=≥<=*m*). He wants to make a New Year present with candies to each friend. Polycarpus is planning to present all candies and he wants to do this in the fairest (that is, most equal) manner. He wants to choose such *a**i*, where *a**i* is the number of candies in the *i*-th friend's present, that the maximum *a**i* differs from the least *a**i* as little as possible. For example, if *n* is divisible by *m*, then he is going to present the same number of candies to all his friends, that is, the maximum *a**i* won't differ from the minimum one.
The single line of the input contains a pair of space-separated positive integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100;*n*<=≥<=*m*) — the number of candies and the number of Polycarpus's friends.
Print the required sequence *a*1,<=*a*2,<=...,<=*a**m*, where *a**i* is the number of candies in the *i*-th friend's present. All numbers *a**i* must be positive integers, total up to *n*, the maximum one should differ from the minimum one by the smallest possible value.
[ "12 3\n", "15 4\n", "18 7\n" ]
[ "4 4 4 ", "3 4 4 4 ", "2 2 2 3 3 3 3 " ]
Print *a*<sub class="lower-index">*i*</sub> in any order, separate the numbers by spaces.
500
[ { "input": "12 4", "output": "3 3 3 3 " }, { "input": "15 6", "output": "2 2 2 3 3 3 " }, { "input": "18 8", "output": "2 2 2 2 2 2 3 3 " }, { "input": "1 1", "output": "1 " }, { "input": "2 1", "output": "2 " }, { "input": "100 1", "output": "100 " }, { "input": "100 100", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "100 10", "output": "10 10 10 10 10 10 10 10 10 10 " }, { "input": "64 8", "output": "8 8 8 8 8 8 8 8 " }, { "input": "81 27", "output": "3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 " }, { "input": "100 99", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 " }, { "input": "100 51", "output": "1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 " }, { "input": "100 49", "output": "2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 " }, { "input": "100 13", "output": "7 7 7 7 8 8 8 8 8 8 8 8 8 " }, { "input": "97 11", "output": "8 8 9 9 9 9 9 9 9 9 9 " }, { "input": "19 3", "output": "6 6 7 " }, { "input": "99 10", "output": "9 10 10 10 10 10 10 10 10 10 " }, { "input": "88 5", "output": "17 17 18 18 18 " }, { "input": "87 34", "output": "2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 " }, { "input": "97 55", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 " } ]
1,368,309,299
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
31
0
n = int(input()) m = int(input()) x = n // m y = n%m for i in range(0, m-y): print(x) for i in range (0, y): print (x+1)
Title: Candies Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarpus has got *n* candies and *m* friends (*n*<=≥<=*m*). He wants to make a New Year present with candies to each friend. Polycarpus is planning to present all candies and he wants to do this in the fairest (that is, most equal) manner. He wants to choose such *a**i*, where *a**i* is the number of candies in the *i*-th friend's present, that the maximum *a**i* differs from the least *a**i* as little as possible. For example, if *n* is divisible by *m*, then he is going to present the same number of candies to all his friends, that is, the maximum *a**i* won't differ from the minimum one. Input Specification: The single line of the input contains a pair of space-separated positive integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100;*n*<=≥<=*m*) — the number of candies and the number of Polycarpus's friends. Output Specification: Print the required sequence *a*1,<=*a*2,<=...,<=*a**m*, where *a**i* is the number of candies in the *i*-th friend's present. All numbers *a**i* must be positive integers, total up to *n*, the maximum one should differ from the minimum one by the smallest possible value. Demo Input: ['12 3\n', '15 4\n', '18 7\n'] Demo Output: ['4 4 4 ', '3 4 4 4 ', '2 2 2 3 3 3 3 '] Note: Print *a*<sub class="lower-index">*i*</sub> in any order, separate the numbers by spaces.
```python n = int(input()) m = int(input()) x = n // m y = n%m for i in range(0, m-y): print(x) for i in range (0, y): print (x+1) ```
-1
236
A
Boy or Girl
PROGRAMMING
800
[ "brute force", "implementation", "strings" ]
null
null
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network. But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names. This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
[ "wjmzbmr\n", "xiaodao\n", "sevenkplus\n" ]
[ "CHAT WITH HER!\n", "IGNORE HIM!\n", "CHAT WITH HER!\n" ]
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
500
[ { "input": "wjmzbmr", "output": "CHAT WITH HER!" }, { "input": "xiaodao", "output": "IGNORE HIM!" }, { "input": "sevenkplus", "output": "CHAT WITH HER!" }, { "input": "pezu", "output": "CHAT WITH HER!" }, { "input": "wnemlgppy", "output": "CHAT WITH HER!" }, { "input": "zcinitufxoldnokacdvtmdohsfdjepyfioyvclhmujiqwvmudbfjzxjfqqxjmoiyxrfsbvseawwoyynn", "output": "IGNORE HIM!" }, { "input": "qsxxuoynwtebujwpxwpajitiwxaxwgbcylxneqiebzfphugwkftpaikixmumkhfbjiswmvzbtiyifbx", "output": "CHAT WITH HER!" }, { "input": "qwbdfzfylckctudyjlyrtmvbidfatdoqfmrfshsqqmhzohhsczscvwzpwyoyswhktjlykumhvaounpzwpxcspxwlgt", "output": "IGNORE HIM!" }, { "input": "nuezoadauueermoeaabjrkxttkatspjsjegjcjcdmcxgodowzbwuqncfbeqlhkk", "output": "IGNORE HIM!" }, { "input": "lggvdmulrsvtuagoavstuyufhypdxfomjlzpnduulukszqnnwfvxbvxyzmleocmofwclmzz", "output": "IGNORE HIM!" }, { "input": "tgcdptnkc", "output": "IGNORE HIM!" }, { "input": "wvfgnfrzabgibzxhzsojskmnlmrokydjoexnvi", "output": "IGNORE HIM!" }, { "input": "sxtburpzskucowowebgrbovhadrrayamuwypmmxhscrujkmcgvyinp", "output": "IGNORE HIM!" }, { "input": "pjqxhvxkyeqqvyuujxhmbspatvrckhhkfloottuybjivkkhpyivcighxumavrxzxslfpggnwbtalmhysyfllznphzia", "output": "IGNORE HIM!" }, { "input": "fpellxwskyekoyvrfnuf", "output": "CHAT WITH HER!" }, { "input": "xninyvkuvakfbs", "output": "IGNORE HIM!" }, { "input": "vnxhrweyvhqufpfywdwftoyrfgrhxuamqhblkvdpxmgvphcbeeqbqssresjifwyzgfhurmamhkwupymuomak", "output": "CHAT WITH HER!" }, { "input": "kmsk", "output": "IGNORE HIM!" }, { "input": "lqonogasrkzhryjxppjyriyfxmdfubieglthyswz", "output": "CHAT WITH HER!" }, { "input": "ndormkufcrkxlihdhmcehzoimcfhqsmombnfjrlcalffq", "output": "CHAT WITH HER!" }, { "input": "zqzlnnuwcfufwujygtczfakhcpqbtxtejrbgoodychepzdphdahtxyfpmlrycyicqthsgm", "output": "IGNORE HIM!" }, { "input": "ppcpbnhwoizajrl", "output": "IGNORE HIM!" }, { "input": "sgubujztzwkzvztitssxxxwzanfmddfqvv", "output": "CHAT WITH HER!" }, { "input": "ptkyaxycecpbrjnvxcjtbqiocqcswnmicxbvhdsptbxyxswbw", "output": "IGNORE HIM!" }, { "input": "yhbtzfppwcycxqjpqdfmjnhwaogyuaxamwxpnrdrnqsgdyfvxu", "output": "CHAT WITH HER!" }, { "input": "ojjvpnkrxibyevxk", "output": "CHAT WITH HER!" }, { "input": "wjweqcrqfuollfvfbiyriijovweg", "output": "IGNORE HIM!" }, { "input": "hkdbykboclchfdsuovvpknwqr", "output": "IGNORE HIM!" }, { "input": "stjvyfrfowopwfjdveduedqylerqugykyu", "output": "IGNORE HIM!" }, { "input": "rafcaanqytfclvfdegak", "output": "CHAT WITH HER!" }, { "input": "xczn", "output": "CHAT WITH HER!" }, { "input": "arcoaeozyeawbveoxpmafxxzdjldsielp", "output": "IGNORE HIM!" }, { "input": "smdfafbyehdylhaleevhoggiurdgeleaxkeqdixyfztkuqsculgslheqfafxyghyuibdgiuwrdxfcitojxika", "output": "CHAT WITH HER!" }, { "input": "vbpfgjqnhfazmvtkpjrdasfhsuxnpiepxfrzvoh", "output": "CHAT WITH HER!" }, { "input": "dbdokywnpqnotfrhdbrzmuyoxfdtrgrzcccninbtmoqvxfatcqg", "output": "CHAT WITH HER!" }, { "input": "udlpagtpq", "output": "CHAT WITH HER!" }, { "input": "zjurevbytijifnpfuyswfchdzelxheboruwjqijxcucylysmwtiqsqqhktexcynquvcwhbjsipy", "output": "CHAT WITH HER!" }, { "input": "qagzrqjomdwhagkhrjahhxkieijyten", "output": "CHAT WITH HER!" }, { "input": "achhcfjnnfwgoufxamcqrsontgjjhgyfzuhklkmiwybnrlsvblnsrjqdytglipxsulpnphpjpoewvlusalsgovwnsngb", "output": "CHAT WITH HER!" }, { "input": "qbkjsdwpahdbbohggbclfcufqelnojoehsxxkr", "output": "CHAT WITH HER!" }, { "input": "cpvftiwgyvnlmbkadiafddpgfpvhqqvuehkypqjsoibpiudfvpkhzlfrykc", "output": "IGNORE HIM!" }, { "input": "lnpdosnceumubvk", "output": "IGNORE HIM!" }, { "input": "efrk", "output": "CHAT WITH HER!" }, { "input": "temnownneghnrujforif", "output": "IGNORE HIM!" }, { "input": "ottnneymszwbumgobazfjyxewkjakglbfflsajuzescplpcxqta", "output": "IGNORE HIM!" }, { "input": "eswpaclodzcwhgixhpyzvhdwsgneqidanbzdzszquefh", "output": "IGNORE HIM!" }, { "input": "gwntwbpj", "output": "IGNORE HIM!" }, { "input": "wuqvlbblkddeindiiswsinkfrnkxghhwunzmmvyovpqapdfbolyim", "output": "IGNORE HIM!" }, { "input": "swdqsnzmzmsyvktukaoyqsqzgfmbzhezbfaqeywgwizrwjyzquaahucjchegknqaioliqd", "output": "CHAT WITH HER!" }, { "input": "vlhrpzezawyolhbmvxbwhtjustdbqggexmzxyieihjlelvwjosmkwesfjmramsikhkupzvfgezmrqzudjcalpjacmhykhgfhrjx", "output": "IGNORE HIM!" }, { "input": "lxxwbkrjgnqjwsnflfnsdyxihmlspgivirazsbveztnkuzpaxtygidniflyjheejelnjyjvgkgvdqks", "output": "CHAT WITH HER!" }, { "input": "wpxbxzfhtdecetpljcrvpjjnllosdqirnkzesiqeukbedkayqx", "output": "CHAT WITH HER!" }, { "input": "vmzxgacicvweclaodrunmjnfwtimceetsaoickarqyrkdghcmyjgmtgsqastcktyrjgvjqimdc", "output": "CHAT WITH HER!" }, { "input": "yzlzmesxdttfcztooypjztlgxwcr", "output": "IGNORE HIM!" }, { "input": "qpbjwzwgdzmeluheirjrvzrhbmagfsjdgvzgwumjtjzecsfkrfqjasssrhhtgdqqfydlmrktlgfc", "output": "IGNORE HIM!" }, { "input": "aqzftsvezdgouyrirsxpbuvdjupnzvbhguyayeqozfzymfnepvwgblqzvmxxkxcilmsjvcgyqykpoaktjvsxbygfgsalbjoq", "output": "CHAT WITH HER!" }, { "input": "znicjjgijhrbdlnwmtjgtdgziollrfxroabfhadygnomodaembllreorlyhnehijfyjbfxucazellblegyfrzuraogadj", "output": "IGNORE HIM!" }, { "input": "qordzrdiknsympdrkgapjxokbldorpnmnpucmwakklmqenpmkom", "output": "CHAT WITH HER!" }, { "input": "wqfldgihuxfktzanyycluzhtewmwvnawqlfoavuguhygqrrxtstxwouuzzsryjqtfqo", "output": "CHAT WITH HER!" }, { "input": "vujtrrpshinkskgyknlcfckmqdrwtklkzlyipmetjvaqxdsslkskschbalmdhzsdrrjmxdltbtnxbh", "output": "IGNORE HIM!" }, { "input": "zioixjibuhrzyrbzqcdjbbhhdmpgmqykixcxoqupggaqajuzonrpzihbsogjfsrrypbiphehonyhohsbybnnukqebopppa", "output": "CHAT WITH HER!" }, { "input": "oh", "output": "CHAT WITH HER!" }, { "input": "kxqthadqesbpgpsvpbcbznxpecqrzjoilpauttzlnxvaczcqwuri", "output": "IGNORE HIM!" }, { "input": "zwlunigqnhrwirkvufqwrnwcnkqqonebrwzcshcbqqwkjxhymjjeakuzjettebciadjlkbfp", "output": "CHAT WITH HER!" }, { "input": "fjuldpuejgmggvvigkwdyzytfxzwdlofrpifqpdnhfyroginqaufwgjcbgshyyruwhofctsdaisqpjxqjmtpp", "output": "CHAT WITH HER!" }, { "input": "xiwntnheuitbtqxrmzvxmieldudakogealwrpygbxsbluhsqhtwmdlpjwzyafckrqrdduonkgo", "output": "CHAT WITH HER!" }, { "input": "mnmbupgo", "output": "IGNORE HIM!" }, { "input": "mcjehdiygkbmrbfjqwpwxidbdfelifwhstaxdapigbymmsgrhnzsdjhsqchl", "output": "IGNORE HIM!" }, { "input": "yocxrzspinchmhtmqo", "output": "CHAT WITH HER!" }, { "input": "vasvvnpymtgjirnzuynluluvmgpquskuaafwogeztfnvybblajvuuvfomtifeuzpikjrolzeeoftv", "output": "CHAT WITH HER!" }, { "input": "ecsdicrznvglwggrdbrvehwzaenzjutjydhvimtqegweurpxtjkmpcznshtrvotkvrghxhacjkedidqqzrduzad", "output": "IGNORE HIM!" }, { "input": "ubvhyaebyxoghakajqrpqpctwbrfqzli", "output": "CHAT WITH HER!" }, { "input": "gogbxfeqylxoummvgxpkoqzsmobasesxbqjjktqbwqxeiaagnnhbvepbpy", "output": "IGNORE HIM!" }, { "input": "nheihhxkbbrmlpxpxbhnpofcjmxemyvqqdbanwd", "output": "IGNORE HIM!" }, { "input": "acrzbavz", "output": "CHAT WITH HER!" }, { "input": "drvzznznvrzskftnrhvvzxcalwutxmdza", "output": "IGNORE HIM!" }, { "input": "oacwxipdfcoabhkwxqdbtowiekpnflnqhlrkustgzryvws", "output": "CHAT WITH HER!" }, { "input": "tpnwfmfsibnccvdwjvzviyvjfljupinfigfunyff", "output": "CHAT WITH HER!" }, { "input": "gavaihhamfolcndgytcsgucqdqngxkrlovpthvteacmmthoglxu", "output": "CHAT WITH HER!" }, { "input": "hsfcfvameeupldgvchmogrvwxrvsmnwxxkxoawwodtsahqvehlcw", "output": "IGNORE HIM!" }, { "input": "sbkydrscoojychxchqsuciperfroumenelgiyiwlqfwximrgdbyvkmacy", "output": "CHAT WITH HER!" }, { "input": "rhh", "output": "CHAT WITH HER!" }, { "input": "zhdouqfmlkenjzdijxdfxnlegxeuvhelo", "output": "IGNORE HIM!" }, { "input": "yufkkfwyhhvcjntsgsvpzbhqtmtgyxifqoewmuplphykmptfdebjxuaxigomjtwgtljwdjhjernkitifbomifbhysnmadtnyn", "output": "CHAT WITH HER!" }, { "input": "urigreuzpxnej", "output": "CHAT WITH HER!" } ]
1,698,664,993
2,147,483,647
PyPy 3-64
OK
TESTS
85
124
0
print(["CHAT WITH HER!", "IGNORE HIM!"][len(set(input())) % 2])
Title: Boy or Girl Time Limit: None seconds Memory Limit: None megabytes Problem Description: Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network. But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names. This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method. Input Specification: The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters. Output Specification: If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes). Demo Input: ['wjmzbmr\n', 'xiaodao\n', 'sevenkplus\n'] Demo Output: ['CHAT WITH HER!\n', 'IGNORE HIM!\n', 'CHAT WITH HER!\n'] Note: For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
```python print(["CHAT WITH HER!", "IGNORE HIM!"][len(set(input())) % 2]) ```
3
71
A
Way Too Long Words
PROGRAMMING
800
[ "strings" ]
A. Way Too Long Words
1
256
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome. Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation. This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes. Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n". You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
[ "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n" ]
[ "word\nl10n\ni18n\np43s\n" ]
none
500
[ { "input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis", "output": "word\nl10n\ni18n\np43s" }, { "input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm", "output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m" }, { "input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd", "output": "n20n\nj27b\nk15d" }, { "input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt", "output": "t41t" }, { "input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings", "output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings" }, { "input": "1\na", "output": "a" }, { "input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz", "output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz" }, { "input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij", "output": "a98j" }, { "input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco", "output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco" }, { "input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt", "output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t" }, { "input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr", "output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr" } ]
1,683,387,395
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
30
0
x=int(input()) for i in range(x): y=input() a=len(y) if a>10: print(y[0]+a-2+y[a-1]) continue else: print(y) continue
Title: Way Too Long Words Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome. Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation. This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes. Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n". You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. Output Specification: Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. Demo Input: ['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n'] Demo Output: ['word\nl10n\ni18n\np43s\n'] Note: none
```python x=int(input()) for i in range(x): y=input() a=len(y) if a>10: print(y[0]+a-2+y[a-1]) continue else: print(y) continue ```
-1
867
A
Between the Offices
PROGRAMMING
800
[ "implementation" ]
null
null
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane. You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days. The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise. You can print each letter in any case (upper or lower).
[ "4\nFSSF\n", "2\nSF\n", "10\nFFFFFFFFFF\n", "10\nSSFFSFFSFF\n" ]
[ "NO\n", "YES\n", "NO\n", "YES\n" ]
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO". In the second example you just flew from Seattle to San Francisco, so the answer is "YES". In the third example you stayed the whole period in San Francisco, so the answer is "NO". In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
500
[ { "input": "4\nFSSF", "output": "NO" }, { "input": "2\nSF", "output": "YES" }, { "input": "10\nFFFFFFFFFF", "output": "NO" }, { "input": "10\nSSFFSFFSFF", "output": "YES" }, { "input": "20\nSFSFFFFSSFFFFSSSSFSS", "output": "NO" }, { "input": "20\nSSFFFFFSFFFFFFFFFFFF", "output": "YES" }, { "input": "20\nSSFSFSFSFSFSFSFSSFSF", "output": "YES" }, { "input": "20\nSSSSFSFSSFSFSSSSSSFS", "output": "NO" }, { "input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF", "output": "NO" }, { "input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF", "output": "YES" }, { "input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS", "output": "NO" }, { "input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS", "output": "NO" }, { "input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS", "output": "NO" }, { "input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS", "output": "NO" }, { "input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS", "output": "NO" }, { "input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS", "output": "NO" }, { "input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS", "output": "NO" }, { "input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "YES" }, { "input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "YES" }, { "input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF", "output": "YES" }, { "input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF", "output": "YES" }, { "input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF", "output": "YES" }, { "input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF", "output": "YES" }, { "input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF", "output": "YES" }, { "input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF", "output": "YES" }, { "input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF", "output": "YES" }, { "input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF", "output": "YES" }, { "input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF", "output": "YES" }, { "input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF", "output": "YES" }, { "input": "2\nSS", "output": "NO" } ]
1,615,814,316
2,147,483,647
PyPy 3
OK
TESTS
34
93
0
n = int(input()) S = input() countTrue = 0 countFalse = 0 for i in range(1, len(S)): if S[i-1] == "S" and S[i] == "F": countTrue += 1 if S[i-1] == "F" and S[i] == "S": countFalse += 1 # print(countTrue, countFalse) if countTrue > countFalse: print("YES") else: print("NO")
Title: Between the Offices Time Limit: None seconds Memory Limit: None megabytes Problem Description: As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane. You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not. Input Specification: The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days. The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence. Output Specification: Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise. You can print each letter in any case (upper or lower). Demo Input: ['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n'] Demo Output: ['NO\n', 'YES\n', 'NO\n', 'YES\n'] Note: In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO". In the second example you just flew from Seattle to San Francisco, so the answer is "YES". In the third example you stayed the whole period in San Francisco, so the answer is "NO". In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
```python n = int(input()) S = input() countTrue = 0 countFalse = 0 for i in range(1, len(S)): if S[i-1] == "S" and S[i] == "F": countTrue += 1 if S[i-1] == "F" and S[i] == "S": countFalse += 1 # print(countTrue, countFalse) if countTrue > countFalse: print("YES") else: print("NO") ```
3
650
A
Watchmen
PROGRAMMING
1,400
[ "data structures", "geometry", "math" ]
null
null
Watchmen are in a danger and Doctor Manhattan together with his friend Daniel Dreiberg should warn them as soon as possible. There are *n* watchmen on a plane, the *i*-th watchman is located at point (*x**i*,<=*y**i*). They need to arrange a plan, but there are some difficulties on their way. As you know, Doctor Manhattan considers the distance between watchmen *i* and *j* to be |*x**i*<=-<=*x**j*|<=+<=|*y**i*<=-<=*y**j*|. Daniel, as an ordinary person, calculates the distance using the formula . The success of the operation relies on the number of pairs (*i*,<=*j*) (1<=≤<=*i*<=&lt;<=*j*<=≤<=*n*), such that the distance between watchman *i* and watchmen *j* calculated by Doctor Manhattan is equal to the distance between them calculated by Daniel. You were asked to compute the number of such pairs.
The first line of the input contains the single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of watchmen. Each of the following *n* lines contains two integers *x**i* and *y**i* (|*x**i*|,<=|*y**i*|<=≤<=109). Some positions may coincide.
Print the number of pairs of watchmen such that the distance between them calculated by Doctor Manhattan is equal to the distance calculated by Daniel.
[ "3\n1 1\n7 5\n1 5\n", "6\n0 0\n0 1\n0 2\n-1 1\n0 1\n1 1\n" ]
[ "2\n", "11\n" ]
In the first sample, the distance between watchman 1 and watchman 2 is equal to |1 - 7| + |1 - 5| = 10 for Doctor Manhattan and <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/bcb5b7064b5f02088da0fdcf677e6fda495dd0df.png" style="max-width: 100.0%;max-height: 100.0%;"/> for Daniel. For pairs (1, 1), (1, 5) and (7, 5), (1, 5) Doctor Manhattan and Daniel will calculate the same distances.
500
[ { "input": "3\n1 1\n7 5\n1 5", "output": "2" }, { "input": "6\n0 0\n0 1\n0 2\n-1 1\n0 1\n1 1", "output": "11" }, { "input": "10\n46 -55\n46 45\n46 45\n83 -55\n46 45\n83 -55\n46 45\n83 45\n83 45\n46 -55", "output": "33" }, { "input": "1\n-5 -90", "output": "0" }, { "input": "2\n315 845\n-669 -762", "output": "0" }, { "input": "3\n8911 7861\n-6888 7861\n8911 7861", "output": "3" }, { "input": "2\n-1 1000000000\n0 -1", "output": "0" }, { "input": "2\n1000000000 0\n-7 1", "output": "0" }, { "input": "2\n1 4\n2 1", "output": "0" }, { "input": "2\n1 0\n0 2333333", "output": "0" }, { "input": "2\n2 1\n1 2", "output": "0" }, { "input": "2\n1 1000000000\n2 -1000000000", "output": "0" }, { "input": "2\n0 1000000000\n1 -7", "output": "0" }, { "input": "2\n1 0\n0 19990213", "output": "0" } ]
1,663,598,507
2,147,483,647
PyPy 3-64
TIME_LIMIT_EXCEEDED
TESTS
9
3,000
29,286,400
def main() -> int: n = int(input()) # количество хранителей my_list, result = [], 0 for i in range(n): my_list.append(tuple([int(x) for x in input().split(" ")])) # количество углов my_list = tuple(my_list) for i in range(n -1): for k in range(i + 1, n): if my_list[i][0] == my_list[k][0] or my_list[i][1] == my_list[k][1]: result += 1 return result if __name__ == '__main__': print(main())
Title: Watchmen Time Limit: None seconds Memory Limit: None megabytes Problem Description: Watchmen are in a danger and Doctor Manhattan together with his friend Daniel Dreiberg should warn them as soon as possible. There are *n* watchmen on a plane, the *i*-th watchman is located at point (*x**i*,<=*y**i*). They need to arrange a plan, but there are some difficulties on their way. As you know, Doctor Manhattan considers the distance between watchmen *i* and *j* to be |*x**i*<=-<=*x**j*|<=+<=|*y**i*<=-<=*y**j*|. Daniel, as an ordinary person, calculates the distance using the formula . The success of the operation relies on the number of pairs (*i*,<=*j*) (1<=≤<=*i*<=&lt;<=*j*<=≤<=*n*), such that the distance between watchman *i* and watchmen *j* calculated by Doctor Manhattan is equal to the distance between them calculated by Daniel. You were asked to compute the number of such pairs. Input Specification: The first line of the input contains the single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of watchmen. Each of the following *n* lines contains two integers *x**i* and *y**i* (|*x**i*|,<=|*y**i*|<=≤<=109). Some positions may coincide. Output Specification: Print the number of pairs of watchmen such that the distance between them calculated by Doctor Manhattan is equal to the distance calculated by Daniel. Demo Input: ['3\n1 1\n7 5\n1 5\n', '6\n0 0\n0 1\n0 2\n-1 1\n0 1\n1 1\n'] Demo Output: ['2\n', '11\n'] Note: In the first sample, the distance between watchman 1 and watchman 2 is equal to |1 - 7| + |1 - 5| = 10 for Doctor Manhattan and <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/bcb5b7064b5f02088da0fdcf677e6fda495dd0df.png" style="max-width: 100.0%;max-height: 100.0%;"/> for Daniel. For pairs (1, 1), (1, 5) and (7, 5), (1, 5) Doctor Manhattan and Daniel will calculate the same distances.
```python def main() -> int: n = int(input()) # количество хранителей my_list, result = [], 0 for i in range(n): my_list.append(tuple([int(x) for x in input().split(" ")])) # количество углов my_list = tuple(my_list) for i in range(n -1): for k in range(i + 1, n): if my_list[i][0] == my_list[k][0] or my_list[i][1] == my_list[k][1]: result += 1 return result if __name__ == '__main__': print(main()) ```
0
873
C
Strange Game On Matrix
PROGRAMMING
1,600
[ "greedy", "two pointers" ]
null
null
Ivan is playing a strange game. He has a matrix *a* with *n* rows and *m* columns. Each element of the matrix is equal to either 0 or 1. Rows and columns are 1-indexed. Ivan can replace any number of ones in this matrix with zeroes. After that, his score in the game will be calculated as follows: 1. Initially Ivan's score is 0; 1. In each column, Ivan will find the topmost 1 (that is, if the current column is *j*, then he will find minimum *i* such that *a**i*,<=*j*<==<=1). If there are no 1's in the column, this column is skipped; 1. Ivan will look at the next *min*(*k*,<=*n*<=-<=*i*<=+<=1) elements in this column (starting from the element he found) and count the number of 1's among these elements. This number will be added to his score. Of course, Ivan wants to maximize his score in this strange game. Also he doesn't want to change many elements, so he will replace the minimum possible number of ones with zeroes. Help him to determine the maximum possible score he can get and the minimum possible number of replacements required to achieve that score.
The first line contains three integer numbers *n*, *m* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100, 1<=≤<=*m*<=≤<=100). Then *n* lines follow, *i*-th of them contains *m* integer numbers — the elements of *i*-th row of matrix *a*. Each number is either 0 or 1.
Print two numbers: the maximum possible score Ivan can get and the minimum number of replacements required to get this score.
[ "4 3 2\n0 1 0\n1 0 1\n0 1 0\n1 1 1\n", "3 2 1\n1 0\n0 1\n0 0\n" ]
[ "4 1\n", "2 0\n" ]
In the first example Ivan will replace the element *a*<sub class="lower-index">1, 2</sub>.
0
[ { "input": "4 3 2\n0 1 0\n1 0 1\n0 1 0\n1 1 1", "output": "4 1" }, { "input": "3 2 1\n1 0\n0 1\n0 0", "output": "2 0" }, { "input": "3 4 2\n0 1 1 1\n1 0 1 1\n1 0 0 1", "output": "7 0" }, { "input": "3 57 3\n1 0 0 1 1 0 1 1 0 0 0 0 1 0 1 0 0 0 0 0 0 1 0 0 0 0 1 0 0 1 1 0 1 1 1 1 0 1 1 1 0 0 0 1 1 0 0 1 0 0 0 1 1 0 0 1 0\n1 1 0 0 0 1 1 1 0 1 1 0 0 0 0 1 1 0 0 1 0 0 1 1 1 0 1 0 0 0 0 1 1 1 0 0 0 1 0 1 0 0 0 1 1 0 0 0 1 1 0 0 1 1 0 0 0\n1 0 1 0 0 1 1 0 1 0 0 0 1 0 1 0 1 0 1 1 1 1 0 1 0 0 0 1 1 1 1 0 1 1 1 0 1 0 0 0 0 0 0 1 1 1 1 0 1 1 1 0 0 1 1 0 1", "output": "80 0" }, { "input": "1 1 1\n1", "output": "1 0" }, { "input": "1 1 1\n0", "output": "0 0" }, { "input": "2 2 1\n0 1\n1 0", "output": "2 0" }, { "input": "100 1 20\n0\n0\n0\n1\n1\n0\n0\n0\n1\n1\n0\n1\n0\n1\n1\n0\n1\n1\n0\n1\n0\n1\n1\n0\n1\n0\n1\n0\n0\n0\n0\n0\n1\n0\n0\n0\n0\n1\n1\n0\n1\n0\n1\n1\n1\n0\n0\n0\n0\n1\n1\n1\n0\n0\n0\n0\n0\n1\n0\n0\n1\n1\n1\n1\n1\n0\n0\n1\n0\n1\n0\n1\n0\n1\n0\n0\n0\n1\n1\n1\n1\n1\n1\n0\n0\n1\n1\n0\n1\n0\n0\n0\n0\n1\n1\n1\n1\n1\n0\n1", "output": "13 34" }, { "input": "1 100 1\n0 0 1 1 1 0 1 0 0 0 0 0 1 1 0 0 0 0 1 1 0 1 1 0 0 1 1 0 0 1 1 1 1 1 0 1 1 1 1 1 1 0 0 1 1 0 1 1 1 1 1 0 1 0 1 0 1 0 1 0 1 1 0 0 0 0 0 0 0 1 0 1 0 0 1 0 0 0 1 1 1 1 1 0 0 1 0 1 1 1 0 1 0 0 1 0 0 1 1 1", "output": "53 0" } ]
1,692,167,366
2,147,483,647
PyPy 3
OK
TESTS
20
108
1,945,600
n, m, k = map(int, input().split()) a = [] for _ in range(n): a.append(list(map(int, input().split()))) total = 0 count = 0 for col in range(m): b = [0] * n b[0] = a[0][col] for row in range(1, n): b[row] = b[row - 1] + a[row][col] maxSum = 0 chg = 0 for row in range(n): if a[row][col] == 0: continue s = b[row - 1] if row > 0 else 0 f = b[row + k - 1] if row + k - 1 <= n - 1 else b[n - 1] sum_val = f - s if sum_val > maxSum: chg = s maxSum = sum_val total += maxSum count += chg print(total, count) ###From jasnah bobb31 ###From jasnah bobb31 ###From jasnah bobb31
Title: Strange Game On Matrix Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ivan is playing a strange game. He has a matrix *a* with *n* rows and *m* columns. Each element of the matrix is equal to either 0 or 1. Rows and columns are 1-indexed. Ivan can replace any number of ones in this matrix with zeroes. After that, his score in the game will be calculated as follows: 1. Initially Ivan's score is 0; 1. In each column, Ivan will find the topmost 1 (that is, if the current column is *j*, then he will find minimum *i* such that *a**i*,<=*j*<==<=1). If there are no 1's in the column, this column is skipped; 1. Ivan will look at the next *min*(*k*,<=*n*<=-<=*i*<=+<=1) elements in this column (starting from the element he found) and count the number of 1's among these elements. This number will be added to his score. Of course, Ivan wants to maximize his score in this strange game. Also he doesn't want to change many elements, so he will replace the minimum possible number of ones with zeroes. Help him to determine the maximum possible score he can get and the minimum possible number of replacements required to achieve that score. Input Specification: The first line contains three integer numbers *n*, *m* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100, 1<=≤<=*m*<=≤<=100). Then *n* lines follow, *i*-th of them contains *m* integer numbers — the elements of *i*-th row of matrix *a*. Each number is either 0 or 1. Output Specification: Print two numbers: the maximum possible score Ivan can get and the minimum number of replacements required to get this score. Demo Input: ['4 3 2\n0 1 0\n1 0 1\n0 1 0\n1 1 1\n', '3 2 1\n1 0\n0 1\n0 0\n'] Demo Output: ['4 1\n', '2 0\n'] Note: In the first example Ivan will replace the element *a*<sub class="lower-index">1, 2</sub>.
```python n, m, k = map(int, input().split()) a = [] for _ in range(n): a.append(list(map(int, input().split()))) total = 0 count = 0 for col in range(m): b = [0] * n b[0] = a[0][col] for row in range(1, n): b[row] = b[row - 1] + a[row][col] maxSum = 0 chg = 0 for row in range(n): if a[row][col] == 0: continue s = b[row - 1] if row > 0 else 0 f = b[row + k - 1] if row + k - 1 <= n - 1 else b[n - 1] sum_val = f - s if sum_val > maxSum: chg = s maxSum = sum_val total += maxSum count += chg print(total, count) ###From jasnah bobb31 ###From jasnah bobb31 ###From jasnah bobb31 ```
3
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,677,909,008
2,147,483,647
PyPy 3-64
COMPILATION_ERROR
TESTS
0
0
0
a=input() q=0 w=0 for x in a: x=x.istitle() if x==True: q=q+1 else: w=w+1 if q>w: print(a.upper()) else: print(a.lower())
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python a=input() q=0 w=0 for x in a: x=x.istitle() if x==True: q=q+1 else: w=w+1 if q>w: print(a.upper()) else: print(a.lower()) ```
-1
417
B
Crash
PROGRAMMING
1,400
[ "implementation" ]
null
null
During the "Russian Code Cup" programming competition, the testing system stores all sent solutions for each participant. We know that many participants use random numbers in their programs and are often sent several solutions with the same source code to check. Each participant is identified by some unique positive integer *k*, and each sent solution *A* is characterized by two numbers: *x* — the number of different solutions that are sent before the first solution identical to *A*, and *k* — the number of the participant, who is the author of the solution. Consequently, all identical solutions have the same *x*. It is known that the data in the testing system are stored in the chronological order, that is, if the testing system has a solution with number *x* (*x*<=&gt;<=0) of the participant with number *k*, then the testing system has a solution with number *x*<=-<=1 of the same participant stored somewhere before. During the competition the checking system crashed, but then the data of the submissions of all participants have been restored. Now the jury wants to verify that the recovered data is in chronological order. Help the jury to do so.
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of solutions. Each of the following *n* lines contains two integers separated by space *x* and *k* (0<=≤<=*x*<=≤<=105; 1<=≤<=*k*<=≤<=105) — the number of previous unique solutions and the identifier of the participant.
A single line of the output should contain «YES» if the data is in chronological order, and «NO» otherwise.
[ "2\n0 1\n1 1\n", "4\n0 1\n1 2\n1 1\n0 2\n", "4\n0 1\n1 1\n0 1\n0 2\n" ]
[ "YES\n", "NO\n", "YES\n" ]
none
1,000
[ { "input": "2\n0 1\n1 1", "output": "YES" }, { "input": "4\n0 1\n1 2\n1 1\n0 2", "output": "NO" }, { "input": "4\n0 1\n1 1\n0 1\n0 2", "output": "YES" }, { "input": "4\n7 1\n4 2\n8 2\n1 8", "output": "NO" }, { "input": "2\n0 8\n0 5", "output": "YES" }, { "input": "3\n7 9\n5 8\n8 2", "output": "NO" }, { "input": "1\n0 8", "output": "YES" }, { "input": "5\n8 10\n7 9\n5 6\n5 2\n10 7", "output": "NO" }, { "input": "7\n0 2\n0 3\n0 2\n0 1\n0 10\n1 10\n0 5", "output": "YES" }, { "input": "6\n0 1\n1 1\n2 1\n1 1\n2 1\n4 1", "output": "NO" }, { "input": "4\n0 1\n1 1\n0 1\n2 1", "output": "YES" }, { "input": "6\n0 1\n1 1\n2 1\n3 1\n4 1\n2 1", "output": "YES" }, { "input": "3\n0 1\n0 1\n2 1", "output": "NO" }, { "input": "1\n1 100000", "output": "NO" }, { "input": "2\n99 1\n99 1", "output": "NO" }, { "input": "4\n0 1\n0 2\n1 1\n1 2", "output": "YES" }, { "input": "4\n0 1\n0 2\n1 1\n2 1", "output": "YES" }, { "input": "5\n0 1\n1 1\n2 1\n1 1\n3 1", "output": "YES" }, { "input": "4\n0 1\n1 100000\n1 1\n0 100000", "output": "NO" }, { "input": "5\n0 1\n1 1\n2 1\n3 1\n1 1", "output": "YES" }, { "input": "3\n0 1\n0 2\n1 1", "output": "YES" }, { "input": "5\n0 1\n1 1\n2 1\n0 1\n4 1", "output": "NO" }, { "input": "1\n2 1", "output": "NO" }, { "input": "6\n0 1\n1 1\n2 1\n0 1\n3 1\n4 1", "output": "YES" } ]
1,697,807,799
2,147,483,647
PyPy 3-64
OK
TESTS
45
607
7,680,000
n = int(input()) c = [-1] * 100001 for i in range(n): x, k = map(int, input().split()) if x > c[k] + 1: print('NO') break c[k] = max(c[k], x) else: print('YES')# 1697807799.4821746
Title: Crash Time Limit: None seconds Memory Limit: None megabytes Problem Description: During the "Russian Code Cup" programming competition, the testing system stores all sent solutions for each participant. We know that many participants use random numbers in their programs and are often sent several solutions with the same source code to check. Each participant is identified by some unique positive integer *k*, and each sent solution *A* is characterized by two numbers: *x* — the number of different solutions that are sent before the first solution identical to *A*, and *k* — the number of the participant, who is the author of the solution. Consequently, all identical solutions have the same *x*. It is known that the data in the testing system are stored in the chronological order, that is, if the testing system has a solution with number *x* (*x*<=&gt;<=0) of the participant with number *k*, then the testing system has a solution with number *x*<=-<=1 of the same participant stored somewhere before. During the competition the checking system crashed, but then the data of the submissions of all participants have been restored. Now the jury wants to verify that the recovered data is in chronological order. Help the jury to do so. Input Specification: The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of solutions. Each of the following *n* lines contains two integers separated by space *x* and *k* (0<=≤<=*x*<=≤<=105; 1<=≤<=*k*<=≤<=105) — the number of previous unique solutions and the identifier of the participant. Output Specification: A single line of the output should contain «YES» if the data is in chronological order, and «NO» otherwise. Demo Input: ['2\n0 1\n1 1\n', '4\n0 1\n1 2\n1 1\n0 2\n', '4\n0 1\n1 1\n0 1\n0 2\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: none
```python n = int(input()) c = [-1] * 100001 for i in range(n): x, k = map(int, input().split()) if x > c[k] + 1: print('NO') break c[k] = max(c[k], x) else: print('YES')# 1697807799.4821746 ```
3
621
B
Wet Shark and Bishops
PROGRAMMING
1,300
[ "combinatorics", "implementation" ]
null
null
Today, Wet Shark is given *n* bishops on a 1000 by 1000 grid. Both rows and columns of the grid are numbered from 1 to 1000. Rows are numbered from top to bottom, while columns are numbered from left to right. Wet Shark thinks that two bishops attack each other if they share the same diagonal. Note, that this is the only criteria, so two bishops may attack each other (according to Wet Shark) even if there is another bishop located between them. Now Wet Shark wants to count the number of pairs of bishops that attack each other.
The first line of the input contains *n* (1<=≤<=*n*<=≤<=200<=000) — the number of bishops. Each of next *n* lines contains two space separated integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the number of row and the number of column where *i*-th bishop is positioned. It's guaranteed that no two bishops share the same position.
Output one integer — the number of pairs of bishops which attack each other.
[ "5\n1 1\n1 5\n3 3\n5 1\n5 5\n", "3\n1 1\n2 3\n3 5\n" ]
[ "6\n", "0\n" ]
In the first sample following pairs of bishops attack each other: (1, 3), (1, 5), (2, 3), (2, 4), (3, 4) and (3, 5). Pairs (1, 2), (1, 4), (2, 5) and (4, 5) do not attack each other because they do not share the same diagonal.
1,000
[ { "input": "5\n1 1\n1 5\n3 3\n5 1\n5 5", "output": "6" }, { "input": "3\n1 1\n2 3\n3 5", "output": "0" }, { "input": "3\n859 96\n634 248\n808 72", "output": "0" }, { "input": "3\n987 237\n891 429\n358 145", "output": "0" }, { "input": "3\n411 81\n149 907\n611 114", "output": "0" }, { "input": "3\n539 221\n895 89\n673 890", "output": "0" }, { "input": "3\n259 770\n448 54\n926 667", "output": "0" }, { "input": "3\n387 422\n898 532\n988 636", "output": "0" }, { "input": "10\n515 563\n451 713\n537 709\n343 819\n855 779\n457 60\n650 359\n631 42\n788 639\n710 709", "output": "0" }, { "input": "10\n939 407\n197 191\n791 486\n30 807\n11 665\n600 100\n445 496\n658 959\n510 389\n729 950", "output": "0" }, { "input": "10\n518 518\n71 971\n121 862\n967 607\n138 754\n513 337\n499 873\n337 387\n647 917\n76 417", "output": "0" }, { "input": "10\n646 171\n816 449\n375 934\n950 299\n702 232\n657 81\n885 306\n660 304\n369 371\n798 657", "output": "0" }, { "input": "10\n70 311\n74 927\n732 711\n126 583\n857 118\n97 928\n975 843\n175 221\n284 929\n816 602", "output": "0" }, { "input": "2\n1 1\n1 1000", "output": "0" }, { "input": "2\n1 1\n1000 1", "output": "0" }, { "input": "2\n1 1\n1000 1000", "output": "1" }, { "input": "2\n1000 1\n1 1000", "output": "1" }, { "input": "2\n1000 1\n1000 1000", "output": "0" }, { "input": "2\n1 1000\n1000 1000", "output": "0" }, { "input": "1\n6 3", "output": "0" }, { "input": "1\n1 1", "output": "0" }, { "input": "1\n1 1000", "output": "0" }, { "input": "1\n1000 1", "output": "0" }, { "input": "1\n1000 1000", "output": "0" }, { "input": "2\n1 1\n3 1", "output": "0" }, { "input": "2\n999 1\n1000 2", "output": "1" }, { "input": "5\n1 1000\n2 999\n3 998\n4 997\n5 996", "output": "10" } ]
1,573,749,861
2,147,483,647
PyPy 3
OK
TESTS
68
1,497
9,113,600
n = int(input()) a = [0] * 2001 b = [0] * 2001 for i in range(n): x, y = map(int, input().split()) a[x - y] += 1 b[x + y] += 1 ans = 0 for i in range(2001): ans += a[i] * (a[i] - 1) // 2 ans += b[i] * (b[i] - 1) // 2 print(ans)
Title: Wet Shark and Bishops Time Limit: None seconds Memory Limit: None megabytes Problem Description: Today, Wet Shark is given *n* bishops on a 1000 by 1000 grid. Both rows and columns of the grid are numbered from 1 to 1000. Rows are numbered from top to bottom, while columns are numbered from left to right. Wet Shark thinks that two bishops attack each other if they share the same diagonal. Note, that this is the only criteria, so two bishops may attack each other (according to Wet Shark) even if there is another bishop located between them. Now Wet Shark wants to count the number of pairs of bishops that attack each other. Input Specification: The first line of the input contains *n* (1<=≤<=*n*<=≤<=200<=000) — the number of bishops. Each of next *n* lines contains two space separated integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the number of row and the number of column where *i*-th bishop is positioned. It's guaranteed that no two bishops share the same position. Output Specification: Output one integer — the number of pairs of bishops which attack each other. Demo Input: ['5\n1 1\n1 5\n3 3\n5 1\n5 5\n', '3\n1 1\n2 3\n3 5\n'] Demo Output: ['6\n', '0\n'] Note: In the first sample following pairs of bishops attack each other: (1, 3), (1, 5), (2, 3), (2, 4), (3, 4) and (3, 5). Pairs (1, 2), (1, 4), (2, 5) and (4, 5) do not attack each other because they do not share the same diagonal.
```python n = int(input()) a = [0] * 2001 b = [0] * 2001 for i in range(n): x, y = map(int, input().split()) a[x - y] += 1 b[x + y] += 1 ans = 0 for i in range(2001): ans += a[i] * (a[i] - 1) // 2 ans += b[i] * (b[i] - 1) // 2 print(ans) ```
3
58
A
Chat room
PROGRAMMING
1,000
[ "greedy", "strings" ]
A. Chat room
1
256
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
If Vasya managed to say hello, print "YES", otherwise print "NO".
[ "ahhellllloou\n", "hlelo\n" ]
[ "YES\n", "NO\n" ]
none
500
[ { "input": "ahhellllloou", "output": "YES" }, { "input": "hlelo", "output": "NO" }, { "input": "helhcludoo", "output": "YES" }, { "input": "hehwelloho", "output": "YES" }, { "input": "pnnepelqomhhheollvlo", "output": "YES" }, { "input": "tymbzjyqhymedasloqbq", "output": "NO" }, { "input": "yehluhlkwo", "output": "NO" }, { "input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello", "output": "YES" }, { "input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq", "output": "YES" }, { "input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi", "output": "YES" }, { "input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo", "output": "YES" }, { "input": "lqllcolohwflhfhlnaow", "output": "NO" }, { "input": "heheeellollvoo", "output": "YES" }, { "input": "hellooo", "output": "YES" }, { "input": "o", "output": "NO" }, { "input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv", "output": "YES" }, { "input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk", "output": "YES" }, { "input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry", "output": "NO" }, { "input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq", "output": "NO" }, { "input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi", "output": "YES" }, { "input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm", "output": "YES" }, { "input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac", "output": "NO" }, { "input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok", "output": "YES" }, { "input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz", "output": "YES" }, { "input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb", "output": "YES" }, { "input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla", "output": "YES" }, { "input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz", "output": "YES" }, { "input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti", "output": "YES" }, { "input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli", "output": "YES" }, { "input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo", "output": "YES" }, { "input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk", "output": "NO" }, { "input": "loee", "output": "NO" }, { "input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo", "output": "NO" }, { "input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi", "output": "YES" }, { "input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv", "output": "NO" }, { "input": "hello", "output": "YES" }, { "input": "oohell", "output": "NO" }, { "input": "hell", "output": "NO" }, { "input": "eloellohoelo", "output": "NO" }, { "input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo", "output": "YES" } ]
1,588,865,495
2,147,483,647
Python 3
OK
TESTS
40
108
6,656,000
s=input() x="hello" k=0 y=0 for i in range(0,len(s)): if s[i]==x[k]: k+=1 y+=1 if y==5: break else: continue else: continue if y==5: print("YES") else: print("NO")
Title: Chat room Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*. Input Specification: The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters. Output Specification: If Vasya managed to say hello, print "YES", otherwise print "NO". Demo Input: ['ahhellllloou\n', 'hlelo\n'] Demo Output: ['YES\n', 'NO\n'] Note: none
```python s=input() x="hello" k=0 y=0 for i in range(0,len(s)): if s[i]==x[k]: k+=1 y+=1 if y==5: break else: continue else: continue if y==5: print("YES") else: print("NO") ```
3.933602
729
D
Sea Battle
PROGRAMMING
1,700
[ "constructive algorithms", "greedy", "math" ]
null
null
Galya is playing one-dimensional Sea Battle on a 1<=×<=*n* grid. In this game *a* ships are placed on the grid. Each of the ships consists of *b* consecutive cells. No cell can be part of two ships, however, the ships can touch each other. Galya doesn't know the ships location. She can shoot to some cells and after each shot she is told if that cell was a part of some ship (this case is called "hit") or not (this case is called "miss"). Galya has already made *k* shots, all of them were misses. Your task is to calculate the minimum number of cells such that if Galya shoot at all of them, she would hit at least one ship. It is guaranteed that there is at least one valid ships placement.
The first line contains four positive integers *n*, *a*, *b*, *k* (1<=≤<=*n*<=≤<=2·105, 1<=≤<=*a*,<=*b*<=≤<=*n*, 0<=≤<=*k*<=≤<=*n*<=-<=1) — the length of the grid, the number of ships on the grid, the length of each ship and the number of shots Galya has already made. The second line contains a string of length *n*, consisting of zeros and ones. If the *i*-th character is one, Galya has already made a shot to this cell. Otherwise, she hasn't. It is guaranteed that there are exactly *k* ones in this string.
In the first line print the minimum number of cells such that if Galya shoot at all of them, she would hit at least one ship. In the second line print the cells Galya should shoot at. Each cell should be printed exactly once. You can print the cells in arbitrary order. The cells are numbered from 1 to *n*, starting from the left. If there are multiple answers, you can print any of them.
[ "5 1 2 1\n00100\n", "13 3 2 3\n1000000010001\n" ]
[ "2\n4 2\n", "2\n7 11\n" ]
There is one ship in the first sample. It can be either to the left or to the right from the shot Galya has already made (the "1" character). So, it is necessary to make two shots: one at the left part, and one at the right part.
1,750
[ { "input": "5 1 2 1\n00100", "output": "2\n2 5 " }, { "input": "13 3 2 3\n1000000010001", "output": "2\n3 5 " }, { "input": "1 1 1 0\n0", "output": "1\n1 " }, { "input": "2 2 1 0\n00", "output": "1\n1 " }, { "input": "5 4 1 0\n00000", "output": "2\n1 2 " }, { "input": "10 2 2 0\n0000000000", "output": "4\n2 4 6 8 " }, { "input": "20 1 3 5\n01001010000000010010", "output": "2\n10 13 " }, { "input": "100 17 4 11\n0100000100000000000000001000000000010001100000000000101000000000000000000000001000001000010000000000", "output": "2\n6 12 " } ]
1,595,650,354
2,147,483,647
PyPy 3
OK
TESTS
21
249
32,870,400
n,a,b,k = map(int,input().split()) s = input() sm = 0 num = 0 res = [] for i in range(n): if s[i] == "1": sm = 0 if s[i] == "0": sm += 1 if sm == b: num += 1 res.append(i+1) sm = 0 k = num - a + 1 print(k) print(*res[:k])
Title: Sea Battle Time Limit: None seconds Memory Limit: None megabytes Problem Description: Galya is playing one-dimensional Sea Battle on a 1<=×<=*n* grid. In this game *a* ships are placed on the grid. Each of the ships consists of *b* consecutive cells. No cell can be part of two ships, however, the ships can touch each other. Galya doesn't know the ships location. She can shoot to some cells and after each shot she is told if that cell was a part of some ship (this case is called "hit") or not (this case is called "miss"). Galya has already made *k* shots, all of them were misses. Your task is to calculate the minimum number of cells such that if Galya shoot at all of them, she would hit at least one ship. It is guaranteed that there is at least one valid ships placement. Input Specification: The first line contains four positive integers *n*, *a*, *b*, *k* (1<=≤<=*n*<=≤<=2·105, 1<=≤<=*a*,<=*b*<=≤<=*n*, 0<=≤<=*k*<=≤<=*n*<=-<=1) — the length of the grid, the number of ships on the grid, the length of each ship and the number of shots Galya has already made. The second line contains a string of length *n*, consisting of zeros and ones. If the *i*-th character is one, Galya has already made a shot to this cell. Otherwise, she hasn't. It is guaranteed that there are exactly *k* ones in this string. Output Specification: In the first line print the minimum number of cells such that if Galya shoot at all of them, she would hit at least one ship. In the second line print the cells Galya should shoot at. Each cell should be printed exactly once. You can print the cells in arbitrary order. The cells are numbered from 1 to *n*, starting from the left. If there are multiple answers, you can print any of them. Demo Input: ['5 1 2 1\n00100\n', '13 3 2 3\n1000000010001\n'] Demo Output: ['2\n4 2\n', '2\n7 11\n'] Note: There is one ship in the first sample. It can be either to the left or to the right from the shot Galya has already made (the "1" character). So, it is necessary to make two shots: one at the left part, and one at the right part.
```python n,a,b,k = map(int,input().split()) s = input() sm = 0 num = 0 res = [] for i in range(n): if s[i] == "1": sm = 0 if s[i] == "0": sm += 1 if sm == b: num += 1 res.append(i+1) sm = 0 k = num - a + 1 print(k) print(*res[:k]) ```
3
959
A
Mahmoud and Ehab and the even-odd game
PROGRAMMING
800
[ "games", "math" ]
null
null
Mahmoud and Ehab play a game called the even-odd game. Ehab chooses his favorite integer *n* and then they take turns, starting from Mahmoud. In each player's turn, he has to choose an integer *a* and subtract it from *n* such that: - 1<=≤<=*a*<=≤<=*n*. - If it's Mahmoud's turn, *a* has to be even, but if it's Ehab's turn, *a* has to be odd. If the current player can't choose any number satisfying the conditions, he loses. Can you determine the winner if they both play optimally?
The only line contains an integer *n* (1<=≤<=*n*<=≤<=109), the number at the beginning of the game.
Output "Mahmoud" (without quotes) if Mahmoud wins and "Ehab" (without quotes) otherwise.
[ "1\n", "2\n" ]
[ "Ehab", "Mahmoud" ]
In the first sample, Mahmoud can't choose any integer *a* initially because there is no positive even integer less than or equal to 1 so Ehab wins. In the second sample, Mahmoud has to choose *a* = 2 and subtract it from *n*. It's Ehab's turn and *n* = 0. There is no positive odd integer less than or equal to 0 so Mahmoud wins.
500
[ { "input": "1", "output": "Ehab" }, { "input": "2", "output": "Mahmoud" }, { "input": "10000", "output": "Mahmoud" }, { "input": "33333", "output": "Ehab" }, { "input": "5", "output": "Ehab" }, { "input": "1000000000", "output": "Mahmoud" }, { "input": "999999999", "output": "Ehab" }, { "input": "123123123", "output": "Ehab" }, { "input": "22222221", "output": "Ehab" }, { "input": "22222220", "output": "Mahmoud" }, { "input": "3", "output": "Ehab" }, { "input": "4", "output": "Mahmoud" }, { "input": "6", "output": "Mahmoud" }, { "input": "7", "output": "Ehab" }, { "input": "8", "output": "Mahmoud" }, { "input": "9", "output": "Ehab" }, { "input": "10", "output": "Mahmoud" }, { "input": "536870912", "output": "Mahmoud" }, { "input": "536870913", "output": "Ehab" }, { "input": "536870911", "output": "Ehab" } ]
1,640,343,491
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
31
0
k = int(input()) ans = True while k>1: if ans: k-=2 ans = False else: k-=1 ans = True if ans: print("Ehab") else: print("Mahmoud")
Title: Mahmoud and Ehab and the even-odd game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mahmoud and Ehab play a game called the even-odd game. Ehab chooses his favorite integer *n* and then they take turns, starting from Mahmoud. In each player's turn, he has to choose an integer *a* and subtract it from *n* such that: - 1<=≤<=*a*<=≤<=*n*. - If it's Mahmoud's turn, *a* has to be even, but if it's Ehab's turn, *a* has to be odd. If the current player can't choose any number satisfying the conditions, he loses. Can you determine the winner if they both play optimally? Input Specification: The only line contains an integer *n* (1<=≤<=*n*<=≤<=109), the number at the beginning of the game. Output Specification: Output "Mahmoud" (without quotes) if Mahmoud wins and "Ehab" (without quotes) otherwise. Demo Input: ['1\n', '2\n'] Demo Output: ['Ehab', 'Mahmoud'] Note: In the first sample, Mahmoud can't choose any integer *a* initially because there is no positive even integer less than or equal to 1 so Ehab wins. In the second sample, Mahmoud has to choose *a* = 2 and subtract it from *n*. It's Ehab's turn and *n* = 0. There is no positive odd integer less than or equal to 0 so Mahmoud wins.
```python k = int(input()) ans = True while k>1: if ans: k-=2 ans = False else: k-=1 ans = True if ans: print("Ehab") else: print("Mahmoud") ```
0
996
A
Hit the Lottery
PROGRAMMING
800
[ "dp", "greedy" ]
null
null
Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance?
The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$).
Output the minimum number of bills that Allen could receive.
[ "125\n", "43\n", "1000000000\n" ]
[ "3\n", "5\n", "10000000\n" ]
In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills. In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills. In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
500
[ { "input": "125", "output": "3" }, { "input": "43", "output": "5" }, { "input": "1000000000", "output": "10000000" }, { "input": "4", "output": "4" }, { "input": "5", "output": "1" }, { "input": "1", "output": "1" }, { "input": "74", "output": "8" }, { "input": "31", "output": "3" }, { "input": "59", "output": "8" }, { "input": "79", "output": "9" }, { "input": "7", "output": "3" }, { "input": "55", "output": "4" }, { "input": "40", "output": "2" }, { "input": "719", "output": "13" }, { "input": "847", "output": "13" }, { "input": "225", "output": "4" }, { "input": "4704", "output": "51" }, { "input": "1132", "output": "15" }, { "input": "7811", "output": "80" }, { "input": "7981", "output": "84" }, { "input": "82655", "output": "830" }, { "input": "6364", "output": "70" }, { "input": "74611", "output": "748" }, { "input": "45391", "output": "459" }, { "input": "620448", "output": "6210" }, { "input": "265145", "output": "2654" }, { "input": "671704", "output": "6721" }, { "input": "365173", "output": "3658" }, { "input": "7130872", "output": "71314" }, { "input": "9628747", "output": "96292" }, { "input": "8898399", "output": "88993" }, { "input": "9497953", "output": "94985" }, { "input": "19070947", "output": "190714" }, { "input": "20185520", "output": "201856" }, { "input": "91402248", "output": "914028" }, { "input": "27035533", "output": "270360" }, { "input": "22717528", "output": "227180" }, { "input": "24403439", "output": "244041" }, { "input": "163565555", "output": "1635659" }, { "input": "152541908", "output": "1525423" }, { "input": "668439837", "output": "6684403" }, { "input": "20", "output": "1" }, { "input": "999999999", "output": "10000009" }, { "input": "10", "output": "1" }, { "input": "7", "output": "3" }, { "input": "6", "output": "2" }, { "input": "99999999", "output": "1000009" }, { "input": "1000001", "output": "10001" }, { "input": "2521", "output": "27" } ]
1,687,244,549
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
2
1,000
0
money = int(input()) bills = 0 for i in range(money): if money >= 100: bills += 1 money -= 100 elif money >= 20: bills += 1 money -= 20 elif money >= 10: bills += 1 money -= 10 elif money >= 5: bills += 1 money -= 5 elif money >= 1: bills += 1 money -= 1 if money == 0: break print(bills)
Title: Hit the Lottery Time Limit: None seconds Memory Limit: None megabytes Problem Description: Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance? Input Specification: The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$). Output Specification: Output the minimum number of bills that Allen could receive. Demo Input: ['125\n', '43\n', '1000000000\n'] Demo Output: ['3\n', '5\n', '10000000\n'] Note: In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills. In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills. In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
```python money = int(input()) bills = 0 for i in range(money): if money >= 100: bills += 1 money -= 100 elif money >= 20: bills += 1 money -= 20 elif money >= 10: bills += 1 money -= 10 elif money >= 5: bills += 1 money -= 5 elif money >= 1: bills += 1 money -= 1 if money == 0: break print(bills) ```
0
222
A
Shooshuns and Sequence
PROGRAMMING
1,200
[ "brute force", "implementation" ]
null
null
One day shooshuns found a sequence of *n* integers, written on a blackboard. The shooshuns can perform one operation with it, the operation consists of two steps: 1. Find the number that goes *k*-th in the current sequence and add the same number to the end of the sequence; 1. Delete the first number of the current sequence. The shooshuns wonder after how many operations all numbers on the board will be the same and whether all numbers will ever be the same.
The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105) — the sequence that the shooshuns found.
Print the minimum number of operations, required for all numbers on the blackboard to become the same. If it is impossible to achieve, print -1.
[ "3 2\n3 1 1\n", "3 1\n3 1 1\n" ]
[ "1\n", "-1\n" ]
In the first test case after the first operation the blackboard will have sequence [1, 1, 1]. So, one operation is enough to make all numbers the same. Thus, the answer equals one. In the second test case the sequence will never consist of the same numbers. It will always contain at least two distinct numbers 3 and 1. Thus, the answer equals -1.
500
[ { "input": "3 2\n3 1 1", "output": "1" }, { "input": "3 1\n3 1 1", "output": "-1" }, { "input": "1 1\n1", "output": "0" }, { "input": "2 1\n1 1", "output": "0" }, { "input": "2 1\n2 1", "output": "-1" }, { "input": "4 4\n1 2 3 4", "output": "3" }, { "input": "4 3\n1 2 3 4", "output": "-1" }, { "input": "5 3\n2 1 1 1 1", "output": "1" }, { "input": "5 3\n1 1 1 1 1", "output": "0" }, { "input": "5 5\n1 1 1 1 1", "output": "0" }, { "input": "10 1\n1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "10 1\n1 2 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "10 1\n2 1 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "10 2\n2 1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "10 2\n1 2 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "10 3\n3 2 1 1 1 1 1 1 1 1", "output": "2" }, { "input": "10 1\n1 2 3 4 5 6 7 8 9 10", "output": "-1" }, { "input": "10 10\n1 2 3 4 5 6 7 8 9 10", "output": "9" }, { "input": "20 10\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "20 11\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1", "output": "10" }, { "input": "20 9\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "20 10\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "20 20\n20 1 19 2 18 3 17 4 16 5 15 6 14 7 13 8 12 9 11 10", "output": "19" } ]
1,604,319,271
2,147,483,647
Python 3
OK
TESTS
47
342
6,041,600
v=input().split() v[0]=int(v[0]) v[1]=int(v[1]) c=input().split() for i in range(v[0]): c[i]=int(c[i]) s=1 for i in range(v[0]-1,0,-1): if c[i]==c[i-1]: s+=1 else: break if v[1]>v[0]-s: print(v[0]-s) else: print(-1)
Title: Shooshuns and Sequence Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day shooshuns found a sequence of *n* integers, written on a blackboard. The shooshuns can perform one operation with it, the operation consists of two steps: 1. Find the number that goes *k*-th in the current sequence and add the same number to the end of the sequence; 1. Delete the first number of the current sequence. The shooshuns wonder after how many operations all numbers on the board will be the same and whether all numbers will ever be the same. Input Specification: The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105) — the sequence that the shooshuns found. Output Specification: Print the minimum number of operations, required for all numbers on the blackboard to become the same. If it is impossible to achieve, print -1. Demo Input: ['3 2\n3 1 1\n', '3 1\n3 1 1\n'] Demo Output: ['1\n', '-1\n'] Note: In the first test case after the first operation the blackboard will have sequence [1, 1, 1]. So, one operation is enough to make all numbers the same. Thus, the answer equals one. In the second test case the sequence will never consist of the same numbers. It will always contain at least two distinct numbers 3 and 1. Thus, the answer equals -1.
```python v=input().split() v[0]=int(v[0]) v[1]=int(v[1]) c=input().split() for i in range(v[0]): c[i]=int(c[i]) s=1 for i in range(v[0]-1,0,-1): if c[i]==c[i-1]: s+=1 else: break if v[1]>v[0]-s: print(v[0]-s) else: print(-1) ```
3
821
A
Okabe and Future Gadget Laboratory
PROGRAMMING
800
[ "implementation" ]
null
null
Okabe needs to renovate the Future Gadget Laboratory after he tried doing some crazy experiments! The lab is represented as an *n* by *n* square grid of integers. A good lab is defined as a lab in which every number not equal to 1 can be expressed as the sum of a number in the same row and a number in the same column. In other words, for every *x*,<=*y* such that 1<=≤<=*x*,<=*y*<=≤<=*n* and *a**x*,<=*y*<=≠<=1, there should exist two indices *s* and *t* so that *a**x*,<=*y*<==<=*a**x*,<=*s*<=+<=*a**t*,<=*y*, where *a**i*,<=*j* denotes the integer in *i*-th row and *j*-th column. Help Okabe determine whether a given lab is good!
The first line of input contains the integer *n* (1<=≤<=*n*<=≤<=50) — the size of the lab. The next *n* lines contain *n* space-separated integers denoting a row of the grid. The *j*-th integer in the *i*-th row is *a**i*,<=*j* (1<=≤<=*a**i*,<=*j*<=≤<=105).
Print "Yes" if the given lab is good and "No" otherwise. You can output each letter in upper or lower case.
[ "3\n1 1 2\n2 3 1\n6 4 1\n", "3\n1 5 2\n1 1 1\n1 2 3\n" ]
[ "Yes\n", "No\n" ]
In the first sample test, the 6 in the bottom left corner is valid because it is the sum of the 2 above it and the 4 on the right. The same holds for every number not equal to 1 in this table, so the answer is "Yes". In the second sample test, the 5 cannot be formed as the sum of an integer in the same row and an integer in the same column. Thus the answer is "No".
500
[ { "input": "3\n1 1 2\n2 3 1\n6 4 1", "output": "Yes" }, { "input": "3\n1 5 2\n1 1 1\n1 2 3", "output": "No" }, { "input": "1\n1", "output": "Yes" }, { "input": "4\n1 1 1 1\n1 11 1 2\n2 5 1 4\n3 9 4 1", "output": "Yes" }, { "input": "4\n1 1 1 1\n1 7 1 1\n1 3 1 2\n2 6 3 1", "output": "Yes" }, { "input": "4\n1 1 1 1\n1 12 1 2\n4 4 1 3\n5 10 6 1", "output": "Yes" }, { "input": "4\n1 1 1 1\n1 13 1 2\n4 5 1 3\n5 11 6 1", "output": "Yes" }, { "input": "4\n1 1 1 1\n1 13 1 2\n4 5 1 3\n7 11 6 1", "output": "No" }, { "input": "4\n1 1 1 1\n1 14 1 6\n4 5 1 5\n3 8 2 1", "output": "Yes" }, { "input": "10\n3 2 6 5 1 2 1 1 2 1\n1 2 2 3 1 4 1 1 1 1\n1 1 3 1 2 2 2 1 1 1\n1 3 1 2 1 2 1 1 1 1\n12 1 4 3 3 1 1 1 2 1\n8 1 1 1 1 3 6 5 1 3\n1 1 1 2 4 1 3 2 1 1\n1 1 1 1 1 1 1 2 1 1\n1 2 1 1 1 1 1 1 1 1\n2 1 1 1 1 1 1 1 1 2", "output": "Yes" }, { "input": "4\n1 2 3 5\n1 1 1 1\n1 1 1 1\n1 1 1 1", "output": "No" }, { "input": "1\n2", "output": "No" }, { "input": "3\n1 1 4\n1 1 2\n1 1 2", "output": "No" }, { "input": "1\n5", "output": "No" }, { "input": "3\n1 2 1\n2 2 3\n1 3 1", "output": "No" }, { "input": "3\n2 1 1\n2 1 1\n2 1 1", "output": "No" }, { "input": "1\n60000", "output": "No" } ]
1,498,401,766
466
Python 3
OK
TESTS
31
296
5,529,600
N = int(input()) table = [] for i in range(N): table.append(list(map(int, input().split()))) for i in range(N): for j in range(N): if table[i][j] == 1: continue flg = False for s in range(N): for t in range(N): if table[i][j] == table[i][s] + table[t][j]: flg = True break if not flg: print("No") exit() print("Yes")
Title: Okabe and Future Gadget Laboratory Time Limit: None seconds Memory Limit: None megabytes Problem Description: Okabe needs to renovate the Future Gadget Laboratory after he tried doing some crazy experiments! The lab is represented as an *n* by *n* square grid of integers. A good lab is defined as a lab in which every number not equal to 1 can be expressed as the sum of a number in the same row and a number in the same column. In other words, for every *x*,<=*y* such that 1<=≤<=*x*,<=*y*<=≤<=*n* and *a**x*,<=*y*<=≠<=1, there should exist two indices *s* and *t* so that *a**x*,<=*y*<==<=*a**x*,<=*s*<=+<=*a**t*,<=*y*, where *a**i*,<=*j* denotes the integer in *i*-th row and *j*-th column. Help Okabe determine whether a given lab is good! Input Specification: The first line of input contains the integer *n* (1<=≤<=*n*<=≤<=50) — the size of the lab. The next *n* lines contain *n* space-separated integers denoting a row of the grid. The *j*-th integer in the *i*-th row is *a**i*,<=*j* (1<=≤<=*a**i*,<=*j*<=≤<=105). Output Specification: Print "Yes" if the given lab is good and "No" otherwise. You can output each letter in upper or lower case. Demo Input: ['3\n1 1 2\n2 3 1\n6 4 1\n', '3\n1 5 2\n1 1 1\n1 2 3\n'] Demo Output: ['Yes\n', 'No\n'] Note: In the first sample test, the 6 in the bottom left corner is valid because it is the sum of the 2 above it and the 4 on the right. The same holds for every number not equal to 1 in this table, so the answer is "Yes". In the second sample test, the 5 cannot be formed as the sum of an integer in the same row and an integer in the same column. Thus the answer is "No".
```python N = int(input()) table = [] for i in range(N): table.append(list(map(int, input().split()))) for i in range(N): for j in range(N): if table[i][j] == 1: continue flg = False for s in range(N): for t in range(N): if table[i][j] == table[i][s] + table[t][j]: flg = True break if not flg: print("No") exit() print("Yes") ```
3
586
A
Alena's Schedule
PROGRAMMING
900
[ "implementation" ]
null
null
Alena has successfully passed the entrance exams to the university and is now looking forward to start studying. One two-hour lesson at the Russian university is traditionally called a pair, it lasts for two academic hours (an academic hour is equal to 45 minutes). The University works in such a way that every day it holds exactly *n* lessons. Depending on the schedule of a particular group of students, on a given day, some pairs may actually contain classes, but some may be empty (such pairs are called breaks). The official website of the university has already published the schedule for tomorrow for Alena's group. Thus, for each of the *n* pairs she knows if there will be a class at that time or not. Alena's House is far from the university, so if there are breaks, she doesn't always go home. Alena has time to go home only if the break consists of at least two free pairs in a row, otherwise she waits for the next pair at the university. Of course, Alena does not want to be sleepy during pairs, so she will sleep as long as possible, and will only come to the first pair that is presented in her schedule. Similarly, if there are no more pairs, then Alena immediately goes home. Alena appreciates the time spent at home, so she always goes home when it is possible, and returns to the university only at the beginning of the next pair. Help Alena determine for how many pairs she will stay at the university. Note that during some pairs Alena may be at the university waiting for the upcoming pair.
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of lessons at the university. The second line contains *n* numbers *a**i* (0<=≤<=*a**i*<=≤<=1). Number *a**i* equals 0, if Alena doesn't have the *i*-th pairs, otherwise it is equal to 1. Numbers *a*1,<=*a*2,<=...,<=*a**n* are separated by spaces.
Print a single number — the number of pairs during which Alena stays at the university.
[ "5\n0 1 0 1 1\n", "7\n1 0 1 0 0 1 0\n", "1\n0\n" ]
[ "4\n", "4\n", "0\n" ]
In the first sample Alena stays at the university from the second to the fifth pair, inclusive, during the third pair she will be it the university waiting for the next pair. In the last sample Alena doesn't have a single pair, so she spends all the time at home.
500
[ { "input": "5\n0 1 0 1 1", "output": "4" }, { "input": "7\n1 0 1 0 0 1 0", "output": "4" }, { "input": "1\n0", "output": "0" }, { "input": "1\n1", "output": "1" }, { "input": "2\n0 0", "output": "0" }, { "input": "2\n0 1", "output": "1" }, { "input": "2\n1 0", "output": "1" }, { "input": "2\n1 1", "output": "2" }, { "input": "10\n0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "9\n1 1 1 1 1 1 1 1 1", "output": "9" }, { "input": "11\n0 0 0 0 0 0 0 0 0 0 1", "output": "1" }, { "input": "12\n1 0 0 0 0 0 0 0 0 0 0 0", "output": "1" }, { "input": "20\n1 1 0 1 1 1 1 1 1 1 1 0 1 1 1 0 0 1 0 0", "output": "16" }, { "input": "41\n1 1 0 1 0 1 0 0 1 0 1 1 1 0 0 0 1 1 1 0 1 0 1 1 0 1 0 1 0 0 0 0 0 0 1 0 0 1 0 1 1", "output": "28" }, { "input": "63\n1 1 0 1 1 0 0 0 1 1 0 0 1 1 1 1 0 1 1 0 1 0 1 1 1 1 1 0 0 0 0 0 0 1 0 0 1 0 0 1 0 1 1 0 0 1 1 0 0 1 1 1 1 0 0 1 1 0 0 1 0 1 0", "output": "39" }, { "input": "80\n0 1 1 1 0 1 1 1 1 1 0 0 1 0 1 1 0 1 1 1 0 1 1 1 1 0 1 0 1 0 0 0 1 1 0 1 1 0 0 0 0 1 1 1 0 0 0 1 0 0 1 1 1 0 0 0 0 0 0 1 0 1 0 0 1 0 1 1 1 1 1 0 0 0 1 1 0 0 1 1", "output": "52" }, { "input": "99\n1 1 0 0 0 1 0 0 1 1 1 1 0 0 0 1 0 1 1 0 1 1 1 1 0 0 0 0 1 1 1 1 0 1 0 1 0 1 1 1 0 0 1 1 1 0 0 0 1 1 1 0 1 1 1 0 1 0 0 1 1 0 1 0 0 1 1 1 1 0 0 1 1 0 0 1 0 1 1 1 0 1 1 0 1 0 0 1 0 1 0 1 0 1 1 0 1 0 1", "output": "72" }, { "input": "100\n0 1 1 0 1 1 0 0 1 1 0 1 1 1 1 1 0 0 1 1 1 0 0 0 0 1 1 0 0 1 0 0 1 0 0 0 0 1 1 1 1 1 1 0 0 1 1 0 0 0 0 1 0 1 1 1 0 1 1 0 1 0 0 0 0 0 1 0 1 1 0 0 1 1 0 1 1 0 0 1 1 1 0 1 1 1 1 1 1 0 0 1 1 1 1 0 1 1 1 0", "output": "65" }, { "input": "11\n0 1 1 0 0 0 0 0 0 0 0", "output": "2" }, { "input": "11\n0 1 0 1 0 0 1 1 0 1 1", "output": "8" }, { "input": "11\n1 0 1 0 1 1 0 1 1 1 0", "output": "10" }, { "input": "11\n1 0 0 0 0 0 1 0 1 1 1", "output": "6" }, { "input": "22\n0 1 1 0 0 0 0 0 1 0 0 0 0 1 1 0 0 1 0 0 1 0", "output": "7" }, { "input": "22\n0 1 0 1 0 1 1 1 1 0 0 1 1 1 0 1 1 1 0 0 0 1", "output": "16" }, { "input": "22\n1 0 1 0 1 0 0 0 0 0 0 1 0 0 0 0 1 1 0 1 1 0", "output": "11" }, { "input": "22\n1 0 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 0 0 1 0 1", "output": "14" }, { "input": "33\n0 1 1 0 1 1 0 1 0 1 1 0 1 1 1 1 0 1 1 1 0 0 1 1 0 0 1 1 0 1 1 0 0", "output": "26" }, { "input": "33\n0 1 0 1 0 1 1 0 0 0 1 1 1 0 1 0 1 1 0 1 0 1 0 0 1 1 1 0 1 1 1 0 1", "output": "27" }, { "input": "33\n1 0 1 0 1 0 0 0 1 0 1 1 1 0 0 0 0 1 1 0 1 0 1 1 0 1 0 1 1 1 1 1 0", "output": "25" }, { "input": "33\n1 0 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 0 1 0 0 0 1 0 1 0 1 0 0 0 0 1 1", "output": "24" }, { "input": "44\n0 1 1 0 1 0 0 0 0 1 1 0 0 0 0 0 1 1 1 0 0 0 0 0 1 0 0 1 1 0 0 0 0 1 1 1 0 0 1 0 1 1 0 0", "output": "19" }, { "input": "44\n0 1 1 1 1 0 1 0 0 1 0 1 0 0 1 1 0 1 1 0 0 1 0 1 0 1 1 0 1 0 1 0 1 0 1 0 0 0 0 0 1 0 1 1", "output": "32" }, { "input": "44\n1 0 1 0 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 1 0 0 1 0 0 1 0", "output": "23" }, { "input": "44\n1 0 1 0 1 1 1 0 0 0 0 0 0 1 0 0 0 1 1 1 0 0 0 1 0 1 0 1 1 0 1 1 0 1 0 1 1 0 1 0 1 1 1 1", "output": "32" }, { "input": "55\n0 1 1 0 1 0 0 0 1 0 0 0 1 0 1 0 0 1 0 0 0 0 1 1 1 0 0 1 1 0 0 0 0 0 1 0 1 1 1 0 0 0 0 0 1 0 0 0 0 1 1 0 0 1 0", "output": "23" }, { "input": "55\n0 1 1 0 1 0 1 1 1 1 0 1 1 0 0 1 1 1 0 0 0 1 1 0 0 1 0 1 0 1 0 0 1 1 1 1 1 0 0 0 1 1 1 1 1 1 1 1 0 1 1 0 0 0 1", "output": "39" }, { "input": "55\n1 0 1 0 0 1 0 0 1 1 0 1 0 1 0 0 1 1 0 0 0 0 1 1 1 0 0 0 1 1 1 1 0 1 0 1 0 0 0 1 0 1 1 0 0 0 1 0 1 0 0 1 1 0 0", "output": "32" }, { "input": "55\n1 0 1 0 1 0 1 0 1 1 0 0 1 1 1 1 0 1 0 0 0 1 1 0 0 1 0 1 0 1 1 1 0 0 0 0 0 0 1 0 0 0 1 1 1 0 0 0 1 0 1 0 1 1 1", "output": "36" }, { "input": "66\n0 1 1 0 0 1 0 1 0 1 0 1 1 0 1 1 0 0 1 1 0 1 0 0 0 0 0 0 0 1 0 0 0 1 1 1 1 1 1 0 0 1 1 1 0 1 0 1 1 0 1 0 0 1 1 0 1 1 1 0 0 0 0 0 1 0", "output": "41" }, { "input": "66\n0 1 1 0 1 1 1 0 0 0 1 1 0 1 1 0 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 0 1 0 0 1 1 1 0 0 1 0 1 1 1 0 0 0 1 0 0 0 0 0 1 0 1 0 0 1 0 0 1 1 0 1", "output": "42" }, { "input": "66\n1 0 1 0 0 0 1 0 1 0 1 0 1 1 0 1 0 1 1 0 0 0 1 1 1 0 1 0 0 1 0 1 0 0 0 0 1 1 0 1 1 0 1 0 0 0 1 1 0 1 0 1 1 0 0 0 1 1 0 1 1 0 1 1 0 0", "output": "46" }, { "input": "66\n1 0 1 0 0 0 1 1 1 1 1 0 1 0 0 0 1 1 1 0 1 1 0 1 0 1 0 0 1 0 0 1 0 1 0 1 0 0 1 0 0 1 0 1 1 1 1 1 0 1 1 1 1 1 1 0 0 0 1 0 1 1 0 0 0 1", "output": "46" }, { "input": "77\n0 0 1 0 0 1 0 0 1 1 1 1 0 1 0 0 1 0 0 0 0 1 0 0 0 0 1 0 1 0 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 0 0 1 0 0 1 1 1 0 1 0 1 1 0 1 0 0 0 1 0 1 1 0 1 1 1 0 1 1 0 1 0", "output": "47" }, { "input": "77\n0 0 1 0 0 0 1 0 1 1 1 1 0 1 1 1 0 1 1 0 1 1 1 0 1 1 0 1 0 0 0 0 1 1 0 0 0 1 1 0 0 1 1 0 1 0 0 1 0 0 0 1 0 0 1 0 0 0 1 0 0 0 1 0 0 1 0 1 1 0 1 0 0 0 0 1 1", "output": "44" }, { "input": "77\n1 0 0 0 1 0 1 1 0 0 1 0 0 0 1 1 1 1 0 1 0 0 0 0 0 0 1 1 0 0 0 1 0 1 0 1 1 1 0 1 1 1 0 0 0 1 1 0 1 1 1 0 1 1 0 0 1 0 0 1 1 1 1 0 1 0 0 0 1 0 1 1 0 0 0 0 0", "output": "45" }, { "input": "77\n1 0 1 0 0 1 1 0 0 0 0 0 0 0 0 0 0 1 0 1 1 1 0 0 1 1 1 0 1 1 0 1 0 0 0 0 1 1 1 0 1 0 0 1 1 0 1 0 1 1 1 1 1 1 1 0 0 1 1 0 0 1 0 1 1 1 1 1 1 1 1 0 0 1 0 1 1", "output": "51" }, { "input": "88\n0 0 1 0 0 0 0 0 0 0 0 1 1 1 1 0 0 0 0 1 0 1 1 1 0 0 1 1 0 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 0 0 0 0 1 0 0 0 1 0 1 1 0 1 0 1 0 0 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 1 0 0 1 1 1 0", "output": "44" }, { "input": "88\n0 0 1 0 0 0 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 1 0 1 1 0 1 1 1 0 1 0 0 1 0 1 1 0 0 0 0 0 1 1 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 0 1 1 1 1 1 1 1 0 0 1 0 1 0 0 0 1 0 1 0 0 0 0 0 0 0 1", "output": "59" }, { "input": "88\n1 0 0 0 1 1 1 0 1 1 0 0 0 0 0 0 1 0 1 0 0 0 1 1 0 0 1 1 1 1 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 1 1 1 0 1 1 0 0 1 1 1 0 0 1 0 0 1 1 1 1 0 0 1 0 1 1 1 0 1 0 1 1 1 1 0 1 0 1 1 1 0 0 0", "output": "53" }, { "input": "88\n1 1 1 0 0 1 1 0 1 0 0 0 1 0 1 1 1 1 1 0 1 1 1 1 1 1 1 0 0 1 0 1 1 1 0 0 0 1 1 0 1 1 0 1 0 0 1 0 0 1 0 0 1 0 1 1 0 1 0 1 0 1 0 0 1 1 1 0 0 0 1 0 0 1 0 0 1 1 0 1 1 1 1 0 1 1 0 1", "output": "63" }, { "input": "99\n0 0 0 0 1 0 0 1 0 0 0 1 1 1 1 1 1 0 1 1 0 1 0 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 0 0 1 0 0 1 0 1 0 1 0 0 0 0 1 0 1 1 0 0 1 1 1 0 0 1 1 0 0 0 0 0 0 1 0 0 0 1 1 0 0 0 1 1 1 0 1 1 0 1 0 1 0 0 0 1 1 0 0 0 0", "output": "56" }, { "input": "99\n0 0 1 0 0 1 1 0 0 0 1 1 0 0 1 0 0 0 1 1 1 1 0 0 0 1 1 0 0 0 1 0 1 1 0 0 1 1 1 0 1 1 0 0 0 0 0 1 0 0 1 0 1 1 0 1 0 1 0 0 1 0 1 1 1 1 1 1 0 1 0 0 1 1 0 0 1 0 1 0 1 0 1 1 1 0 0 1 1 1 0 0 0 0 0 0 1 1 1", "output": "58" }, { "input": "99\n1 1 0 0 1 1 1 0 0 0 1 0 1 0 1 1 0 0 0 0 0 0 0 0 1 0 1 1 0 0 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 0 1 0 1 1 1 1 0 1 1 1 0 0 1 0 0 1 1 0 0 0 0 1 0 0 1 0 1 1 0 1 1 0 0 1 0 0 1 0 1 0 1 1 0 1 0 1 1 1 1 0 0 1 0", "output": "65" }, { "input": "99\n1 1 1 0 1 0 1 1 0 1 1 0 0 1 0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 0 1 1 1 0 1 1 0 1 1 0 1 0 1 0 0 1 1 1 1 1 0 1 1 0 1 1 0 0 0 1 0 1 0 1 0 1 0 0 0 1 1 1 1 0 0 1 1 0 1 0 0 0 1 0 1 1 1 0 0 1 1 1 1 1 0 1 1 1 1", "output": "77" }, { "input": "90\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "90" }, { "input": "95\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "95\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "95" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "100" } ]
1,480,327,887
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
46
0
n=int(input()) l=list(map(int,input().split())) k=0 if l[0]==0 : k=1 for i in range(1,n-1) : if l[i]==0 and l[i-1]==0 or l[i]==0 and l[i+1]==0 : k=k+1 if l[n-1]==0 : k=k+1 print(n-k)
Title: Alena's Schedule Time Limit: None seconds Memory Limit: None megabytes Problem Description: Alena has successfully passed the entrance exams to the university and is now looking forward to start studying. One two-hour lesson at the Russian university is traditionally called a pair, it lasts for two academic hours (an academic hour is equal to 45 minutes). The University works in such a way that every day it holds exactly *n* lessons. Depending on the schedule of a particular group of students, on a given day, some pairs may actually contain classes, but some may be empty (such pairs are called breaks). The official website of the university has already published the schedule for tomorrow for Alena's group. Thus, for each of the *n* pairs she knows if there will be a class at that time or not. Alena's House is far from the university, so if there are breaks, she doesn't always go home. Alena has time to go home only if the break consists of at least two free pairs in a row, otherwise she waits for the next pair at the university. Of course, Alena does not want to be sleepy during pairs, so she will sleep as long as possible, and will only come to the first pair that is presented in her schedule. Similarly, if there are no more pairs, then Alena immediately goes home. Alena appreciates the time spent at home, so she always goes home when it is possible, and returns to the university only at the beginning of the next pair. Help Alena determine for how many pairs she will stay at the university. Note that during some pairs Alena may be at the university waiting for the upcoming pair. Input Specification: The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of lessons at the university. The second line contains *n* numbers *a**i* (0<=≤<=*a**i*<=≤<=1). Number *a**i* equals 0, if Alena doesn't have the *i*-th pairs, otherwise it is equal to 1. Numbers *a*1,<=*a*2,<=...,<=*a**n* are separated by spaces. Output Specification: Print a single number — the number of pairs during which Alena stays at the university. Demo Input: ['5\n0 1 0 1 1\n', '7\n1 0 1 0 0 1 0\n', '1\n0\n'] Demo Output: ['4\n', '4\n', '0\n'] Note: In the first sample Alena stays at the university from the second to the fifth pair, inclusive, during the third pair she will be it the university waiting for the next pair. In the last sample Alena doesn't have a single pair, so she spends all the time at home.
```python n=int(input()) l=list(map(int,input().split())) k=0 if l[0]==0 : k=1 for i in range(1,n-1) : if l[i]==0 and l[i-1]==0 or l[i]==0 and l[i+1]==0 : k=k+1 if l[n-1]==0 : k=k+1 print(n-k) ```
0
996
B
World Cup
PROGRAMMING
1,300
[ "binary search", "math" ]
null
null
Allen wants to enter a fan zone that occupies a round square and has $n$ entrances. There already is a queue of $a_i$ people in front of the $i$-th entrance. Each entrance allows one person from its queue to enter the fan zone in one minute. Allen uses the following strategy to enter the fan zone: - Initially he stands in the end of the queue in front of the first entrance. - Each minute, if he is not allowed into the fan zone during the minute (meaning he is not the first in the queue), he leaves the current queue and stands in the end of the queue of the next entrance (or the first entrance if he leaves the last entrance). Determine the entrance through which Allen will finally enter the fan zone.
The first line contains a single integer $n$ ($2 \le n \le 10^5$) — the number of entrances. The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($0 \le a_i \le 10^9$) — the number of people in queues. These numbers do not include Allen.
Print a single integer — the number of entrance that Allen will use.
[ "4\n2 3 2 0\n", "2\n10 10\n", "6\n5 2 6 5 7 4\n" ]
[ "3\n", "1\n", "6\n" ]
In the first example the number of people (not including Allen) changes as follows: $[\textbf{2}, 3, 2, 0] \to [1, \textbf{2}, 1, 0] \to [0, 1, \textbf{0}, 0]$. The number in bold is the queue Alles stands in. We see that he will enter the fan zone through the third entrance. In the second example the number of people (not including Allen) changes as follows: $[\textbf{10}, 10] \to [9, \textbf{9}] \to [\textbf{8}, 8] \to [7, \textbf{7}] \to [\textbf{6}, 6] \to \\ [5, \textbf{5}] \to [\textbf{4}, 4] \to [3, \textbf{3}] \to [\textbf{2}, 2] \to [1, \textbf{1}] \to [\textbf{0}, 0]$. In the third example the number of people (not including Allen) changes as follows: $[\textbf{5}, 2, 6, 5, 7, 4] \to [4, \textbf{1}, 5, 4, 6, 3] \to [3, 0, \textbf{4}, 3, 5, 2] \to \\ [2, 0, 3, \textbf{2}, 4, 1] \to [1, 0, 2, 1, \textbf{3}, 0] \to [0, 0, 1, 0, 2, \textbf{0}]$.
1,000
[ { "input": "4\n2 3 2 0", "output": "3" }, { "input": "2\n10 10", "output": "1" }, { "input": "6\n5 2 6 5 7 4", "output": "6" }, { "input": "2\n483544186 940350702", "output": "1" }, { "input": "10\n3 3 3 5 6 9 3 1 7 3", "output": "7" }, { "input": "10\n0 8 45 88 48 68 28 55 17 24", "output": "1" }, { "input": "100\n8 8 9 10 6 8 2 4 2 2 10 6 6 10 10 2 3 5 1 2 10 4 2 0 9 4 9 3 0 6 3 2 3 10 10 6 4 6 4 4 2 5 1 4 1 1 9 8 9 5 3 5 5 4 5 5 6 5 3 3 7 2 0 10 9 7 7 3 5 1 0 9 6 3 1 3 4 4 3 6 3 2 1 4 10 2 3 4 4 3 6 7 6 2 1 7 0 6 8 10", "output": "7" }, { "input": "10\n5 6 7 8 9 10 11 12 13 14", "output": "1" }, { "input": "10\n15 14 13 12 11 10 9 8 7 6", "output": "9" }, { "input": "2\n1000000000 1000000000", "output": "1" }, { "input": "3\n3 3 1", "output": "3" }, { "input": "10\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000", "output": "1" }, { "input": "3\n15 8 9", "output": "2" }, { "input": "3\n5 5 5", "output": "3" }, { "input": "3\n41 5 6", "output": "2" }, { "input": "2\n999999999 1000000000", "output": "1" }, { "input": "2\n0 1", "output": "1" }, { "input": "3\n3 2 3", "output": "1" }, { "input": "3\n8 5 8", "output": "2" }, { "input": "4\n5 2 3 4", "output": "2" }, { "input": "2\n0 0", "output": "1" }, { "input": "2\n3 3", "output": "2" }, { "input": "4\n9 2 4 7", "output": "2" }, { "input": "30\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000", "output": "11" }, { "input": "4\n11 10 12 12", "output": "1" }, { "input": "2\n1 0", "output": "2" }, { "input": "6\n7 2 6 5 7 9", "output": "2" }, { "input": "3\n1000000000 1000000000 1000000000", "output": "2" }, { "input": "2\n999999999 999999699", "output": "2" }, { "input": "5\n5 5 5 5 5", "output": "1" }, { "input": "2\n1 1", "output": "2" } ]
1,693,245,994
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
15
0
import math n=int(input()) l= list(map(int,input().split(" "))) ans = max(l) for i in range(len(l)): x =math.ceil((l[i] - i) /(2*len(l))) print(i,x) if(x<ans): ans=x index=i print(index+1)
Title: World Cup Time Limit: None seconds Memory Limit: None megabytes Problem Description: Allen wants to enter a fan zone that occupies a round square and has $n$ entrances. There already is a queue of $a_i$ people in front of the $i$-th entrance. Each entrance allows one person from its queue to enter the fan zone in one minute. Allen uses the following strategy to enter the fan zone: - Initially he stands in the end of the queue in front of the first entrance. - Each minute, if he is not allowed into the fan zone during the minute (meaning he is not the first in the queue), he leaves the current queue and stands in the end of the queue of the next entrance (or the first entrance if he leaves the last entrance). Determine the entrance through which Allen will finally enter the fan zone. Input Specification: The first line contains a single integer $n$ ($2 \le n \le 10^5$) — the number of entrances. The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($0 \le a_i \le 10^9$) — the number of people in queues. These numbers do not include Allen. Output Specification: Print a single integer — the number of entrance that Allen will use. Demo Input: ['4\n2 3 2 0\n', '2\n10 10\n', '6\n5 2 6 5 7 4\n'] Demo Output: ['3\n', '1\n', '6\n'] Note: In the first example the number of people (not including Allen) changes as follows: $[\textbf{2}, 3, 2, 0] \to [1, \textbf{2}, 1, 0] \to [0, 1, \textbf{0}, 0]$. The number in bold is the queue Alles stands in. We see that he will enter the fan zone through the third entrance. In the second example the number of people (not including Allen) changes as follows: $[\textbf{10}, 10] \to [9, \textbf{9}] \to [\textbf{8}, 8] \to [7, \textbf{7}] \to [\textbf{6}, 6] \to \\ [5, \textbf{5}] \to [\textbf{4}, 4] \to [3, \textbf{3}] \to [\textbf{2}, 2] \to [1, \textbf{1}] \to [\textbf{0}, 0]$. In the third example the number of people (not including Allen) changes as follows: $[\textbf{5}, 2, 6, 5, 7, 4] \to [4, \textbf{1}, 5, 4, 6, 3] \to [3, 0, \textbf{4}, 3, 5, 2] \to \\ [2, 0, 3, \textbf{2}, 4, 1] \to [1, 0, 2, 1, \textbf{3}, 0] \to [0, 0, 1, 0, 2, \textbf{0}]$.
```python import math n=int(input()) l= list(map(int,input().split(" "))) ans = max(l) for i in range(len(l)): x =math.ceil((l[i] - i) /(2*len(l))) print(i,x) if(x<ans): ans=x index=i print(index+1) ```
0
359
A
Table
PROGRAMMING
1,000
[ "constructive algorithms", "greedy", "implementation" ]
null
null
Simon has a rectangular table consisting of *n* rows and *m* columns. Simon numbered the rows of the table from top to bottom starting from one and the columns — from left to right starting from one. We'll represent the cell on the *x*-th row and the *y*-th column as a pair of numbers (*x*,<=*y*). The table corners are cells: (1,<=1), (*n*,<=1), (1,<=*m*), (*n*,<=*m*). Simon thinks that some cells in this table are good. Besides, it's known that no good cell is the corner of the table. Initially, all cells of the table are colorless. Simon wants to color all cells of his table. In one move, he can choose any good cell of table (*x*1,<=*y*1), an arbitrary corner of the table (*x*2,<=*y*2) and color all cells of the table (*p*,<=*q*), which meet both inequations: *min*(*x*1,<=*x*2)<=≤<=*p*<=≤<=*max*(*x*1,<=*x*2), *min*(*y*1,<=*y*2)<=≤<=*q*<=≤<=*max*(*y*1,<=*y*2). Help Simon! Find the minimum number of operations needed to color all cells of the table. Note that you can color one cell multiple times.
The first line contains exactly two integers *n*, *m* (3<=≤<=*n*,<=*m*<=≤<=50). Next *n* lines contain the description of the table cells. Specifically, the *i*-th line contains *m* space-separated integers *a**i*1,<=*a**i*2,<=...,<=*a**im*. If *a**ij* equals zero, then cell (*i*,<=*j*) isn't good. Otherwise *a**ij* equals one. It is guaranteed that at least one cell is good. It is guaranteed that no good cell is a corner.
Print a single number — the minimum number of operations Simon needs to carry out his idea.
[ "3 3\n0 0 0\n0 1 0\n0 0 0\n", "4 3\n0 0 0\n0 0 1\n1 0 0\n0 0 0\n" ]
[ "4\n", "2\n" ]
In the first sample, the sequence of operations can be like this: - For the first time you need to choose cell (2, 2) and corner (1, 1). - For the second time you need to choose cell (2, 2) and corner (3, 3). - For the third time you need to choose cell (2, 2) and corner (3, 1). - For the fourth time you need to choose cell (2, 2) and corner (1, 3). In the second sample the sequence of operations can be like this: - For the first time you need to choose cell (3, 1) and corner (4, 3). - For the second time you need to choose cell (2, 3) and corner (1, 1).
500
[ { "input": "3 3\n0 0 0\n0 1 0\n0 0 0", "output": "4" }, { "input": "4 3\n0 0 0\n0 0 1\n1 0 0\n0 0 0", "output": "2" }, { "input": "50 4\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 1 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0", "output": "4" }, { "input": "5 50\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "2" }, { "input": "4 32\n0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "2" }, { "input": "7 4\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0\n0 1 0 0", "output": "2" }, { "input": "13 15\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "2" }, { "input": "3 3\n0 1 0\n0 0 0\n0 0 0", "output": "2" }, { "input": "3 3\n0 0 0\n0 0 0\n0 1 0", "output": "2" }, { "input": "3 3\n0 0 0\n1 0 0\n0 0 0", "output": "2" }, { "input": "3 3\n0 0 0\n0 0 1\n0 0 0", "output": "2" }, { "input": "3 4\n0 1 0 0\n0 0 0 0\n0 0 0 0", "output": "2" }, { "input": "3 5\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0", "output": "2" }, { "input": "3 5\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "3 5\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0", "output": "2" }, { "input": "3 5\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0", "output": "4" }, { "input": "4 3\n0 1 0\n0 0 0\n0 0 0\n0 0 0", "output": "2" }, { "input": "4 3\n0 0 0\n0 0 0\n0 0 0\n0 1 0", "output": "2" }, { "input": "5 3\n0 0 0\n0 0 0\n1 0 0\n0 0 0\n0 0 0", "output": "2" }, { "input": "5 3\n0 0 0\n0 0 1\n0 0 0\n0 0 0\n0 0 0", "output": "2" }, { "input": "5 3\n0 0 0\n0 1 0\n0 0 0\n0 0 0\n0 0 0", "output": "4" }, { "input": "4 4\n0 0 0 0\n0 1 1 0\n0 1 1 0\n0 0 0 0", "output": "4" }, { "input": "5 3\n0 0 0\n0 0 1\n0 0 0\n0 1 0\n0 0 0", "output": "2" }, { "input": "3 3\n0 0 0\n0 1 1\n0 0 0", "output": "2" }, { "input": "4 3\n0 0 0\n0 0 0\n0 1 0\n0 0 0", "output": "4" }, { "input": "5 5\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0", "output": "4" }, { "input": "5 3\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n0 0 0", "output": "2" } ]
1,383,380,183
983
Python 3
COMPILATION_ERROR
PRETESTS
0
0
0
uses math; Var a:Array[0..100,0..100] of longint; ans,i,j,t,n,m:longint; begin Read(n,m); for i:=1 to n do for j:=1 to m do read(a[i,j]); ans:=5; for i:=1 to n do begin for j:=1 to m do begin if a[i,j]=1 then begin t:=4; if (j=m) or (j=1) then dec(t,2); if (i=1) or (i=n) then dec(t,2); if t=0 then t:=1; ans:=min(ans,t); end; end; end; WriteLn(ans); end.
Title: Table Time Limit: None seconds Memory Limit: None megabytes Problem Description: Simon has a rectangular table consisting of *n* rows and *m* columns. Simon numbered the rows of the table from top to bottom starting from one and the columns — from left to right starting from one. We'll represent the cell on the *x*-th row and the *y*-th column as a pair of numbers (*x*,<=*y*). The table corners are cells: (1,<=1), (*n*,<=1), (1,<=*m*), (*n*,<=*m*). Simon thinks that some cells in this table are good. Besides, it's known that no good cell is the corner of the table. Initially, all cells of the table are colorless. Simon wants to color all cells of his table. In one move, he can choose any good cell of table (*x*1,<=*y*1), an arbitrary corner of the table (*x*2,<=*y*2) and color all cells of the table (*p*,<=*q*), which meet both inequations: *min*(*x*1,<=*x*2)<=≤<=*p*<=≤<=*max*(*x*1,<=*x*2), *min*(*y*1,<=*y*2)<=≤<=*q*<=≤<=*max*(*y*1,<=*y*2). Help Simon! Find the minimum number of operations needed to color all cells of the table. Note that you can color one cell multiple times. Input Specification: The first line contains exactly two integers *n*, *m* (3<=≤<=*n*,<=*m*<=≤<=50). Next *n* lines contain the description of the table cells. Specifically, the *i*-th line contains *m* space-separated integers *a**i*1,<=*a**i*2,<=...,<=*a**im*. If *a**ij* equals zero, then cell (*i*,<=*j*) isn't good. Otherwise *a**ij* equals one. It is guaranteed that at least one cell is good. It is guaranteed that no good cell is a corner. Output Specification: Print a single number — the minimum number of operations Simon needs to carry out his idea. Demo Input: ['3 3\n0 0 0\n0 1 0\n0 0 0\n', '4 3\n0 0 0\n0 0 1\n1 0 0\n0 0 0\n'] Demo Output: ['4\n', '2\n'] Note: In the first sample, the sequence of operations can be like this: - For the first time you need to choose cell (2, 2) and corner (1, 1). - For the second time you need to choose cell (2, 2) and corner (3, 3). - For the third time you need to choose cell (2, 2) and corner (3, 1). - For the fourth time you need to choose cell (2, 2) and corner (1, 3). In the second sample the sequence of operations can be like this: - For the first time you need to choose cell (3, 1) and corner (4, 3). - For the second time you need to choose cell (2, 3) and corner (1, 1).
```python uses math; Var a:Array[0..100,0..100] of longint; ans,i,j,t,n,m:longint; begin Read(n,m); for i:=1 to n do for j:=1 to m do read(a[i,j]); ans:=5; for i:=1 to n do begin for j:=1 to m do begin if a[i,j]=1 then begin t:=4; if (j=m) or (j=1) then dec(t,2); if (i=1) or (i=n) then dec(t,2); if t=0 then t:=1; ans:=min(ans,t); end; end; end; WriteLn(ans); end. ```
-1
199
A
Hexadecimal's theorem
PROGRAMMING
900
[ "brute force", "constructive algorithms", "implementation", "number theory" ]
null
null
Recently, a chaotic virus Hexadecimal advanced a new theorem which will shake the Universe. She thinks that each Fibonacci number can be represented as sum of three not necessary different Fibonacci numbers. Let's remember how Fibonacci numbers can be calculated. *F*0<==<=0, *F*1<==<=1, and all the next numbers are *F**i*<==<=*F**i*<=-<=2<=+<=*F**i*<=-<=1. So, Fibonacci numbers make a sequence of numbers: 0, 1, 1, 2, 3, 5, 8, 13, ... If you haven't run away from the PC in fear, you have to help the virus. Your task is to divide given Fibonacci number *n* by three not necessary different Fibonacci numbers or say that it is impossible.
The input contains of a single integer *n* (0<=≤<=*n*<=&lt;<=109) — the number that should be represented by the rules described above. It is guaranteed that *n* is a Fibonacci number.
Output three required numbers: *a*, *b* and *c*. If there is no answer for the test you have to print "I'm too stupid to solve this problem" without the quotes. If there are multiple answers, print any of them.
[ "3\n", "13\n" ]
[ "1 1 1\n", "2 3 8\n" ]
none
500
[ { "input": "3", "output": "1 1 1" }, { "input": "13", "output": "2 3 8" }, { "input": "0", "output": "0 0 0" }, { "input": "1", "output": "1 0 0" }, { "input": "2", "output": "1 1 0" }, { "input": "1597", "output": "233 377 987" }, { "input": "0", "output": "0 0 0" }, { "input": "1", "output": "1 0 0" }, { "input": "1", "output": "1 0 0" }, { "input": "2", "output": "1 1 0" }, { "input": "3", "output": "1 1 1" }, { "input": "5", "output": "1 1 3" }, { "input": "8", "output": "1 2 5" }, { "input": "13", "output": "2 3 8" }, { "input": "21", "output": "3 5 13" }, { "input": "34", "output": "5 8 21" }, { "input": "55", "output": "8 13 34" }, { "input": "89", "output": "13 21 55" }, { "input": "144", "output": "21 34 89" }, { "input": "233", "output": "34 55 144" }, { "input": "377", "output": "55 89 233" }, { "input": "610", "output": "89 144 377" }, { "input": "987", "output": "144 233 610" }, { "input": "1597", "output": "233 377 987" }, { "input": "2584", "output": "377 610 1597" }, { "input": "4181", "output": "610 987 2584" }, { "input": "6765", "output": "987 1597 4181" }, { "input": "10946", "output": "1597 2584 6765" }, { "input": "17711", "output": "2584 4181 10946" }, { "input": "28657", "output": "4181 6765 17711" }, { "input": "46368", "output": "6765 10946 28657" }, { "input": "75025", "output": "10946 17711 46368" }, { "input": "121393", "output": "17711 28657 75025" }, { "input": "196418", "output": "28657 46368 121393" }, { "input": "317811", "output": "46368 75025 196418" }, { "input": "514229", "output": "75025 121393 317811" }, { "input": "832040", "output": "121393 196418 514229" }, { "input": "1346269", "output": "196418 317811 832040" }, { "input": "2178309", "output": "317811 514229 1346269" }, { "input": "3524578", "output": "514229 832040 2178309" }, { "input": "5702887", "output": "832040 1346269 3524578" }, { "input": "9227465", "output": "1346269 2178309 5702887" }, { "input": "14930352", "output": "2178309 3524578 9227465" }, { "input": "24157817", "output": "3524578 5702887 14930352" }, { "input": "39088169", "output": "5702887 9227465 24157817" }, { "input": "63245986", "output": "9227465 14930352 39088169" }, { "input": "102334155", "output": "14930352 24157817 63245986" }, { "input": "165580141", "output": "24157817 39088169 102334155" }, { "input": "267914296", "output": "39088169 63245986 165580141" }, { "input": "433494437", "output": "63245986 102334155 267914296" }, { "input": "701408733", "output": "102334155 165580141 433494437" }, { "input": "701408733", "output": "102334155 165580141 433494437" }, { "input": "102334155", "output": "14930352 24157817 63245986" }, { "input": "63245986", "output": "9227465 14930352 39088169" } ]
1,662,543,451
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
62
0
n = int(input()) def fib(num): if num <= 0: return 0 if num ==1: return 1 else: return (fib(num-1) + fib(num-2)) i=0 while fib(i)!= n: i+=1 print(fib(i-1),fib(i-2),0)
Title: Hexadecimal's theorem Time Limit: None seconds Memory Limit: None megabytes Problem Description: Recently, a chaotic virus Hexadecimal advanced a new theorem which will shake the Universe. She thinks that each Fibonacci number can be represented as sum of three not necessary different Fibonacci numbers. Let's remember how Fibonacci numbers can be calculated. *F*0<==<=0, *F*1<==<=1, and all the next numbers are *F**i*<==<=*F**i*<=-<=2<=+<=*F**i*<=-<=1. So, Fibonacci numbers make a sequence of numbers: 0, 1, 1, 2, 3, 5, 8, 13, ... If you haven't run away from the PC in fear, you have to help the virus. Your task is to divide given Fibonacci number *n* by three not necessary different Fibonacci numbers or say that it is impossible. Input Specification: The input contains of a single integer *n* (0<=≤<=*n*<=&lt;<=109) — the number that should be represented by the rules described above. It is guaranteed that *n* is a Fibonacci number. Output Specification: Output three required numbers: *a*, *b* and *c*. If there is no answer for the test you have to print "I'm too stupid to solve this problem" without the quotes. If there are multiple answers, print any of them. Demo Input: ['3\n', '13\n'] Demo Output: ['1 1 1\n', '2 3 8\n'] Note: none
```python n = int(input()) def fib(num): if num <= 0: return 0 if num ==1: return 1 else: return (fib(num-1) + fib(num-2)) i=0 while fib(i)!= n: i+=1 print(fib(i-1),fib(i-2),0) ```
0
499
B
Lecture
PROGRAMMING
1,000
[ "implementation", "strings" ]
null
null
You have a new professor of graph theory and he speaks very quickly. You come up with the following plan to keep up with his lecture and make notes. You know two languages, and the professor is giving the lecture in the first one. The words in both languages consist of lowercase English characters, each language consists of several words. For each language, all words are distinct, i.e. they are spelled differently. Moreover, the words of these languages have a one-to-one correspondence, that is, for each word in each language, there exists exactly one word in the other language having has the same meaning. You can write down every word the professor says in either the first language or the second language. Of course, during the lecture you write down each word in the language in which the word is shorter. In case of equal lengths of the corresponding words you prefer the word of the first language. You are given the text of the lecture the professor is going to read. Find out how the lecture will be recorded in your notes.
The first line contains two integers, *n* and *m* (1<=≤<=*n*<=≤<=3000, 1<=≤<=*m*<=≤<=3000) — the number of words in the professor's lecture and the number of words in each of these languages. The following *m* lines contain the words. The *i*-th line contains two strings *a**i*, *b**i* meaning that the word *a**i* belongs to the first language, the word *b**i* belongs to the second language, and these two words have the same meaning. It is guaranteed that no word occurs in both languages, and each word occurs in its language exactly once. The next line contains *n* space-separated strings *c*1,<=*c*2,<=...,<=*c**n* — the text of the lecture. It is guaranteed that each of the strings *c**i* belongs to the set of strings {*a*1,<=*a*2,<=... *a**m*}. All the strings in the input are non-empty, each consisting of no more than 10 lowercase English letters.
Output exactly *n* words: how you will record the lecture in your notebook. Output the words of the lecture in the same order as in the input.
[ "4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest\n", "5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll\n" ]
[ "codeforces round letter round\n", "hbnyiyc joll joll un joll\n" ]
none
500
[ { "input": "4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest", "output": "codeforces round letter round" }, { "input": "5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll", "output": "hbnyiyc joll joll un joll" }, { "input": "5 5\nqueyqj f\nb vn\ntabzvk qpfzoqx\nytnyonoc hnxsd\njpggvr lchinjmt\nqueyqj jpggvr b ytnyonoc b", "output": "f jpggvr b hnxsd b" }, { "input": "10 22\nazbrll oen\ngh vdyayei\njphveblohx vfglv\nmfyxib jepnvhcuwo\nrpikazqj uam\nl rx\nokjenof qpnyi\nj tixqrno\nod itozmfct\nikkdxmirx ev\nqexftojc p\nkdazb zjs\nmbk ykvqjrxaxu\nhbcwhouzq pwt\nmirpsz zfaegpl\nuhkkvcj rlvwj\nef iqnnwtolrc\npjzfcpmeag ecdayth\nsa qcthz\ncbfhfxi qrnbvdryz\nwqel tj\natx smkbid\nef hbcwhouzq cbfhfxi hbcwhouzq mirpsz cbfhfxi cbfhfxi okjenof pjzfcpmeag kdazb", "output": "ef pwt cbfhfxi pwt mirpsz cbfhfxi cbfhfxi qpnyi ecdayth zjs" }, { "input": "1 1\namit am\namit", "output": "am" }, { "input": "1 1\na c\na", "output": "a" } ]
1,608,580,672
2,147,483,647
Python 3
OK
TESTS
37
124
512,000
n, m = map(int, input().split()) lang_map = {} for i in range(m): w1, w2 = input().split() lang_map[w1] = min(w1, w2, key=len) lecture = input() print(" ".join([lang_map[w] for w in lecture.split()]))
Title: Lecture Time Limit: None seconds Memory Limit: None megabytes Problem Description: You have a new professor of graph theory and he speaks very quickly. You come up with the following plan to keep up with his lecture and make notes. You know two languages, and the professor is giving the lecture in the first one. The words in both languages consist of lowercase English characters, each language consists of several words. For each language, all words are distinct, i.e. they are spelled differently. Moreover, the words of these languages have a one-to-one correspondence, that is, for each word in each language, there exists exactly one word in the other language having has the same meaning. You can write down every word the professor says in either the first language or the second language. Of course, during the lecture you write down each word in the language in which the word is shorter. In case of equal lengths of the corresponding words you prefer the word of the first language. You are given the text of the lecture the professor is going to read. Find out how the lecture will be recorded in your notes. Input Specification: The first line contains two integers, *n* and *m* (1<=≤<=*n*<=≤<=3000, 1<=≤<=*m*<=≤<=3000) — the number of words in the professor's lecture and the number of words in each of these languages. The following *m* lines contain the words. The *i*-th line contains two strings *a**i*, *b**i* meaning that the word *a**i* belongs to the first language, the word *b**i* belongs to the second language, and these two words have the same meaning. It is guaranteed that no word occurs in both languages, and each word occurs in its language exactly once. The next line contains *n* space-separated strings *c*1,<=*c*2,<=...,<=*c**n* — the text of the lecture. It is guaranteed that each of the strings *c**i* belongs to the set of strings {*a*1,<=*a*2,<=... *a**m*}. All the strings in the input are non-empty, each consisting of no more than 10 lowercase English letters. Output Specification: Output exactly *n* words: how you will record the lecture in your notebook. Output the words of the lecture in the same order as in the input. Demo Input: ['4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest\n', '5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll\n'] Demo Output: ['codeforces round letter round\n', 'hbnyiyc joll joll un joll\n'] Note: none
```python n, m = map(int, input().split()) lang_map = {} for i in range(m): w1, w2 = input().split() lang_map[w1] = min(w1, w2, key=len) lecture = input() print(" ".join([lang_map[w] for w in lecture.split()])) ```
3
701
A
Cards
PROGRAMMING
800
[ "greedy", "implementation" ]
null
null
There are *n* cards (*n* is even) in the deck. Each card has a positive integer written on it. *n*<=/<=2 people will play new card game. At the beginning of the game each player gets two cards, each card is given to exactly one player. Find the way to distribute cards such that the sum of values written of the cards will be equal for each player. It is guaranteed that it is always possible.
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=100) — the number of cards in the deck. It is guaranteed that *n* is even. The second line contains the sequence of *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100), where *a**i* is equal to the number written on the *i*-th card.
Print *n*<=/<=2 pairs of integers, the *i*-th pair denote the cards that should be given to the *i*-th player. Each card should be given to exactly one player. Cards are numbered in the order they appear in the input. It is guaranteed that solution exists. If there are several correct answers, you are allowed to print any of them.
[ "6\n1 5 7 4 4 3\n", "4\n10 10 10 10\n" ]
[ "1 3\n6 2\n4 5\n", "1 2\n3 4\n" ]
In the first sample, cards are distributed in such a way that each player has the sum of numbers written on his cards equal to 8. In the second sample, all values *a*<sub class="lower-index">*i*</sub> are equal. Thus, any distribution is acceptable.
500
[ { "input": "6\n1 5 7 4 4 3", "output": "1 3\n6 2\n4 5" }, { "input": "4\n10 10 10 10", "output": "1 4\n2 3" }, { "input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2", "output": "1 100\n2 99\n3 98\n4 97\n5 96\n6 95\n7 94\n8 93\n9 92\n10 91\n11 90\n12 89\n13 88\n14 87\n15 86\n16 85\n17 84\n18 83\n19 82\n20 81\n21 80\n22 79\n23 78\n24 77\n25 76\n26 75\n27 74\n28 73\n29 72\n30 71\n31 70\n32 69\n33 68\n34 67\n35 66\n36 65\n37 64\n38 63\n39 62\n40 61\n41 60\n42 59\n43 58\n44 57\n45 56\n46 55\n47 54\n48 53\n49 52\n50 51" }, { "input": "4\n82 46 8 44", "output": "3 1\n4 2" }, { "input": "2\n35 50", "output": "1 2" }, { "input": "8\n24 39 49 38 44 64 44 50", "output": "1 6\n4 8\n2 3\n5 7" }, { "input": "100\n23 44 35 88 10 78 8 84 46 19 69 36 81 60 46 12 53 22 83 73 6 18 80 14 54 39 74 42 34 20 91 70 32 11 80 53 70 21 24 12 87 68 35 39 8 84 81 70 8 54 73 2 60 71 4 33 65 48 69 58 55 57 78 61 45 50 55 72 86 37 5 11 12 81 32 19 22 11 22 82 23 56 61 84 47 59 31 38 31 90 57 1 24 38 68 27 80 9 37 14", "output": "92 31\n52 90\n55 4\n71 41\n21 69\n7 84\n45 46\n49 8\n98 19\n5 80\n34 74\n72 47\n78 13\n16 97\n40 35\n73 23\n24 63\n100 6\n22 27\n10 51\n76 20\n30 68\n38 54\n18 48\n77 37\n79 32\n1 59\n81 11\n39 95\n93 42\n96 57\n87 83\n89 64\n33 53\n75 14\n56 86\n29 60\n3 91\n43 62\n12 82\n70 67\n99 61\n88 50\n94 25\n26 36\n44 17\n28 66\n2 58\n65 85\n9 15" }, { "input": "12\n22 83 2 67 55 12 40 93 83 73 12 28", "output": "3 8\n6 9\n11 2\n1 10\n12 4\n7 5" }, { "input": "16\n10 33 36 32 48 25 31 27 45 13 37 26 22 21 15 43", "output": "1 5\n10 9\n15 16\n14 11\n13 3\n6 2\n12 4\n8 7" }, { "input": "20\n18 13 71 60 28 10 20 65 65 12 13 14 64 68 6 50 72 7 66 58", "output": "15 17\n18 3\n6 14\n10 19\n2 9\n11 8\n12 13\n1 4\n7 20\n5 16" }, { "input": "24\n59 39 25 22 46 21 24 70 60 11 46 42 44 37 13 37 41 58 72 23 25 61 58 62", "output": "10 19\n15 8\n6 24\n4 22\n20 9\n7 1\n3 23\n21 18\n14 11\n16 5\n2 13\n17 12" }, { "input": "28\n22 1 51 31 83 35 3 64 59 10 61 25 19 53 55 80 78 8 82 22 67 4 27 64 33 6 85 76", "output": "2 27\n7 5\n22 19\n26 16\n18 17\n10 28\n13 21\n1 24\n20 8\n12 11\n23 9\n4 15\n25 14\n6 3" }, { "input": "32\n41 42 22 68 40 52 66 16 73 25 41 21 36 60 46 30 24 55 35 10 54 52 70 24 20 56 3 34 35 6 51 8", "output": "27 9\n30 23\n32 4\n20 7\n8 14\n25 26\n12 18\n3 21\n17 22\n24 6\n10 31\n16 15\n28 2\n19 11\n29 1\n13 5" }, { "input": "36\n1 10 61 43 27 49 55 33 7 30 45 78 69 34 38 19 36 49 55 11 30 63 46 24 16 68 71 18 11 52 72 24 60 68 8 41", "output": "1 12\n9 31\n35 27\n2 13\n20 34\n29 26\n25 22\n28 3\n16 33\n24 19\n32 7\n5 30\n10 18\n21 6\n8 23\n14 11\n17 4\n15 36" }, { "input": "40\n7 30 13 37 37 56 45 28 61 28 23 33 44 63 58 52 21 2 42 19 10 32 9 7 61 15 58 20 45 4 46 24 35 17 50 4 20 48 41 55", "output": "18 14\n30 25\n36 9\n1 27\n24 15\n23 6\n21 40\n3 16\n26 35\n34 38\n20 31\n28 29\n37 7\n17 13\n11 19\n32 39\n8 5\n10 4\n2 33\n22 12" }, { "input": "44\n7 12 46 78 24 68 86 22 71 79 85 14 58 72 26 46 54 39 35 13 31 45 81 21 15 8 47 64 69 87 57 6 18 80 47 29 36 62 34 67 59 48 75 25", "output": "32 30\n1 7\n26 11\n2 23\n20 34\n12 10\n25 4\n33 43\n24 14\n8 9\n5 29\n44 6\n15 40\n36 28\n21 38\n39 41\n19 13\n37 31\n18 17\n22 42\n3 35\n16 27" }, { "input": "48\n57 38 16 25 34 57 29 38 60 51 72 78 22 39 10 33 20 16 12 3 51 74 9 88 4 70 56 65 86 18 33 12 77 78 52 87 68 85 81 5 61 2 52 39 80 13 74 30", "output": "42 24\n20 36\n25 29\n40 38\n23 39\n15 45\n19 34\n32 12\n46 33\n3 47\n18 22\n30 11\n17 26\n13 37\n4 28\n7 41\n48 9\n16 6\n31 1\n5 27\n2 43\n8 35\n14 21\n44 10" }, { "input": "52\n57 12 13 40 68 31 18 4 31 18 65 3 62 32 6 3 49 48 51 33 53 40 9 32 47 53 58 19 14 23 32 38 39 69 19 20 62 52 68 17 39 22 54 59 3 2 52 9 67 68 24 39", "output": "46 34\n12 50\n16 39\n45 5\n8 49\n15 11\n23 37\n48 13\n2 44\n3 27\n29 1\n40 43\n7 26\n10 21\n28 47\n35 38\n36 19\n42 17\n30 18\n51 25\n6 22\n9 4\n14 52\n24 41\n31 33\n20 32" }, { "input": "56\n53 59 66 68 71 25 48 32 12 61 72 69 30 6 56 55 25 49 60 47 46 46 66 19 31 9 23 15 10 12 71 53 51 32 39 31 66 66 17 52 12 7 7 22 49 12 71 29 63 7 47 29 18 39 27 26", "output": "14 11\n42 47\n43 31\n50 5\n26 12\n29 4\n9 38\n30 37\n41 23\n46 3\n28 49\n39 10\n53 19\n24 2\n44 15\n27 16\n6 32\n17 1\n56 40\n55 33\n48 45\n52 18\n13 7\n25 51\n36 20\n8 22\n34 21\n35 54" }, { "input": "60\n47 63 20 68 46 12 45 44 14 38 28 73 60 5 20 18 70 64 37 47 26 47 37 61 29 61 23 28 30 68 55 22 25 60 38 7 63 12 38 15 14 30 11 5 70 15 53 52 7 57 49 45 55 37 45 28 50 2 31 30", "output": "58 12\n14 45\n44 17\n36 30\n49 4\n43 18\n6 37\n38 2\n9 26\n41 24\n40 34\n46 13\n16 50\n3 53\n15 31\n32 47\n27 48\n33 57\n21 51\n11 22\n28 20\n56 1\n25 5\n29 55\n42 52\n60 7\n59 8\n19 39\n23 35\n54 10" }, { "input": "64\n63 39 19 5 48 56 49 45 29 68 25 59 37 69 62 26 60 44 60 6 67 68 2 40 56 6 19 12 17 70 23 11 59 37 41 55 30 68 72 14 38 34 3 71 2 4 55 15 31 66 15 51 36 72 18 7 6 14 43 33 8 35 57 18", "output": "23 54\n45 39\n43 44\n46 30\n4 14\n20 38\n26 22\n57 10\n56 21\n61 50\n32 1\n28 15\n40 19\n58 17\n48 33\n51 12\n29 63\n55 25\n64 6\n3 47\n27 36\n31 52\n11 7\n16 5\n9 8\n37 18\n49 59\n60 35\n42 24\n62 2\n53 41\n13 34" }, { "input": "68\n58 68 40 55 62 15 10 54 19 18 69 27 15 53 8 18 8 33 15 49 20 9 70 8 18 64 14 59 9 64 3 35 46 11 5 65 58 55 28 58 4 55 64 5 68 24 4 58 23 45 58 50 38 68 5 15 20 9 5 53 20 63 69 68 15 53 65 65", "output": "31 23\n41 63\n47 11\n35 64\n44 54\n55 45\n59 2\n15 68\n17 67\n24 36\n22 43\n29 30\n58 26\n7 62\n34 5\n27 28\n6 51\n13 48\n19 40\n56 37\n65 1\n10 42\n16 38\n25 4\n9 8\n21 66\n57 60\n61 14\n49 52\n46 20\n12 33\n39 50\n18 3\n32 53" }, { "input": "72\n61 13 55 23 24 55 44 33 59 19 14 17 66 40 27 33 29 37 28 74 50 56 59 65 64 17 42 56 73 51 64 23 22 26 38 22 36 47 60 14 52 28 14 12 6 41 73 5 64 67 61 74 54 34 45 34 44 4 34 49 18 72 44 47 31 19 11 31 5 4 45 50", "output": "58 52\n70 20\n48 47\n69 29\n45 62\n67 50\n44 13\n2 24\n11 49\n40 31\n43 25\n12 51\n26 1\n61 39\n10 23\n66 9\n33 28\n36 22\n4 6\n32 3\n5 53\n34 41\n15 30\n19 72\n42 21\n17 60\n65 64\n68 38\n8 71\n16 55\n54 63\n56 57\n59 7\n37 27\n18 46\n35 14" }, { "input": "76\n73 37 73 67 26 45 43 74 47 31 43 81 4 3 39 79 48 81 67 39 67 66 43 67 80 51 34 79 5 58 45 10 39 50 9 78 6 18 75 17 45 17 51 71 34 53 33 11 17 15 11 69 50 41 13 74 10 33 77 41 11 64 36 74 17 32 3 10 27 20 5 73 52 41 7 57", "output": "14 18\n67 12\n13 25\n29 28\n71 16\n37 36\n75 59\n35 39\n32 64\n57 56\n68 8\n48 72\n51 3\n61 1\n55 44\n50 52\n40 24\n42 21\n49 19\n65 4\n38 22\n70 62\n5 30\n69 76\n10 46\n66 73\n47 43\n58 26\n27 53\n45 34\n63 17\n2 9\n15 41\n20 31\n33 6\n54 23\n60 11\n74 7" }, { "input": "80\n18 38 65 1 20 9 57 2 36 26 15 17 33 61 65 27 10 35 49 42 40 32 19 33 12 36 56 31 10 41 8 54 56 60 5 47 61 43 23 19 20 30 7 6 38 60 29 58 35 64 30 51 6 17 30 24 47 1 37 47 34 36 48 28 5 25 47 19 30 39 36 23 31 28 46 46 59 43 19 49", "output": "4 15\n58 3\n8 50\n35 37\n65 14\n44 46\n53 34\n43 77\n31 48\n6 7\n17 33\n29 27\n25 32\n11 52\n12 80\n54 19\n1 63\n23 67\n40 60\n68 57\n79 36\n5 76\n41 75\n39 78\n72 38\n56 20\n66 30\n10 21\n16 70\n64 45\n74 2\n47 59\n42 71\n51 62\n55 26\n69 9\n28 49\n73 18\n22 61\n13 24" }, { "input": "84\n59 41 54 14 42 55 29 28 41 73 40 15 1 1 66 49 76 59 68 60 42 81 19 23 33 12 80 81 42 22 54 54 2 22 22 28 27 60 36 57 17 76 38 20 40 65 23 9 81 50 25 13 46 36 59 53 6 35 47 40 59 19 67 46 63 49 12 33 23 49 33 23 32 62 60 70 44 1 6 63 28 16 70 69", "output": "13 49\n14 28\n78 22\n33 27\n57 42\n79 17\n48 10\n26 83\n67 76\n52 84\n4 19\n12 63\n82 15\n41 46\n23 80\n62 65\n44 74\n30 75\n34 38\n35 20\n24 61\n47 55\n69 18\n72 1\n51 40\n37 6\n8 32\n36 31\n81 3\n7 56\n73 50\n25 70\n68 66\n71 16\n58 59\n39 64\n54 53\n43 77\n11 29\n45 21\n60 5\n2 9" }, { "input": "88\n10 28 71 6 58 66 45 52 13 71 39 1 10 29 30 70 14 17 15 38 4 60 5 46 66 41 40 58 2 57 32 44 21 26 13 40 64 63 56 33 46 8 30 43 67 55 44 28 32 62 14 58 42 67 45 59 32 68 10 31 51 6 42 34 9 12 51 27 20 14 62 42 16 5 1 14 30 62 40 59 58 26 25 15 27 47 21 57", "output": "12 10\n75 3\n29 16\n21 58\n23 54\n74 45\n4 25\n62 6\n42 37\n65 38\n1 78\n13 71\n59 50\n66 22\n9 80\n35 56\n17 81\n51 52\n70 28\n76 5\n19 88\n84 30\n73 39\n18 46\n69 8\n33 67\n87 61\n83 86\n34 41\n82 24\n68 55\n85 7\n2 47\n48 32\n14 44\n15 72\n43 63\n77 53\n60 26\n31 79\n49 36\n57 27\n40 11\n64 20" }, { "input": "92\n17 37 81 15 29 70 73 42 49 23 44 77 27 44 74 11 43 66 15 41 60 36 33 11 2 76 16 51 45 21 46 16 85 29 76 79 16 6 60 13 25 44 62 28 43 35 63 24 76 71 62 15 57 72 45 10 71 59 74 14 53 13 58 72 14 72 73 11 25 1 57 42 86 63 50 30 64 38 10 77 75 24 58 8 54 12 43 30 27 71 52 34", "output": "70 73\n25 33\n38 3\n84 36\n56 80\n79 12\n16 49\n24 35\n68 26\n86 81\n40 59\n62 15\n60 67\n65 7\n4 66\n19 64\n52 54\n27 90\n32 57\n37 50\n1 6\n30 18\n10 77\n48 74\n82 47\n41 51\n69 43\n13 39\n89 21\n44 58\n5 83\n34 63\n76 71\n88 53\n23 85\n92 61\n46 91\n22 28\n2 75\n78 9\n20 31\n8 55\n72 29\n17 42\n45 14\n87 11" }, { "input": "96\n77 7 47 19 73 31 46 13 89 69 52 9 26 77 6 87 55 45 71 2 79 1 80 20 4 82 64 20 75 86 84 24 77 56 16 54 53 35 74 73 40 29 63 20 83 39 58 16 31 41 40 16 11 90 30 48 62 39 55 8 50 3 77 73 75 66 14 90 18 54 38 10 53 22 67 38 27 91 62 37 85 13 92 7 18 83 10 3 86 54 80 59 34 16 39 43", "output": "22 83\n20 78\n62 68\n88 54\n25 9\n15 16\n2 89\n84 30\n60 81\n12 31\n72 86\n87 45\n53 26\n8 91\n82 23\n67 21\n35 63\n48 33\n52 14\n94 1\n69 65\n85 29\n4 39\n24 64\n28 40\n44 5\n74 19\n32 10\n13 75\n77 66\n42 27\n55 43\n6 79\n49 57\n93 92\n38 47\n80 34\n71 59\n76 17\n46 90\n58 70\n95 36\n41 73\n51 37\n50 11\n96 61\n18 56\n7 3" }, { "input": "4\n100 100 1 1", "output": "3 2\n4 1" }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1 100\n2 99\n3 98\n4 97\n5 96\n6 95\n7 94\n8 93\n9 92\n10 91\n11 90\n12 89\n13 88\n14 87\n15 86\n16 85\n17 84\n18 83\n19 82\n20 81\n21 80\n22 79\n23 78\n24 77\n25 76\n26 75\n27 74\n28 73\n29 72\n30 71\n31 70\n32 69\n33 68\n34 67\n35 66\n36 65\n37 64\n38 63\n39 62\n40 61\n41 60\n42 59\n43 58\n44 57\n45 56\n46 55\n47 54\n48 53\n49 52\n50 51" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "1 100\n2 99\n3 98\n4 97\n5 96\n6 95\n7 94\n8 93\n9 92\n10 91\n11 90\n12 89\n13 88\n14 87\n15 86\n16 85\n17 84\n18 83\n19 82\n20 81\n21 80\n22 79\n23 78\n24 77\n25 76\n26 75\n27 74\n28 73\n29 72\n30 71\n31 70\n32 69\n33 68\n34 67\n35 66\n36 65\n37 64\n38 63\n39 62\n40 61\n41 60\n42 59\n43 58\n44 57\n45 56\n46 55\n47 54\n48 53\n49 52\n50 51" }, { "input": "4\n3 4 4 5", "output": "1 4\n2 3" }, { "input": "4\n1 1 2 2", "output": "1 4\n2 3" }, { "input": "4\n1 2 3 4", "output": "1 4\n2 3" } ]
1,654,603,350
2,147,483,647
Python 3
OK
TESTS
35
46
0
def sort_key(x): return x[1] n = int(input()) a = list(map(int, input().split())) a = list(enumerate(a, 1)) a = sorted(a, key=sort_key) for i in range(n // 2): print(a[i][0], a[(-i - 1)][0])
Title: Cards Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* cards (*n* is even) in the deck. Each card has a positive integer written on it. *n*<=/<=2 people will play new card game. At the beginning of the game each player gets two cards, each card is given to exactly one player. Find the way to distribute cards such that the sum of values written of the cards will be equal for each player. It is guaranteed that it is always possible. Input Specification: The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=100) — the number of cards in the deck. It is guaranteed that *n* is even. The second line contains the sequence of *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100), where *a**i* is equal to the number written on the *i*-th card. Output Specification: Print *n*<=/<=2 pairs of integers, the *i*-th pair denote the cards that should be given to the *i*-th player. Each card should be given to exactly one player. Cards are numbered in the order they appear in the input. It is guaranteed that solution exists. If there are several correct answers, you are allowed to print any of them. Demo Input: ['6\n1 5 7 4 4 3\n', '4\n10 10 10 10\n'] Demo Output: ['1 3\n6 2\n4 5\n', '1 2\n3 4\n'] Note: In the first sample, cards are distributed in such a way that each player has the sum of numbers written on his cards equal to 8. In the second sample, all values *a*<sub class="lower-index">*i*</sub> are equal. Thus, any distribution is acceptable.
```python def sort_key(x): return x[1] n = int(input()) a = list(map(int, input().split())) a = list(enumerate(a, 1)) a = sorted(a, key=sort_key) for i in range(n // 2): print(a[i][0], a[(-i - 1)][0]) ```
3
384
A
Coder
PROGRAMMING
800
[ "implementation" ]
null
null
Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1). Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000).
On the first line print an integer, the maximum number of Coders that can be placed on the chessboard. On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'. If there are multiple correct answers, you can print any.
[ "2\n" ]
[ "2\nC.\n.C\n" ]
none
500
[ { "input": "2", "output": "2\nC.\n.C" }, { "input": "3", "output": "5\nC.C\n.C.\nC.C" }, { "input": "4", "output": "8\nC.C.\n.C.C\nC.C.\n.C.C" }, { "input": "10", "output": "50\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C" }, { "input": "15", "output": "113\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C" }, { "input": "100", "output": "5000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "101", "output": "5101\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "500", "output": "125000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n...." }, { "input": "501", "output": "125501\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n..." }, { "input": "755", "output": "285013\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "888", "output": "394272\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "998", "output": "498002\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "999", "output": "499001\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "1000", "output": "500000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "1", "output": "1\nC" } ]
1,527,702,603
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
9
1,000
8,396,800
inp = int(input()) total = 0 string = "" for i in range(inp): if i % 2 == 0: for j in range(inp): if j % 2 == 0: string = string + "C" total += 1 else: #print(".", end='') string = string + "." #print("", end='\n') string = string + "n" else: for j in range(inp): if j % 2 == 0: #print(".", end='') string = string + "." else: string = string + "C" #print("C", end='') total += 1 #print("", end = "\n") string = string + "n" print(total) for i in range(len(string)): if string[i] != 'n': print(string[i], end="") else: print("", end="\n")
Title: Coder Time Limit: None seconds Memory Limit: None megabytes Problem Description: Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1). Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000). Output Specification: On the first line print an integer, the maximum number of Coders that can be placed on the chessboard. On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'. If there are multiple correct answers, you can print any. Demo Input: ['2\n'] Demo Output: ['2\nC.\n.C\n'] Note: none
```python inp = int(input()) total = 0 string = "" for i in range(inp): if i % 2 == 0: for j in range(inp): if j % 2 == 0: string = string + "C" total += 1 else: #print(".", end='') string = string + "." #print("", end='\n') string = string + "n" else: for j in range(inp): if j % 2 == 0: #print(".", end='') string = string + "." else: string = string + "C" #print("C", end='') total += 1 #print("", end = "\n") string = string + "n" print(total) for i in range(len(string)): if string[i] != 'n': print(string[i], end="") else: print("", end="\n") ```
0
551
A
GukiZ and Contest
PROGRAMMING
800
[ "brute force", "implementation", "sortings" ]
null
null
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest. In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings. He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position. GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students. The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
[ "3\n1 3 3\n", "1\n1\n", "5\n3 5 3 4 5\n" ]
[ "3 1 1\n", "1\n", "4 1 4 3 1\n" ]
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating. In the second sample, first student is the only one on the contest. In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
500
[ { "input": "3\n1 3 3", "output": "3 1 1" }, { "input": "1\n1", "output": "1" }, { "input": "5\n3 5 3 4 5", "output": "4 1 4 3 1" }, { "input": "7\n1 3 5 4 2 2 1", "output": "6 3 1 2 4 4 6" }, { "input": "11\n5 6 4 2 9 7 6 6 6 6 7", "output": "9 4 10 11 1 2 4 4 4 4 2" }, { "input": "1\n2000", "output": "1" }, { "input": "2\n2000 2000", "output": "1 1" }, { "input": "3\n500 501 502", "output": "3 2 1" }, { "input": "10\n105 106 1 1 1 11 1000 999 1000 999", "output": "6 5 8 8 8 7 1 3 1 3" }, { "input": "6\n1 2 3 4 5 6", "output": "6 5 4 3 2 1" }, { "input": "7\n6 5 4 3 2 1 1", "output": "1 2 3 4 5 6 6" }, { "input": "8\n153 100 87 14 10 8 6 5", "output": "1 2 3 4 5 6 7 8" }, { "input": "70\n11 54 37 62 1 46 13 17 38 47 28 15 63 5 61 34 49 66 32 59 3 41 58 28 23 62 41 64 20 5 14 41 10 37 51 32 65 46 61 8 15 19 16 44 31 42 19 46 66 25 26 58 60 5 19 18 69 53 20 40 45 27 24 41 32 23 57 56 62 10", "output": "62 18 35 7 70 23 61 56 34 22 42 58 6 66 10 37 21 2 38 13 69 29 14 42 48 7 29 5 50 66 60 29 63 35 20 38 4 23 10 65 58 52 57 27 41 28 52 23 2 46 45 14 12 66 52 55 1 19 50 33 26 44 47 29 38 48 16 17 7 63" }, { "input": "5\n1 2000 1 1 2000", "output": "3 1 3 3 1" } ]
1,624,252,605
2,147,483,647
Python 3
OK
TESTS
36
529
0
n = int(input()) arr = list(map(int, input().split())) for i in arr: count = 0 for j in arr: if j > i: count+=1 if count == 0: print(1, end=" ") else: print(count+1, end=" ")
Title: GukiZ and Contest Time Limit: None seconds Memory Limit: None megabytes Problem Description: Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest. In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings. He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position. GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students. The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*). Output Specification: In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input. Demo Input: ['3\n1 3 3\n', '1\n1\n', '5\n3 5 3 4 5\n'] Demo Output: ['3 1 1\n', '1\n', '4 1 4 3 1\n'] Note: In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating. In the second sample, first student is the only one on the contest. In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
```python n = int(input()) arr = list(map(int, input().split())) for i in arr: count = 0 for j in arr: if j > i: count+=1 if count == 0: print(1, end=" ") else: print(count+1, end=" ") ```
3
620
B
Grandfather Dovlet’s calculator
PROGRAMMING
1,000
[ "implementation" ]
null
null
Once Max found an electronic calculator from his grandfather Dovlet's chest. He noticed that the numbers were written with seven-segment indicators ([https://en.wikipedia.org/wiki/Seven-segment_display](https://en.wikipedia.org/wiki/Seven-segment_display)). Max starts to type all the values from *a* to *b*. After typing each number Max resets the calculator. Find the total number of segments printed on the calculator. For example if *a*<==<=1 and *b*<==<=3 then at first the calculator will print 2 segments, then — 5 segments and at last it will print 5 segments. So the total number of printed segments is 12.
The only line contains two integers *a*,<=*b* (1<=≤<=*a*<=≤<=*b*<=≤<=106) — the first and the last number typed by Max.
Print the only integer *a* — the total number of printed segments.
[ "1 3\n", "10 15\n" ]
[ "12\n", "39\n" ]
none
0
[ { "input": "1 3", "output": "12" }, { "input": "10 15", "output": "39" }, { "input": "1 100", "output": "928" }, { "input": "100 10000", "output": "188446" }, { "input": "213 221442", "output": "5645356" }, { "input": "1 1000000", "output": "28733372" }, { "input": "1000000 1000000", "output": "38" }, { "input": "222145 353252", "output": "3860750" }, { "input": "2 1000000", "output": "28733370" }, { "input": "1 999999", "output": "28733334" }, { "input": "192 200", "output": "122" } ]
1,550,178,879
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
5
1,000
0
f=lambda:map(int,input().split()) a=[6,2,5,5,4,5,6,3,7,6] x,y=f() s=0 for i in range(x,y+1): s+=sum(a[int(i)] for i in str(i)) print(s)
Title: Grandfather Dovlet’s calculator Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once Max found an electronic calculator from his grandfather Dovlet's chest. He noticed that the numbers were written with seven-segment indicators ([https://en.wikipedia.org/wiki/Seven-segment_display](https://en.wikipedia.org/wiki/Seven-segment_display)). Max starts to type all the values from *a* to *b*. After typing each number Max resets the calculator. Find the total number of segments printed on the calculator. For example if *a*<==<=1 and *b*<==<=3 then at first the calculator will print 2 segments, then — 5 segments and at last it will print 5 segments. So the total number of printed segments is 12. Input Specification: The only line contains two integers *a*,<=*b* (1<=≤<=*a*<=≤<=*b*<=≤<=106) — the first and the last number typed by Max. Output Specification: Print the only integer *a* — the total number of printed segments. Demo Input: ['1 3\n', '10 15\n'] Demo Output: ['12\n', '39\n'] Note: none
```python f=lambda:map(int,input().split()) a=[6,2,5,5,4,5,6,3,7,6] x,y=f() s=0 for i in range(x,y+1): s+=sum(a[int(i)] for i in str(i)) print(s) ```
0
334
A
Candy Bags
PROGRAMMING
1,000
[ "implementation" ]
null
null
Gerald has *n* younger brothers and their number happens to be even. One day he bought *n*2 candy bags. One bag has one candy, one bag has two candies, one bag has three candies and so on. In fact, for each integer *k* from 1 to *n*2 he has exactly one bag with *k* candies. Help him give *n* bags of candies to each brother so that all brothers got the same number of candies.
The single line contains a single integer *n* (*n* is even, 2<=≤<=*n*<=≤<=100) — the number of Gerald's brothers.
Let's assume that Gerald indexes his brothers with numbers from 1 to *n*. You need to print *n* lines, on the *i*-th line print *n* integers — the numbers of candies in the bags for the *i*-th brother. Naturally, all these numbers should be distinct and be within limits from 1 to *n*2. You can print the numbers in the lines in any order. It is guaranteed that the solution exists at the given limits.
[ "2\n" ]
[ "1 4\n2 3\n" ]
The sample shows Gerald's actions if he has two brothers. In this case, his bags contain 1, 2, 3 and 4 candies. He can give the bags with 1 and 4 candies to one brother and the bags with 2 and 3 to the other brother.
500
[ { "input": "2", "output": "1 4\n2 3" }, { "input": "4", "output": "1 16 2 15\n3 14 4 13\n5 12 6 11\n7 10 8 9" }, { "input": "6", "output": "1 36 2 35 3 34\n4 33 5 32 6 31\n7 30 8 29 9 28\n10 27 11 26 12 25\n13 24 14 23 15 22\n16 21 17 20 18 19" }, { "input": "8", "output": "1 64 2 63 3 62 4 61\n5 60 6 59 7 58 8 57\n9 56 10 55 11 54 12 53\n13 52 14 51 15 50 16 49\n17 48 18 47 19 46 20 45\n21 44 22 43 23 42 24 41\n25 40 26 39 27 38 28 37\n29 36 30 35 31 34 32 33" }, { "input": "10", "output": "1 100 2 99 3 98 4 97 5 96\n6 95 7 94 8 93 9 92 10 91\n11 90 12 89 13 88 14 87 15 86\n16 85 17 84 18 83 19 82 20 81\n21 80 22 79 23 78 24 77 25 76\n26 75 27 74 28 73 29 72 30 71\n31 70 32 69 33 68 34 67 35 66\n36 65 37 64 38 63 39 62 40 61\n41 60 42 59 43 58 44 57 45 56\n46 55 47 54 48 53 49 52 50 51" }, { "input": "100", "output": "1 10000 2 9999 3 9998 4 9997 5 9996 6 9995 7 9994 8 9993 9 9992 10 9991 11 9990 12 9989 13 9988 14 9987 15 9986 16 9985 17 9984 18 9983 19 9982 20 9981 21 9980 22 9979 23 9978 24 9977 25 9976 26 9975 27 9974 28 9973 29 9972 30 9971 31 9970 32 9969 33 9968 34 9967 35 9966 36 9965 37 9964 38 9963 39 9962 40 9961 41 9960 42 9959 43 9958 44 9957 45 9956 46 9955 47 9954 48 9953 49 9952 50 9951\n51 9950 52 9949 53 9948 54 9947 55 9946 56 9945 57 9944 58 9943 59 9942 60 9941 61 9940 62 9939 63 9938 64 9937 65 993..." }, { "input": "62", "output": "1 3844 2 3843 3 3842 4 3841 5 3840 6 3839 7 3838 8 3837 9 3836 10 3835 11 3834 12 3833 13 3832 14 3831 15 3830 16 3829 17 3828 18 3827 19 3826 20 3825 21 3824 22 3823 23 3822 24 3821 25 3820 26 3819 27 3818 28 3817 29 3816 30 3815 31 3814\n32 3813 33 3812 34 3811 35 3810 36 3809 37 3808 38 3807 39 3806 40 3805 41 3804 42 3803 43 3802 44 3801 45 3800 46 3799 47 3798 48 3797 49 3796 50 3795 51 3794 52 3793 53 3792 54 3791 55 3790 56 3789 57 3788 58 3787 59 3786 60 3785 61 3784 62 3783\n63 3782 64 3781 65 378..." }, { "input": "66", "output": "1 4356 2 4355 3 4354 4 4353 5 4352 6 4351 7 4350 8 4349 9 4348 10 4347 11 4346 12 4345 13 4344 14 4343 15 4342 16 4341 17 4340 18 4339 19 4338 20 4337 21 4336 22 4335 23 4334 24 4333 25 4332 26 4331 27 4330 28 4329 29 4328 30 4327 31 4326 32 4325 33 4324\n34 4323 35 4322 36 4321 37 4320 38 4319 39 4318 40 4317 41 4316 42 4315 43 4314 44 4313 45 4312 46 4311 47 4310 48 4309 49 4308 50 4307 51 4306 52 4305 53 4304 54 4303 55 4302 56 4301 57 4300 58 4299 59 4298 60 4297 61 4296 62 4295 63 4294 64 4293 65 4292..." }, { "input": "18", "output": "1 324 2 323 3 322 4 321 5 320 6 319 7 318 8 317 9 316\n10 315 11 314 12 313 13 312 14 311 15 310 16 309 17 308 18 307\n19 306 20 305 21 304 22 303 23 302 24 301 25 300 26 299 27 298\n28 297 29 296 30 295 31 294 32 293 33 292 34 291 35 290 36 289\n37 288 38 287 39 286 40 285 41 284 42 283 43 282 44 281 45 280\n46 279 47 278 48 277 49 276 50 275 51 274 52 273 53 272 54 271\n55 270 56 269 57 268 58 267 59 266 60 265 61 264 62 263 63 262\n64 261 65 260 66 259 67 258 68 257 69 256 70 255 71 254 72 253\n73 252 7..." }, { "input": "68", "output": "1 4624 2 4623 3 4622 4 4621 5 4620 6 4619 7 4618 8 4617 9 4616 10 4615 11 4614 12 4613 13 4612 14 4611 15 4610 16 4609 17 4608 18 4607 19 4606 20 4605 21 4604 22 4603 23 4602 24 4601 25 4600 26 4599 27 4598 28 4597 29 4596 30 4595 31 4594 32 4593 33 4592 34 4591\n35 4590 36 4589 37 4588 38 4587 39 4586 40 4585 41 4584 42 4583 43 4582 44 4581 45 4580 46 4579 47 4578 48 4577 49 4576 50 4575 51 4574 52 4573 53 4572 54 4571 55 4570 56 4569 57 4568 58 4567 59 4566 60 4565 61 4564 62 4563 63 4562 64 4561 65 4560..." }, { "input": "86", "output": "1 7396 2 7395 3 7394 4 7393 5 7392 6 7391 7 7390 8 7389 9 7388 10 7387 11 7386 12 7385 13 7384 14 7383 15 7382 16 7381 17 7380 18 7379 19 7378 20 7377 21 7376 22 7375 23 7374 24 7373 25 7372 26 7371 27 7370 28 7369 29 7368 30 7367 31 7366 32 7365 33 7364 34 7363 35 7362 36 7361 37 7360 38 7359 39 7358 40 7357 41 7356 42 7355 43 7354\n44 7353 45 7352 46 7351 47 7350 48 7349 49 7348 50 7347 51 7346 52 7345 53 7344 54 7343 55 7342 56 7341 57 7340 58 7339 59 7338 60 7337 61 7336 62 7335 63 7334 64 7333 65 7332..." }, { "input": "96", "output": "1 9216 2 9215 3 9214 4 9213 5 9212 6 9211 7 9210 8 9209 9 9208 10 9207 11 9206 12 9205 13 9204 14 9203 15 9202 16 9201 17 9200 18 9199 19 9198 20 9197 21 9196 22 9195 23 9194 24 9193 25 9192 26 9191 27 9190 28 9189 29 9188 30 9187 31 9186 32 9185 33 9184 34 9183 35 9182 36 9181 37 9180 38 9179 39 9178 40 9177 41 9176 42 9175 43 9174 44 9173 45 9172 46 9171 47 9170 48 9169\n49 9168 50 9167 51 9166 52 9165 53 9164 54 9163 55 9162 56 9161 57 9160 58 9159 59 9158 60 9157 61 9156 62 9155 63 9154 64 9153 65 9152..." }, { "input": "12", "output": "1 144 2 143 3 142 4 141 5 140 6 139\n7 138 8 137 9 136 10 135 11 134 12 133\n13 132 14 131 15 130 16 129 17 128 18 127\n19 126 20 125 21 124 22 123 23 122 24 121\n25 120 26 119 27 118 28 117 29 116 30 115\n31 114 32 113 33 112 34 111 35 110 36 109\n37 108 38 107 39 106 40 105 41 104 42 103\n43 102 44 101 45 100 46 99 47 98 48 97\n49 96 50 95 51 94 52 93 53 92 54 91\n55 90 56 89 57 88 58 87 59 86 60 85\n61 84 62 83 63 82 64 81 65 80 66 79\n67 78 68 77 69 76 70 75 71 74 72 73" }, { "input": "88", "output": "1 7744 2 7743 3 7742 4 7741 5 7740 6 7739 7 7738 8 7737 9 7736 10 7735 11 7734 12 7733 13 7732 14 7731 15 7730 16 7729 17 7728 18 7727 19 7726 20 7725 21 7724 22 7723 23 7722 24 7721 25 7720 26 7719 27 7718 28 7717 29 7716 30 7715 31 7714 32 7713 33 7712 34 7711 35 7710 36 7709 37 7708 38 7707 39 7706 40 7705 41 7704 42 7703 43 7702 44 7701\n45 7700 46 7699 47 7698 48 7697 49 7696 50 7695 51 7694 52 7693 53 7692 54 7691 55 7690 56 7689 57 7688 58 7687 59 7686 60 7685 61 7684 62 7683 63 7682 64 7681 65 7680..." }, { "input": "28", "output": "1 784 2 783 3 782 4 781 5 780 6 779 7 778 8 777 9 776 10 775 11 774 12 773 13 772 14 771\n15 770 16 769 17 768 18 767 19 766 20 765 21 764 22 763 23 762 24 761 25 760 26 759 27 758 28 757\n29 756 30 755 31 754 32 753 33 752 34 751 35 750 36 749 37 748 38 747 39 746 40 745 41 744 42 743\n43 742 44 741 45 740 46 739 47 738 48 737 49 736 50 735 51 734 52 733 53 732 54 731 55 730 56 729\n57 728 58 727 59 726 60 725 61 724 62 723 63 722 64 721 65 720 66 719 67 718 68 717 69 716 70 715\n71 714 72 713 73 712 74 7..." }, { "input": "80", "output": "1 6400 2 6399 3 6398 4 6397 5 6396 6 6395 7 6394 8 6393 9 6392 10 6391 11 6390 12 6389 13 6388 14 6387 15 6386 16 6385 17 6384 18 6383 19 6382 20 6381 21 6380 22 6379 23 6378 24 6377 25 6376 26 6375 27 6374 28 6373 29 6372 30 6371 31 6370 32 6369 33 6368 34 6367 35 6366 36 6365 37 6364 38 6363 39 6362 40 6361\n41 6360 42 6359 43 6358 44 6357 45 6356 46 6355 47 6354 48 6353 49 6352 50 6351 51 6350 52 6349 53 6348 54 6347 55 6346 56 6345 57 6344 58 6343 59 6342 60 6341 61 6340 62 6339 63 6338 64 6337 65 6336..." }, { "input": "48", "output": "1 2304 2 2303 3 2302 4 2301 5 2300 6 2299 7 2298 8 2297 9 2296 10 2295 11 2294 12 2293 13 2292 14 2291 15 2290 16 2289 17 2288 18 2287 19 2286 20 2285 21 2284 22 2283 23 2282 24 2281\n25 2280 26 2279 27 2278 28 2277 29 2276 30 2275 31 2274 32 2273 33 2272 34 2271 35 2270 36 2269 37 2268 38 2267 39 2266 40 2265 41 2264 42 2263 43 2262 44 2261 45 2260 46 2259 47 2258 48 2257\n49 2256 50 2255 51 2254 52 2253 53 2252 54 2251 55 2250 56 2249 57 2248 58 2247 59 2246 60 2245 61 2244 62 2243 63 2242 64 2241 65 224..." }, { "input": "54", "output": "1 2916 2 2915 3 2914 4 2913 5 2912 6 2911 7 2910 8 2909 9 2908 10 2907 11 2906 12 2905 13 2904 14 2903 15 2902 16 2901 17 2900 18 2899 19 2898 20 2897 21 2896 22 2895 23 2894 24 2893 25 2892 26 2891 27 2890\n28 2889 29 2888 30 2887 31 2886 32 2885 33 2884 34 2883 35 2882 36 2881 37 2880 38 2879 39 2878 40 2877 41 2876 42 2875 43 2874 44 2873 45 2872 46 2871 47 2870 48 2869 49 2868 50 2867 51 2866 52 2865 53 2864 54 2863\n55 2862 56 2861 57 2860 58 2859 59 2858 60 2857 61 2856 62 2855 63 2854 64 2853 65 285..." }, { "input": "58", "output": "1 3364 2 3363 3 3362 4 3361 5 3360 6 3359 7 3358 8 3357 9 3356 10 3355 11 3354 12 3353 13 3352 14 3351 15 3350 16 3349 17 3348 18 3347 19 3346 20 3345 21 3344 22 3343 23 3342 24 3341 25 3340 26 3339 27 3338 28 3337 29 3336\n30 3335 31 3334 32 3333 33 3332 34 3331 35 3330 36 3329 37 3328 38 3327 39 3326 40 3325 41 3324 42 3323 43 3322 44 3321 45 3320 46 3319 47 3318 48 3317 49 3316 50 3315 51 3314 52 3313 53 3312 54 3311 55 3310 56 3309 57 3308 58 3307\n59 3306 60 3305 61 3304 62 3303 63 3302 64 3301 65 330..." }, { "input": "64", "output": "1 4096 2 4095 3 4094 4 4093 5 4092 6 4091 7 4090 8 4089 9 4088 10 4087 11 4086 12 4085 13 4084 14 4083 15 4082 16 4081 17 4080 18 4079 19 4078 20 4077 21 4076 22 4075 23 4074 24 4073 25 4072 26 4071 27 4070 28 4069 29 4068 30 4067 31 4066 32 4065\n33 4064 34 4063 35 4062 36 4061 37 4060 38 4059 39 4058 40 4057 41 4056 42 4055 43 4054 44 4053 45 4052 46 4051 47 4050 48 4049 49 4048 50 4047 51 4046 52 4045 53 4044 54 4043 55 4042 56 4041 57 4040 58 4039 59 4038 60 4037 61 4036 62 4035 63 4034 64 4033\n65 403..." }, { "input": "44", "output": "1 1936 2 1935 3 1934 4 1933 5 1932 6 1931 7 1930 8 1929 9 1928 10 1927 11 1926 12 1925 13 1924 14 1923 15 1922 16 1921 17 1920 18 1919 19 1918 20 1917 21 1916 22 1915\n23 1914 24 1913 25 1912 26 1911 27 1910 28 1909 29 1908 30 1907 31 1906 32 1905 33 1904 34 1903 35 1902 36 1901 37 1900 38 1899 39 1898 40 1897 41 1896 42 1895 43 1894 44 1893\n45 1892 46 1891 47 1890 48 1889 49 1888 50 1887 51 1886 52 1885 53 1884 54 1883 55 1882 56 1881 57 1880 58 1879 59 1878 60 1877 61 1876 62 1875 63 1874 64 1873 65 187..." } ]
1,531,053,100
2,147,483,647
Python 3
OK
TESTS
21
248
204,800
n = int(input()) k, N = n // 2, n ** 2 for i in range(n): for j in range(1, k + 1): num = k * i + j print(num, N - num + 1, end=' ') print()
Title: Candy Bags Time Limit: None seconds Memory Limit: None megabytes Problem Description: Gerald has *n* younger brothers and their number happens to be even. One day he bought *n*2 candy bags. One bag has one candy, one bag has two candies, one bag has three candies and so on. In fact, for each integer *k* from 1 to *n*2 he has exactly one bag with *k* candies. Help him give *n* bags of candies to each brother so that all brothers got the same number of candies. Input Specification: The single line contains a single integer *n* (*n* is even, 2<=≤<=*n*<=≤<=100) — the number of Gerald's brothers. Output Specification: Let's assume that Gerald indexes his brothers with numbers from 1 to *n*. You need to print *n* lines, on the *i*-th line print *n* integers — the numbers of candies in the bags for the *i*-th brother. Naturally, all these numbers should be distinct and be within limits from 1 to *n*2. You can print the numbers in the lines in any order. It is guaranteed that the solution exists at the given limits. Demo Input: ['2\n'] Demo Output: ['1 4\n2 3\n'] Note: The sample shows Gerald's actions if he has two brothers. In this case, his bags contain 1, 2, 3 and 4 candies. He can give the bags with 1 and 4 candies to one brother and the bags with 2 and 3 to the other brother.
```python n = int(input()) k, N = n // 2, n ** 2 for i in range(n): for j in range(1, k + 1): num = k * i + j print(num, N - num + 1, end=' ') print() ```
3
327
C
Magic Five
PROGRAMMING
1,700
[ "combinatorics", "math" ]
null
null
There is a long plate *s* containing *n* digits. Iahub wants to delete some digits (possibly none, but he is not allowed to delete all the digits) to form his "magic number" on the plate, a number that is divisible by 5. Note that, the resulting number may contain leading zeros. Now Iahub wants to count the number of ways he can obtain magic number, modulo 1000000007 (109<=+<=7). Two ways are different, if the set of deleted positions in *s* differs. Look at the input part of the statement, *s* is given in a special form.
In the first line you're given a string *a* (1<=≤<=|*a*|<=≤<=105), containing digits only. In the second line you're given an integer *k* (1<=≤<=*k*<=≤<=109). The plate *s* is formed by concatenating *k* copies of *a* together. That is *n*<==<=|*a*|·*k*.
Print a single integer — the required number of ways modulo 1000000007 (109<=+<=7).
[ "1256\n1\n", "13990\n2\n", "555\n2\n" ]
[ "4\n", "528\n", "63\n" ]
In the first case, there are four possible ways to make a number that is divisible by 5: 5, 15, 25 and 125. In the second case, remember to concatenate the copies of *a*. The actual plate is 1399013990. In the third case, except deleting all digits, any choice will do. Therefore there are 2<sup class="upper-index">6</sup> - 1 = 63 possible ways to delete digits.
1,500
[ { "input": "1256\n1", "output": "4" }, { "input": "13990\n2", "output": "528" }, { "input": "555\n2", "output": "63" }, { "input": "14\n178", "output": "0" }, { "input": "27755776656210607832788619414635535178188775623838313967013958143619017005079991285469853503718562504927535176713879737569375166451462839457844835806559098448980069427607\n151", "output": "319271478" }, { "input": "205831218776360805549796263726315728152440389522084825015113219980083245807721536032762703389\n161", "output": "97770312" }, { "input": "58761716080256287618526160263668449282855983776878138369871377531384\n100", "output": "48078375" }, { "input": "28626813825922172933379733204622160613220115755143268169598722697537715419\n184", "output": "43220279" }, { "input": "0\n1000000000", "output": "140625000" }, { "input": "079797897977\n1", "output": "1" } ]
1,683,855,557
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
3
1,000
0
import itertools a = input() k = int(input()) n = a * k qtd_div = 0 for L in range(1,len(n) + 1): for subset in itertools.combinations(n, L): #print(subset) if subset[-1] in ("5", "0"): qtd_div += 1 print(qtd_div)
Title: Magic Five Time Limit: None seconds Memory Limit: None megabytes Problem Description: There is a long plate *s* containing *n* digits. Iahub wants to delete some digits (possibly none, but he is not allowed to delete all the digits) to form his "magic number" on the plate, a number that is divisible by 5. Note that, the resulting number may contain leading zeros. Now Iahub wants to count the number of ways he can obtain magic number, modulo 1000000007 (109<=+<=7). Two ways are different, if the set of deleted positions in *s* differs. Look at the input part of the statement, *s* is given in a special form. Input Specification: In the first line you're given a string *a* (1<=≤<=|*a*|<=≤<=105), containing digits only. In the second line you're given an integer *k* (1<=≤<=*k*<=≤<=109). The plate *s* is formed by concatenating *k* copies of *a* together. That is *n*<==<=|*a*|·*k*. Output Specification: Print a single integer — the required number of ways modulo 1000000007 (109<=+<=7). Demo Input: ['1256\n1\n', '13990\n2\n', '555\n2\n'] Demo Output: ['4\n', '528\n', '63\n'] Note: In the first case, there are four possible ways to make a number that is divisible by 5: 5, 15, 25 and 125. In the second case, remember to concatenate the copies of *a*. The actual plate is 1399013990. In the third case, except deleting all digits, any choice will do. Therefore there are 2<sup class="upper-index">6</sup> - 1 = 63 possible ways to delete digits.
```python import itertools a = input() k = int(input()) n = a * k qtd_div = 0 for L in range(1,len(n) + 1): for subset in itertools.combinations(n, L): #print(subset) if subset[-1] in ("5", "0"): qtd_div += 1 print(qtd_div) ```
0
548
B
Mike and Fun
PROGRAMMING
1,400
[ "brute force", "dp", "greedy", "implementation" ]
null
null
Mike and some bears are playing a game just for fun. Mike is the judge. All bears except Mike are standing in an *n*<=×<=*m* grid, there's exactly one bear in each cell. We denote the bear standing in column number *j* of row number *i* by (*i*,<=*j*). Mike's hands are on his ears (since he's the judge) and each bear standing in the grid has hands either on his mouth or his eyes. They play for *q* rounds. In each round, Mike chooses a bear (*i*,<=*j*) and tells him to change his state i. e. if his hands are on his mouth, then he'll put his hands on his eyes or he'll put his hands on his mouth otherwise. After that, Mike wants to know the score of the bears. Score of the bears is the maximum over all rows of number of consecutive bears with hands on their eyes in that row. Since bears are lazy, Mike asked you for help. For each round, tell him the score of these bears after changing the state of a bear selected in that round.
The first line of input contains three integers *n*, *m* and *q* (1<=≤<=*n*,<=*m*<=≤<=500 and 1<=≤<=*q*<=≤<=5000). The next *n* lines contain the grid description. There are *m* integers separated by spaces in each line. Each of these numbers is either 0 (for mouth) or 1 (for eyes). The next *q* lines contain the information about the rounds. Each of them contains two integers *i* and *j* (1<=≤<=*i*<=≤<=*n* and 1<=≤<=*j*<=≤<=*m*), the row number and the column number of the bear changing his state.
After each round, print the current score of the bears.
[ "5 4 5\n0 1 1 0\n1 0 0 1\n0 1 1 0\n1 0 0 1\n0 0 0 0\n1 1\n1 4\n1 1\n4 2\n4 3\n" ]
[ "3\n4\n3\n3\n4\n" ]
none
1,000
[ { "input": "5 4 5\n0 1 1 0\n1 0 0 1\n0 1 1 0\n1 0 0 1\n0 0 0 0\n1 1\n1 4\n1 1\n4 2\n4 3", "output": "3\n4\n3\n3\n4" }, { "input": "2 2 10\n1 1\n0 1\n1 1\n2 1\n1 1\n2 2\n1 1\n2 1\n2 2\n2 2\n1 1\n1 1", "output": "1\n2\n2\n2\n1\n1\n1\n1\n2\n1" }, { "input": "2 2 10\n1 1\n0 1\n2 2\n2 2\n1 1\n2 1\n2 1\n1 1\n1 1\n2 1\n1 1\n2 1", "output": "2\n2\n1\n2\n1\n2\n1\n2\n2\n2" }, { "input": "5 5 30\n0 1 1 1 0\n1 1 0 1 1\n0 1 1 1 1\n0 0 1 1 0\n0 0 0 0 0\n3 2\n2 2\n2 2\n4 3\n1 4\n3 2\n4 1\n2 4\n1 4\n2 1\n5 2\n4 1\n4 1\n5 1\n2 4\n2 4\n4 4\n1 2\n3 1\n4 5\n1 2\n2 3\n1 1\n5 1\n3 4\n1 1\n5 4\n1 5\n5 4\n2 2", "output": "3\n3\n3\n3\n3\n4\n4\n4\n4\n4\n4\n4\n4\n4\n4\n4\n4\n4\n5\n5\n5\n5\n5\n5\n4\n3\n3\n4\n4\n4" }, { "input": "1 1 10\n0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "1\n0\n1\n0\n1\n0\n1\n0\n1\n0" }, { "input": "1 1 3\n1\n1 1\n1 1\n1 1", "output": "0\n1\n0" }, { "input": "1 5 5\n0 0 0 0 0\n1 2\n1 1\n1 4\n1 5\n1 3", "output": "1\n2\n2\n2\n5" }, { "input": "5 1 5\n0\n0\n0\n0\n0\n1 1\n2 1\n3 1\n4 1\n5 1", "output": "1\n1\n1\n1\n1" }, { "input": "1 1 1\n0\n1 1", "output": "1" }, { "input": "2 2 1\n1 1\n1 1\n1 1", "output": "2" } ]
1,609,993,312
2,147,483,647
PyPy 3
TIME_LIMIT_EXCEEDED
TESTS
6
2,000
5,939,200
from sys import stdin,stdout nmbr = lambda: int(stdin.readline()) lst = lambda: list(map(int, stdin.readline().split())) for _ in range(1):#nmbr()): r,c,q=lst() a=[lst() for _ in range(r)] for _ in range(q): x,y=lst();ans=0 a[x-1][y-1]^=1 for i in range(r): cnt = res= 0 for j in range(c): if a[i][j] == 1:cnt += 1 else:cnt = 0 res = max(cnt, res) ans=max(res,ans) print(ans)
Title: Mike and Fun Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mike and some bears are playing a game just for fun. Mike is the judge. All bears except Mike are standing in an *n*<=×<=*m* grid, there's exactly one bear in each cell. We denote the bear standing in column number *j* of row number *i* by (*i*,<=*j*). Mike's hands are on his ears (since he's the judge) and each bear standing in the grid has hands either on his mouth or his eyes. They play for *q* rounds. In each round, Mike chooses a bear (*i*,<=*j*) and tells him to change his state i. e. if his hands are on his mouth, then he'll put his hands on his eyes or he'll put his hands on his mouth otherwise. After that, Mike wants to know the score of the bears. Score of the bears is the maximum over all rows of number of consecutive bears with hands on their eyes in that row. Since bears are lazy, Mike asked you for help. For each round, tell him the score of these bears after changing the state of a bear selected in that round. Input Specification: The first line of input contains three integers *n*, *m* and *q* (1<=≤<=*n*,<=*m*<=≤<=500 and 1<=≤<=*q*<=≤<=5000). The next *n* lines contain the grid description. There are *m* integers separated by spaces in each line. Each of these numbers is either 0 (for mouth) or 1 (for eyes). The next *q* lines contain the information about the rounds. Each of them contains two integers *i* and *j* (1<=≤<=*i*<=≤<=*n* and 1<=≤<=*j*<=≤<=*m*), the row number and the column number of the bear changing his state. Output Specification: After each round, print the current score of the bears. Demo Input: ['5 4 5\n0 1 1 0\n1 0 0 1\n0 1 1 0\n1 0 0 1\n0 0 0 0\n1 1\n1 4\n1 1\n4 2\n4 3\n'] Demo Output: ['3\n4\n3\n3\n4\n'] Note: none
```python from sys import stdin,stdout nmbr = lambda: int(stdin.readline()) lst = lambda: list(map(int, stdin.readline().split())) for _ in range(1):#nmbr()): r,c,q=lst() a=[lst() for _ in range(r)] for _ in range(q): x,y=lst();ans=0 a[x-1][y-1]^=1 for i in range(r): cnt = res= 0 for j in range(c): if a[i][j] == 1:cnt += 1 else:cnt = 0 res = max(cnt, res) ans=max(res,ans) print(ans) ```
0
288
A
Polo the Penguin and Strings
PROGRAMMING
1,300
[ "greedy" ]
null
null
Little penguin Polo adores strings. But most of all he adores strings of length *n*. One day he wanted to find a string that meets the following conditions: 1. The string consists of *n* lowercase English letters (that is, the string's length equals *n*), exactly *k* of these letters are distinct. 1. No two neighbouring letters of a string coincide; that is, if we represent a string as *s*<==<=*s*1*s*2... *s**n*, then the following inequality holds, *s**i*<=≠<=*s**i*<=+<=1(1<=≤<=*i*<=&lt;<=*n*). 1. Among all strings that meet points 1 and 2, the required string is lexicographically smallest. Help him find such string or state that such string doesn't exist. String *x*<==<=*x*1*x*2... *x**p* is lexicographically less than string *y*<==<=*y*1*y*2... *y**q*, if either *p*<=&lt;<=*q* and *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**p*<==<=*y**p*, or there is such number *r* (*r*<=&lt;<=*p*,<=*r*<=&lt;<=*q*), that *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**r*<==<=*y**r* and *x**r*<=+<=1<=&lt;<=*y**r*<=+<=1. The characters of the strings are compared by their ASCII codes.
A single line contains two positive integers *n* and *k* (1<=≤<=*n*<=≤<=106,<=1<=≤<=*k*<=≤<=26) — the string's length and the number of distinct letters.
In a single line print the required string. If there isn't such string, print "-1" (without the quotes).
[ "7 4\n", "4 7\n" ]
[ "ababacd\n", "-1\n" ]
none
500
[ { "input": "7 4", "output": "ababacd" }, { "input": "4 7", "output": "-1" }, { "input": "10 5", "output": "abababacde" }, { "input": "47 2", "output": "abababababababababababababababababababababababa" }, { "input": "10 7", "output": "ababacdefg" }, { "input": "20 7", "output": "abababababababacdefg" }, { "input": "26 26", "output": "abcdefghijklmnopqrstuvwxyz" }, { "input": "47 1", "output": "-1" }, { "input": "128 26", "output": "ababababababababababababababababababababababababababababababababababababababababababababababababababababcdefghijklmnopqrstuvwxyz" }, { "input": "999 7", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..." }, { "input": "4585 1", "output": "-1" }, { "input": "6875 2", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..." }, { "input": "7642 3", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..." }, { "input": "100000 7", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..." }, { "input": "68754 25", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..." }, { "input": "1000000 1", "output": "-1" }, { "input": "999999 2", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..." }, { "input": "1000000 26", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..." }, { "input": "100000 20", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..." }, { "input": "579466 17", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..." }, { "input": "679854 9", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..." }, { "input": "978458 16", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..." }, { "input": "6791 21", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..." }, { "input": "6795 1", "output": "-1" }, { "input": "12 17", "output": "-1" }, { "input": "1 1", "output": "a" }, { "input": "2 2", "output": "ab" }, { "input": "1 2", "output": "-1" }, { "input": "1 26", "output": "-1" }, { "input": "26 2", "output": "ababababababababababababab" }, { "input": "123 21", "output": "ababababababababababababababababababababababababababababababababababababababababababababababababababababcdefghijklmnopqrstu" }, { "input": "3 3", "output": "abc" } ]
1,621,205,237
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
7
216
0
n,k=map(int,input().split()) ascii="abcdefghijklmnopqrstuvwxyz" if k > n: print(-1) else: t1=k-2 t2=n-t1 tam=t2//2 kal=t2%2 r="ab"*tam+"a"*kal for i in range(t1): i+=2 r+=ascii[i] print(r)
Title: Polo the Penguin and Strings Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little penguin Polo adores strings. But most of all he adores strings of length *n*. One day he wanted to find a string that meets the following conditions: 1. The string consists of *n* lowercase English letters (that is, the string's length equals *n*), exactly *k* of these letters are distinct. 1. No two neighbouring letters of a string coincide; that is, if we represent a string as *s*<==<=*s*1*s*2... *s**n*, then the following inequality holds, *s**i*<=≠<=*s**i*<=+<=1(1<=≤<=*i*<=&lt;<=*n*). 1. Among all strings that meet points 1 and 2, the required string is lexicographically smallest. Help him find such string or state that such string doesn't exist. String *x*<==<=*x*1*x*2... *x**p* is lexicographically less than string *y*<==<=*y*1*y*2... *y**q*, if either *p*<=&lt;<=*q* and *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**p*<==<=*y**p*, or there is such number *r* (*r*<=&lt;<=*p*,<=*r*<=&lt;<=*q*), that *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**r*<==<=*y**r* and *x**r*<=+<=1<=&lt;<=*y**r*<=+<=1. The characters of the strings are compared by their ASCII codes. Input Specification: A single line contains two positive integers *n* and *k* (1<=≤<=*n*<=≤<=106,<=1<=≤<=*k*<=≤<=26) — the string's length and the number of distinct letters. Output Specification: In a single line print the required string. If there isn't such string, print "-1" (without the quotes). Demo Input: ['7 4\n', '4 7\n'] Demo Output: ['ababacd\n', '-1\n'] Note: none
```python n,k=map(int,input().split()) ascii="abcdefghijklmnopqrstuvwxyz" if k > n: print(-1) else: t1=k-2 t2=n-t1 tam=t2//2 kal=t2%2 r="ab"*tam+"a"*kal for i in range(t1): i+=2 r+=ascii[i] print(r) ```
0
705
A
Hulk
PROGRAMMING
800
[ "implementation" ]
null
null
Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings. Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on... For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on. Please help Dr. Banner.
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate.
Print Dr.Banner's feeling in one line.
[ "1\n", "2\n", "3\n" ]
[ "I hate it\n", "I hate that I love it\n", "I hate that I love that I hate it\n" ]
none
500
[ { "input": "1", "output": "I hate it" }, { "input": "2", "output": "I hate that I love it" }, { "input": "3", "output": "I hate that I love that I hate it" }, { "input": "4", "output": "I hate that I love that I hate that I love it" }, { "input": "5", "output": "I hate that I love that I hate that I love that I hate it" }, { "input": "10", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it" }, { "input": "18", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it" }, { "input": "19", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it" }, { "input": "76", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "77", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "81", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "82", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "85", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "86", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "100", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "99", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "98", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "33", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it" }, { "input": "34", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it" }, { "input": "57", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "100", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." } ]
1,697,000,217
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
30
0
n=int(input()) c="" for i in range(1,n+1): if i==n and n%2==0: y=" i love it" elif i==n and n%2!=0: y=" i hate it" elif i%2==0: y=" i love that" else: y=" i hate that" c+=y print(c)
Title: Hulk Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings. Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on... For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on. Please help Dr. Banner. Input Specification: The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate. Output Specification: Print Dr.Banner's feeling in one line. Demo Input: ['1\n', '2\n', '3\n'] Demo Output: ['I hate it\n', 'I hate that I love it\n', 'I hate that I love that I hate it\n'] Note: none
```python n=int(input()) c="" for i in range(1,n+1): if i==n and n%2==0: y=" i love it" elif i==n and n%2!=0: y=" i hate it" elif i%2==0: y=" i love that" else: y=" i hate that" c+=y print(c) ```
0
384
A
Coder
PROGRAMMING
800
[ "implementation" ]
null
null
Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1). Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000).
On the first line print an integer, the maximum number of Coders that can be placed on the chessboard. On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'. If there are multiple correct answers, you can print any.
[ "2\n" ]
[ "2\nC.\n.C\n" ]
none
500
[ { "input": "2", "output": "2\nC.\n.C" }, { "input": "3", "output": "5\nC.C\n.C.\nC.C" }, { "input": "4", "output": "8\nC.C.\n.C.C\nC.C.\n.C.C" }, { "input": "10", "output": "50\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C" }, { "input": "15", "output": "113\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C" }, { "input": "100", "output": "5000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "101", "output": "5101\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "500", "output": "125000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n...." }, { "input": "501", "output": "125501\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n..." }, { "input": "755", "output": "285013\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "888", "output": "394272\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "998", "output": "498002\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "999", "output": "499001\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "1000", "output": "500000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..." }, { "input": "1", "output": "1\nC" } ]
1,613,565,371
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
46
0
n=int(input()) for i in range(n): print("C.") print(".C")
Title: Coder Time Limit: None seconds Memory Limit: None megabytes Problem Description: Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1). Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000). Output Specification: On the first line print an integer, the maximum number of Coders that can be placed on the chessboard. On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'. If there are multiple correct answers, you can print any. Demo Input: ['2\n'] Demo Output: ['2\nC.\n.C\n'] Note: none
```python n=int(input()) for i in range(n): print("C.") print(".C") ```
0
599
A
Patrick and Shopping
PROGRAMMING
800
[ "implementation" ]
null
null
Today Patrick waits for a visit from his friend Spongebob. To prepare for the visit, Patrick needs to buy some goodies in two stores located near his house. There is a *d*1 meter long road between his house and the first shop and a *d*2 meter long road between his house and the second shop. Also, there is a road of length *d*3 directly connecting these two shops to each other. Help Patrick calculate the minimum distance that he needs to walk in order to go to both shops and return to his house. Patrick always starts at his house. He should visit both shops moving only along the three existing roads and return back to his house. He doesn't mind visiting the same shop or passing the same road multiple times. The only goal is to minimize the total distance traveled.
The first line of the input contains three integers *d*1, *d*2, *d*3 (1<=≤<=*d*1,<=*d*2,<=*d*3<=≤<=108) — the lengths of the paths. - *d*1 is the length of the path connecting Patrick's house and the first shop; - *d*2 is the length of the path connecting Patrick's house and the second shop; - *d*3 is the length of the path connecting both shops.
Print the minimum distance that Patrick will have to walk in order to visit both shops and return to his house.
[ "10 20 30\n", "1 1 5\n" ]
[ "60\n", "4\n" ]
The first sample is shown on the picture in the problem statement. One of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house. In the second sample one of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house.
500
[ { "input": "10 20 30", "output": "60" }, { "input": "1 1 5", "output": "4" }, { "input": "100 33 34", "output": "134" }, { "input": "777 777 777", "output": "2331" }, { "input": "2 2 8", "output": "8" }, { "input": "12 34 56", "output": "92" }, { "input": "789 101112 131415", "output": "203802" }, { "input": "27485716 99999999 35182", "output": "55041796" }, { "input": "1 293548 5", "output": "12" }, { "input": "12059 259855 5874875", "output": "543828" }, { "input": "46981 105809 585858", "output": "305580" }, { "input": "9889 1221 2442", "output": "7326" }, { "input": "100500 200600 300700", "output": "601800" }, { "input": "318476 318476 318476", "output": "955428" }, { "input": "23985 3353 75633", "output": "54676" }, { "input": "120 1298 2222", "output": "2836" }, { "input": "98437 23487 666672", "output": "243848" }, { "input": "100000000 100000000 100000000", "output": "300000000" }, { "input": "2 5 2", "output": "8" }, { "input": "1 1000 1", "output": "4" }, { "input": "1 100000000 1", "output": "4" } ]
1,652,004,785
2,147,483,647
Python 3
OK
TESTS
21
46
0
a,b,c=map(int,input().split()) l=[] l.append(2*a+2*b) l.append(a+b+c) l.append(2*c+2*a) l.append(2*c+2*b) l.sort() print(l[0])
Title: Patrick and Shopping Time Limit: None seconds Memory Limit: None megabytes Problem Description: Today Patrick waits for a visit from his friend Spongebob. To prepare for the visit, Patrick needs to buy some goodies in two stores located near his house. There is a *d*1 meter long road between his house and the first shop and a *d*2 meter long road between his house and the second shop. Also, there is a road of length *d*3 directly connecting these two shops to each other. Help Patrick calculate the minimum distance that he needs to walk in order to go to both shops and return to his house. Patrick always starts at his house. He should visit both shops moving only along the three existing roads and return back to his house. He doesn't mind visiting the same shop or passing the same road multiple times. The only goal is to minimize the total distance traveled. Input Specification: The first line of the input contains three integers *d*1, *d*2, *d*3 (1<=≤<=*d*1,<=*d*2,<=*d*3<=≤<=108) — the lengths of the paths. - *d*1 is the length of the path connecting Patrick's house and the first shop; - *d*2 is the length of the path connecting Patrick's house and the second shop; - *d*3 is the length of the path connecting both shops. Output Specification: Print the minimum distance that Patrick will have to walk in order to visit both shops and return to his house. Demo Input: ['10 20 30\n', '1 1 5\n'] Demo Output: ['60\n', '4\n'] Note: The first sample is shown on the picture in the problem statement. One of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house. In the second sample one of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house.
```python a,b,c=map(int,input().split()) l=[] l.append(2*a+2*b) l.append(a+b+c) l.append(2*c+2*a) l.append(2*c+2*b) l.sort() print(l[0]) ```
3
832
A
Sasha and Sticks
PROGRAMMING
800
[ "games", "math" ]
null
null
It's one more school day now. Sasha doesn't like classes and is always bored at them. So, each day he invents some game and plays in it alone or with friends. Today he invented one simple game to play with Lena, with whom he shares a desk. The rules are simple. Sasha draws *n* sticks in a row. After that the players take turns crossing out exactly *k* sticks from left or right in each turn. Sasha moves first, because he is the inventor of the game. If there are less than *k* sticks on the paper before some turn, the game ends. Sasha wins if he makes strictly more moves than Lena. Sasha wants to know the result of the game before playing, you are to help him.
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1018, *k*<=≤<=*n*) — the number of sticks drawn by Sasha and the number *k* — the number of sticks to be crossed out on each turn.
If Sasha wins, print "YES" (without quotes), otherwise print "NO" (without quotes). You can print each letter in arbitrary case (upper of lower).
[ "1 1\n", "10 4\n" ]
[ "YES\n", "NO\n" ]
In the first example Sasha crosses out 1 stick, and then there are no sticks. So Lena can't make a move, and Sasha wins. In the second example Sasha crosses out 4 sticks, then Lena crosses out 4 sticks, and after that there are only 2 sticks left. Sasha can't make a move. The players make equal number of moves, so Sasha doesn't win.
500
[ { "input": "1 1", "output": "YES" }, { "input": "10 4", "output": "NO" }, { "input": "251656215122324104 164397544865601257", "output": "YES" }, { "input": "963577813436662285 206326039287271924", "output": "NO" }, { "input": "1000000000000000000 1", "output": "NO" }, { "input": "253308697183523656 25332878317796706", "output": "YES" }, { "input": "669038685745448997 501718093668307460", "output": "YES" }, { "input": "116453141993601660 87060381463547965", "output": "YES" }, { "input": "766959657 370931668", "output": "NO" }, { "input": "255787422422806632 146884995820359999", "output": "YES" }, { "input": "502007866464507926 71266379084204128", "output": "YES" }, { "input": "257439908778973480 64157133126869976", "output": "NO" }, { "input": "232709385 91708542", "output": "NO" }, { "input": "252482458300407528 89907711721009125", "output": "NO" }, { "input": "6 2", "output": "YES" }, { "input": "6 3", "output": "NO" }, { "input": "6 4", "output": "YES" }, { "input": "6 5", "output": "YES" }, { "input": "6 6", "output": "YES" }, { "input": "258266151957056904 30153168463725364", "output": "NO" }, { "input": "83504367885565783 52285355047292458", "output": "YES" }, { "input": "545668929424440387 508692735816921376", "output": "YES" }, { "input": "547321411485639939 36665750286082900", "output": "NO" }, { "input": "548973893546839491 183137237979822911", "output": "NO" }, { "input": "544068082 193116851", "output": "NO" }, { "input": "871412474 749817171", "output": "YES" }, { "input": "999999999 1247", "output": "NO" }, { "input": "851941088 712987048", "output": "YES" }, { "input": "559922900 418944886", "output": "YES" }, { "input": "293908937 37520518", "output": "YES" }, { "input": "650075786 130049650", "output": "NO" }, { "input": "1000000000 1000000000", "output": "YES" }, { "input": "548147654663723363 107422751713800746", "output": "YES" }, { "input": "828159210 131819483", "output": "NO" }, { "input": "6242634 4110365", "output": "YES" }, { "input": "458601973 245084155", "output": "YES" }, { "input": "349593257 18089089", "output": "YES" }, { "input": "814768821 312514745", "output": "NO" }, { "input": "697884949 626323363", "output": "YES" }, { "input": "667011589 54866795", "output": "NO" }, { "input": "1000000000000000000 2", "output": "NO" }, { "input": "1000000000000000000 3", "output": "YES" }, { "input": "1000000000000000000 4", "output": "NO" }, { "input": "999999999999999 1", "output": "YES" }, { "input": "17 4", "output": "NO" }, { "input": "2 2", "output": "YES" }, { "input": "1000000000000000 2", "output": "NO" }, { "input": "12 4", "output": "YES" }, { "input": "6 1", "output": "NO" }, { "input": "2 1", "output": "NO" }, { "input": "10000000005 1", "output": "YES" }, { "input": "10000000000000009 2", "output": "NO" }, { "input": "12457895452123 1", "output": "YES" }, { "input": "999999999999999999 9", "output": "YES" }, { "input": "1000000000000 3", "output": "YES" }, { "input": "13099714659575475 6549849616514894", "output": "NO" }, { "input": "100000000000000001 1", "output": "YES" }, { "input": "825175814723458 324", "output": "YES" }, { "input": "20 4", "output": "YES" }, { "input": "100000176877 4", "output": "YES" }, { "input": "100000 3", "output": "YES" }, { "input": "946744073709551614 10", "output": "YES" } ]
1,617,817,741
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
5
62
0
n, k = map(int, input().split()) if(k*2 > n): print("YES") else: print("NO")
Title: Sasha and Sticks Time Limit: None seconds Memory Limit: None megabytes Problem Description: It's one more school day now. Sasha doesn't like classes and is always bored at them. So, each day he invents some game and plays in it alone or with friends. Today he invented one simple game to play with Lena, with whom he shares a desk. The rules are simple. Sasha draws *n* sticks in a row. After that the players take turns crossing out exactly *k* sticks from left or right in each turn. Sasha moves first, because he is the inventor of the game. If there are less than *k* sticks on the paper before some turn, the game ends. Sasha wins if he makes strictly more moves than Lena. Sasha wants to know the result of the game before playing, you are to help him. Input Specification: The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1018, *k*<=≤<=*n*) — the number of sticks drawn by Sasha and the number *k* — the number of sticks to be crossed out on each turn. Output Specification: If Sasha wins, print "YES" (without quotes), otherwise print "NO" (without quotes). You can print each letter in arbitrary case (upper of lower). Demo Input: ['1 1\n', '10 4\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first example Sasha crosses out 1 stick, and then there are no sticks. So Lena can't make a move, and Sasha wins. In the second example Sasha crosses out 4 sticks, then Lena crosses out 4 sticks, and after that there are only 2 sticks left. Sasha can't make a move. The players make equal number of moves, so Sasha doesn't win.
```python n, k = map(int, input().split()) if(k*2 > n): print("YES") else: print("NO") ```
0
460
A
Vasya and Socks
PROGRAMMING
900
[ "brute force", "implementation", "math" ]
null
null
Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks?
The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space.
Print a single integer — the answer to the problem.
[ "2 2\n", "9 3\n" ]
[ "3\n", "13\n" ]
In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two. In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day.
500
[ { "input": "2 2", "output": "3" }, { "input": "9 3", "output": "13" }, { "input": "1 2", "output": "1" }, { "input": "2 3", "output": "2" }, { "input": "1 99", "output": "1" }, { "input": "4 4", "output": "5" }, { "input": "10 2", "output": "19" }, { "input": "10 9", "output": "11" }, { "input": "100 100", "output": "101" }, { "input": "2 27", "output": "2" }, { "input": "99 100", "output": "99" }, { "input": "99 2", "output": "197" }, { "input": "100 3", "output": "149" }, { "input": "98 3", "output": "146" }, { "input": "4 4", "output": "5" }, { "input": "100 2", "output": "199" }, { "input": "62 4", "output": "82" }, { "input": "99 10", "output": "109" }, { "input": "100 5", "output": "124" }, { "input": "80 80", "output": "81" }, { "input": "95 16", "output": "101" }, { "input": "75 16", "output": "79" }, { "input": "99 74", "output": "100" }, { "input": "20 21", "output": "20" }, { "input": "52 96", "output": "52" }, { "input": "24 5", "output": "29" } ]
1,660,881,479
2,147,483,647
Python 3
OK
TESTS
26
46
0
n,m = map(int,input().split()) z = ((n-1)/(m-1)) print(int(n+z))
Title: Vasya and Socks Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks? Input Specification: The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space. Output Specification: Print a single integer — the answer to the problem. Demo Input: ['2 2\n', '9 3\n'] Demo Output: ['3\n', '13\n'] Note: In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two. In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day.
```python n,m = map(int,input().split()) z = ((n-1)/(m-1)) print(int(n+z)) ```
3
0
none
none
none
0
[ "none" ]
null
null
Andryusha goes through a park each day. The squares and paths between them look boring to Andryusha, so he decided to decorate them. The park consists of *n* squares connected with (*n*<=-<=1) bidirectional paths in such a way that any square is reachable from any other using these paths. Andryusha decided to hang a colored balloon at each of the squares. The baloons' colors are described by positive integers, starting from 1. In order to make the park varicolored, Andryusha wants to choose the colors in a special way. More precisely, he wants to use such colors that if *a*, *b* and *c* are distinct squares that *a* and *b* have a direct path between them, and *b* and *c* have a direct path between them, then balloon colors on these three squares are distinct. Andryusha wants to use as little different colors as possible. Help him to choose the colors!
The first line contains single integer *n* (3<=≤<=*n*<=≤<=2·105) — the number of squares in the park. Each of the next (*n*<=-<=1) lines contains two integers *x* and *y* (1<=≤<=*x*,<=*y*<=≤<=*n*) — the indices of two squares directly connected by a path. It is guaranteed that any square is reachable from any other using the paths.
In the first line print single integer *k* — the minimum number of colors Andryusha has to use. In the second line print *n* integers, the *i*-th of them should be equal to the balloon color on the *i*-th square. Each of these numbers should be within range from 1 to *k*.
[ "3\n2 3\n1 3\n", "5\n2 3\n5 3\n4 3\n1 3\n", "5\n2 1\n3 2\n4 3\n5 4\n" ]
[ "3\n1 3 2 ", "5\n1 3 2 5 4 ", "3\n1 2 3 1 2 " ]
In the first sample the park consists of three squares: 1 → 3 → 2. Thus, the balloon colors have to be distinct. In the second example there are following triples of consequently connected squares: - 1 → 3 → 2 - 1 → 3 → 4 - 1 → 3 → 5 - 2 → 3 → 4 - 2 → 3 → 5 - 4 → 3 → 5 In the third example there are following triples: - 1 → 2 → 3 - 2 → 3 → 4 - 3 → 4 → 5
0
[ { "input": "3\n2 3\n1 3", "output": "3\n1 3 2 " }, { "input": "5\n2 3\n5 3\n4 3\n1 3", "output": "5\n1 3 2 5 4 " }, { "input": "5\n2 1\n3 2\n4 3\n5 4", "output": "3\n1 2 3 1 2 " }, { "input": "10\n5 3\n9 2\n7 1\n3 8\n4 1\n1 9\n10 1\n8 9\n6 2", "output": "5\n1 2 1 3 2 1 2 3 4 5 " }, { "input": "3\n2 1\n3 2", "output": "3\n1 2 3 " }, { "input": "10\n2 7\n8 2\n9 8\n1 9\n4 1\n3 4\n6 3\n10 6\n5 10", "output": "3\n1 1 2 3 2 1 2 3 2 3 " }, { "input": "5\n4 2\n3 1\n3 4\n3 5", "output": "4\n1 1 2 3 4 " }, { "input": "7\n3 6\n3 1\n3 2\n3 5\n3 4\n3 7", "output": "7\n1 4 2 6 5 3 7 " }, { "input": "10\n8 6\n10 5\n8 4\n2 7\n3 8\n10 3\n3 9\n2 1\n3 2", "output": "5\n1 2 4 3 1 2 3 1 5 3 " }, { "input": "50\n45 2\n4 48\n16 4\n17 29\n29 33\n31 2\n47 41\n41 33\n22 6\n44 40\n32 24\n12 40\n28 16\n18 30\n20 41\n25 45\n35 29\n10 32\n1 48\n15 50\n6 9\n43 2\n33 2\n38 33\n8 2\n36 7\n26 48\n50 8\n34 31\n48 33\n13 45\n37 33\n7 6\n40 32\n3 6\n30 49\n49 33\n11 40\n19 40\n24 2\n14 50\n5 50\n42 16\n23 2\n9 45\n39 6\n46 48\n27 13\n21 2", "output": "9\n1 4 4 3 4 2 3 6 5 2 5 4 3 3 2 1 2 2 6 2 9 1 8 7 2 4 2 2 1 1 2 1 5 1 3 1 7 6 6 3 3 4 3 2 1 6 1 2 8 1 " }, { "input": "50\n8 37\n40 8\n38 40\n10 38\n29 10\n33 29\n17 33\n25 17\n19 25\n3 19\n13 3\n24 13\n12 24\n5 12\n41 5\n11 41\n27 11\n45 27\n6 45\n35 6\n9 35\n50 9\n32 50\n21 32\n22 21\n1 22\n31 1\n28 31\n4 28\n30 4\n7 30\n48 7\n46 48\n16 46\n49 16\n39 49\n18 39\n14 18\n34 14\n23 34\n20 23\n15 20\n44 15\n42 44\n2 42\n36 2\n43 36\n26 43\n47 26", "output": "3\n1 3 2 1 1 2 2 2 3 2 2 2 1 1 3 2 2 2 3 1 3 2 2 3 1 3 1 2 1 3 3 1 3 3 1 2 3 3 3 1 3 1 1 2 3 3 2 1 1 2 " }, { "input": "50\n7 5\n6 40\n49 43\n48 2\n44 11\n10 3\n46 49\n22 18\n17 33\n4 29\n48 4\n47 41\n24 19\n48 8\n1 21\n2 17\n17 34\n16 10\n17 20\n1 22\n44 32\n6 28\n7 1\n47 26\n28 44\n23 50\n21 15\n1 30\n7 27\n28 25\n17 23\n14 42\n6 46\n5 24\n44 9\n25 39\n46 47\n21 35\n7 16\n34 12\n45 14\n35 36\n28 13\n6 48\n46 37\n39 45\n40 7\n2 31\n30 38", "output": "6\n1 2 2 3 2 1 4 5 5 1 1 2 5 3 3 5 1 2 3 5 2 3 6 1 4 2 3 2 1 5 3 4 3 4 4 1 5 2 1 6 1 1 1 3 2 3 4 4 2 2 " } ]
1,689,599,739
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
15
0
print("_RANDOM_GUESS_1689599739.4741573")# 1689599739.4741821
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Andryusha goes through a park each day. The squares and paths between them look boring to Andryusha, so he decided to decorate them. The park consists of *n* squares connected with (*n*<=-<=1) bidirectional paths in such a way that any square is reachable from any other using these paths. Andryusha decided to hang a colored balloon at each of the squares. The baloons' colors are described by positive integers, starting from 1. In order to make the park varicolored, Andryusha wants to choose the colors in a special way. More precisely, he wants to use such colors that if *a*, *b* and *c* are distinct squares that *a* and *b* have a direct path between them, and *b* and *c* have a direct path between them, then balloon colors on these three squares are distinct. Andryusha wants to use as little different colors as possible. Help him to choose the colors! Input Specification: The first line contains single integer *n* (3<=≤<=*n*<=≤<=2·105) — the number of squares in the park. Each of the next (*n*<=-<=1) lines contains two integers *x* and *y* (1<=≤<=*x*,<=*y*<=≤<=*n*) — the indices of two squares directly connected by a path. It is guaranteed that any square is reachable from any other using the paths. Output Specification: In the first line print single integer *k* — the minimum number of colors Andryusha has to use. In the second line print *n* integers, the *i*-th of them should be equal to the balloon color on the *i*-th square. Each of these numbers should be within range from 1 to *k*. Demo Input: ['3\n2 3\n1 3\n', '5\n2 3\n5 3\n4 3\n1 3\n', '5\n2 1\n3 2\n4 3\n5 4\n'] Demo Output: ['3\n1 3 2 ', '5\n1 3 2 5 4 ', '3\n1 2 3 1 2 '] Note: In the first sample the park consists of three squares: 1 → 3 → 2. Thus, the balloon colors have to be distinct. In the second example there are following triples of consequently connected squares: - 1 → 3 → 2 - 1 → 3 → 4 - 1 → 3 → 5 - 2 → 3 → 4 - 2 → 3 → 5 - 4 → 3 → 5 In the third example there are following triples: - 1 → 2 → 3 - 2 → 3 → 4 - 3 → 4 → 5
```python print("_RANDOM_GUESS_1689599739.4741573")# 1689599739.4741821 ```
0
236
A
Boy or Girl
PROGRAMMING
800
[ "brute force", "implementation", "strings" ]
null
null
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network. But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names. This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
[ "wjmzbmr\n", "xiaodao\n", "sevenkplus\n" ]
[ "CHAT WITH HER!\n", "IGNORE HIM!\n", "CHAT WITH HER!\n" ]
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
500
[ { "input": "wjmzbmr", "output": "CHAT WITH HER!" }, { "input": "xiaodao", "output": "IGNORE HIM!" }, { "input": "sevenkplus", "output": "CHAT WITH HER!" }, { "input": "pezu", "output": "CHAT WITH HER!" }, { "input": "wnemlgppy", "output": "CHAT WITH HER!" }, { "input": "zcinitufxoldnokacdvtmdohsfdjepyfioyvclhmujiqwvmudbfjzxjfqqxjmoiyxrfsbvseawwoyynn", "output": "IGNORE HIM!" }, { "input": "qsxxuoynwtebujwpxwpajitiwxaxwgbcylxneqiebzfphugwkftpaikixmumkhfbjiswmvzbtiyifbx", "output": "CHAT WITH HER!" }, { "input": "qwbdfzfylckctudyjlyrtmvbidfatdoqfmrfshsqqmhzohhsczscvwzpwyoyswhktjlykumhvaounpzwpxcspxwlgt", "output": "IGNORE HIM!" }, { "input": "nuezoadauueermoeaabjrkxttkatspjsjegjcjcdmcxgodowzbwuqncfbeqlhkk", "output": "IGNORE HIM!" }, { "input": "lggvdmulrsvtuagoavstuyufhypdxfomjlzpnduulukszqnnwfvxbvxyzmleocmofwclmzz", "output": "IGNORE HIM!" }, { "input": "tgcdptnkc", "output": "IGNORE HIM!" }, { "input": "wvfgnfrzabgibzxhzsojskmnlmrokydjoexnvi", "output": "IGNORE HIM!" }, { "input": "sxtburpzskucowowebgrbovhadrrayamuwypmmxhscrujkmcgvyinp", "output": "IGNORE HIM!" }, { "input": "pjqxhvxkyeqqvyuujxhmbspatvrckhhkfloottuybjivkkhpyivcighxumavrxzxslfpggnwbtalmhysyfllznphzia", "output": "IGNORE HIM!" }, { "input": "fpellxwskyekoyvrfnuf", "output": "CHAT WITH HER!" }, { "input": "xninyvkuvakfbs", "output": "IGNORE HIM!" }, { "input": "vnxhrweyvhqufpfywdwftoyrfgrhxuamqhblkvdpxmgvphcbeeqbqssresjifwyzgfhurmamhkwupymuomak", "output": "CHAT WITH HER!" }, { "input": "kmsk", "output": "IGNORE HIM!" }, { "input": "lqonogasrkzhryjxppjyriyfxmdfubieglthyswz", "output": "CHAT WITH HER!" }, { "input": "ndormkufcrkxlihdhmcehzoimcfhqsmombnfjrlcalffq", "output": "CHAT WITH HER!" }, { "input": "zqzlnnuwcfufwujygtczfakhcpqbtxtejrbgoodychepzdphdahtxyfpmlrycyicqthsgm", "output": "IGNORE HIM!" }, { "input": "ppcpbnhwoizajrl", "output": "IGNORE HIM!" }, { "input": "sgubujztzwkzvztitssxxxwzanfmddfqvv", "output": "CHAT WITH HER!" }, { "input": "ptkyaxycecpbrjnvxcjtbqiocqcswnmicxbvhdsptbxyxswbw", "output": "IGNORE HIM!" }, { "input": "yhbtzfppwcycxqjpqdfmjnhwaogyuaxamwxpnrdrnqsgdyfvxu", "output": "CHAT WITH HER!" }, { "input": "ojjvpnkrxibyevxk", "output": "CHAT WITH HER!" }, { "input": "wjweqcrqfuollfvfbiyriijovweg", "output": "IGNORE HIM!" }, { "input": "hkdbykboclchfdsuovvpknwqr", "output": "IGNORE HIM!" }, { "input": "stjvyfrfowopwfjdveduedqylerqugykyu", "output": "IGNORE HIM!" }, { "input": "rafcaanqytfclvfdegak", "output": "CHAT WITH HER!" }, { "input": "xczn", "output": "CHAT WITH HER!" }, { "input": "arcoaeozyeawbveoxpmafxxzdjldsielp", "output": "IGNORE HIM!" }, { "input": "smdfafbyehdylhaleevhoggiurdgeleaxkeqdixyfztkuqsculgslheqfafxyghyuibdgiuwrdxfcitojxika", "output": "CHAT WITH HER!" }, { "input": "vbpfgjqnhfazmvtkpjrdasfhsuxnpiepxfrzvoh", "output": "CHAT WITH HER!" }, { "input": "dbdokywnpqnotfrhdbrzmuyoxfdtrgrzcccninbtmoqvxfatcqg", "output": "CHAT WITH HER!" }, { "input": "udlpagtpq", "output": "CHAT WITH HER!" }, { "input": "zjurevbytijifnpfuyswfchdzelxheboruwjqijxcucylysmwtiqsqqhktexcynquvcwhbjsipy", "output": "CHAT WITH HER!" }, { "input": "qagzrqjomdwhagkhrjahhxkieijyten", "output": "CHAT WITH HER!" }, { "input": "achhcfjnnfwgoufxamcqrsontgjjhgyfzuhklkmiwybnrlsvblnsrjqdytglipxsulpnphpjpoewvlusalsgovwnsngb", "output": "CHAT WITH HER!" }, { "input": "qbkjsdwpahdbbohggbclfcufqelnojoehsxxkr", "output": "CHAT WITH HER!" }, { "input": "cpvftiwgyvnlmbkadiafddpgfpvhqqvuehkypqjsoibpiudfvpkhzlfrykc", "output": "IGNORE HIM!" }, { "input": "lnpdosnceumubvk", "output": "IGNORE HIM!" }, { "input": "efrk", "output": "CHAT WITH HER!" }, { "input": "temnownneghnrujforif", "output": "IGNORE HIM!" }, { "input": "ottnneymszwbumgobazfjyxewkjakglbfflsajuzescplpcxqta", "output": "IGNORE HIM!" }, { "input": "eswpaclodzcwhgixhpyzvhdwsgneqidanbzdzszquefh", "output": "IGNORE HIM!" }, { "input": "gwntwbpj", "output": "IGNORE HIM!" }, { "input": "wuqvlbblkddeindiiswsinkfrnkxghhwunzmmvyovpqapdfbolyim", "output": "IGNORE HIM!" }, { "input": "swdqsnzmzmsyvktukaoyqsqzgfmbzhezbfaqeywgwizrwjyzquaahucjchegknqaioliqd", "output": "CHAT WITH HER!" }, { "input": "vlhrpzezawyolhbmvxbwhtjustdbqggexmzxyieihjlelvwjosmkwesfjmramsikhkupzvfgezmrqzudjcalpjacmhykhgfhrjx", "output": "IGNORE HIM!" }, { "input": "lxxwbkrjgnqjwsnflfnsdyxihmlspgivirazsbveztnkuzpaxtygidniflyjheejelnjyjvgkgvdqks", "output": "CHAT WITH HER!" }, { "input": "wpxbxzfhtdecetpljcrvpjjnllosdqirnkzesiqeukbedkayqx", "output": "CHAT WITH HER!" }, { "input": "vmzxgacicvweclaodrunmjnfwtimceetsaoickarqyrkdghcmyjgmtgsqastcktyrjgvjqimdc", "output": "CHAT WITH HER!" }, { "input": "yzlzmesxdttfcztooypjztlgxwcr", "output": "IGNORE HIM!" }, { "input": "qpbjwzwgdzmeluheirjrvzrhbmagfsjdgvzgwumjtjzecsfkrfqjasssrhhtgdqqfydlmrktlgfc", "output": "IGNORE HIM!" }, { "input": "aqzftsvezdgouyrirsxpbuvdjupnzvbhguyayeqozfzymfnepvwgblqzvmxxkxcilmsjvcgyqykpoaktjvsxbygfgsalbjoq", "output": "CHAT WITH HER!" }, { "input": "znicjjgijhrbdlnwmtjgtdgziollrfxroabfhadygnomodaembllreorlyhnehijfyjbfxucazellblegyfrzuraogadj", "output": "IGNORE HIM!" }, { "input": "qordzrdiknsympdrkgapjxokbldorpnmnpucmwakklmqenpmkom", "output": "CHAT WITH HER!" }, { "input": "wqfldgihuxfktzanyycluzhtewmwvnawqlfoavuguhygqrrxtstxwouuzzsryjqtfqo", "output": "CHAT WITH HER!" }, { "input": "vujtrrpshinkskgyknlcfckmqdrwtklkzlyipmetjvaqxdsslkskschbalmdhzsdrrjmxdltbtnxbh", "output": "IGNORE HIM!" }, { "input": "zioixjibuhrzyrbzqcdjbbhhdmpgmqykixcxoqupggaqajuzonrpzihbsogjfsrrypbiphehonyhohsbybnnukqebopppa", "output": "CHAT WITH HER!" }, { "input": "oh", "output": "CHAT WITH HER!" }, { "input": "kxqthadqesbpgpsvpbcbznxpecqrzjoilpauttzlnxvaczcqwuri", "output": "IGNORE HIM!" }, { "input": "zwlunigqnhrwirkvufqwrnwcnkqqonebrwzcshcbqqwkjxhymjjeakuzjettebciadjlkbfp", "output": "CHAT WITH HER!" }, { "input": "fjuldpuejgmggvvigkwdyzytfxzwdlofrpifqpdnhfyroginqaufwgjcbgshyyruwhofctsdaisqpjxqjmtpp", "output": "CHAT WITH HER!" }, { "input": "xiwntnheuitbtqxrmzvxmieldudakogealwrpygbxsbluhsqhtwmdlpjwzyafckrqrdduonkgo", "output": "CHAT WITH HER!" }, { "input": "mnmbupgo", "output": "IGNORE HIM!" }, { "input": "mcjehdiygkbmrbfjqwpwxidbdfelifwhstaxdapigbymmsgrhnzsdjhsqchl", "output": "IGNORE HIM!" }, { "input": "yocxrzspinchmhtmqo", "output": "CHAT WITH HER!" }, { "input": "vasvvnpymtgjirnzuynluluvmgpquskuaafwogeztfnvybblajvuuvfomtifeuzpikjrolzeeoftv", "output": "CHAT WITH HER!" }, { "input": "ecsdicrznvglwggrdbrvehwzaenzjutjydhvimtqegweurpxtjkmpcznshtrvotkvrghxhacjkedidqqzrduzad", "output": "IGNORE HIM!" }, { "input": "ubvhyaebyxoghakajqrpqpctwbrfqzli", "output": "CHAT WITH HER!" }, { "input": "gogbxfeqylxoummvgxpkoqzsmobasesxbqjjktqbwqxeiaagnnhbvepbpy", "output": "IGNORE HIM!" }, { "input": "nheihhxkbbrmlpxpxbhnpofcjmxemyvqqdbanwd", "output": "IGNORE HIM!" }, { "input": "acrzbavz", "output": "CHAT WITH HER!" }, { "input": "drvzznznvrzskftnrhvvzxcalwutxmdza", "output": "IGNORE HIM!" }, { "input": "oacwxipdfcoabhkwxqdbtowiekpnflnqhlrkustgzryvws", "output": "CHAT WITH HER!" }, { "input": "tpnwfmfsibnccvdwjvzviyvjfljupinfigfunyff", "output": "CHAT WITH HER!" }, { "input": "gavaihhamfolcndgytcsgucqdqngxkrlovpthvteacmmthoglxu", "output": "CHAT WITH HER!" }, { "input": "hsfcfvameeupldgvchmogrvwxrvsmnwxxkxoawwodtsahqvehlcw", "output": "IGNORE HIM!" }, { "input": "sbkydrscoojychxchqsuciperfroumenelgiyiwlqfwximrgdbyvkmacy", "output": "CHAT WITH HER!" }, { "input": "rhh", "output": "CHAT WITH HER!" }, { "input": "zhdouqfmlkenjzdijxdfxnlegxeuvhelo", "output": "IGNORE HIM!" }, { "input": "yufkkfwyhhvcjntsgsvpzbhqtmtgyxifqoewmuplphykmptfdebjxuaxigomjtwgtljwdjhjernkitifbomifbhysnmadtnyn", "output": "CHAT WITH HER!" }, { "input": "urigreuzpxnej", "output": "CHAT WITH HER!" } ]
1,695,711,735
2,147,483,647
PyPy 3-64
OK
TESTS
85
154
0
s=str(input()) mylist=[] for i in s: if i not in mylist: mylist.append(i) if (len(mylist)%2)==0: print("CHAT WITH HER!") else : print("IGNORE HIM!")
Title: Boy or Girl Time Limit: None seconds Memory Limit: None megabytes Problem Description: Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network. But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names. This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method. Input Specification: The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters. Output Specification: If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes). Demo Input: ['wjmzbmr\n', 'xiaodao\n', 'sevenkplus\n'] Demo Output: ['CHAT WITH HER!\n', 'IGNORE HIM!\n', 'CHAT WITH HER!\n'] Note: For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
```python s=str(input()) mylist=[] for i in s: if i not in mylist: mylist.append(i) if (len(mylist)%2)==0: print("CHAT WITH HER!") else : print("IGNORE HIM!") ```
3
417
B
Crash
PROGRAMMING
1,400
[ "implementation" ]
null
null
During the "Russian Code Cup" programming competition, the testing system stores all sent solutions for each participant. We know that many participants use random numbers in their programs and are often sent several solutions with the same source code to check. Each participant is identified by some unique positive integer *k*, and each sent solution *A* is characterized by two numbers: *x* — the number of different solutions that are sent before the first solution identical to *A*, and *k* — the number of the participant, who is the author of the solution. Consequently, all identical solutions have the same *x*. It is known that the data in the testing system are stored in the chronological order, that is, if the testing system has a solution with number *x* (*x*<=&gt;<=0) of the participant with number *k*, then the testing system has a solution with number *x*<=-<=1 of the same participant stored somewhere before. During the competition the checking system crashed, but then the data of the submissions of all participants have been restored. Now the jury wants to verify that the recovered data is in chronological order. Help the jury to do so.
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of solutions. Each of the following *n* lines contains two integers separated by space *x* and *k* (0<=≤<=*x*<=≤<=105; 1<=≤<=*k*<=≤<=105) — the number of previous unique solutions and the identifier of the participant.
A single line of the output should contain «YES» if the data is in chronological order, and «NO» otherwise.
[ "2\n0 1\n1 1\n", "4\n0 1\n1 2\n1 1\n0 2\n", "4\n0 1\n1 1\n0 1\n0 2\n" ]
[ "YES\n", "NO\n", "YES\n" ]
none
1,000
[ { "input": "2\n0 1\n1 1", "output": "YES" }, { "input": "4\n0 1\n1 2\n1 1\n0 2", "output": "NO" }, { "input": "4\n0 1\n1 1\n0 1\n0 2", "output": "YES" }, { "input": "4\n7 1\n4 2\n8 2\n1 8", "output": "NO" }, { "input": "2\n0 8\n0 5", "output": "YES" }, { "input": "3\n7 9\n5 8\n8 2", "output": "NO" }, { "input": "1\n0 8", "output": "YES" }, { "input": "5\n8 10\n7 9\n5 6\n5 2\n10 7", "output": "NO" }, { "input": "7\n0 2\n0 3\n0 2\n0 1\n0 10\n1 10\n0 5", "output": "YES" }, { "input": "6\n0 1\n1 1\n2 1\n1 1\n2 1\n4 1", "output": "NO" }, { "input": "4\n0 1\n1 1\n0 1\n2 1", "output": "YES" }, { "input": "6\n0 1\n1 1\n2 1\n3 1\n4 1\n2 1", "output": "YES" }, { "input": "3\n0 1\n0 1\n2 1", "output": "NO" }, { "input": "1\n1 100000", "output": "NO" }, { "input": "2\n99 1\n99 1", "output": "NO" }, { "input": "4\n0 1\n0 2\n1 1\n1 2", "output": "YES" }, { "input": "4\n0 1\n0 2\n1 1\n2 1", "output": "YES" }, { "input": "5\n0 1\n1 1\n2 1\n1 1\n3 1", "output": "YES" }, { "input": "4\n0 1\n1 100000\n1 1\n0 100000", "output": "NO" }, { "input": "5\n0 1\n1 1\n2 1\n3 1\n1 1", "output": "YES" }, { "input": "3\n0 1\n0 2\n1 1", "output": "YES" }, { "input": "5\n0 1\n1 1\n2 1\n0 1\n4 1", "output": "NO" }, { "input": "1\n2 1", "output": "NO" }, { "input": "6\n0 1\n1 1\n2 1\n0 1\n3 1\n4 1", "output": "YES" } ]
1,689,634,396
2,147,483,647
PyPy 3-64
RUNTIME_ERROR
TESTS
12
436
6,963,200
n = int(input()) ks = [-1] * (10 ** 5) res = "YES" for _ in range(n): x,k = map(int, input().split()) if ks[k] < x - 1: res = "NO" else: ks[k] = max(ks[k], x) print(res)
Title: Crash Time Limit: None seconds Memory Limit: None megabytes Problem Description: During the "Russian Code Cup" programming competition, the testing system stores all sent solutions for each participant. We know that many participants use random numbers in their programs and are often sent several solutions with the same source code to check. Each participant is identified by some unique positive integer *k*, and each sent solution *A* is characterized by two numbers: *x* — the number of different solutions that are sent before the first solution identical to *A*, and *k* — the number of the participant, who is the author of the solution. Consequently, all identical solutions have the same *x*. It is known that the data in the testing system are stored in the chronological order, that is, if the testing system has a solution with number *x* (*x*<=&gt;<=0) of the participant with number *k*, then the testing system has a solution with number *x*<=-<=1 of the same participant stored somewhere before. During the competition the checking system crashed, but then the data of the submissions of all participants have been restored. Now the jury wants to verify that the recovered data is in chronological order. Help the jury to do so. Input Specification: The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of solutions. Each of the following *n* lines contains two integers separated by space *x* and *k* (0<=≤<=*x*<=≤<=105; 1<=≤<=*k*<=≤<=105) — the number of previous unique solutions and the identifier of the participant. Output Specification: A single line of the output should contain «YES» if the data is in chronological order, and «NO» otherwise. Demo Input: ['2\n0 1\n1 1\n', '4\n0 1\n1 2\n1 1\n0 2\n', '4\n0 1\n1 1\n0 1\n0 2\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: none
```python n = int(input()) ks = [-1] * (10 ** 5) res = "YES" for _ in range(n): x,k = map(int, input().split()) if ks[k] < x - 1: res = "NO" else: ks[k] = max(ks[k], x) print(res) ```
-1