contestId
int64
0
1.01k
index
stringclasses
57 values
name
stringlengths
2
58
type
stringclasses
2 values
rating
int64
0
3.5k
tags
listlengths
0
11
title
stringclasses
522 values
time-limit
stringclasses
8 values
memory-limit
stringclasses
8 values
problem-description
stringlengths
0
7.15k
input-specification
stringlengths
0
2.05k
output-specification
stringlengths
0
1.5k
demo-input
listlengths
0
7
demo-output
listlengths
0
7
note
stringlengths
0
5.24k
points
float64
0
425k
test_cases
listlengths
0
402
creationTimeSeconds
int64
1.37B
1.7B
relativeTimeSeconds
int64
8
2.15B
programmingLanguage
stringclasses
3 values
verdict
stringclasses
14 values
testset
stringclasses
12 values
passedTestCount
int64
0
1k
timeConsumedMillis
int64
0
15k
memoryConsumedBytes
int64
0
805M
code
stringlengths
3
65.5k
prompt
stringlengths
262
8.2k
response
stringlengths
17
65.5k
score
float64
-1
3.99
761
A
Dasha and Stairs
PROGRAMMING
1,000
[ "brute force", "constructive algorithms", "implementation", "math" ]
null
null
On her way to programming school tiger Dasha faced her first test — a huge staircase! The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers. You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct.
In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly.
In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise.
[ "2 3\n", "3 1\n" ]
[ "YES\n", "NO\n" ]
In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5.
500
[ { "input": "2 3", "output": "YES" }, { "input": "3 1", "output": "NO" }, { "input": "5 4", "output": "YES" }, { "input": "9 9", "output": "YES" }, { "input": "85 95", "output": "NO" }, { "input": "0 1", "output": "YES" }, { "input": "89 25", "output": "NO" }, { "input": "74 73", "output": "YES" }, { "input": "62 39", "output": "NO" }, { "input": "57 57", "output": "YES" }, { "input": "100 99", "output": "YES" }, { "input": "0 0", "output": "NO" }, { "input": "98 100", "output": "NO" }, { "input": "99 100", "output": "YES" }, { "input": "1 0", "output": "YES" }, { "input": "100 0", "output": "NO" }, { "input": "0 100", "output": "NO" }, { "input": "100 98", "output": "NO" }, { "input": "100 100", "output": "YES" }, { "input": "0 5", "output": "NO" }, { "input": "2 2", "output": "YES" } ]
1,685,246,194
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
30
0
def read_array(size): return list(map(int, input().split())) def build_intervals(distances, L): n = len(distances) intervals = [] for i in range(n - 1): intervals.append(distances[i + 1] - distances[i]) intervals.append(L - distances[n - 1] + distances[0]) return intervals def is_same(intervals1, intervals2): n = len(intervals1) for offset in range(n): if all(intervals1[i] == intervals2[(i + offset) % n] for i in range(n)): return True return False def solve(): n, L = map(int, input().split()) distances1 = read_array(n) distances2 = read_array(n) return is_same(build_intervals(distances1, L), build_intervals(distances2, L)) if solve(): print("YES") else: print("NO")
Title: Dasha and Stairs Time Limit: None seconds Memory Limit: None megabytes Problem Description: On her way to programming school tiger Dasha faced her first test — a huge staircase! The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers. You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct. Input Specification: In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly. Output Specification: In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise. Demo Input: ['2 3\n', '3 1\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5.
```python def read_array(size): return list(map(int, input().split())) def build_intervals(distances, L): n = len(distances) intervals = [] for i in range(n - 1): intervals.append(distances[i + 1] - distances[i]) intervals.append(L - distances[n - 1] + distances[0]) return intervals def is_same(intervals1, intervals2): n = len(intervals1) for offset in range(n): if all(intervals1[i] == intervals2[(i + offset) % n] for i in range(n)): return True return False def solve(): n, L = map(int, input().split()) distances1 = read_array(n) distances2 = read_array(n) return is_same(build_intervals(distances1, L), build_intervals(distances2, L)) if solve(): print("YES") else: print("NO") ```
-1
981
A
Antipalindrome
PROGRAMMING
900
[ "brute force", "implementation", "strings" ]
null
null
A string is a palindrome if it reads the same from the left to the right and from the right to the left. For example, the strings "kek", "abacaba", "r" and "papicipap" are palindromes, while the strings "abb" and "iq" are not. A substring $s[l \ldots r]$ ($1<=\leq<=l<=\leq<=r<=\leq<=|s|$) of a string $s<==<=s_{1}s_{2} \ldots s_{|s|}$ is the string $s_{l}s_{l<=+<=1} \ldots s_{r}$. Anna does not like palindromes, so she makes her friends call her Ann. She also changes all the words she reads in a similar way. Namely, each word $s$ is changed into its longest substring that is not a palindrome. If all the substrings of $s$ are palindromes, she skips the word at all. Some time ago Ann read the word $s$. What is the word she changed it into?
The first line contains a non-empty string $s$ with length at most $50$ characters, containing lowercase English letters only.
If there is such a substring in $s$ that is not a palindrome, print the maximum length of such a substring. Otherwise print $0$. Note that there can be multiple longest substrings that are not palindromes, but their length is unique.
[ "mew\n", "wuffuw\n", "qqqqqqqq\n" ]
[ "3\n", "5\n", "0\n" ]
"mew" is not a palindrome, so the longest substring of it that is not a palindrome, is the string "mew" itself. Thus, the answer for the first example is $3$. The string "uffuw" is one of the longest non-palindrome substrings (of length $5$) of the string "wuffuw", so the answer for the second example is $5$. All substrings of the string "qqqqqqqq" consist of equal characters so they are palindromes. This way, there are no non-palindrome substrings. Thus, the answer for the third example is $0$.
500
[ { "input": "mew", "output": "3" }, { "input": "wuffuw", "output": "5" }, { "input": "qqqqqqqq", "output": "0" }, { "input": "ijvji", "output": "4" }, { "input": "iiiiiii", "output": "0" }, { "input": "wobervhvvkihcuyjtmqhaaigvvgiaahqmtjyuchikvvhvrebow", "output": "49" }, { "input": "wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww", "output": "0" }, { "input": "wobervhvvkihcuyjtmqhaaigvahheoqleromusrartldojsjvy", "output": "50" }, { "input": "ijvxljt", "output": "7" }, { "input": "fyhcncnchyf", "output": "10" }, { "input": "ffffffffffff", "output": "0" }, { "input": "fyhcncfsepqj", "output": "12" }, { "input": "ybejrrlbcinttnicblrrjeby", "output": "23" }, { "input": "yyyyyyyyyyyyyyyyyyyyyyyyy", "output": "0" }, { "input": "ybejrrlbcintahovgjddrqatv", "output": "25" }, { "input": "oftmhcmclgyqaojljoaqyglcmchmtfo", "output": "30" }, { "input": "oooooooooooooooooooooooooooooooo", "output": "0" }, { "input": "oftmhcmclgyqaojllbotztajglsmcilv", "output": "32" }, { "input": "gxandbtgpbknxvnkjaajknvxnkbpgtbdnaxg", "output": "35" }, { "input": "gggggggggggggggggggggggggggggggggggg", "output": "0" }, { "input": "gxandbtgpbknxvnkjaygommzqitqzjfalfkk", "output": "36" }, { "input": "fcliblymyqckxvieotjooojtoeivxkcqymylbilcf", "output": "40" }, { "input": "fffffffffffffffffffffffffffffffffffffffffff", "output": "0" }, { "input": "fcliblymyqckxvieotjootiqwtyznhhvuhbaixwqnsy", "output": "43" }, { "input": "rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr", "output": "0" }, { "input": "rajccqwqnqmshmerpvjyfepxwpxyldzpzhctqjnstxyfmlhiy", "output": "49" }, { "input": "a", "output": "0" }, { "input": "abca", "output": "4" }, { "input": "aaaaabaaaaa", "output": "10" }, { "input": "aba", "output": "2" }, { "input": "asaa", "output": "4" }, { "input": "aabaa", "output": "4" }, { "input": "aabbaa", "output": "5" }, { "input": "abcdaaa", "output": "7" }, { "input": "aaholaa", "output": "7" }, { "input": "abcdefghijka", "output": "12" }, { "input": "aaadcba", "output": "7" }, { "input": "aaaabaaaa", "output": "8" }, { "input": "abaa", "output": "4" }, { "input": "abcbaa", "output": "6" }, { "input": "ab", "output": "2" }, { "input": "l", "output": "0" }, { "input": "aaaabcaaaa", "output": "10" }, { "input": "abbaaaaaabba", "output": "11" }, { "input": "abaaa", "output": "5" }, { "input": "baa", "output": "3" }, { "input": "aaaaaaabbba", "output": "11" }, { "input": "ccbcc", "output": "4" }, { "input": "bbbaaab", "output": "7" }, { "input": "abaaaaaaaa", "output": "10" }, { "input": "abaaba", "output": "5" }, { "input": "aabsdfaaaa", "output": "10" }, { "input": "aaaba", "output": "5" }, { "input": "aaabaaa", "output": "6" }, { "input": "baaabbb", "output": "7" }, { "input": "ccbbabbcc", "output": "8" }, { "input": "cabc", "output": "4" }, { "input": "aabcd", "output": "5" }, { "input": "abcdea", "output": "6" }, { "input": "bbabb", "output": "4" }, { "input": "aaaaabababaaaaa", "output": "14" }, { "input": "bbabbb", "output": "6" }, { "input": "aababd", "output": "6" }, { "input": "abaaaa", "output": "6" }, { "input": "aaaaaaaabbba", "output": "12" }, { "input": "aabca", "output": "5" }, { "input": "aaabccbaaa", "output": "9" }, { "input": "aaaaaaaaaaaaaaaaaaaab", "output": "21" }, { "input": "babb", "output": "4" }, { "input": "abcaa", "output": "5" }, { "input": "qwqq", "output": "4" }, { "input": "aaaaaaaaaaabbbbbbbbbbbbbbbaaaaaaaaaaaaaaaaaaaaaa", "output": "48" }, { "input": "aaab", "output": "4" }, { "input": "aaaaaabaaaaa", "output": "12" }, { "input": "wwuww", "output": "4" }, { "input": "aaaaabcbaaaaa", "output": "12" }, { "input": "aaabbbaaa", "output": "8" }, { "input": "aabcbaa", "output": "6" }, { "input": "abccdefccba", "output": "11" }, { "input": "aabbcbbaa", "output": "8" }, { "input": "aaaabbaaaa", "output": "9" }, { "input": "aabcda", "output": "6" }, { "input": "abbca", "output": "5" }, { "input": "aaaaaabbaaa", "output": "11" }, { "input": "sssssspssssss", "output": "12" }, { "input": "sdnmsdcs", "output": "8" }, { "input": "aaabbbccbbbaaa", "output": "13" }, { "input": "cbdbdc", "output": "6" }, { "input": "abb", "output": "3" }, { "input": "abcdefaaaa", "output": "10" }, { "input": "abbbaaa", "output": "7" }, { "input": "v", "output": "0" }, { "input": "abccbba", "output": "7" }, { "input": "axyza", "output": "5" }, { "input": "abcdefgaaaa", "output": "11" }, { "input": "aaabcdaaa", "output": "9" }, { "input": "aaaacaaaa", "output": "8" }, { "input": "aaaaaaaaaaaaaaaaaaaabaaaaaaaaaaaaaaaaaaaaa", "output": "42" }, { "input": "abbbaa", "output": "6" }, { "input": "abcdee", "output": "6" }, { "input": "oom", "output": "3" }, { "input": "aabcaa", "output": "6" }, { "input": "abba", "output": "3" }, { "input": "aaca", "output": "4" }, { "input": "aacbca", "output": "6" }, { "input": "ababa", "output": "4" }, { "input": "abcda", "output": "5" }, { "input": "cccaaccc", "output": "7" }, { "input": "aaabcda", "output": "7" }, { "input": "aa", "output": "0" }, { "input": "aabaaaa", "output": "7" }, { "input": "abbaaaa", "output": "7" }, { "input": "aaabcbaaa", "output": "8" }, { "input": "aabba", "output": "5" }, { "input": "xyxx", "output": "4" }, { "input": "aaaaaaaaaaaabc", "output": "14" }, { "input": "bbaaaabb", "output": "7" }, { "input": "aaabaa", "output": "6" }, { "input": "sssssabsssss", "output": "12" }, { "input": "bbbaaaabbb", "output": "9" }, { "input": "abbbbaaaa", "output": "9" }, { "input": "wwufuww", "output": "6" }, { "input": "oowoo", "output": "4" }, { "input": "cccaccc", "output": "6" }, { "input": "aaa", "output": "0" }, { "input": "bbbcc", "output": "5" }, { "input": "abcdef", "output": "6" }, { "input": "abbba", "output": "4" }, { "input": "aab", "output": "3" }, { "input": "aaba", "output": "4" }, { "input": "azbyaaa", "output": "7" }, { "input": "oooooiooooo", "output": "10" }, { "input": "aabbbbbaaaaaa", "output": "13" } ]
1,695,332,417
2,147,483,647
Python 3
OK
TESTS
133
46
0
def verificaPalindromo(s): if len(s) >= 1: if s[0] == s[-1]: return verificaPalindromo(s[1:-1]) else: return False else: return True def antipalindromo(s): if (verificaPalindromo(s)): if len(s) == 1: print(0) else: antipalindromo(s[0:-1]) else: print(len(s)) s = input() antipalindromo(s)
Title: Antipalindrome Time Limit: None seconds Memory Limit: None megabytes Problem Description: A string is a palindrome if it reads the same from the left to the right and from the right to the left. For example, the strings "kek", "abacaba", "r" and "papicipap" are palindromes, while the strings "abb" and "iq" are not. A substring $s[l \ldots r]$ ($1<=\leq<=l<=\leq<=r<=\leq<=|s|$) of a string $s<==<=s_{1}s_{2} \ldots s_{|s|}$ is the string $s_{l}s_{l<=+<=1} \ldots s_{r}$. Anna does not like palindromes, so she makes her friends call her Ann. She also changes all the words she reads in a similar way. Namely, each word $s$ is changed into its longest substring that is not a palindrome. If all the substrings of $s$ are palindromes, she skips the word at all. Some time ago Ann read the word $s$. What is the word she changed it into? Input Specification: The first line contains a non-empty string $s$ with length at most $50$ characters, containing lowercase English letters only. Output Specification: If there is such a substring in $s$ that is not a palindrome, print the maximum length of such a substring. Otherwise print $0$. Note that there can be multiple longest substrings that are not palindromes, but their length is unique. Demo Input: ['mew\n', 'wuffuw\n', 'qqqqqqqq\n'] Demo Output: ['3\n', '5\n', '0\n'] Note: "mew" is not a palindrome, so the longest substring of it that is not a palindrome, is the string "mew" itself. Thus, the answer for the first example is $3$. The string "uffuw" is one of the longest non-palindrome substrings (of length $5$) of the string "wuffuw", so the answer for the second example is $5$. All substrings of the string "qqqqqqqq" consist of equal characters so they are palindromes. This way, there are no non-palindrome substrings. Thus, the answer for the third example is $0$.
```python def verificaPalindromo(s): if len(s) >= 1: if s[0] == s[-1]: return verificaPalindromo(s[1:-1]) else: return False else: return True def antipalindromo(s): if (verificaPalindromo(s)): if len(s) == 1: print(0) else: antipalindromo(s[0:-1]) else: print(len(s)) s = input() antipalindromo(s) ```
3
17
A
Noldbach problem
PROGRAMMING
1,000
[ "brute force", "math", "number theory" ]
A. Noldbach problem
2
64
Nick is interested in prime numbers. Once he read about Goldbach problem. It states that every even integer greater than 2 can be expressed as the sum of two primes. That got Nick's attention and he decided to invent a problem of his own and call it Noldbach problem. Since Nick is interested only in prime numbers, Noldbach problem states that at least *k* prime numbers from 2 to *n* inclusively can be expressed as the sum of three integer numbers: two neighboring prime numbers and 1. For example, 19 = 7 + 11 + 1, or 13 = 5 + 7 + 1. Two prime numbers are called neighboring if there are no other prime numbers between them. You are to help Nick, and find out if he is right or wrong.
The first line of the input contains two integers *n* (2<=≤<=*n*<=≤<=1000) and *k* (0<=≤<=*k*<=≤<=1000).
Output YES if at least *k* prime numbers from 2 to *n* inclusively can be expressed as it was described above. Otherwise output NO.
[ "27 2\n", "45 7\n" ]
[ "YES", "NO" ]
In the first sample the answer is YES since at least two numbers can be expressed as it was described (for example, 13 and 19). In the second sample the answer is NO since it is impossible to express 7 prime numbers from 2 to 45 in the desired form.
0
[ { "input": "27 2", "output": "YES" }, { "input": "45 7", "output": "NO" }, { "input": "2 0", "output": "YES" }, { "input": "15 1", "output": "YES" }, { "input": "17 1", "output": "YES" }, { "input": "34 5", "output": "NO" }, { "input": "37 4", "output": "YES" }, { "input": "43 5", "output": "YES" }, { "input": "47 7", "output": "NO" }, { "input": "50 5", "output": "YES" }, { "input": "57 6", "output": "YES" }, { "input": "60 8", "output": "NO" }, { "input": "62 7", "output": "YES" }, { "input": "76 9", "output": "NO" }, { "input": "69 7", "output": "YES" }, { "input": "113 10", "output": "YES" }, { "input": "141 11", "output": "YES" }, { "input": "207 16", "output": "NO" }, { "input": "231 18", "output": "NO" }, { "input": "296 19", "output": "YES" }, { "input": "332 20", "output": "YES" }, { "input": "378 24", "output": "NO" }, { "input": "428 23", "output": "YES" }, { "input": "497 27", "output": "NO" }, { "input": "640 32", "output": "YES" }, { "input": "798 35", "output": "YES" }, { "input": "802 35", "output": "YES" }, { "input": "864 40", "output": "NO" }, { "input": "953 44", "output": "NO" }, { "input": "995 44", "output": "YES" }, { "input": "1000 44", "output": "YES" }, { "input": "1000 0", "output": "YES" }, { "input": "1000 1000", "output": "NO" }, { "input": "2 1000", "output": "NO" }, { "input": "2 0", "output": "YES" } ]
1,623,422,265
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
6
216
0
import sys import math import bisect from math import sqrt def input(): return sys.stdin.readline().strip() def iinput(): return int(input()) def rinput(): return map(int, sys.stdin.readline().strip().split()) def get_list(): return list(map(int, sys.stdin.readline().strip().split())) mod = int(1e9)+7 n, k = rinput() primes = [1 for _ in range(n)] primes[0] = primes[1] = 0 i = 2 while(i*i <= n): if primes[i]: for j in range(2*i, n, i): primes[j] = 0 i += 1 p = [] for i in range(n): if primes[i] == 1: p.append(i) sums = {} for i in range(1, len(p)): sums[p[i] + p[i-1]] = 1 cnt = 0 for i in range(2, n): if primes[i] and sums.get(i-1, -1)!=-1: cnt += 1 if cnt>=k: print("YES") else: print("NO")
Title: Noldbach problem Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: Nick is interested in prime numbers. Once he read about Goldbach problem. It states that every even integer greater than 2 can be expressed as the sum of two primes. That got Nick's attention and he decided to invent a problem of his own and call it Noldbach problem. Since Nick is interested only in prime numbers, Noldbach problem states that at least *k* prime numbers from 2 to *n* inclusively can be expressed as the sum of three integer numbers: two neighboring prime numbers and 1. For example, 19 = 7 + 11 + 1, or 13 = 5 + 7 + 1. Two prime numbers are called neighboring if there are no other prime numbers between them. You are to help Nick, and find out if he is right or wrong. Input Specification: The first line of the input contains two integers *n* (2<=≤<=*n*<=≤<=1000) and *k* (0<=≤<=*k*<=≤<=1000). Output Specification: Output YES if at least *k* prime numbers from 2 to *n* inclusively can be expressed as it was described above. Otherwise output NO. Demo Input: ['27 2\n', '45 7\n'] Demo Output: ['YES', 'NO'] Note: In the first sample the answer is YES since at least two numbers can be expressed as it was described (for example, 13 and 19). In the second sample the answer is NO since it is impossible to express 7 prime numbers from 2 to 45 in the desired form.
```python import sys import math import bisect from math import sqrt def input(): return sys.stdin.readline().strip() def iinput(): return int(input()) def rinput(): return map(int, sys.stdin.readline().strip().split()) def get_list(): return list(map(int, sys.stdin.readline().strip().split())) mod = int(1e9)+7 n, k = rinput() primes = [1 for _ in range(n)] primes[0] = primes[1] = 0 i = 2 while(i*i <= n): if primes[i]: for j in range(2*i, n, i): primes[j] = 0 i += 1 p = [] for i in range(n): if primes[i] == 1: p.append(i) sums = {} for i in range(1, len(p)): sums[p[i] + p[i-1]] = 1 cnt = 0 for i in range(2, n): if primes[i] and sums.get(i-1, -1)!=-1: cnt += 1 if cnt>=k: print("YES") else: print("NO") ```
0
584
A
Olesya and Rodion
PROGRAMMING
1,000
[ "math" ]
null
null
Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them. Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1.
The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by.
Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them.
[ "3 2\n" ]
[ "712" ]
none
500
[ { "input": "3 2", "output": "222" }, { "input": "2 2", "output": "22" }, { "input": "4 3", "output": "3333" }, { "input": "5 3", "output": "33333" }, { "input": "10 7", "output": "7777777777" }, { "input": "2 9", "output": "99" }, { "input": "18 8", "output": "888888888888888888" }, { "input": "1 5", "output": "5" }, { "input": "1 10", "output": "-1" }, { "input": "100 5", "output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "10 2", "output": "2222222222" }, { "input": "18 10", "output": "111111111111111110" }, { "input": "1 9", "output": "9" }, { "input": "7 6", "output": "6666666" }, { "input": "4 4", "output": "4444" }, { "input": "14 7", "output": "77777777777777" }, { "input": "3 8", "output": "888" }, { "input": "1 3", "output": "3" }, { "input": "2 8", "output": "88" }, { "input": "3 8", "output": "888" }, { "input": "4 3", "output": "3333" }, { "input": "5 9", "output": "99999" }, { "input": "4 8", "output": "8888" }, { "input": "3 4", "output": "444" }, { "input": "9 4", "output": "444444444" }, { "input": "8 10", "output": "11111110" }, { "input": "1 6", "output": "6" }, { "input": "20 3", "output": "33333333333333333333" }, { "input": "15 10", "output": "111111111111110" }, { "input": "31 4", "output": "4444444444444444444444444444444" }, { "input": "18 9", "output": "999999999999999999" }, { "input": "72 4", "output": "444444444444444444444444444444444444444444444444444444444444444444444444" }, { "input": "76 8", "output": "8888888888888888888888888888888888888888888888888888888888888888888888888888" }, { "input": "12 5", "output": "555555555555" }, { "input": "54 5", "output": "555555555555555555555555555555555555555555555555555555" }, { "input": "96 10", "output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "15 9", "output": "999999999999999" }, { "input": "100 2", "output": "2222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222" }, { "input": "99 3", "output": "333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333" }, { "input": "98 4", "output": "44444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444" }, { "input": "97 5", "output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "100 6", "output": "6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666" }, { "input": "99 7", "output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "98 8", "output": "88888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888" }, { "input": "97 9", "output": "9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999" }, { "input": "100 10", "output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "3 10", "output": "110" }, { "input": "2 4", "output": "44" }, { "input": "2 10", "output": "10" }, { "input": "10 10", "output": "1111111110" }, { "input": "4 10", "output": "1110" }, { "input": "25 10", "output": "1111111111111111111111110" }, { "input": "50 10", "output": "11111111111111111111111111111111111111111111111110" }, { "input": "5 10", "output": "11110" }, { "input": "99 10", "output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "100 10", "output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "1 2", "output": "2" }, { "input": "20 10", "output": "11111111111111111110" }, { "input": "99 7", "output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "89 5", "output": "55555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "6 10", "output": "111110" }, { "input": "3 8", "output": "888" }, { "input": "1 9", "output": "9" }, { "input": "1 4", "output": "4" }, { "input": "100 7", "output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" } ]
1,687,941,141
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
31
0
n, m = map(int, input().split()) ans = 1 for _ in range(1, n): ans *= 10 print(ans + (ans % m))
Title: Olesya and Rodion Time Limit: None seconds Memory Limit: None megabytes Problem Description: Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them. Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1. Input Specification: The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by. Output Specification: Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them. Demo Input: ['3 2\n'] Demo Output: ['712'] Note: none
```python n, m = map(int, input().split()) ans = 1 for _ in range(1, n): ans *= 10 print(ans + (ans % m)) ```
0
131
A
cAPS lOCK
PROGRAMMING
1,000
[ "implementation", "strings" ]
null
null
wHAT DO WE NEED cAPS LOCK FOR? Caps lock is a computer keyboard key. Pressing it sets an input mode in which typed letters are capital by default. If it is pressed by accident, it leads to accidents like the one we had in the first passage. Let's consider that a word has been typed with the Caps lock key accidentally switched on, if: - either it only contains uppercase letters; - or all letters except for the first one are uppercase. In this case we should automatically change the case of all letters. For example, the case of the letters that form words "hELLO", "HTTP", "z" should be changed. Write a program that applies the rule mentioned above. If the rule cannot be applied, the program should leave the word unchanged.
The first line of the input data contains a word consisting of uppercase and lowercase Latin letters. The word's length is from 1 to 100 characters, inclusive.
Print the result of the given word's processing.
[ "cAPS\n", "Lock\n" ]
[ "Caps", "Lock\n" ]
none
500
[ { "input": "cAPS", "output": "Caps" }, { "input": "Lock", "output": "Lock" }, { "input": "cAPSlOCK", "output": "cAPSlOCK" }, { "input": "CAPs", "output": "CAPs" }, { "input": "LoCK", "output": "LoCK" }, { "input": "OOPS", "output": "oops" }, { "input": "oops", "output": "oops" }, { "input": "a", "output": "A" }, { "input": "A", "output": "a" }, { "input": "aA", "output": "Aa" }, { "input": "Zz", "output": "Zz" }, { "input": "Az", "output": "Az" }, { "input": "zA", "output": "Za" }, { "input": "AAA", "output": "aaa" }, { "input": "AAa", "output": "AAa" }, { "input": "AaR", "output": "AaR" }, { "input": "Tdr", "output": "Tdr" }, { "input": "aTF", "output": "Atf" }, { "input": "fYd", "output": "fYd" }, { "input": "dsA", "output": "dsA" }, { "input": "fru", "output": "fru" }, { "input": "hYBKF", "output": "Hybkf" }, { "input": "XweAR", "output": "XweAR" }, { "input": "mogqx", "output": "mogqx" }, { "input": "eOhEi", "output": "eOhEi" }, { "input": "nkdku", "output": "nkdku" }, { "input": "zcnko", "output": "zcnko" }, { "input": "lcccd", "output": "lcccd" }, { "input": "vwmvg", "output": "vwmvg" }, { "input": "lvchf", "output": "lvchf" }, { "input": "IUNVZCCHEWENCHQQXQYPUJCRDZLUXCLJHXPHBXEUUGNXOOOPBMOBRIBHHMIRILYJGYYGFMTMFSVURGYHUWDRLQVIBRLPEVAMJQYO", "output": "iunvzcchewenchqqxqypujcrdzluxcljhxphbxeuugnxooopbmobribhhmirilyjgyygfmtmfsvurgyhuwdrlqvibrlpevamjqyo" }, { "input": "OBHSZCAMDXEJWOZLKXQKIVXUUQJKJLMMFNBPXAEFXGVNSKQLJGXHUXHGCOTESIVKSFMVVXFVMTEKACRIWALAGGMCGFEXQKNYMRTG", "output": "obhszcamdxejwozlkxqkivxuuqjkjlmmfnbpxaefxgvnskqljgxhuxhgcotesivksfmvvxfvmtekacriwalaggmcgfexqknymrtg" }, { "input": "IKJYZIKROIYUUCTHSVSKZTETNNOCMAUBLFJCEVANCADASMZRCNLBZPQRXESHEEMOMEPCHROSRTNBIDXYMEPJSIXSZQEBTEKKUHFS", "output": "ikjyzikroiyuucthsvskztetnnocmaublfjcevancadasmzrcnlbzpqrxesheemomepchrosrtnbidxymepjsixszqebtekkuhfs" }, { "input": "cTKDZNWVYRTFPQLDAUUNSPKTDJTUPPFPRXRSINTVFVNNQNKXWUZUDHZBUSOKTABUEDQKUIVRTTVUREEOBJTSDKJKVEGFXVHXEYPE", "output": "Ctkdznwvyrtfpqldauunspktdjtuppfprxrsintvfvnnqnkxwuzudhzbusoktabuedqkuivrttvureeobjtsdkjkvegfxvhxeype" }, { "input": "uCKJZRGZJCPPLEEYJTUNKOQSWGBMTBQEVPYFPIPEKRVYQNTDPANOIXKMPINNFUSZWCURGBDPYTEKBEKCPMVZPMWAOSHJYMGKOMBQ", "output": "Uckjzrgzjcppleeyjtunkoqswgbmtbqevpyfpipekrvyqntdpanoixkmpinnfuszwcurgbdpytekbekcpmvzpmwaoshjymgkombq" }, { "input": "KETAXTSWAAOBKUOKUQREHIOMVMMRSAEWKGXZKRASwTVNSSFSNIWYNPSTMRADOADEEBURRHPOOBIEUIBGYDJCEKPNLEUCANZYJKMR", "output": "KETAXTSWAAOBKUOKUQREHIOMVMMRSAEWKGXZKRASwTVNSSFSNIWYNPSTMRADOADEEBURRHPOOBIEUIBGYDJCEKPNLEUCANZYJKMR" }, { "input": "ZEKGDMWJPVUWFlNXRLUmWKLMMYSLRQQIBRWDPKWITUIMZYYKOEYGREKHHZRZZUFPVTNIHKGTCCTLOKSZITXXZDMPITHNZUIGDZLE", "output": "ZEKGDMWJPVUWFlNXRLUmWKLMMYSLRQQIBRWDPKWITUIMZYYKOEYGREKHHZRZZUFPVTNIHKGTCCTLOKSZITXXZDMPITHNZUIGDZLE" }, { "input": "TcMbVPCFvnNkCEUUCIFLgBJeCOKuJhIGwXFrhAZjuAhBraMSchBfWwIuHAEbgJOFzGtxDLDXzDSaPCFujGGxgxdlHUIQYRrMFCgJ", "output": "TcMbVPCFvnNkCEUUCIFLgBJeCOKuJhIGwXFrhAZjuAhBraMSchBfWwIuHAEbgJOFzGtxDLDXzDSaPCFujGGxgxdlHUIQYRrMFCgJ" }, { "input": "xFGqoLILNvxARKuIntPfeukFtMbvzDezKpPRAKkIoIvwqNXnehRVwkkXYvuRCeoieBaBfTjwsYhDeCLvBwktntyluoxCYVioXGdm", "output": "xFGqoLILNvxARKuIntPfeukFtMbvzDezKpPRAKkIoIvwqNXnehRVwkkXYvuRCeoieBaBfTjwsYhDeCLvBwktntyluoxCYVioXGdm" }, { "input": "udvqolbxdwbkijwvhlyaelhynmnfgszbhgshlcwdkaibceqomzujndixuzivlsjyjqxzxodzbukxxhwwultvekdfntwpzlhhrIjm", "output": "udvqolbxdwbkijwvhlyaelhynmnfgszbhgshlcwdkaibceqomzujndixuzivlsjyjqxzxodzbukxxhwwultvekdfntwpzlhhrIjm" }, { "input": "jgpwhetqqoncighgzbbaLwwwxkxivuwtokehrgprfgewzcwxkavwoflcgsgbhoeamzbefzoonwsyzisetoydrpufktzgbaycgaeg", "output": "jgpwhetqqoncighgzbbaLwwwxkxivuwtokehrgprfgewzcwxkavwoflcgsgbhoeamzbefzoonwsyzisetoydrpufktzgbaycgaeg" }, { "input": "vyujsazdstbnkxeunedfbolicojzjpufgfemhtmdrswvmuhoivjvonacefqenbqudelmdegxqtbwezsbydmanzutvdgkgrjxzlnc", "output": "vyujsazdstbnkxeunedfbolicojzjpufgfemhtmdrswvmuhoivjvonacefqenbqudelmdegxqtbwezsbydmanzutvdgkgrjxzlnc" }, { "input": "pivqnuqkaofcduvbttztjbuavrqwiqrwkfncmvatoxruelyoecnkpqraiahumiaiqeyjapbqyrsxcdgjbihivtqezvasfmzntdfv", "output": "pivqnuqkaofcduvbttztjbuavrqwiqrwkfncmvatoxruelyoecnkpqraiahumiaiqeyjapbqyrsxcdgjbihivtqezvasfmzntdfv" }, { "input": "upvtbsxswbohxshdrbjxcungzquhuomgxwlryvshshsfvqbrxvcikbglietlpqkiwbhiqpmdwuqosbtdvyxekkaqiwrbsibpoect", "output": "upvtbsxswbohxshdrbjxcungzquhuomgxwlryvshshsfvqbrxvcikbglietlpqkiwbhiqpmdwuqosbtdvyxekkaqiwrbsibpoect" }, { "input": "cTKDZNWVYRTFPQLDAUUNSPKTDJTUPPFPRXRSINTVFVNNQNKXWUZUDHZBUSOKTABUEDQKUIVRTTVUREEOBJTSDKJKVEGFXVHXEYPE", "output": "Ctkdznwvyrtfpqldauunspktdjtuppfprxrsintvfvnnqnkxwuzudhzbusoktabuedqkuivrttvureeobjtsdkjkvegfxvhxeype" }, { "input": "JEGDOFJOFGJHFROGHOFGMHOFGHORGFHMOu", "output": "JEGDOFJOFGJHFROGHOFGMHOFGHORGFHMOu" }, { "input": "aBACABa", "output": "aBACABa" }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAaa", "output": "AAAAAAAAAAAAAAAAAAAAAAAAaa" }, { "input": "aaAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "aaAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA" }, { "input": "dDDDDDDDDDDDDD", "output": "Dddddddddddddd" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "z", "output": "Z" }, { "input": "AZ", "output": "az" }, { "input": "Z", "output": "z" }, { "input": "aAAAA", "output": "Aaaaa" }, { "input": "F", "output": "f" } ]
1,694,600,834
2,147,483,647
Python 3
OK
TESTS
56
46
0
s=input() up=s.upper() f=0 z=0 ans="" if s==up: z=1 print(s.lower()) else: if s[0]==s[0].lower(): for i in range(1,len(s)): if s[i]!=s[i].upper(): f=1 if f==0: ans+=s[0].upper() for i in range(1,len(s)): ans+=s[i].lower() z=1 print(ans) if z==0: print(s)
Title: cAPS lOCK Time Limit: None seconds Memory Limit: None megabytes Problem Description: wHAT DO WE NEED cAPS LOCK FOR? Caps lock is a computer keyboard key. Pressing it sets an input mode in which typed letters are capital by default. If it is pressed by accident, it leads to accidents like the one we had in the first passage. Let's consider that a word has been typed with the Caps lock key accidentally switched on, if: - either it only contains uppercase letters; - or all letters except for the first one are uppercase. In this case we should automatically change the case of all letters. For example, the case of the letters that form words "hELLO", "HTTP", "z" should be changed. Write a program that applies the rule mentioned above. If the rule cannot be applied, the program should leave the word unchanged. Input Specification: The first line of the input data contains a word consisting of uppercase and lowercase Latin letters. The word's length is from 1 to 100 characters, inclusive. Output Specification: Print the result of the given word's processing. Demo Input: ['cAPS\n', 'Lock\n'] Demo Output: ['Caps', 'Lock\n'] Note: none
```python s=input() up=s.upper() f=0 z=0 ans="" if s==up: z=1 print(s.lower()) else: if s[0]==s[0].lower(): for i in range(1,len(s)): if s[i]!=s[i].upper(): f=1 if f==0: ans+=s[0].upper() for i in range(1,len(s)): ans+=s[i].lower() z=1 print(ans) if z==0: print(s) ```
3
784
F
Crunching Numbers Just for You
PROGRAMMING
1,900
[ "*special", "implementation" ]
null
null
You are developing a new feature for the website which sells airline tickets: being able to sort tickets by price! You have already extracted the tickets' prices, so there's just the last step to be done... You are given an array of integers. Sort it in non-descending order.
The input consists of a single line of space-separated integers. The first number is *n* (1<=≤<=*n*<=≤<=10) — the size of the array. The following *n* numbers are the elements of the array (1<=≤<=*a**i*<=≤<=100).
Output space-separated elements of the sorted array.
[ "3 3 1 2\n" ]
[ "1 2 3 \n" ]
Remember, this is a very important feature, and you have to make sure the customers appreciate it!
0
[ { "input": "3 3 1 2", "output": "1 2 3 " }, { "input": "10 54 100 27 1 33 27 80 49 27 6", "output": "1 6 27 27 27 33 49 54 80 100 " } ]
1,549,985,508
3,108
Python 3
REJECTED
TESTS
0
0
0
t = 1 for i in range(5000000): t += i a=list(map(int,input().split()));b=a[1:];b.sort();print(" ".join(map(str,b)))
Title: Crunching Numbers Just for You Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are developing a new feature for the website which sells airline tickets: being able to sort tickets by price! You have already extracted the tickets' prices, so there's just the last step to be done... You are given an array of integers. Sort it in non-descending order. Input Specification: The input consists of a single line of space-separated integers. The first number is *n* (1<=≤<=*n*<=≤<=10) — the size of the array. The following *n* numbers are the elements of the array (1<=≤<=*a**i*<=≤<=100). Output Specification: Output space-separated elements of the sorted array. Demo Input: ['3 3 1 2\n'] Demo Output: ['1 2 3 \n'] Note: Remember, this is a very important feature, and you have to make sure the customers appreciate it!
```python t = 1 for i in range(5000000): t += i a=list(map(int,input().split()));b=a[1:];b.sort();print(" ".join(map(str,b))) ```
-1
803
C
Maximal GCD
PROGRAMMING
1,900
[ "constructive algorithms", "greedy", "math" ]
null
null
You are given positive integer number *n*. You should create such strictly increasing sequence of *k* positive numbers *a*1,<=*a*2,<=...,<=*a**k*, that their sum is equal to *n* and greatest common divisor is maximal. Greatest common divisor of sequence is maximum of such numbers that every element of sequence is divisible by them. If there is no possible sequence then output -1.
The first line consists of two numbers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1010).
If the answer exists then output *k* numbers — resulting sequence. Otherwise output -1. If there are multiple answers, print any of them.
[ "6 3\n", "8 2\n", "5 3\n" ]
[ "1 2 3\n", "2 6\n", "-1\n" ]
none
0
[ { "input": "6 3", "output": "1 2 3" }, { "input": "8 2", "output": "2 6" }, { "input": "5 3", "output": "-1" }, { "input": "1 1", "output": "1" }, { "input": "1 2", "output": "-1" }, { "input": "2 1", "output": "2" }, { "input": "2 10000000000", "output": "-1" }, { "input": "5 1", "output": "5" }, { "input": "6 2", "output": "2 4" }, { "input": "24 2", "output": "8 16" }, { "input": "24 3", "output": "4 8 12" }, { "input": "24 4", "output": "2 4 6 12" }, { "input": "24 5", "output": "1 2 3 4 14" }, { "input": "479001600 2", "output": "159667200 319334400" }, { "input": "479001600 3", "output": "79833600 159667200 239500800" }, { "input": "479001600 4", "output": "47900160 95800320 143700480 191600640" }, { "input": "479001600 5", "output": "31933440 63866880 95800320 127733760 159667200" }, { "input": "479001600 6", "output": "22809600 45619200 68428800 91238400 114048000 136857600" }, { "input": "3000000021 1", "output": "3000000021" }, { "input": "3000000021 2", "output": "1000000007 2000000014" }, { "input": "3000000021 3", "output": "3 6 3000000012" }, { "input": "3000000021 4", "output": "3 6 9 3000000003" }, { "input": "3000000021 50000", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "3000000021 100000", "output": "-1" }, { "input": "10000000000 100", "output": "1953125 3906250 5859375 7812500 9765625 11718750 13671875 15625000 17578125 19531250 21484375 23437500 25390625 27343750 29296875 31250000 33203125 35156250 37109375 39062500 41015625 42968750 44921875 46875000 48828125 50781250 52734375 54687500 56640625 58593750 60546875 62500000 64453125 66406250 68359375 70312500 72265625 74218750 76171875 78125000 80078125 82031250 83984375 85937500 87890625 89843750 91796875 93750000 95703125 97656250 99609375 101562500 103515625 105468750 107421875 109375000 1113281..." }, { "input": "10000000000 2000", "output": "4000 8000 12000 16000 20000 24000 28000 32000 36000 40000 44000 48000 52000 56000 60000 64000 68000 72000 76000 80000 84000 88000 92000 96000 100000 104000 108000 112000 116000 120000 124000 128000 132000 136000 140000 144000 148000 152000 156000 160000 164000 168000 172000 176000 180000 184000 188000 192000 196000 200000 204000 208000 212000 216000 220000 224000 228000 232000 236000 240000 244000 248000 252000 256000 260000 264000 268000 272000 276000 280000 284000 288000 292000 296000 300000 304000 30800..." }, { "input": "10000000000 5000", "output": "640 1280 1920 2560 3200 3840 4480 5120 5760 6400 7040 7680 8320 8960 9600 10240 10880 11520 12160 12800 13440 14080 14720 15360 16000 16640 17280 17920 18560 19200 19840 20480 21120 21760 22400 23040 23680 24320 24960 25600 26240 26880 27520 28160 28800 29440 30080 30720 31360 32000 32640 33280 33920 34560 35200 35840 36480 37120 37760 38400 39040 39680 40320 40960 41600 42240 42880 43520 44160 44800 45440 46080 46720 47360 48000 48640 49280 49920 50560 51200 51840 52480 53120 53760 54400 55040 55680 56320..." }, { "input": "10000000000 100000", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "10000000000 100000000", "output": "-1" }, { "input": "10000000000 10000000000", "output": "-1" }, { "input": "10000000000 100001", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "1 4000000000", "output": "-1" }, { "input": "4294967296 4294967296", "output": "-1" }, { "input": "71227122 9603838834", "output": "-1" }, { "input": "10000000000 9603838835", "output": "-1" }, { "input": "5 5999999999", "output": "-1" }, { "input": "2 9324327498", "output": "-1" }, { "input": "9 2", "output": "3 6" }, { "input": "10000000000 4294967296", "output": "-1" }, { "input": "1 3500000000", "output": "-1" }, { "input": "10000000000 4000000000", "output": "-1" }, { "input": "2000 9324327498", "output": "-1" }, { "input": "10000000000 8589934592", "output": "-1" }, { "input": "5000150001 100001", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "10000000000 3037000500", "output": "-1" }, { "input": "9400000000 9324327498", "output": "-1" }, { "input": "10000000000 3307000500", "output": "-1" }, { "input": "2 4000000000", "output": "-1" }, { "input": "1000 4294967295", "output": "-1" }, { "input": "36 3", "output": "6 12 18" }, { "input": "2147483648 4294967296", "output": "-1" }, { "input": "999 4294967295", "output": "-1" }, { "input": "10000000000 130000", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "10000000000 140000", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "10000000000 6074001000", "output": "-1" }, { "input": "12344321 1", "output": "12344321" }, { "input": "2 2", "output": "-1" }, { "input": "28 7", "output": "1 2 3 4 5 6 7" }, { "input": "1 1", "output": "1" }, { "input": "1 2", "output": "-1" }, { "input": "1 3", "output": "-1" }, { "input": "1 4", "output": "-1" }, { "input": "1 5", "output": "-1" }, { "input": "1 6", "output": "-1" }, { "input": "1 7", "output": "-1" }, { "input": "1 8", "output": "-1" }, { "input": "1 9", "output": "-1" }, { "input": "1 10", "output": "-1" }, { "input": "2 1", "output": "2" }, { "input": "2 2", "output": "-1" }, { "input": "2 3", "output": "-1" }, { "input": "2 4", "output": "-1" }, { "input": "2 5", "output": "-1" }, { "input": "2 6", "output": "-1" }, { "input": "2 7", "output": "-1" }, { "input": "2 8", "output": "-1" }, { "input": "2 9", "output": "-1" }, { "input": "2 10", "output": "-1" }, { "input": "3 1", "output": "3" }, { "input": "3 2", "output": "1 2" }, { "input": "3 3", "output": "-1" }, { "input": "3 4", "output": "-1" }, { "input": "3 5", "output": "-1" }, { "input": "3 6", "output": "-1" }, { "input": "3 7", "output": "-1" }, { "input": "3 8", "output": "-1" }, { "input": "3 9", "output": "-1" }, { "input": "3 10", "output": "-1" }, { "input": "4 1", "output": "4" }, { "input": "4 2", "output": "1 3" }, { "input": "4 3", "output": "-1" }, { "input": "4 4", "output": "-1" }, { "input": "4 5", "output": "-1" }, { "input": "4 6", "output": "-1" }, { "input": "4 7", "output": "-1" }, { "input": "4 8", "output": "-1" }, { "input": "4 9", "output": "-1" }, { "input": "4 10", "output": "-1" }, { "input": "5 1", "output": "5" }, { "input": "5 2", "output": "1 4" }, { "input": "5 3", "output": "-1" }, { "input": "5 4", "output": "-1" }, { "input": "5 5", "output": "-1" }, { "input": "5 6", "output": "-1" }, { "input": "5 7", "output": "-1" }, { "input": "5 8", "output": "-1" }, { "input": "5 9", "output": "-1" }, { "input": "5 10", "output": "-1" }, { "input": "6 1", "output": "6" }, { "input": "6 2", "output": "2 4" }, { "input": "6 3", "output": "1 2 3" }, { "input": "6 4", "output": "-1" }, { "input": "6 5", "output": "-1" }, { "input": "6 6", "output": "-1" }, { "input": "6 7", "output": "-1" }, { "input": "6 8", "output": "-1" }, { "input": "6 9", "output": "-1" }, { "input": "6 10", "output": "-1" }, { "input": "7 1", "output": "7" }, { "input": "7 2", "output": "1 6" }, { "input": "7 3", "output": "1 2 4" }, { "input": "7 4", "output": "-1" }, { "input": "7 5", "output": "-1" }, { "input": "7 6", "output": "-1" }, { "input": "7 7", "output": "-1" }, { "input": "7 8", "output": "-1" }, { "input": "7 9", "output": "-1" }, { "input": "7 10", "output": "-1" }, { "input": "8 1", "output": "8" }, { "input": "8 2", "output": "2 6" }, { "input": "8 3", "output": "1 2 5" }, { "input": "8 4", "output": "-1" }, { "input": "8 5", "output": "-1" }, { "input": "8 6", "output": "-1" }, { "input": "8 7", "output": "-1" }, { "input": "8 8", "output": "-1" }, { "input": "8 9", "output": "-1" }, { "input": "8 10", "output": "-1" } ]
1,493,431,138
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
9
46
4,608,000
import math def divisorGenerator(n): large_divisors = [] for i in range(1, int(math.sqrt(n) + 1)): if n % i == 0: yield i if i*i != n: large_divisors.append(n / i) for divisor in reversed(large_divisors): yield divisor def result(n,k): Main = [] Last = n for i in range(1,n*2): if k==1: break Main.append(i) Last -= i k -= 1 Main.append(Last) return Main n,k = map(int,input().split()) divisors = list(divisorGenerator(100)) for i in range(len(divisors)): divisors[i] = int(divisors[i]) kk = (k**2+k)//2 if n<kk: print(-1) else: oo = n//(kk) pp = 1 for i in divisors: if i <= oo: pp = i oo = pp w = result(n//oo,k) s = "" for i in w: s += " "+str(i*oo) print(s[1:])
Title: Maximal GCD Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given positive integer number *n*. You should create such strictly increasing sequence of *k* positive numbers *a*1,<=*a*2,<=...,<=*a**k*, that their sum is equal to *n* and greatest common divisor is maximal. Greatest common divisor of sequence is maximum of such numbers that every element of sequence is divisible by them. If there is no possible sequence then output -1. Input Specification: The first line consists of two numbers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1010). Output Specification: If the answer exists then output *k* numbers — resulting sequence. Otherwise output -1. If there are multiple answers, print any of them. Demo Input: ['6 3\n', '8 2\n', '5 3\n'] Demo Output: ['1 2 3\n', '2 6\n', '-1\n'] Note: none
```python import math def divisorGenerator(n): large_divisors = [] for i in range(1, int(math.sqrt(n) + 1)): if n % i == 0: yield i if i*i != n: large_divisors.append(n / i) for divisor in reversed(large_divisors): yield divisor def result(n,k): Main = [] Last = n for i in range(1,n*2): if k==1: break Main.append(i) Last -= i k -= 1 Main.append(Last) return Main n,k = map(int,input().split()) divisors = list(divisorGenerator(100)) for i in range(len(divisors)): divisors[i] = int(divisors[i]) kk = (k**2+k)//2 if n<kk: print(-1) else: oo = n//(kk) pp = 1 for i in divisors: if i <= oo: pp = i oo = pp w = result(n//oo,k) s = "" for i in w: s += " "+str(i*oo) print(s[1:]) ```
0
748
B
Santa Claus and Keyboard Check
PROGRAMMING
1,500
[ "implementation", "strings" ]
null
null
Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be. In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard. You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once.
The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters.
If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes). Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct. If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair. Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes.
[ "helloworld\nehoolwlroz\n", "hastalavistababy\nhastalavistababy\n", "merrychristmas\nchristmasmerry\n" ]
[ "3\nh e\nl o\nd z\n", "0\n", "-1\n" ]
none
1,000
[ { "input": "helloworld\nehoolwlroz", "output": "3\nh e\nl o\nd z" }, { "input": "hastalavistababy\nhastalavistababy", "output": "0" }, { "input": "merrychristmas\nchristmasmerry", "output": "-1" }, { "input": "kusyvdgccw\nkusyvdgccw", "output": "0" }, { "input": "bbbbbabbab\naaaaabaaba", "output": "1\nb a" }, { "input": "zzzzzzzzzzzzzzzzzzzzz\nqwertyuiopasdfghjklzx", "output": "-1" }, { "input": "accdccdcdccacddbcacc\naccbccbcbccacbbdcacc", "output": "1\nd b" }, { "input": "giiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd\ngiiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd", "output": "0" }, { "input": "gndggadlmdefgejidmmcglbjdcmglncfmbjjndjcibnjbabfab\nfihffahlmhogfojnhmmcflkjhcmflicgmkjjihjcnkijkakgak", "output": "5\ng f\nn i\nd h\ne o\nb k" }, { "input": "ijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc\nijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc", "output": "0" }, { "input": "ab\naa", "output": "-1" }, { "input": "a\nz", "output": "1\na z" }, { "input": "zz\nzy", "output": "-1" }, { "input": "as\ndf", "output": "2\na d\ns f" }, { "input": "abc\nbca", "output": "-1" }, { "input": "rtfg\nrftg", "output": "1\nt f" }, { "input": "y\ny", "output": "0" }, { "input": "qwertyuiopasdfghjklzx\nzzzzzzzzzzzzzzzzzzzzz", "output": "-1" }, { "input": "qazwsxedcrfvtgbyhnujmik\nqwertyuiasdfghjkzxcvbnm", "output": "-1" }, { "input": "aaaaaa\nabcdef", "output": "-1" }, { "input": "qwerty\nffffff", "output": "-1" }, { "input": "dofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh\ndofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh", "output": "0" }, { "input": "acdbccddadbcbabbebbaebdcedbbcebeaccecdabadeabeecbacacdcbccedeadadedeccedecdaabcedccccbbcbcedcaccdede\ndcbaccbbdbacadaaeaadeabcebaaceaedccecbdadbedaeecadcdcbcaccebedbdbebeccebecbddacebccccaacacebcdccbebe", "output": "-1" }, { "input": "bacccbbacabbcaacbbba\nbacccbbacabbcaacbbba", "output": "0" }, { "input": "dbadbddddb\nacbacaaaac", "output": "-1" }, { "input": "dacbdbbbdd\nadbdadddaa", "output": "-1" }, { "input": "bbbbcbcbbc\ndaddbabddb", "output": "-1" }, { "input": "dddddbcdbd\nbcbbbdacdb", "output": "-1" }, { "input": "cbadcbcdaa\nabbbababbb", "output": "-1" }, { "input": "dmkgadidjgdjikgkehhfkhgkeamhdkfemikkjhhkdjfaenmkdgenijinamngjgkmgmmedfdehkhdigdnnkhmdkdindhkhndnakdgdhkdefagkedndnijekdmkdfedkhekgdkhgkimfeakdhhhgkkff\nbdenailbmnbmlcnehjjkcgnehadgickhdlecmggcimkahfdeinhflmlfadfnmncdnddhbkbhgejblnbffcgdbeilfigegfifaebnijeihkanehififlmhcbdcikhieghenbejneldkhaebjggncckk", "output": "-1" }, { "input": "acbbccabaa\nabbbbbabaa", "output": "-1" }, { "input": "ccccaccccc\naaaabaaaac", "output": "-1" }, { "input": "acbacacbbb\nacbacacbbb", "output": "0" }, { "input": "abbababbcc\nccccccccbb", "output": "-1" }, { "input": "jbcbbjiifdcbeajgdeabddbfcecafejddcigfcaedbgicjihifgbahjihcjefgabgbccdiibfjgacehbbdjceacdbdeaiibaicih\nhhihhhddcfihddhjfddhffhcididcdhffidjciddfhjdihdhdcjhdhhdhihdcjdhjhiifddhchjdidhhhfhiddifhfddddhddidh", "output": "-1" }, { "input": "ahaeheedefeehahfefhjhhedheeeedhehhfhdejdhffhhejhhhejadhefhahhadjjhdhheeeehfdaffhhefehhhefhhhhehehjda\neiefbdfgdhffieihfhjajifgjddffgifjbhigfagjhhjicaijbdaegidhiejiegaabgjidcfcjhgehhjjchcbjjdhjbiidjdjage", "output": "-1" }, { "input": "fficficbidbcbfaddifbffdbbiaccbbciiaidbcbbiadcccbccbbaibabcbbdbcibcciibiccfifbiiicadibbiaafadacdficbc\nddjhdghbgcbhadeccjdbddcbfjeiiaaigjejcaiabgechiiahibfejbeahafcfhjbihgjfgihdgdagjjhecjafjeedecehcdjhai", "output": "-1" }, { "input": "z\nz", "output": "0" }, { "input": "a\nz", "output": "1\na z" }, { "input": "z\na", "output": "1\nz a" }, { "input": "aa\nzz", "output": "1\na z" }, { "input": "az\nza", "output": "1\na z" }, { "input": "aa\nza", "output": "-1" }, { "input": "za\nzz", "output": "-1" }, { "input": "aa\nab", "output": "-1" }, { "input": "hehe\nheeh", "output": "-1" }, { "input": "bd\ncc", "output": "-1" }, { "input": "he\nhh", "output": "-1" }, { "input": "hee\nheh", "output": "-1" }, { "input": "aa\nac", "output": "-1" }, { "input": "ab\naa", "output": "-1" }, { "input": "hello\nehlol", "output": "-1" }, { "input": "ac\naa", "output": "-1" }, { "input": "aaabbb\nbbbaab", "output": "-1" }, { "input": "aa\nfa", "output": "-1" }, { "input": "hg\nee", "output": "-1" }, { "input": "helloworld\nehoolwlrow", "output": "-1" }, { "input": "abb\nbab", "output": "-1" }, { "input": "aaa\naae", "output": "-1" }, { "input": "aba\nbaa", "output": "-1" }, { "input": "aa\nba", "output": "-1" }, { "input": "da\naa", "output": "-1" }, { "input": "aaa\naab", "output": "-1" }, { "input": "xy\nzz", "output": "-1" } ]
1,482,959,819
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
1
46
4,608,000
ch=input() sh=input() n=len(ch) t=[] for i in range(n): if ch[i]!=sh[i]: k=[ch[i],sh[i]] k.sort() if k not in t: t.append(k) print(len(t)) for i in t: print(i[0]," ",i[1])
Title: Santa Claus and Keyboard Check Time Limit: None seconds Memory Limit: None megabytes Problem Description: Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be. In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard. You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once. Input Specification: The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters. Output Specification: If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes). Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct. If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair. Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes. Demo Input: ['helloworld\nehoolwlroz\n', 'hastalavistababy\nhastalavistababy\n', 'merrychristmas\nchristmasmerry\n'] Demo Output: ['3\nh e\nl o\nd z\n', '0\n', '-1\n'] Note: none
```python ch=input() sh=input() n=len(ch) t=[] for i in range(n): if ch[i]!=sh[i]: k=[ch[i],sh[i]] k.sort() if k not in t: t.append(k) print(len(t)) for i in t: print(i[0]," ",i[1]) ```
-1
794
A
Bank Robbery
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
A robber has attempted to rob a bank but failed to complete his task. However, he had managed to open all the safes. Oleg the bank client loves money (who doesn't), and decides to take advantage of this failed robbery and steal some money from the safes. There are many safes arranged in a line, where the *i*-th safe from the left is called safe *i*. There are *n* banknotes left in all the safes in total. The *i*-th banknote is in safe *x**i*. Oleg is now at safe *a*. There are two security guards, one of which guards the safe *b* such that *b*<=&lt;<=*a*, i.e. the first guard is to the left of Oleg. The other guard guards the safe *c* so that *c*<=&gt;<=*a*, i.e. he is to the right of Oleg. The two guards are very lazy, so they do not move. In every second, Oleg can either take all the banknotes from the current safe or move to any of the neighboring safes. However, he cannot visit any safe that is guarded by security guards at any time, becaues he might be charged for stealing. Determine the maximum amount of banknotes Oleg can gather.
The first line of input contains three space-separated integers, *a*, *b* and *c* (1<=≤<=*b*<=&lt;<=*a*<=&lt;<=*c*<=≤<=109), denoting the positions of Oleg, the first security guard and the second security guard, respectively. The next line of input contains a single integer *n* (1<=≤<=*n*<=≤<=105), denoting the number of banknotes. The next line of input contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109), denoting that the *i*-th banknote is located in the *x**i*-th safe. Note that *x**i* are not guaranteed to be distinct.
Output a single integer: the maximum number of banknotes Oleg can take.
[ "5 3 7\n8\n4 7 5 5 3 6 2 8\n", "6 5 7\n5\n1 5 7 92 3\n" ]
[ "4\n", "0\n" ]
In the first example Oleg can take the banknotes in positions 4, 5, 6 (note that there are 2 banknotes at position 5). Oleg can't take the banknotes in safes 7 and 8 because he can't run into the second security guard. Similarly, Oleg cannot take the banknotes at positions 3 and 2 because he can't run into the first security guard. Thus, he can take a maximum of 4 banknotes. For the second sample, Oleg can't take any banknotes without bumping into any of the security guards.
500
[ { "input": "5 3 7\n8\n4 7 5 5 3 6 2 8", "output": "4" }, { "input": "6 5 7\n5\n1 5 7 92 3", "output": "0" }, { "input": "3 2 4\n1\n3", "output": "1" }, { "input": "5 3 8\n12\n8 3 4 5 7 6 8 3 5 4 7 6", "output": "8" }, { "input": "7 3 10\n5\n3 3 3 3 3", "output": "0" }, { "input": "3 2 5\n4\n1 3 4 5", "output": "2" }, { "input": "3 2 4\n1\n1", "output": "0" }, { "input": "6 4 8\n1\n4", "output": "0" }, { "input": "2 1 3\n1\n3", "output": "0" } ]
1,585,562,989
2,147,483,647
PyPy 3
OK
TESTS
46
249
10,752,000
n,m,o = map(int,input().split()) a = int(input()) b = sorted(list(map(int,input().split()))) z =0 for i in b: if i>m and i<o: z+=1 print(z)
Title: Bank Robbery Time Limit: None seconds Memory Limit: None megabytes Problem Description: A robber has attempted to rob a bank but failed to complete his task. However, he had managed to open all the safes. Oleg the bank client loves money (who doesn't), and decides to take advantage of this failed robbery and steal some money from the safes. There are many safes arranged in a line, where the *i*-th safe from the left is called safe *i*. There are *n* banknotes left in all the safes in total. The *i*-th banknote is in safe *x**i*. Oleg is now at safe *a*. There are two security guards, one of which guards the safe *b* such that *b*<=&lt;<=*a*, i.e. the first guard is to the left of Oleg. The other guard guards the safe *c* so that *c*<=&gt;<=*a*, i.e. he is to the right of Oleg. The two guards are very lazy, so they do not move. In every second, Oleg can either take all the banknotes from the current safe or move to any of the neighboring safes. However, he cannot visit any safe that is guarded by security guards at any time, becaues he might be charged for stealing. Determine the maximum amount of banknotes Oleg can gather. Input Specification: The first line of input contains three space-separated integers, *a*, *b* and *c* (1<=≤<=*b*<=&lt;<=*a*<=&lt;<=*c*<=≤<=109), denoting the positions of Oleg, the first security guard and the second security guard, respectively. The next line of input contains a single integer *n* (1<=≤<=*n*<=≤<=105), denoting the number of banknotes. The next line of input contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109), denoting that the *i*-th banknote is located in the *x**i*-th safe. Note that *x**i* are not guaranteed to be distinct. Output Specification: Output a single integer: the maximum number of banknotes Oleg can take. Demo Input: ['5 3 7\n8\n4 7 5 5 3 6 2 8\n', '6 5 7\n5\n1 5 7 92 3\n'] Demo Output: ['4\n', '0\n'] Note: In the first example Oleg can take the banknotes in positions 4, 5, 6 (note that there are 2 banknotes at position 5). Oleg can't take the banknotes in safes 7 and 8 because he can't run into the second security guard. Similarly, Oleg cannot take the banknotes at positions 3 and 2 because he can't run into the first security guard. Thus, he can take a maximum of 4 banknotes. For the second sample, Oleg can't take any banknotes without bumping into any of the security guards.
```python n,m,o = map(int,input().split()) a = int(input()) b = sorted(list(map(int,input().split()))) z =0 for i in b: if i>m and i<o: z+=1 print(z) ```
3
615
D
Multipliers
PROGRAMMING
2,000
[ "math", "number theory" ]
null
null
Ayrat has number *n*, represented as it's prime factorization *p**i* of size *m*, i.e. *n*<==<=*p*1·*p*2·...·*p**m*. Ayrat got secret information that that the product of all divisors of *n* taken modulo 109<=+<=7 is the password to the secret data base. Now he wants to calculate this value.
The first line of the input contains a single integer *m* (1<=≤<=*m*<=≤<=200<=000) — the number of primes in factorization of *n*. The second line contains *m* primes numbers *p**i* (2<=≤<=*p**i*<=≤<=200<=000).
Print one integer — the product of all divisors of *n* modulo 109<=+<=7.
[ "2\n2 3\n", "3\n2 3 2\n" ]
[ "36\n", "1728\n" ]
In the first sample *n* = 2·3 = 6. The divisors of 6 are 1, 2, 3 and 6, their product is equal to 1·2·3·6 = 36. In the second sample 2·3·2 = 12. The divisors of 12 are 1, 2, 3, 4, 6 and 12. 1·2·3·4·6·12 = 1728.
2,000
[ { "input": "2\n2 3", "output": "36" }, { "input": "3\n2 3 2", "output": "1728" }, { "input": "1\n2017", "output": "2017" }, { "input": "2\n63997 63997", "output": "135893224" }, { "input": "5\n11 7 11 7 11", "output": "750455957" }, { "input": "5\n2 2 2 2 2", "output": "32768" }, { "input": "4\n3 3 3 5", "output": "332150625" }, { "input": "6\n101 103 107 109 101 103", "output": "760029909" }, { "input": "10\n3 3 3 3 3 3 3 3 3 3", "output": "555340537" }, { "input": "5\n7 5 2 3 13", "output": "133580280" }, { "input": "23\n190979 191627 93263 72367 52561 188317 198397 24979 70313 105239 86263 78697 6163 7673 84137 199967 14657 84391 101009 16231 175103 24239 123289", "output": "727083628" }, { "input": "7\n34429 104287 171293 101333 104287 34429 104287", "output": "249330396" }, { "input": "27\n151153 29429 91411 91411 194507 194819 91411 91411 194507 181211 194507 131363 9371 194819 181211 194507 151153 91411 91411 192391 192391 151153 151153 194507 192391 192391 194819", "output": "132073405" }, { "input": "47\n9041 60013 53609 82939 160861 123377 74383 74383 184039 19867 123377 101879 74383 193603 123377 115331 101879 53609 74383 115331 51869 51869 184039 193603 91297 160861 160861 115331 184039 51869 123377 74383 160861 74383 115331 115331 51869 74383 19867 193603 193603 115331 184039 9041 53609 53609 193603", "output": "648634399" }, { "input": "67\n98929 19079 160079 181891 17599 91807 19079 98929 182233 92647 77477 98929 98639 182233 181891 182233 160079 98929 19079 98639 114941 98929 161341 91807 160079 22777 132361 92647 98929 77477 182233 103913 160079 77477 55711 77477 77477 182233 114941 91807 98929 19079 104393 182233 182233 131009 132361 16883 161341 103913 16883 98929 182233 114941 92647 92647 104393 132361 181891 114941 19079 91807 114941 132361 98639 161341 182233", "output": "5987226" }, { "input": "44\n73 59 17 41 37 7 71 47 29 83 67 17 53 61 43 43 3 23 29 11 7 83 61 79 31 37 37 83 41 71 11 19 83 2 83 73 7 67 83 13 2 53 31 47", "output": "464170294" }, { "input": "100\n2 3 5 7 11 13 17 19 23 29 31 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 293 307 311 313 317 331 337 347 349 353 359 367 373 379 383 389 397 401 409 419 421 431 433 439 443 449 457 461 463 467 479 487 491 499 503 509 521 523 541", "output": "72902143" }, { "input": "130\n2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 5 5 5 5 5 5 5 5 5 5 7 7 7 7 7 7 7 7 7 7 11 11 11 11 11 11 11 11 11 11 13 13 13 13 13 13 13 13 13 13 17 17 17 17 17 17 17 17 17 17 19 19 19 19 19 19 19 19 19 19 23 23 23 23 23 23 23 23 23 23 29 29 29 29 29 29 29 29 29 29 31 31 31 31 31 31 31 31 31 31 37 37 37 37 37 37 37 37 37 37 41 41 41 41 41 41 41 41 41 41", "output": "869075922" }, { "input": "101\n2 3 5 7 11 13 17 19 23 29 31 37 41 43 47 53 59 61 67 71 73 79 83 89 97 101 103 107 109 113 127 131 137 139 149 151 157 163 167 173 179 181 191 193 197 199 211 223 227 229 233 239 241 251 257 263 269 271 277 281 283 293 307 311 313 317 331 337 347 349 353 359 367 373 379 383 389 397 401 409 419 421 431 433 439 443 449 457 461 463 467 479 487 491 499 503 509 521 523 541 2", "output": "918713851" }, { "input": "42\n1657 1871 2423 3037 5023 5099 5449 5701 6361 6619 7393 7489 8179 9743 9791 9907 12289 12457 13063 13933 14947 16141 16829 16943 17191 17863 20161 20947 21661 22727 23197 23201 23813 24023 24181 24223 24391 26479 28619 30529 32441 32611", "output": "468186759" } ]
1,649,887,716
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
20
326
21,196,800
import sys N, mod = 2 * 10 ** 5 + 1, 10 ** 9 + 7 add = lambda a, b: (a + b) % mod mult = lambda a, b: (a * b) % mod input = lambda: sys.stdin.buffer.readline().decode().strip() n, primes, ans, num = int(input()), [0] * N, 1, 1 for i in [int(x) for x in input().split()]: primes[i] += 1 for p in range(2, N): nprod = ans for j in range(1, primes[p] + 1): ans = mult(mult(pow(pow(p, j, mod), num, mod), nprod), ans) num = mult(num, primes[p] + 1) print(ans)
Title: Multipliers Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ayrat has number *n*, represented as it's prime factorization *p**i* of size *m*, i.e. *n*<==<=*p*1·*p*2·...·*p**m*. Ayrat got secret information that that the product of all divisors of *n* taken modulo 109<=+<=7 is the password to the secret data base. Now he wants to calculate this value. Input Specification: The first line of the input contains a single integer *m* (1<=≤<=*m*<=≤<=200<=000) — the number of primes in factorization of *n*. The second line contains *m* primes numbers *p**i* (2<=≤<=*p**i*<=≤<=200<=000). Output Specification: Print one integer — the product of all divisors of *n* modulo 109<=+<=7. Demo Input: ['2\n2 3\n', '3\n2 3 2\n'] Demo Output: ['36\n', '1728\n'] Note: In the first sample *n* = 2·3 = 6. The divisors of 6 are 1, 2, 3 and 6, their product is equal to 1·2·3·6 = 36. In the second sample 2·3·2 = 12. The divisors of 12 are 1, 2, 3, 4, 6 and 12. 1·2·3·4·6·12 = 1728.
```python import sys N, mod = 2 * 10 ** 5 + 1, 10 ** 9 + 7 add = lambda a, b: (a + b) % mod mult = lambda a, b: (a * b) % mod input = lambda: sys.stdin.buffer.readline().decode().strip() n, primes, ans, num = int(input()), [0] * N, 1, 1 for i in [int(x) for x in input().split()]: primes[i] += 1 for p in range(2, N): nprod = ans for j in range(1, primes[p] + 1): ans = mult(mult(pow(pow(p, j, mod), num, mod), nprod), ans) num = mult(num, primes[p] + 1) print(ans) ```
0
767
A
Snacktower
PROGRAMMING
1,100
[ "data structures", "implementation" ]
null
null
According to an old legeng, a long time ago Ankh-Morpork residents did something wrong to miss Fortune, and she cursed them. She said that at some time *n* snacks of distinct sizes will fall on the city, and the residents should build a Snacktower of them by placing snacks one on another. Of course, big snacks should be at the bottom of the tower, while small snacks should be at the top. Years passed, and once different snacks started to fall onto the city, and the residents began to build the Snacktower. However, they faced some troubles. Each day exactly one snack fell onto the city, but their order was strange. So, at some days the residents weren't able to put the new stack on the top of the Snacktower: they had to wait until all the bigger snacks fell. Of course, in order to not to anger miss Fortune again, the residents placed each snack on the top of the tower immediately as they could do it. Write a program that models the behavior of Ankh-Morpork residents.
The first line contains single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the total number of snacks. The second line contains *n* integers, the *i*-th of them equals the size of the snack which fell on the *i*-th day. Sizes are distinct integers from 1 to *n*.
Print *n* lines. On the *i*-th of them print the sizes of the snacks which the residents placed on the top of the Snacktower on the *i*-th day in the order they will do that. If no snack is placed on some day, leave the corresponding line empty.
[ "3\n3 1 2\n", "5\n4 5 1 2 3\n" ]
[ "3\n \n2 1", "5 4\n \n \n3 2 1\n" ]
In the example a snack of size 3 fell on the first day, and the residents immediately placed it. On the second day a snack of size 1 fell, and the residents weren't able to place it because they were missing the snack of size 2. On the third day a snack of size 2 fell, and the residents immediately placed it. Right after that they placed the snack of size 1 which had fallen before.
500
[ { "input": "3\n3 1 2", "output": "3 \n\n2 1 " }, { "input": "5\n4 5 1 2 3", "output": "5 4 \n\n\n3 2 1 " }, { "input": "1\n1", "output": "1 " }, { "input": "2\n1 2", "output": "2 1 " }, { "input": "10\n5 1 6 2 8 3 4 10 9 7", "output": "10 \n9 8 \n7 6 5 4 3 2 1 " }, { "input": "30\n16 10 4 29 5 28 12 21 11 30 18 6 14 3 17 22 20 15 9 1 27 19 24 26 13 25 2 23 8 7", "output": "30 29 28 \n\n\n\n\n\n\n\n\n\n\n27 \n\n\n26 \n\n25 24 \n\n23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 \n8 \n7 6 5 4 3 2 1 " }, { "input": "100\n98 52 63 2 18 96 31 58 84 40 41 45 66 100 46 71 26 48 81 20 73 91 68 76 13 93 17 29 64 95 79 21 55 75 19 85 54 51 89 78 15 87 43 59 36 1 90 35 65 56 62 28 86 5 82 49 3 99 33 9 92 32 74 69 27 22 77 16 44 94 34 6 57 70 23 12 61 25 8 11 67 47 83 88 10 14 30 7 97 60 42 37 24 38 53 50 4 80 72 39", "output": "100 \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n99 98 \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 \n\n\n\n\n\n\n\n\n80 79 78 77 76 75 74 73 \n72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 \n39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 " }, { "input": "2\n2 1", "output": "2 \n1 " } ]
1,628,259,119
2,147,483,647
Python 3
OK
TESTS
25
1,903
14,438,400
import bisect t = int(input()) s=list() arr=list(map(int,input().split())) for i in arr : if i == t : print(t,end=" ") t-=1 else : bisect.insort(s, i) while len(s)>0 and t == s[-1] : print(t,end=" ") s.pop() t-=1 print()
Title: Snacktower Time Limit: None seconds Memory Limit: None megabytes Problem Description: According to an old legeng, a long time ago Ankh-Morpork residents did something wrong to miss Fortune, and she cursed them. She said that at some time *n* snacks of distinct sizes will fall on the city, and the residents should build a Snacktower of them by placing snacks one on another. Of course, big snacks should be at the bottom of the tower, while small snacks should be at the top. Years passed, and once different snacks started to fall onto the city, and the residents began to build the Snacktower. However, they faced some troubles. Each day exactly one snack fell onto the city, but their order was strange. So, at some days the residents weren't able to put the new stack on the top of the Snacktower: they had to wait until all the bigger snacks fell. Of course, in order to not to anger miss Fortune again, the residents placed each snack on the top of the tower immediately as they could do it. Write a program that models the behavior of Ankh-Morpork residents. Input Specification: The first line contains single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the total number of snacks. The second line contains *n* integers, the *i*-th of them equals the size of the snack which fell on the *i*-th day. Sizes are distinct integers from 1 to *n*. Output Specification: Print *n* lines. On the *i*-th of them print the sizes of the snacks which the residents placed on the top of the Snacktower on the *i*-th day in the order they will do that. If no snack is placed on some day, leave the corresponding line empty. Demo Input: ['3\n3 1 2\n', '5\n4 5 1 2 3\n'] Demo Output: ['3\n\xa0\n2 1', '5 4\n\xa0\n\xa0\n3 2 1\n'] Note: In the example a snack of size 3 fell on the first day, and the residents immediately placed it. On the second day a snack of size 1 fell, and the residents weren't able to place it because they were missing the snack of size 2. On the third day a snack of size 2 fell, and the residents immediately placed it. Right after that they placed the snack of size 1 which had fallen before.
```python import bisect t = int(input()) s=list() arr=list(map(int,input().split())) for i in arr : if i == t : print(t,end=" ") t-=1 else : bisect.insort(s, i) while len(s)>0 and t == s[-1] : print(t,end=" ") s.pop() t-=1 print() ```
3
172
B
Pseudorandom Sequence Period
PROGRAMMING
1,200
[ "*special", "implementation", "number theory" ]
null
null
Polycarpus has recently got interested in sequences of pseudorandom numbers. He learned that many programming languages generate such sequences in a similar way: (for *i*<=≥<=1). Here *a*, *b*, *m* are constants, fixed for the given realization of the pseudorandom numbers generator, *r*0 is the so-called *randseed* (this value can be set from the program using functions like RandSeed(r) or srand(n)), and denotes the operation of taking the remainder of division. For example, if *a*<==<=2,<=*b*<==<=6,<=*m*<==<=12,<=*r*0<==<=11, the generated sequence will be: 4,<=2,<=10,<=2,<=10,<=2,<=10,<=2,<=10,<=2,<=10,<=.... Polycarpus realized that any such sequence will sooner or later form a cycle, but the cycle may occur not in the beginning, so there exist a preperiod and a period. The example above shows a preperiod equal to 1 and a period equal to 2. Your task is to find the period of a sequence defined by the given values of *a*,<=*b*,<=*m* and *r*0. Formally, you have to find such minimum positive integer *t*, for which exists such positive integer *k*, that for any *i*<=≥<=*k*: *r**i*<==<=*r**i*<=+<=*t*.
The single line of the input contains four integers *a*, *b*, *m* and *r*0 (1<=≤<=*m*<=≤<=105,<=0<=≤<=*a*,<=*b*<=≤<=1000,<=0<=≤<=*r*0<=&lt;<=*m*), separated by single spaces.
Print a single integer — the period of the sequence.
[ "2 6 12 11\n", "2 3 5 1\n", "3 6 81 9\n" ]
[ "2\n", "4\n", "1\n" ]
The first sample is described above. In the second sample the sequence is (starting from the first element): 0, 3, 4, 1, 0, 3, 4, 1, 0, ... In the third sample the sequence is (starting from the first element): 33, 24, 78, 78, 78, 78, ...
1,000
[ { "input": "2 6 12 11", "output": "2" }, { "input": "2 3 5 1", "output": "4" }, { "input": "3 6 81 9", "output": "1" }, { "input": "10 11 12 3", "output": "3" }, { "input": "4 4 5 4", "output": "2" }, { "input": "0 1 6 5", "output": "1" }, { "input": "1 0 7 3", "output": "1" }, { "input": "25 154 200 68", "output": "4" }, { "input": "0 0 1 0", "output": "1" }, { "input": "1 1 100000 0", "output": "100000" }, { "input": "73 778 36193 20163", "output": "1064" }, { "input": "65 101 43738 16242", "output": "3450" }, { "input": "177 329 83469 5951", "output": "9274" }, { "input": "452 53 51476 50033", "output": "3024" }, { "input": "900 209 34129 21607", "output": "4266" }, { "input": "137 936 79151 3907", "output": "79150" }, { "input": "687 509 56521 48466", "output": "3409" }, { "input": "977 461 14937 9343", "output": "2292" }, { "input": "545 541 43487 31725", "output": "43486" }, { "input": "550 5 88379 9433", "output": "44189" }, { "input": "173 105 24791 23343", "output": "5718" }, { "input": "239 695 50503 18287", "output": "25251" }, { "input": "397 24 21491 18004", "output": "21490" }, { "input": "887 265 55829 22027", "output": "55828" }, { "input": "821 163 39195 20770", "output": "660" }, { "input": "491 3 64907 3847", "output": "115" }, { "input": "503 233 5683 3462", "output": "1894" }, { "input": "367 701 18523 11701", "output": "882" }, { "input": "349 673 81953 56773", "output": "81952" }, { "input": "619 37 37223 877", "output": "18611" }, { "input": "643 863 77551 25943", "output": "38775" }, { "input": "937 859 7333 2141", "output": "7332" }, { "input": "271 761 99991 75353", "output": "49995" }, { "input": "1 1 10000 0", "output": "10000" }, { "input": "0 0 16709 12233", "output": "1" }, { "input": "0 1 55305 6822", "output": "1" }, { "input": "1 0 54062 35990", "output": "1" }, { "input": "0 0 23896 0", "output": "1" }, { "input": "0 1 53172 0", "output": "1" }, { "input": "1 0 54652 0", "output": "1" }, { "input": "6 0 99991 1", "output": "99990" }, { "input": "101 0 100000 1", "output": "1000" }, { "input": "2 0 99989 1", "output": "99988" }, { "input": "2 0 54539 1", "output": "54538" }, { "input": "3 0 42953 1", "output": "42952" }, { "input": "7 0 67129 1", "output": "67128" }, { "input": "2 0 89261 1", "output": "89260" }, { "input": "11 0 35311 1", "output": "35310" }, { "input": "0 0 2 0", "output": "1" }, { "input": "1 0 2 0", "output": "1" }, { "input": "0 1 2 0", "output": "1" }, { "input": "1 1 2 0", "output": "2" }, { "input": "0 0 2 1", "output": "1" }, { "input": "1 0 2 1", "output": "1" }, { "input": "0 1 2 1", "output": "1" }, { "input": "1 1 2 1", "output": "2" } ]
1,676,479,317
2,147,483,647
PyPy 3-64
OK
TESTS
56
186
10,342,400
a , b , m , r = map(int,input().split()) cache = {r : 0} index = 1 flag = True while flag : n = (a * r + b) % m if n in cache.keys() : print(index - cache[n]) flag = False exit() else: cache[n] = index index += 1 r = n
Title: Pseudorandom Sequence Period Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarpus has recently got interested in sequences of pseudorandom numbers. He learned that many programming languages generate such sequences in a similar way: (for *i*<=≥<=1). Here *a*, *b*, *m* are constants, fixed for the given realization of the pseudorandom numbers generator, *r*0 is the so-called *randseed* (this value can be set from the program using functions like RandSeed(r) or srand(n)), and denotes the operation of taking the remainder of division. For example, if *a*<==<=2,<=*b*<==<=6,<=*m*<==<=12,<=*r*0<==<=11, the generated sequence will be: 4,<=2,<=10,<=2,<=10,<=2,<=10,<=2,<=10,<=2,<=10,<=.... Polycarpus realized that any such sequence will sooner or later form a cycle, but the cycle may occur not in the beginning, so there exist a preperiod and a period. The example above shows a preperiod equal to 1 and a period equal to 2. Your task is to find the period of a sequence defined by the given values of *a*,<=*b*,<=*m* and *r*0. Formally, you have to find such minimum positive integer *t*, for which exists such positive integer *k*, that for any *i*<=≥<=*k*: *r**i*<==<=*r**i*<=+<=*t*. Input Specification: The single line of the input contains four integers *a*, *b*, *m* and *r*0 (1<=≤<=*m*<=≤<=105,<=0<=≤<=*a*,<=*b*<=≤<=1000,<=0<=≤<=*r*0<=&lt;<=*m*), separated by single spaces. Output Specification: Print a single integer — the period of the sequence. Demo Input: ['2 6 12 11\n', '2 3 5 1\n', '3 6 81 9\n'] Demo Output: ['2\n', '4\n', '1\n'] Note: The first sample is described above. In the second sample the sequence is (starting from the first element): 0, 3, 4, 1, 0, 3, 4, 1, 0, ... In the third sample the sequence is (starting from the first element): 33, 24, 78, 78, 78, 78, ...
```python a , b , m , r = map(int,input().split()) cache = {r : 0} index = 1 flag = True while flag : n = (a * r + b) % m if n in cache.keys() : print(index - cache[n]) flag = False exit() else: cache[n] = index index += 1 r = n ```
3
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,665,138,608
2,147,483,647
Python 3
OK
TESTS
30
92
0
s=input() x=0 y=0 for i in s: if i.islower(): y+=1 else: x+=1 if(x>y): for i in s: print(i.upper(),end="") else: for i in s: print(i.lower(),end="")
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python s=input() x=0 y=0 for i in s: if i.islower(): y+=1 else: x+=1 if(x>y): for i in s: print(i.upper(),end="") else: for i in s: print(i.lower(),end="") ```
3.977
387
B
George and Round
PROGRAMMING
1,200
[ "brute force", "greedy", "two pointers" ]
null
null
George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*. To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities. George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data. However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity.
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George.
Print a single integer — the answer to the problem.
[ "3 5\n1 2 3\n1 2 2 3 3\n", "3 5\n1 2 3\n1 1 1 1 1\n", "3 1\n2 3 4\n1\n" ]
[ "0\n", "2\n", "3\n" ]
In the first sample the set of the prepared problems meets the requirements for a good round. In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round. In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4.
1,000
[ { "input": "3 5\n1 2 3\n1 2 2 3 3", "output": "0" }, { "input": "3 5\n1 2 3\n1 1 1 1 1", "output": "2" }, { "input": "3 1\n2 3 4\n1", "output": "3" }, { "input": "29 100\n20 32 41 67 72 155 331 382 399 412 465 470 484 511 515 529 616 637 679 715 733 763 826 843 862 903 925 979 989\n15 15 15 17 18 19 19 20 21 21 22 24 25 26 26 27 28 31 32 32 37 38 38 39 39 40 41 42 43 43 45 45 46 47 49 49 50 50 50 51 52 53 53 55 56 57 59 59 59 60 60 62 62 63 63 64 64 64 66 67 69 69 70 70 72 72 73 74 75 76 77 78 80 80 81 81 83 83 83 84 86 86 86 86 87 88 89 91 91 91 92 93 94 94 96 97 97 97 98 98", "output": "24" } ]
1,597,299,303
2,147,483,647
PyPy 3
OK
TESTS
41
156
2,048,000
n, m = [int(i) for i in input().split()] a = [int(i) for i in input().split()] b = [int(i) for i in input().split()] a.sort() b.sort() i = 0 j = 0 while i < n and j < m: if a[i] <= b[j]: i += 1 j += 1 else: j += 1 if i == n: print(0) else: print(n - i)
Title: George and Round Time Limit: None seconds Memory Limit: None megabytes Problem Description: George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*. To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities. George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data. However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity. Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George. Output Specification: Print a single integer — the answer to the problem. Demo Input: ['3 5\n1 2 3\n1 2 2 3 3\n', '3 5\n1 2 3\n1 1 1 1 1\n', '3 1\n2 3 4\n1\n'] Demo Output: ['0\n', '2\n', '3\n'] Note: In the first sample the set of the prepared problems meets the requirements for a good round. In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round. In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4.
```python n, m = [int(i) for i in input().split()] a = [int(i) for i in input().split()] b = [int(i) for i in input().split()] a.sort() b.sort() i = 0 j = 0 while i < n and j < m: if a[i] <= b[j]: i += 1 j += 1 else: j += 1 if i == n: print(0) else: print(n - i) ```
3
770
A
New Password
PROGRAMMING
800
[ "*special", "implementation" ]
null
null
Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help. Innokentiy decides that new password should satisfy the following conditions: - the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct. Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions.
The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it. Pay attention that a desired new password always exists.
Print any password which satisfies all conditions given by Innokentiy.
[ "4 3\n", "6 6\n", "5 2\n" ]
[ "java\n", "python\n", "phphp\n" ]
In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it. In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters. In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it. Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests.
500
[ { "input": "4 3", "output": "abca" }, { "input": "6 6", "output": "abcdef" }, { "input": "5 2", "output": "ababa" }, { "input": "3 2", "output": "aba" }, { "input": "10 2", "output": "ababababab" }, { "input": "26 13", "output": "abcdefghijklmabcdefghijklm" }, { "input": "100 2", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababab" }, { "input": "100 10", "output": "abcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij" }, { "input": "3 3", "output": "abc" }, { "input": "6 3", "output": "abcabc" }, { "input": "10 3", "output": "abcabcabca" }, { "input": "50 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab" }, { "input": "90 2", "output": "ababababababababababababababababababababababababababababababababababababababababababababab" }, { "input": "6 2", "output": "ababab" }, { "input": "99 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabc" }, { "input": "4 2", "output": "abab" }, { "input": "100 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca" }, { "input": "40 22", "output": "abcdefghijklmnopqrstuvabcdefghijklmnopqr" }, { "input": "13 8", "output": "abcdefghabcde" }, { "input": "16 15", "output": "abcdefghijklmnoa" }, { "input": "17 17", "output": "abcdefghijklmnopq" }, { "input": "19 4", "output": "abcdabcdabcdabcdabc" }, { "input": "100 26", "output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv" }, { "input": "100 25", "output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxy" }, { "input": "26 26", "output": "abcdefghijklmnopqrstuvwxyz" }, { "input": "27 26", "output": "abcdefghijklmnopqrstuvwxyza" }, { "input": "2 2", "output": "ab" }, { "input": "26 25", "output": "abcdefghijklmnopqrstuvwxya" }, { "input": "99 2", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababa" }, { "input": "99 26", "output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstu" }, { "input": "4 4", "output": "abcd" }, { "input": "5 3", "output": "abcab" }, { "input": "5 4", "output": "abcda" }, { "input": "5 5", "output": "abcde" }, { "input": "24 22", "output": "abcdefghijklmnopqrstuvab" }, { "input": "26 14", "output": "abcdefghijklmnabcdefghijkl" }, { "input": "26 15", "output": "abcdefghijklmnoabcdefghijk" }, { "input": "30 12", "output": "abcdefghijklabcdefghijklabcdef" }, { "input": "35 4", "output": "abcdabcdabcdabcdabcdabcdabcdabcdabc" }, { "input": "79 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca" }, { "input": "79 14", "output": "abcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghi" }, { "input": "85 13", "output": "abcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefg" }, { "input": "90 25", "output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmno" }, { "input": "90 19", "output": "abcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmn" }, { "input": "26 24", "output": "abcdefghijklmnopqrstuvwxab" }, { "input": "100 17", "output": "abcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmno" }, { "input": "26 2", "output": "ababababababababababababab" } ]
1,603,885,797
2,147,483,647
Python 3
OK
TESTS
47
109
0
m="abcdefghijklmnopqrstuvwxyz" n,k = map(int, input().split()) z= m[:k] # print(z) # print(n//k) z=z*(n//k) print(z+z[:n-len(z)])
Title: New Password Time Limit: None seconds Memory Limit: None megabytes Problem Description: Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help. Innokentiy decides that new password should satisfy the following conditions: - the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct. Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions. Input Specification: The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it. Pay attention that a desired new password always exists. Output Specification: Print any password which satisfies all conditions given by Innokentiy. Demo Input: ['4 3\n', '6 6\n', '5 2\n'] Demo Output: ['java\n', 'python\n', 'phphp\n'] Note: In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it. In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters. In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it. Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests.
```python m="abcdefghijklmnopqrstuvwxyz" n,k = map(int, input().split()) z= m[:k] # print(z) # print(n//k) z=z*(n//k) print(z+z[:n-len(z)]) ```
3
1,000
B
Light It Up
PROGRAMMING
1,500
[ "greedy" ]
null
null
Recently, you bought a brand new smart lamp with programming features. At first, you set up a schedule to the lamp. Every day it will turn power on at moment $0$ and turn power off at moment $M$. Moreover, the lamp allows you to set a program of switching its state (states are "lights on" and "lights off"). Unfortunately, some program is already installed into the lamp. The lamp allows only good programs. Good program can be represented as a non-empty array $a$, where $0 &lt; a_1 &lt; a_2 &lt; \dots &lt; a_{|a|} &lt; M$. All $a_i$ must be integers. Of course, preinstalled program is a good program. The lamp follows program $a$ in next manner: at moment $0$ turns power and light on. Then at moment $a_i$ the lamp flips its state to opposite (if it was lit, it turns off, and vice versa). The state of the lamp flips instantly: for example, if you turn the light off at moment $1$ and then do nothing, the total time when the lamp is lit will be $1$. Finally, at moment $M$ the lamp is turning its power off regardless of its state. Since you are not among those people who read instructions, and you don't understand the language it's written in, you realize (after some testing) the only possible way to alter the preinstalled program. You can insert at most one element into the program $a$, so it still should be a good program after alteration. Insertion can be done between any pair of consecutive elements of $a$, or even at the begining or at the end of $a$. Find such a way to alter the program that the total time when the lamp is lit is maximum possible. Maybe you should leave program untouched. If the lamp is lit from $x$ till moment $y$, then its lit for $y - x$ units of time. Segments of time when the lamp is lit are summed up.
First line contains two space separated integers $n$ and $M$ ($1 \le n \le 10^5$, $2 \le M \le 10^9$) — the length of program $a$ and the moment when power turns off. Second line contains $n$ space separated integers $a_1, a_2, \dots, a_n$ ($0 &lt; a_1 &lt; a_2 &lt; \dots &lt; a_n &lt; M$) — initially installed program $a$.
Print the only integer — maximum possible total time when the lamp is lit.
[ "3 10\n4 6 7\n", "2 12\n1 10\n", "2 7\n3 4\n" ]
[ "8\n", "9\n", "6\n" ]
In the first example, one of possible optimal solutions is to insert value $x = 3$ before $a_1$, so program will be $[3, 4, 6, 7]$ and time of lamp being lit equals $(3 - 0) + (6 - 4) + (10 - 7) = 8$. Other possible solution is to insert $x = 5$ in appropriate place. In the second example, there is only one optimal solution: to insert $x = 2$ between $a_1$ and $a_2$. Program will become $[1, 2, 10]$, and answer will be $(1 - 0) + (10 - 2) = 9$. In the third example, optimal answer is to leave program untouched, so answer will be $(3 - 0) + (7 - 4) = 6$.
0
[ { "input": "3 10\n4 6 7", "output": "8" }, { "input": "2 12\n1 10", "output": "9" }, { "input": "2 7\n3 4", "output": "6" }, { "input": "1 2\n1", "output": "1" }, { "input": "5 10\n1 3 5 6 8", "output": "6" }, { "input": "7 1000000000\n1 10001 10011 20011 20021 40021 40031", "output": "999999969" }, { "input": "7 1000000000\n3 10001 10011 20011 20021 40021 40031", "output": "999999969" }, { "input": "1 10\n1", "output": "9" }, { "input": "1 10000000\n1", "output": "9999999" }, { "input": "1 8\n1", "output": "7" }, { "input": "7 17\n1 5 9 10 11 14 16", "output": "9" }, { "input": "4 17\n1 5 9 10", "output": "12" }, { "input": "5 12\n1 2 3 4 5", "output": "9" }, { "input": "2 1000000000\n100 111", "output": "999999989" }, { "input": "3 90591\n90579 90580 90581", "output": "90589" }, { "input": "5 16\n1 2 3 4 5", "output": "13" }, { "input": "6 981231233\n1 6 15 30 130 1875", "output": "981229468" }, { "input": "1 3\n1", "output": "2" }, { "input": "3 12\n4 7 11", "output": "8" }, { "input": "1 100000\n1", "output": "99999" }, { "input": "2 5\n1 3", "output": "3" }, { "input": "1 1000000000\n1", "output": "999999999" }, { "input": "1 1000000000\n999999999", "output": "999999999" }, { "input": "3 4\n1 2 3", "output": "2" }, { "input": "3 5\n1 2 3", "output": "3" }, { "input": "1 4\n2", "output": "3" }, { "input": "3 5\n1 3 4", "output": "3" }, { "input": "9 20\n5 9 11 12 14 15 16 17 19", "output": "12" }, { "input": "2 4\n1 2", "output": "3" }, { "input": "1 10\n2", "output": "9" }, { "input": "2 6\n2 4", "output": "4" }, { "input": "2 4\n1 3", "output": "2" }, { "input": "3 6\n1 2 4", "output": "4" }, { "input": "7 9863\n65 96 97 98 101 112 1115", "output": "9819" } ]
1,666,007,834
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
5
1,000
14,643,200
from copy import copy a,b=map(int,input().split()) a0=a c=list(map(int,input().split())) c0=copy(c) t=[] t1=c[0] if a%2==0: c.append(b) else: a0+=1 if a>1: for i in range(1,a,2): t1+=(c[i+1]-c[i]) t.append(t1) t1=0 for i in range(1,b): if a0%2==0: c.append(b) if i not in c: c.append(i) c.sort() t1=c[0] for j in range(1,a0,2): t1+=(c[j+1]-c[j]) t.append(t1) c=copy(c0) print(max(t))
Title: Light It Up Time Limit: None seconds Memory Limit: None megabytes Problem Description: Recently, you bought a brand new smart lamp with programming features. At first, you set up a schedule to the lamp. Every day it will turn power on at moment $0$ and turn power off at moment $M$. Moreover, the lamp allows you to set a program of switching its state (states are "lights on" and "lights off"). Unfortunately, some program is already installed into the lamp. The lamp allows only good programs. Good program can be represented as a non-empty array $a$, where $0 &lt; a_1 &lt; a_2 &lt; \dots &lt; a_{|a|} &lt; M$. All $a_i$ must be integers. Of course, preinstalled program is a good program. The lamp follows program $a$ in next manner: at moment $0$ turns power and light on. Then at moment $a_i$ the lamp flips its state to opposite (if it was lit, it turns off, and vice versa). The state of the lamp flips instantly: for example, if you turn the light off at moment $1$ and then do nothing, the total time when the lamp is lit will be $1$. Finally, at moment $M$ the lamp is turning its power off regardless of its state. Since you are not among those people who read instructions, and you don't understand the language it's written in, you realize (after some testing) the only possible way to alter the preinstalled program. You can insert at most one element into the program $a$, so it still should be a good program after alteration. Insertion can be done between any pair of consecutive elements of $a$, or even at the begining or at the end of $a$. Find such a way to alter the program that the total time when the lamp is lit is maximum possible. Maybe you should leave program untouched. If the lamp is lit from $x$ till moment $y$, then its lit for $y - x$ units of time. Segments of time when the lamp is lit are summed up. Input Specification: First line contains two space separated integers $n$ and $M$ ($1 \le n \le 10^5$, $2 \le M \le 10^9$) — the length of program $a$ and the moment when power turns off. Second line contains $n$ space separated integers $a_1, a_2, \dots, a_n$ ($0 &lt; a_1 &lt; a_2 &lt; \dots &lt; a_n &lt; M$) — initially installed program $a$. Output Specification: Print the only integer — maximum possible total time when the lamp is lit. Demo Input: ['3 10\n4 6 7\n', '2 12\n1 10\n', '2 7\n3 4\n'] Demo Output: ['8\n', '9\n', '6\n'] Note: In the first example, one of possible optimal solutions is to insert value $x = 3$ before $a_1$, so program will be $[3, 4, 6, 7]$ and time of lamp being lit equals $(3 - 0) + (6 - 4) + (10 - 7) = 8$. Other possible solution is to insert $x = 5$ in appropriate place. In the second example, there is only one optimal solution: to insert $x = 2$ between $a_1$ and $a_2$. Program will become $[1, 2, 10]$, and answer will be $(1 - 0) + (10 - 2) = 9$. In the third example, optimal answer is to leave program untouched, so answer will be $(3 - 0) + (7 - 4) = 6$.
```python from copy import copy a,b=map(int,input().split()) a0=a c=list(map(int,input().split())) c0=copy(c) t=[] t1=c[0] if a%2==0: c.append(b) else: a0+=1 if a>1: for i in range(1,a,2): t1+=(c[i+1]-c[i]) t.append(t1) t1=0 for i in range(1,b): if a0%2==0: c.append(b) if i not in c: c.append(i) c.sort() t1=c[0] for j in range(1,a0,2): t1+=(c[j+1]-c[j]) t.append(t1) c=copy(c0) print(max(t)) ```
0
840
A
Leha and Function
PROGRAMMING
1,300
[ "combinatorics", "greedy", "math", "number theory", "sortings" ]
null
null
Leha like all kinds of strange things. Recently he liked the function *F*(*n*,<=*k*). Consider all possible *k*-element subsets of the set [1,<=2,<=...,<=*n*]. For subset find minimal element in it. *F*(*n*,<=*k*) — mathematical expectation of the minimal element among all *k*-element subsets. But only function does not interest him. He wants to do interesting things with it. Mom brought him two arrays *A* and *B*, each consists of *m* integers. For all *i*,<=*j* such that 1<=≤<=*i*,<=*j*<=≤<=*m* the condition *A**i*<=≥<=*B**j* holds. Help Leha rearrange the numbers in the array *A* so that the sum is maximally possible, where *A*' is already rearranged array.
First line of input data contains single integer *m* (1<=≤<=*m*<=≤<=2·105) — length of arrays *A* and *B*. Next line contains *m* integers *a*1,<=*a*2,<=...,<=*a**m* (1<=≤<=*a**i*<=≤<=109) — array *A*. Next line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=109) — array *B*.
Output *m* integers *a*'1,<=*a*'2,<=...,<=*a*'*m* — array *A*' which is permutation of the array *A*.
[ "5\n7 3 5 3 4\n2 1 3 2 3\n", "7\n4 6 5 8 8 2 6\n2 1 2 2 1 1 2\n" ]
[ "4 7 3 5 3\n", "2 6 4 5 8 8 6\n" ]
none
500
[ { "input": "5\n7 3 5 3 4\n2 1 3 2 3", "output": "4 7 3 5 3" }, { "input": "7\n4 6 5 8 8 2 6\n2 1 2 2 1 1 2", "output": "2 6 4 5 8 8 6" } ]
1,587,947,813
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
108
307,200
from copy import copy m = int(input()) A = sorted([int(x) for x in input().split()], reverse=True) B = sorted([(int(x), i) for i, x in enumerate(input().split())]) ans = copy(A) for i, x in enumerate(A): ans[i] = A[B[i][1]] print(ans)
Title: Leha and Function Time Limit: None seconds Memory Limit: None megabytes Problem Description: Leha like all kinds of strange things. Recently he liked the function *F*(*n*,<=*k*). Consider all possible *k*-element subsets of the set [1,<=2,<=...,<=*n*]. For subset find minimal element in it. *F*(*n*,<=*k*) — mathematical expectation of the minimal element among all *k*-element subsets. But only function does not interest him. He wants to do interesting things with it. Mom brought him two arrays *A* and *B*, each consists of *m* integers. For all *i*,<=*j* such that 1<=≤<=*i*,<=*j*<=≤<=*m* the condition *A**i*<=≥<=*B**j* holds. Help Leha rearrange the numbers in the array *A* so that the sum is maximally possible, where *A*' is already rearranged array. Input Specification: First line of input data contains single integer *m* (1<=≤<=*m*<=≤<=2·105) — length of arrays *A* and *B*. Next line contains *m* integers *a*1,<=*a*2,<=...,<=*a**m* (1<=≤<=*a**i*<=≤<=109) — array *A*. Next line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=109) — array *B*. Output Specification: Output *m* integers *a*'1,<=*a*'2,<=...,<=*a*'*m* — array *A*' which is permutation of the array *A*. Demo Input: ['5\n7 3 5 3 4\n2 1 3 2 3\n', '7\n4 6 5 8 8 2 6\n2 1 2 2 1 1 2\n'] Demo Output: ['4 7 3 5 3\n', '2 6 4 5 8 8 6\n'] Note: none
```python from copy import copy m = int(input()) A = sorted([int(x) for x in input().split()], reverse=True) B = sorted([(int(x), i) for i, x in enumerate(input().split())]) ans = copy(A) for i, x in enumerate(A): ans[i] = A[B[i][1]] print(ans) ```
0
32
B
Borze
PROGRAMMING
800
[ "expression parsing", "implementation" ]
B. Borze
2
256
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output the decoded ternary number. It can have leading zeroes.
[ ".-.--\n", "--.\n", "-..-.--\n" ]
[ "012", "20", "1012" ]
none
1,000
[ { "input": ".-.--", "output": "012" }, { "input": "--.", "output": "20" }, { "input": "-..-.--", "output": "1012" }, { "input": "---..", "output": "210" }, { "input": "..--.---..", "output": "0020210" }, { "input": "-.....----.", "output": "10000220" }, { "input": ".", "output": "0" }, { "input": "-.", "output": "1" }, { "input": "--", "output": "2" }, { "input": "..", "output": "00" }, { "input": "--.", "output": "20" }, { "input": ".--.", "output": "020" }, { "input": ".-.-..", "output": "0110" }, { "input": "----.-.", "output": "2201" }, { "input": "-..--.-.", "output": "10201" }, { "input": "..--..--.", "output": "0020020" }, { "input": "-.-.---.--..-..-.-.-..-..-.--.", "output": "112120010111010120" }, { "input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.", "output": "21112220010101011012011011221011" }, { "input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------", "output": "11020111110111222212021020002022111100201121222020012022110010222" }, { "input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..", "output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110" }, { "input": ".-..-.-.---.-----.--.---...-.--.-.-....-..", "output": "01011212212021001201100010" }, { "input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..", "output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210" }, { "input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.", "output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220" }, { "input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----", "output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122" }, { "input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..", "output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110" }, { "input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.", "output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020" }, { "input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..", "output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200" }, { "input": "-.---...----...--.--...-.--.----", "output": "121002200020200012022" }, { "input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.", "output": "202020212012111010201021100001021221200011222112012201012220" } ]
1,589,823,239
2,147,483,647
PyPy 3
OK
TESTS
30
340
0
s = input() t = 0 p = "" while t<len(s): if s[t]==".": t+=1 p+="0" elif s[t] == "-" and s[t+1] == ".": p+="1" t+=2 elif s[t] == '-' and s[t+1] == "-": t +=2 p+="2" print(p)
Title: Borze Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet. Input Specification: The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes). Output Specification: Output the decoded ternary number. It can have leading zeroes. Demo Input: ['.-.--\n', '--.\n', '-..-.--\n'] Demo Output: ['012', '20', '1012'] Note: none
```python s = input() t = 0 p = "" while t<len(s): if s[t]==".": t+=1 p+="0" elif s[t] == "-" and s[t+1] == ".": p+="1" t+=2 elif s[t] == '-' and s[t+1] == "-": t +=2 p+="2" print(p) ```
3.915
387
B
George and Round
PROGRAMMING
1,200
[ "brute force", "greedy", "two pointers" ]
null
null
George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*. To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities. George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data. However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity.
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George.
Print a single integer — the answer to the problem.
[ "3 5\n1 2 3\n1 2 2 3 3\n", "3 5\n1 2 3\n1 1 1 1 1\n", "3 1\n2 3 4\n1\n" ]
[ "0\n", "2\n", "3\n" ]
In the first sample the set of the prepared problems meets the requirements for a good round. In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round. In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4.
1,000
[ { "input": "3 5\n1 2 3\n1 2 2 3 3", "output": "0" }, { "input": "3 5\n1 2 3\n1 1 1 1 1", "output": "2" }, { "input": "3 1\n2 3 4\n1", "output": "3" }, { "input": "29 100\n20 32 41 67 72 155 331 382 399 412 465 470 484 511 515 529 616 637 679 715 733 763 826 843 862 903 925 979 989\n15 15 15 17 18 19 19 20 21 21 22 24 25 26 26 27 28 31 32 32 37 38 38 39 39 40 41 42 43 43 45 45 46 47 49 49 50 50 50 51 52 53 53 55 56 57 59 59 59 60 60 62 62 63 63 64 64 64 66 67 69 69 70 70 72 72 73 74 75 76 77 78 80 80 81 81 83 83 83 84 86 86 86 86 87 88 89 91 91 91 92 93 94 94 96 97 97 97 98 98", "output": "24" } ]
1,599,927,458
2,147,483,647
Python 3
OK
TESTS
41
109
614,400
read=lambda:map(int,input().split()) n,m=read() a=list(read()) b=list(read()) i,j=0,0 while(i<n and j<m): if(a[i]<=b[j]): i+=1 j+=1 print(n-i)
Title: George and Round Time Limit: None seconds Memory Limit: None megabytes Problem Description: George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*. To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities. George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data. However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity. Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George. Output Specification: Print a single integer — the answer to the problem. Demo Input: ['3 5\n1 2 3\n1 2 2 3 3\n', '3 5\n1 2 3\n1 1 1 1 1\n', '3 1\n2 3 4\n1\n'] Demo Output: ['0\n', '2\n', '3\n'] Note: In the first sample the set of the prepared problems meets the requirements for a good round. In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round. In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4.
```python read=lambda:map(int,input().split()) n,m=read() a=list(read()) b=list(read()) i,j=0,0 while(i<n and j<m): if(a[i]<=b[j]): i+=1 j+=1 print(n-i) ```
3
370
A
Rook, Bishop and King
PROGRAMMING
1,100
[ "graphs", "math", "shortest paths" ]
null
null
Little Petya is learning to play chess. He has already learned how to move a king, a rook and a bishop. Let us remind you the rules of moving chess pieces. A chessboard is 64 square fields organized into an 8<=×<=8 table. A field is represented by a pair of integers (*r*,<=*c*) — the number of the row and the number of the column (in a classical game the columns are traditionally indexed by letters). Each chess piece takes up exactly one field. To make a move is to move a chess piece, the pieces move by the following rules: - A rook moves any number of fields horizontally or vertically. - A bishop moves any number of fields diagonally. - A king moves one field in any direction — horizontally, vertically or diagonally. Petya is thinking about the following problem: what minimum number of moves is needed for each of these pieces to move from field (*r*1,<=*c*1) to field (*r*2,<=*c*2)? At that, we assume that there are no more pieces besides this one on the board. Help him solve this problem.
The input contains four integers *r*1,<=*c*1,<=*r*2,<=*c*2 (1<=≤<=*r*1,<=*c*1,<=*r*2,<=*c*2<=≤<=8) — the coordinates of the starting and the final field. The starting field doesn't coincide with the final one. You can assume that the chessboard rows are numbered from top to bottom 1 through 8, and the columns are numbered from left to right 1 through 8.
Print three space-separated integers: the minimum number of moves the rook, the bishop and the king (in this order) is needed to move from field (*r*1,<=*c*1) to field (*r*2,<=*c*2). If a piece cannot make such a move, print a 0 instead of the corresponding number.
[ "4 3 1 6\n", "5 5 5 6\n" ]
[ "2 1 3\n", "1 0 1\n" ]
none
500
[ { "input": "4 3 1 6", "output": "2 1 3" }, { "input": "5 5 5 6", "output": "1 0 1" }, { "input": "1 1 8 8", "output": "2 1 7" }, { "input": "1 1 8 1", "output": "1 0 7" }, { "input": "1 1 1 8", "output": "1 0 7" }, { "input": "8 1 1 1", "output": "1 0 7" }, { "input": "8 1 1 8", "output": "2 1 7" }, { "input": "7 7 6 6", "output": "2 1 1" }, { "input": "8 1 8 8", "output": "1 0 7" }, { "input": "1 8 1 1", "output": "1 0 7" }, { "input": "1 8 8 1", "output": "2 1 7" }, { "input": "1 8 8 8", "output": "1 0 7" }, { "input": "8 8 1 1", "output": "2 1 7" }, { "input": "8 8 1 8", "output": "1 0 7" }, { "input": "8 8 8 1", "output": "1 0 7" }, { "input": "1 3 1 6", "output": "1 0 3" }, { "input": "1 3 1 4", "output": "1 0 1" }, { "input": "1 3 1 5", "output": "1 2 2" }, { "input": "3 3 2 4", "output": "2 1 1" }, { "input": "3 3 1 5", "output": "2 1 2" }, { "input": "1 6 2 1", "output": "2 2 5" }, { "input": "1 5 6 4", "output": "2 2 5" }, { "input": "1 3 3 7", "output": "2 2 4" }, { "input": "1 1 8 1", "output": "1 0 7" }, { "input": "1 7 5 4", "output": "2 0 4" }, { "input": "1 5 2 7", "output": "2 0 2" }, { "input": "1 4 6 2", "output": "2 0 5" }, { "input": "1 2 3 5", "output": "2 0 3" }, { "input": "1 8 8 7", "output": "2 2 7" }, { "input": "6 5 6 2", "output": "1 0 3" }, { "input": "6 3 3 5", "output": "2 0 3" }, { "input": "6 1 7 8", "output": "2 2 7" }, { "input": "1 2 3 2", "output": "1 2 2" }, { "input": "3 8 7 2", "output": "2 2 6" }, { "input": "4 2 6 4", "output": "2 1 2" }, { "input": "1 1 1 3", "output": "1 2 2" }, { "input": "6 8 8 6", "output": "2 1 2" }, { "input": "6 7 4 1", "output": "2 2 6" }, { "input": "6 5 1 4", "output": "2 2 5" }, { "input": "3 2 7 6", "output": "2 1 4" }, { "input": "3 8 4 1", "output": "2 2 7" }, { "input": "3 6 1 4", "output": "2 1 2" } ]
1,689,065,120
2,147,483,647
Python 3
COMPILATION_ERROR
TESTS
0
0
0
// Online C++ compiler to run C++ program online #include <iostream> using namespace std; int main() { int r1, c1, r2, c2; cin >> r1 >> c1 >> r2 >> c2; if (r1 == r2 || c1 == c2) cout << 1; else cout << 2; cout << " "; if ((r1 + c1) % 2 != (r2 + c2) % 2) cout << 0; else { if (r1 + c1 == r2 + c2 || r1 - c1 == r2 - c2) cout << 1; else cout << 2; } cout << " "; cout << max(abs(r1 - r2), abs(c1 - c2)) << endl; } # Tue Jul 11 2023 11:45:19 GMT+0300 (Moscow Standard Time)
Title: Rook, Bishop and King Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Petya is learning to play chess. He has already learned how to move a king, a rook and a bishop. Let us remind you the rules of moving chess pieces. A chessboard is 64 square fields organized into an 8<=×<=8 table. A field is represented by a pair of integers (*r*,<=*c*) — the number of the row and the number of the column (in a classical game the columns are traditionally indexed by letters). Each chess piece takes up exactly one field. To make a move is to move a chess piece, the pieces move by the following rules: - A rook moves any number of fields horizontally or vertically. - A bishop moves any number of fields diagonally. - A king moves one field in any direction — horizontally, vertically or diagonally. Petya is thinking about the following problem: what minimum number of moves is needed for each of these pieces to move from field (*r*1,<=*c*1) to field (*r*2,<=*c*2)? At that, we assume that there are no more pieces besides this one on the board. Help him solve this problem. Input Specification: The input contains four integers *r*1,<=*c*1,<=*r*2,<=*c*2 (1<=≤<=*r*1,<=*c*1,<=*r*2,<=*c*2<=≤<=8) — the coordinates of the starting and the final field. The starting field doesn't coincide with the final one. You can assume that the chessboard rows are numbered from top to bottom 1 through 8, and the columns are numbered from left to right 1 through 8. Output Specification: Print three space-separated integers: the minimum number of moves the rook, the bishop and the king (in this order) is needed to move from field (*r*1,<=*c*1) to field (*r*2,<=*c*2). If a piece cannot make such a move, print a 0 instead of the corresponding number. Demo Input: ['4 3 1 6\n', '5 5 5 6\n'] Demo Output: ['2 1 3\n', '1 0 1\n'] Note: none
```python // Online C++ compiler to run C++ program online #include <iostream> using namespace std; int main() { int r1, c1, r2, c2; cin >> r1 >> c1 >> r2 >> c2; if (r1 == r2 || c1 == c2) cout << 1; else cout << 2; cout << " "; if ((r1 + c1) % 2 != (r2 + c2) % 2) cout << 0; else { if (r1 + c1 == r2 + c2 || r1 - c1 == r2 - c2) cout << 1; else cout << 2; } cout << " "; cout << max(abs(r1 - r2), abs(c1 - c2)) << endl; } # Tue Jul 11 2023 11:45:19 GMT+0300 (Moscow Standard Time) ```
-1
26
A
Almost Prime
PROGRAMMING
900
[ "number theory" ]
A. Almost Prime
2
256
A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive.
Input contains one integer number *n* (1<=≤<=*n*<=≤<=3000).
Output the amount of almost prime numbers between 1 and *n*, inclusive.
[ "10\n", "21\n" ]
[ "2\n", "8\n" ]
none
500
[ { "input": "10", "output": "2" }, { "input": "21", "output": "8" }, { "input": "1", "output": "0" }, { "input": "2", "output": "0" }, { "input": "4", "output": "0" }, { "input": "3", "output": "0" }, { "input": "8", "output": "1" }, { "input": "19", "output": "6" }, { "input": "40", "output": "19" }, { "input": "77", "output": "41" }, { "input": "222", "output": "125" }, { "input": "987", "output": "501" }, { "input": "1000", "output": "508" }, { "input": "2000", "output": "958" }, { "input": "3000", "output": "1375" }, { "input": "2999", "output": "1375" }, { "input": "2998", "output": "1375" }, { "input": "2997", "output": "1374" }, { "input": "1429", "output": "706" }, { "input": "1673", "output": "808" }, { "input": "1500", "output": "732" }, { "input": "500", "output": "266" }, { "input": "856", "output": "439" } ]
1,597,156,358
2,147,483,647
Python 3
OK
TESTS
23
218
6,963,200
def sieve(): prime = [1] * 3005 prime[0] = prime[1] = 0 almostprime = [0]*3005 for i in range(2, 3001) : if prime[i] : j = 2*i while(j < 3001): prime[j] = 0 almostprime[j] += 1 j += i return almostprime almnostPrime = sieve() ans = 0 n = int(input()) for i in range(n+1): if almnostPrime[i] == 2: ans += 1 print(ans)
Title: Almost Prime Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive. Input Specification: Input contains one integer number *n* (1<=≤<=*n*<=≤<=3000). Output Specification: Output the amount of almost prime numbers between 1 and *n*, inclusive. Demo Input: ['10\n', '21\n'] Demo Output: ['2\n', '8\n'] Note: none
```python def sieve(): prime = [1] * 3005 prime[0] = prime[1] = 0 almostprime = [0]*3005 for i in range(2, 3001) : if prime[i] : j = 2*i while(j < 3001): prime[j] = 0 almostprime[j] += 1 j += i return almostprime almnostPrime = sieve() ans = 0 n = int(input()) for i in range(n+1): if almnostPrime[i] == 2: ans += 1 print(ans) ```
3.93253
784
A
Numbers Joke
PROGRAMMING
1,700
[ "*special" ]
null
null
The input contains a single integer *a* (1<=≤<=*a*<=≤<=30). Output a single integer.
The input contains a single integer *a* (1<=≤<=*a*<=≤<=30).
Output a single integer.
[ "3\n" ]
[ "27\n" ]
none
0
[ { "input": "3", "output": "27" }, { "input": "1", "output": "4" }, { "input": "2", "output": "22" }, { "input": "4", "output": "58" }, { "input": "5", "output": "85" }, { "input": "6", "output": "94" }, { "input": "7", "output": "121" }, { "input": "8", "output": "166" }, { "input": "9", "output": "202" }, { "input": "10", "output": "265" }, { "input": "11", "output": "274" }, { "input": "12", "output": "319" }, { "input": "13", "output": "346" }, { "input": "14", "output": "355" }, { "input": "15", "output": "378" }, { "input": "16", "output": "382" }, { "input": "17", "output": "391" }, { "input": "18", "output": "438" }, { "input": "19", "output": "454" }, { "input": "20", "output": "483" }, { "input": "21", "output": "517" }, { "input": "22", "output": "526" }, { "input": "23", "output": "535" }, { "input": "24", "output": "562" }, { "input": "25", "output": "576" }, { "input": "26", "output": "588" }, { "input": "27", "output": "627" }, { "input": "28", "output": "634" }, { "input": "29", "output": "636" }, { "input": "30", "output": "645" } ]
1,662,309,079
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
1
46
0
print(9 * int(input()))
Title: Numbers Joke Time Limit: None seconds Memory Limit: None megabytes Problem Description: The input contains a single integer *a* (1<=≤<=*a*<=≤<=30). Output a single integer. Input Specification: The input contains a single integer *a* (1<=≤<=*a*<=≤<=30). Output Specification: Output a single integer. Demo Input: ['3\n'] Demo Output: ['27\n'] Note: none
```python print(9 * int(input())) ```
0
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,686,921,881
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
60
0
def word(): s=str(input("Enter a word")) if len(s)>100 or len(s)<1: return count_lower=0 count_high=0 for i in s: if i.islower(): count_lower+=1 else: count_high+= 1 if count_lower>count_high: return s.lower() else: return s.upper() x=word() print(x)
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python def word(): s=str(input("Enter a word")) if len(s)>100 or len(s)<1: return count_lower=0 count_high=0 for i in s: if i.islower(): count_lower+=1 else: count_high+= 1 if count_lower>count_high: return s.lower() else: return s.upper() x=word() print(x) ```
0
467
A
George and Accommodation
PROGRAMMING
800
[ "implementation" ]
null
null
George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory. George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms. The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity.
Print a single integer — the number of rooms where George and Alex can move in.
[ "3\n1 1\n2 2\n3 3\n", "3\n1 10\n0 10\n10 10\n" ]
[ "0\n", "2\n" ]
none
500
[ { "input": "3\n1 1\n2 2\n3 3", "output": "0" }, { "input": "3\n1 10\n0 10\n10 10", "output": "2" }, { "input": "2\n36 67\n61 69", "output": "2" }, { "input": "3\n21 71\n10 88\n43 62", "output": "3" }, { "input": "3\n1 2\n2 3\n3 4", "output": "0" }, { "input": "10\n0 10\n0 20\n0 30\n0 40\n0 50\n0 60\n0 70\n0 80\n0 90\n0 100", "output": "10" }, { "input": "13\n14 16\n30 31\n45 46\n19 20\n15 17\n66 67\n75 76\n95 97\n29 30\n37 38\n0 2\n36 37\n8 9", "output": "4" }, { "input": "19\n66 67\n97 98\n89 91\n67 69\n67 68\n18 20\n72 74\n28 30\n91 92\n27 28\n75 77\n17 18\n74 75\n28 30\n16 18\n90 92\n9 11\n22 24\n52 54", "output": "12" }, { "input": "15\n55 57\n95 97\n57 59\n34 36\n50 52\n96 98\n39 40\n13 15\n13 14\n74 76\n47 48\n56 58\n24 25\n11 13\n67 68", "output": "10" }, { "input": "17\n68 69\n47 48\n30 31\n52 54\n41 43\n33 35\n38 40\n56 58\n45 46\n92 93\n73 74\n61 63\n65 66\n37 39\n67 68\n77 78\n28 30", "output": "8" }, { "input": "14\n64 66\n43 44\n10 12\n76 77\n11 12\n25 27\n87 88\n62 64\n39 41\n58 60\n10 11\n28 29\n57 58\n12 14", "output": "7" }, { "input": "38\n74 76\n52 54\n78 80\n48 49\n40 41\n64 65\n28 30\n6 8\n49 51\n68 70\n44 45\n57 59\n24 25\n46 48\n49 51\n4 6\n63 64\n76 78\n57 59\n18 20\n63 64\n71 73\n88 90\n21 22\n89 90\n65 66\n89 91\n96 98\n42 44\n1 1\n74 76\n72 74\n39 40\n75 76\n29 30\n48 49\n87 89\n27 28", "output": "22" }, { "input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "26\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2", "output": "0" }, { "input": "68\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2", "output": "68" }, { "input": "7\n0 1\n1 5\n2 4\n3 5\n4 6\n5 6\n6 8", "output": "5" }, { "input": "1\n0 0", "output": "0" }, { "input": "1\n100 100", "output": "0" }, { "input": "44\n0 8\n1 11\n2 19\n3 5\n4 29\n5 45\n6 6\n7 40\n8 19\n9 22\n10 18\n11 26\n12 46\n13 13\n14 27\n15 48\n16 25\n17 20\n18 29\n19 27\n20 45\n21 39\n22 29\n23 39\n24 42\n25 37\n26 52\n27 36\n28 43\n29 35\n30 38\n31 70\n32 47\n33 38\n34 61\n35 71\n36 51\n37 71\n38 59\n39 77\n40 70\n41 80\n42 77\n43 73", "output": "42" }, { "input": "3\n1 3\n2 7\n8 9", "output": "2" }, { "input": "53\n0 1\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53", "output": "0" }, { "input": "55\n0 0\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54", "output": "0" }, { "input": "51\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 62\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 82\n55 68\n55 70\n55 63\n55 55\n55 55\n55 55\n55 75\n55 75\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 82\n55 99\n55 60", "output": "12" }, { "input": "14\n1 1\n1 1\n1 55\n1 16\n1 1\n1 1\n1 55\n1 62\n1 53\n1 26\n1 1\n1 36\n1 2\n1 3", "output": "8" } ]
1,694,276,199
2,147,483,647
Python 3
OK
TESTS
27
46
0
c = 0 for s in [*open(0)][1:]: c += eval(s.replace(' ', '-'))<-1 print(c)
Title: George and Accommodation Time Limit: None seconds Memory Limit: None megabytes Problem Description: George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory. George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms. The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity. Output Specification: Print a single integer — the number of rooms where George and Alex can move in. Demo Input: ['3\n1 1\n2 2\n3 3\n', '3\n1 10\n0 10\n10 10\n'] Demo Output: ['0\n', '2\n'] Note: none
```python c = 0 for s in [*open(0)][1:]: c += eval(s.replace(' ', '-'))<-1 print(c) ```
3
112
A
Petya and Strings
PROGRAMMING
800
[ "implementation", "strings" ]
A. Petya and Strings
2
256
Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison.
Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters.
If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared.
[ "aaaa\naaaA\n", "abs\nAbz\n", "abcdefg\nAbCdEfF\n" ]
[ "0\n", "-1\n", "1\n" ]
If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site: - http://en.wikipedia.org/wiki/Lexicographical_order
500
[ { "input": "aaaa\naaaA", "output": "0" }, { "input": "abs\nAbz", "output": "-1" }, { "input": "abcdefg\nAbCdEfF", "output": "1" }, { "input": "asadasdasd\nasdwasdawd", "output": "-1" }, { "input": "aslkjlkasdd\nasdlkjdajwi", "output": "1" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "0" }, { "input": "aAaaaAAaAaaAzZsssSsdDfeEaeqZlpP\nAaaaAaaAaaAaZzSSSSsDdFeeAeQZLpp", "output": "0" }, { "input": "bwuEhEveouaTECagLZiqmUdxEmhRSOzMauJRWLQMppZOumxhAmwuGeDIkvkBLvMXwUoFmpAfDprBcFtEwOULcZWRQhcTbTbX\nHhoDWbcxwiMnCNexOsKsujLiSGcLllXOkRSbnOzThAjnnliLYFFmsYkOfpTxRNEfBsoUHfoLTiqAINRPxWRqrTJhgfkKcDOH", "output": "-1" }, { "input": "kGWUuguKzcvxqKTNpxeDWXpXkrXDvGMFGoXKDfPBZvWSDUyIYBynbKOUonHvmZaKeirUhfmVRKtGhAdBfKMWXDUoqvbfpfHYcg\ncvOULleuIIiYVVxcLZmHVpNGXuEpzcWZZWyMOwIwbpkKPwCfkVbKkUuosvxYCKjqfVmHfJKbdrsAcatPYgrCABaFcoBuOmMfFt", "output": "1" }, { "input": "nCeNVIzHqPceNhjHeHvJvgBsNFiXBATRrjSTXJzhLMDMxiJztphxBRlDlqwDFImWeEPkggZCXSRwelOdpNrYnTepiOqpvkr\nHJbjJFtlvNxIbkKlxQUwmZHJFVNMwPAPDRslIoXISBYHHfymyIaQHLgECPxAmqnOCizwXnIUBRmpYUBVPenoUKhCobKdOjL", "output": "1" }, { "input": "ttXjenUAlfixytHEOrPkgXmkKTSGYuyVXGIHYmWWYGlBYpHkujueqBSgjLguSgiMGJWATIGEUjjAjKXdMiVbHozZUmqQtFrT\nJziDBFBDmDJCcGqFsQwDFBYdOidLxxhBCtScznnDgnsiStlWFnEXQrJxqTXKPxZyIGfLIToETKWZBPUIBmLeImrlSBWCkTNo", "output": "1" }, { "input": "AjQhPqSVhwQQjcgCycjKorWBgFCRuQBwgdVuAPSMJAvTyxGVuFHjfJzkKfsmfhFbKqFrFIohSZBbpjgEHebezmVlGLTPSCTMf\nXhxWuSnMmKFrCUOwkTUmvKAfbTbHWzzOTzxJatLLCdlGnHVaBUnxDlsqpvjLHMThOPAFBggVKDyKBrZAmjnjrhHlrnSkyzBja", "output": "-1" }, { "input": "HCIgYtnqcMyjVngziNflxKHtdTmcRJhzMAjFAsNdWXFJYEhiTzsQUtFNkAbdrFBRmvLirkuirqTDvIpEfyiIqkrwsjvpPWTEdI\nErqiiWKsmIjyZuzgTlTqxYZwlrpvRyaVhRTOYUqtPMVGGtWOkDCOOQRKrkkRzPftyQCkYkzKkzTPqqXmeZhvvEEiEhkdOmoMvy", "output": "1" }, { "input": "mtBeJYILXcECGyEVSyzLFdQJbiVnnfkbsYYsdUJSIRmyzLfTTtFwIBmRLVnwcewIqcuydkcLpflHAFyDaToLiFMgeHvQorTVbI\nClLvyejznjbRfCDcrCzkLvqQaGzTjwmWONBdCctJAPJBcQrcYvHaSLQgPIJbmkFBhFzuQLBiRzAdNHulCjIAkBvZxxlkdzUWLR", "output": "1" }, { "input": "tjucSbGESVmVridTBjTmpVBCwwdWKBPeBvmgdxgIVLwQxveETnSdxkTVJpXoperWSgdpPMKNmwDiGeHfxnuqaDissgXPlMuNZIr\nHfjOOJhomqNIKHvqSgfySjlsWJQBuWYwhLQhlZYlpZwboMpoLoluGsBmhhlYgeIouwdkPfiaAIrkYRlxtiFazOPOllPsNZHcIZd", "output": "1" }, { "input": "AanbDfbZNlUodtBQlvPMyomStKNhgvSGhSbTdabxGFGGXCdpsJDimsAykKjfBDPMulkhBMsqLmVKLDoesHZsRAEEdEzqigueXInY\ncwfyjoppiJNrjrOLNZkqcGimrpTsiyFBVgMWEPXsMrxLJDDbtYzerXiFGuLBcQYitLdqhGHBpdjRnkUegmnwhGHAKXGyFtscWDSI", "output": "-1" }, { "input": "HRfxniwuJCaHOcaOVgjOGHXKrwxrDQxJpppeGDXnTAowyKbCsCQPbchCKeTWOcKbySSYnoaTJDnmRcyGPbfXJyZoPcARHBu\nxkLXvwkvGIWSQaFTznLOctUXNuzzBBOlqvzmVfTSejekTAlwidRrsxkbZTsGGeEWxCXHzqWVuLGoCyrGjKkQoHqduXwYQKC", "output": "-1" }, { "input": "OjYwwNuPESIazoyLFREpObIaMKhCaKAMWMfRGgucEuyNYRantwdwQkmflzfqbcFRaXBnZoIUGsFqXZHGKwlaBUXABBcQEWWPvkjW\nRxLqGcTTpBwHrHltCOllnTpRKLDofBUqqHxnOtVWPgvGaeHIevgUSOeeDOJubfqonFpVNGVbHFcAhjnyFvrrqnRgKhkYqQZmRfUl", "output": "-1" }, { "input": "tatuhQPIzjptlzzJpCAPXSRTKZRlwgfoCIsFjJquRoIDyZZYRSPdFUTjjUPhLBBfeEIfLQpygKXRcyQFiQsEtRtLnZErBqW\ntkHUjllbafLUWhVCnvblKjgYIEoHhsjVmrDBmAWbvtkHxDbRFvsXAjHIrujaDbYwOZmacknhZPeCcorbRgHjjgAgoJdjvLo", "output": "-1" }, { "input": "cymCPGqdXKUdADEWDdUaLEEMHiXHsdAZuDnJDMUvxvrLRBrPSDpXPAgMRoGplLtniFRTomDTAHXWAdgUveTxaqKVSvnOyhOwiRN\nuhmyEWzapiRNPFDisvHTbenXMfeZaHqOFlKjrfQjUBwdFktNpeiRoDWuBftZLcCZZAVfioOihZVNqiNCNDIsUdIhvbcaxpTRWoV", "output": "-1" }, { "input": "sSvpcITJAwghVfJaLKBmyjOkhltTGjYJVLWCYMFUomiJaKQYhXTajvZVHIMHbyckYROGQZzjWyWCcnmDmrkvTKfHSSzCIhsXgEZa\nvhCXkCwAmErGVBPBAnkSYEYvseFKbWSktoqaHYXUmYkHfOkRwuEyBRoGoBrOXBKVxXycjZGStuvDarnXMbZLWrbjrisDoJBdSvWJ", "output": "-1" }, { "input": "hJDANKUNBisOOINDsTixJmYgHNogtpwswwcvVMptfGwIjvqgwTYFcqTdyAqaqlnhOCMtsnWXQqtjFwQlEcBtMFAtSqnqthVb\nrNquIcjNWESjpPVWmzUJFrelpUZeGDmSvCurCqVmKHKVAAPkaHksniOlzjiKYIJtvbuQWZRufMebpTFPqyxIWWjfPaWYiNlK", "output": "-1" }, { "input": "ycLoapxsfsDTHMSfAAPIUpiEhQKUIXUcXEiopMBuuZLHtfPpLmCHwNMNQUwsEXxCEmKHTBSnKhtQhGWUvppUFZUgSpbeChX\ndCZhgVXofkGousCzObxZSJwXcHIaqUDSCPKzXntcVmPxtNcXmVcjsetZYxedmgQzXTZHMvzjoaXCMKsncGciSDqQWIIRlys", "output": "1" }, { "input": "nvUbnrywIePXcoukIhwTfUVcHUEgXcsMyNQhmMlTltZiCooyZiIKRIGVHMCnTKgzXXIuvoNDEZswKoACOBGSyVNqTNQqMhAG\nplxuGSsyyJjdvpddrSebOARSAYcZKEaKjqbCwvjhNykuaECoQVHTVFMKXwvrQXRaqXsHsBaGVhCxGRxNyGUbMlxOarMZNXxy", "output": "-1" }, { "input": "EncmXtAblQzcVRzMQqdDqXfAhXbtJKQwZVWyHoWUckohnZqfoCmNJDzexFgFJYrwNHGgzCJTzQQFnxGlhmvQTpicTkEeVICKac\nNIUNZoMLFMyAjVgQLITELJSodIXcGSDWfhFypRoGYuogJpnqGTotWxVqpvBHjFOWcDRDtARsaHarHaOkeNWEHGTaGOFCOFEwvK", "output": "-1" }, { "input": "UG\nak", "output": "1" }, { "input": "JZR\nVae", "output": "-1" }, { "input": "a\nZ", "output": "-1" }, { "input": "rk\nkv", "output": "1" }, { "input": "RvuT\nbJzE", "output": "1" }, { "input": "PPS\nydq", "output": "-1" }, { "input": "q\nq", "output": "0" }, { "input": "peOw\nIgSJ", "output": "1" }, { "input": "PyK\noKN", "output": "1" }, { "input": "O\ni", "output": "1" }, { "input": "NmGY\npDlP", "output": "-1" }, { "input": "nG\nZf", "output": "-1" }, { "input": "m\na", "output": "1" }, { "input": "MWyB\nWZEV", "output": "-1" }, { "input": "Gre\nfxc", "output": "1" }, { "input": "Ooq\nwap", "output": "-1" }, { "input": "XId\nlbB", "output": "1" }, { "input": "lfFpECEqUMEOJhipvkZjDPcpDNJedOVXiSMgBvBZbtfzIKekcvpWPCazKAhJyHircRtgcBIJwwstpHaLAgxFOngAWUZRgCef\nLfFPEcequmeojHIpVkzjDPcpdNJEDOVXiSmGBVBZBtfZikEKcvPwpCAzKAHJyHIrCRTgCbIJWwSTphALagXfOnGAwUzRGcEF", "output": "0" }, { "input": "DQBdtSEDtFGiNRUeJNbOIfDZnsryUlzJHGTXGFXnwsVyxNtLgmklmFvRCzYETBVdmkpJJIvIOkMDgCFHZOTODiYrkwXd\nDQbDtsEdTFginRUEJNBOIfdZnsryulZJHGtxGFxnwSvYxnTLgmKlmFVRCzyEtBVdmKpJjiVioKMDgCFhzoTODiYrKwXD", "output": "0" }, { "input": "tYWRijFQSzHBpCjUzqBtNvBKyzZRnIdWEuyqnORBQTLyOQglIGfYJIRjuxnbLvkqZakNqPiGDvgpWYkfxYNXsdoKXZtRkSasfa\nTYwRiJfqsZHBPcJuZQBTnVbkyZZRnidwEuYQnorbQTLYOqGligFyjirJUxnblVKqZaknQpigDVGPwyKfxyNXSDoKxztRKSaSFA", "output": "0" }, { "input": "KhScXYiErQIUtmVhNTCXSLAviefIeHIIdiGhsYnPkSBaDTvMkyanfMLBOvDWgRybLtDqvXVdVjccNunDyijhhZEAKBrdz\nkHsCXyiErqIuTMVHNTCxSLaViEFIEhIIDiGHsYNpKsBAdTvMKyANFMLBovdwGRYbLtdQVxvDVJCcNUndYiJHhzeakBrdZ", "output": "0" }, { "input": "cpPQMpjRQJKQVXjWDYECXbagSmNcVfOuBWNZxihdERraVuiOpSVDCPgTGuSQALNoVjySceHcKXwOEpSzXrEqWwwrYeppNiWhDVg\nCPPqmPjRqJkQvxJwdyECXBAGsMNcVfOuBWNzxIhderRavUiOpSvDCpGTgusqAlNovjyScEhCKXwoePSZxrEQwWwryEPPniWHDvG", "output": "0" }, { "input": "SajcCGMepaLjZIWLRBGFcrZRCRvvoCsIyKsQerbrwsIamxxpRmQSZSalasJLVFbCHCuXJlubciQAvLxXYBazLsMKLHLdDQ\nsaJcCgmEpaLJziWlrBgFcRzrCrVVOcSIykSQerBrwSIamxxPrMqSzSalASjLVFbChCUxjLUbCIQAVlxxybAZLsmkLhLDdQ", "output": "0" }, { "input": "kigPrWNTOUNDBskAfefjhHYZNYdnfZWuXWzHiBxFQryBbAkPtenFwWvCSTYGpzOntUNzNUhxRWjKmicTwLwJAnbAxj\nkigpRWntOUNdBsKaFEFjhhYZnYDNfzWuXwZhibxFQRybbakPteNfwwvcStyGPzoNTunznuHXrWjKMIctWLWJANBAxJ", "output": "0" }, { "input": "nTomZZuTTRTAAPoUsySVFGElrpQRNLjqvFmcYytiheQnjUhPLnqNBiYtQkljbcvmjuNAVKbvQOWpqqFlQhAhULIhquoCnjUI\nntOmzZuttrtAAPOUSySVFgeLRPQrNLjQvfmCyYTiHEQnjuHPlNQNbIYtqKLJBCVmjunavkbvQOWPQQFlqHaHULIHQuOcnJUi", "output": "0" }, { "input": "abac\nadaa", "output": "-1" }, { "input": "Bbc\nabc", "output": "1" }, { "input": "aaaba\naaaab", "output": "1" } ]
1,695,259,265
2,147,483,647
Python 3
OK
TESTS
53
92
0
m=input().upper() n=input().upper() if m<n: print(-1) elif m>n: print(1) else: print(0)
Title: Petya and Strings Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison. Input Specification: Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters. Output Specification: If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared. Demo Input: ['aaaa\naaaA\n', 'abs\nAbz\n', 'abcdefg\nAbCdEfF\n'] Demo Output: ['0\n', '-1\n', '1\n'] Note: If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site: - http://en.wikipedia.org/wiki/Lexicographical_order
```python m=input().upper() n=input().upper() if m<n: print(-1) elif m>n: print(1) else: print(0) ```
3.977
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,640,251,687
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
62
0
a=input() counter=0 k=0 for i in range(len(a)): if a[i]==a[i].lower: counter+=1 else: k+=1 if counter<k or counter==k: print(a.lower()) else: print(a.upper())
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python a=input() counter=0 k=0 for i in range(len(a)): if a[i]==a[i].lower: counter+=1 else: k+=1 if counter<k or counter==k: print(a.lower()) else: print(a.upper()) ```
0
380
C
Sereja and Brackets
PROGRAMMING
2,000
[ "data structures", "schedules" ]
null
null
Sereja has a bracket sequence *s*1,<=*s*2,<=...,<=*s**n*, or, in other words, a string *s* of length *n*, consisting of characters "(" and ")". Sereja needs to answer *m* queries, each of them is described by two integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). The answer to the *i*-th query is the length of the maximum correct bracket subsequence of sequence *s**l**i*,<=*s**l**i*<=+<=1,<=...,<=*s**r**i*. Help Sereja answer all queries. You can find the definitions for a subsequence and a correct bracket sequence in the notes.
The first line contains a sequence of characters *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*n*<=≤<=106) without any spaces. Each character is either a "(" or a ")". The second line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains a pair of integers. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) — the description of the *i*-th query.
Print the answer to each question on a single line. Print the answers in the order they go in the input.
[ "())(())(())(\n7\n1 1\n2 3\n1 2\n1 12\n8 12\n5 11\n2 10\n" ]
[ "0\n0\n2\n10\n4\n6\n6\n" ]
A subsequence of length |*x*| of string *s* = *s*<sub class="lower-index">1</sub>*s*<sub class="lower-index">2</sub>... *s*<sub class="lower-index">|*s*|</sub> (where |*s*| is the length of string *s*) is string *x* = *s*<sub class="lower-index">*k*<sub class="lower-index">1</sub></sub>*s*<sub class="lower-index">*k*<sub class="lower-index">2</sub></sub>... *s*<sub class="lower-index">*k*<sub class="lower-index">|*x*|</sub></sub> (1 ≤ *k*<sub class="lower-index">1</sub> &lt; *k*<sub class="lower-index">2</sub> &lt; ... &lt; *k*<sub class="lower-index">|*x*|</sub> ≤ |*s*|). A correct bracket sequence is a bracket sequence that can be transformed into a correct aryphmetic expression by inserting characters "1" and "+" between the characters of the string. For example, bracket sequences "()()", "(())" are correct (the resulting expressions "(1)+(1)", "((1+1)+1)"), and ")(" and "(" are not. For the third query required sequence will be «()». For the fourth query required sequence will be «()(())(())».
1,500
[ { "input": "())(())(())(\n7\n1 1\n2 3\n1 2\n1 12\n8 12\n5 11\n2 10", "output": "0\n0\n2\n10\n4\n6\n6" }, { "input": "(((((()((((((((((()((()(((((\n1\n8 15", "output": "0" }, { "input": "((()((())(((((((((()(()(()(((((((((((((((()(()((((((((((((((()(((((((((((((((((((()(((\n39\n28 56\n39 46\n57 63\n29 48\n51 75\n14 72\n5 70\n51 73\n10 64\n31 56\n50 54\n15 78\n78 82\n1 11\n1 70\n1 19\n10 22\n13 36\n3 10\n34 40\n51 76\n64 71\n36 75\n24 71\n1 63\n5 14\n46 67\n32 56\n39 43\n43 56\n61 82\n2 78\n1 21\n10 72\n49 79\n12 14\n53 79\n15 31\n7 47", "output": "4\n4\n2\n4\n2\n12\n16\n2\n12\n4\n0\n12\n0\n6\n18\n6\n2\n6\n6\n0\n2\n0\n6\n8\n18\n4\n2\n4\n2\n2\n2\n18\n8\n12\n2\n0\n2\n6\n12" }, { "input": "))(()))))())())))))())((()()))))()))))))))))))\n9\n26 42\n21 22\n6 22\n7 26\n43 46\n25 27\n32 39\n22 40\n2 45", "output": "4\n0\n6\n8\n0\n2\n2\n10\n20" }, { "input": "(()((((()(())((((((((()((((((()((((\n71\n15 29\n17 18\n5 26\n7 10\n16 31\n26 35\n2 30\n16 24\n2 24\n7 12\n15 18\n12 13\n25 30\n1 30\n12 13\n16 20\n6 35\n20 28\n18 23\n9 31\n12 35\n14 17\n8 16\n3 10\n12 33\n7 19\n2 33\n7 17\n21 27\n10 30\n29 32\n9 28\n18 32\n28 31\n31 33\n4 26\n15 27\n10 17\n8 14\n11 28\n8 23\n17 33\n4 14\n3 6\n6 34\n19 23\n4 21\n16 27\n14 27\n6 19\n31 32\n29 32\n9 17\n1 21\n2 31\n18 29\n16 26\n15 18\n4 5\n13 20\n9 28\n18 30\n1 32\n2 9\n16 24\n1 20\n4 15\n16 23\n19 34\n5 22\n5 23", "output": "2\n0\n8\n2\n4\n2\n10\n2\n10\n4\n0\n0\n0\n10\n0\n0\n10\n2\n2\n8\n4\n0\n6\n2\n4\n6\n12\n6\n2\n6\n2\n6\n4\n2\n0\n8\n2\n4\n6\n4\n8\n4\n6\n0\n10\n2\n6\n2\n2\n6\n0\n2\n4\n8\n12\n2\n2\n0\n0\n0\n6\n2\n12\n4\n2\n8\n6\n2\n4\n6\n8" }, { "input": "(((())((((()()((((((()((()(((((((((((()((\n6\n20 37\n28 32\n12 18\n7 25\n21 33\n4 5", "output": "4\n0\n2\n6\n4\n2" }, { "input": "(((()((((()()()(()))((((()(((()))()((((()))()((())\n24\n37 41\n13 38\n31 34\n14 16\n29 29\n12 46\n1 26\n15 34\n8 47\n11 23\n6 32\n2 22\n9 27\n17 40\n6 15\n4 49\n12 33\n3 48\n22 47\n19 48\n10 27\n23 25\n4 44\n27 48", "output": "2\n16\n0\n2\n0\n26\n16\n12\n30\n8\n18\n14\n14\n12\n6\n34\n16\n32\n18\n18\n12\n0\n30\n16" }, { "input": ")()((((((((((((((((()(((()()(()((((((()(((((((()()))((((())(((((((((()(((((((((\n51\n29 53\n31 69\n54 59\n3 52\n26 46\n14 62\n6 54\n39 56\n17 27\n46 74\n60 72\n18 26\n38 46\n4 27\n22 52\n44 49\n42 77\n2 20\n39 57\n61 70\n33 54\n10 30\n67 70\n46 66\n17 77\n5 52\n33 77\n26 32\n1 72\n40 78\n38 68\n19 47\n30 53\n19 29\n52 71\n1 11\n22 53\n17 42\n2 51\n4 12\n24 76\n22 34\n21 69\n11 69\n36 52\n17 31\n57 58\n54 62\n23 71\n5 46\n51 53", "output": "12\n14\n4\n18\n6\n22\n18\n8\n4\n12\n2\n4\n2\n4\n16\n2\n14\n2\n8\n2\n10\n6\n2\n10\n24\n18\n16\n4\n26\n14\n14\n10\n12\n6\n6\n2\n16\n10\n18\n0\n22\n6\n20\n22\n10\n8\n2\n4\n22\n10\n0" }, { "input": "(\n1\n1 1", "output": "0" }, { "input": ")\n1\n1 1", "output": "0" }, { "input": "()\n1\n1 2", "output": "2" }, { "input": ")(\n1\n1 2", "output": "0" } ]
1,699,740,064
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
30
0
s = input() n = len(s) cumulative_sum = [0] * n # Precompute the cumulative sum of matching parentheses for i in range(1, n): if s[i] == ')' and s[i - 1] == '(': cumulative_sum[i] = cumulative_sum[i - 2] + 2 if i >= 2 else 2 else: cumulative_sum[i] = cumulative_sum[i - 1] for _ in range(int(input())): l, r = map(int, input().split()) total_sum = cumulative_sum[r - 1] - cumulative_sum[l - 2] if l > 1 else cumulative_sum[r - 1] print(total_sum)
Title: Sereja and Brackets Time Limit: None seconds Memory Limit: None megabytes Problem Description: Sereja has a bracket sequence *s*1,<=*s*2,<=...,<=*s**n*, or, in other words, a string *s* of length *n*, consisting of characters "(" and ")". Sereja needs to answer *m* queries, each of them is described by two integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). The answer to the *i*-th query is the length of the maximum correct bracket subsequence of sequence *s**l**i*,<=*s**l**i*<=+<=1,<=...,<=*s**r**i*. Help Sereja answer all queries. You can find the definitions for a subsequence and a correct bracket sequence in the notes. Input Specification: The first line contains a sequence of characters *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*n*<=≤<=106) without any spaces. Each character is either a "(" or a ")". The second line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains a pair of integers. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) — the description of the *i*-th query. Output Specification: Print the answer to each question on a single line. Print the answers in the order they go in the input. Demo Input: ['())(())(())(\n7\n1 1\n2 3\n1 2\n1 12\n8 12\n5 11\n2 10\n'] Demo Output: ['0\n0\n2\n10\n4\n6\n6\n'] Note: A subsequence of length |*x*| of string *s* = *s*<sub class="lower-index">1</sub>*s*<sub class="lower-index">2</sub>... *s*<sub class="lower-index">|*s*|</sub> (where |*s*| is the length of string *s*) is string *x* = *s*<sub class="lower-index">*k*<sub class="lower-index">1</sub></sub>*s*<sub class="lower-index">*k*<sub class="lower-index">2</sub></sub>... *s*<sub class="lower-index">*k*<sub class="lower-index">|*x*|</sub></sub> (1 ≤ *k*<sub class="lower-index">1</sub> &lt; *k*<sub class="lower-index">2</sub> &lt; ... &lt; *k*<sub class="lower-index">|*x*|</sub> ≤ |*s*|). A correct bracket sequence is a bracket sequence that can be transformed into a correct aryphmetic expression by inserting characters "1" and "+" between the characters of the string. For example, bracket sequences "()()", "(())" are correct (the resulting expressions "(1)+(1)", "((1+1)+1)"), and ")(" and "(" are not. For the third query required sequence will be «()». For the fourth query required sequence will be «()(())(())».
```python s = input() n = len(s) cumulative_sum = [0] * n # Precompute the cumulative sum of matching parentheses for i in range(1, n): if s[i] == ')' and s[i - 1] == '(': cumulative_sum[i] = cumulative_sum[i - 2] + 2 if i >= 2 else 2 else: cumulative_sum[i] = cumulative_sum[i - 1] for _ in range(int(input())): l, r = map(int, input().split()) total_sum = cumulative_sum[r - 1] - cumulative_sum[l - 2] if l > 1 else cumulative_sum[r - 1] print(total_sum) ```
0
758
A
Holiday Of Equality
PROGRAMMING
800
[ "implementation", "math" ]
null
null
In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury. Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland). You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them.
The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen.
In the only line print the integer *S* — the minimum number of burles which are had to spend.
[ "5\n0 1 2 3 4\n", "5\n1 1 0 1 1\n", "3\n1 3 1\n", "1\n12\n" ]
[ "10", "1", "4", "0" ]
In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4. In the second example it is enough to give one burle to the third citizen. In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3. In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles.
500
[ { "input": "5\n0 1 2 3 4", "output": "10" }, { "input": "5\n1 1 0 1 1", "output": "1" }, { "input": "3\n1 3 1", "output": "4" }, { "input": "1\n12", "output": "0" }, { "input": "3\n1 2 3", "output": "3" }, { "input": "14\n52518 718438 358883 462189 853171 592966 225788 46977 814826 295697 676256 561479 56545 764281", "output": "5464380" }, { "input": "21\n842556 216391 427181 626688 775504 168309 851038 448402 880826 73697 593338 519033 135115 20128 424606 939484 846242 756907 377058 241543 29353", "output": "9535765" }, { "input": "3\n1 3 2", "output": "3" }, { "input": "3\n2 1 3", "output": "3" }, { "input": "3\n2 3 1", "output": "3" }, { "input": "3\n3 1 2", "output": "3" }, { "input": "3\n3 2 1", "output": "3" }, { "input": "1\n228503", "output": "0" }, { "input": "2\n32576 550340", "output": "517764" }, { "input": "3\n910648 542843 537125", "output": "741328" }, { "input": "4\n751720 572344 569387 893618", "output": "787403" }, { "input": "6\n433864 631347 597596 794426 713555 231193", "output": "1364575" }, { "input": "9\n31078 645168 695751 126111 375934 150495 838412 434477 993107", "output": "4647430" }, { "input": "30\n315421 772664 560686 654312 151528 356749 351486 707462 820089 226682 546700 136028 824236 842130 578079 337807 665903 764100 617900 822937 992759 591749 651310 742085 767695 695442 17967 515106 81059 186025", "output": "13488674" }, { "input": "45\n908719 394261 815134 419990 926993 383792 772842 277695 527137 655356 684956 695716 273062 550324 106247 399133 442382 33076 462920 294674 846052 817752 421365 474141 290471 358990 109812 74492 543281 169434 919692 786809 24028 197184 310029 801476 699355 429672 51343 374128 776726 850380 293868 981569 550763", "output": "21993384" }, { "input": "56\n100728 972537 13846 385421 756708 184642 259487 319707 376662 221694 675284 972837 499419 13846 38267 289898 901299 831197 954715 197515 514102 910423 127555 883934 362472 870788 538802 741008 973434 448124 391526 363321 947321 544618 68006 782313 955075 741981 815027 723297 585059 718114 700739 413489 454091 736144 308999 98065 3716 347323 9635 289003 986510 607065 60236 273351", "output": "26984185" }, { "input": "70\n644488 5444 150441 714420 602059 335330 510670 196555 546346 740011 509449 850947 692874 524857 750434 952985 223744 374727 896124 753037 367352 679050 560202 172728 569291 778616 332116 286927 843598 372698 244906 498046 900681 709791 420904 724593 864493 813094 791377 39998 296710 625656 403891 579231 706693 984045 16901 574259 562265 761104 930361 256045 124461 538980 573508 372148 988722 108592 784354 55302 232524 277205 782251 299943 436488 743389 324618 742543 266915 99642", "output": "32816391" }, { "input": "1\n0", "output": "0" }, { "input": "1\n1000000", "output": "0" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "100\n1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "99000000" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000", "output": "99000000" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "99000000" }, { "input": "3\n0 0 0", "output": "0" }, { "input": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "3\n5 0 0", "output": "10" }, { "input": "5\n2 10 0 0 0", "output": "38" } ]
1,653,550,240
2,147,483,647
Python 3
OK
TESTS
41
31
0
n = int(input()) count = 0 a = list(map(int, input().split())) for i in range(len(a)): maximum = max(a) count += maximum - a[i] print(count)
Title: Holiday Of Equality Time Limit: None seconds Memory Limit: None megabytes Problem Description: In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury. Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland). You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them. Input Specification: The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen. Output Specification: In the only line print the integer *S* — the minimum number of burles which are had to spend. Demo Input: ['5\n0 1 2 3 4\n', '5\n1 1 0 1 1\n', '3\n1 3 1\n', '1\n12\n'] Demo Output: ['10', '1', '4', '0'] Note: In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4. In the second example it is enough to give one burle to the third citizen. In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3. In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles.
```python n = int(input()) count = 0 a = list(map(int, input().split())) for i in range(len(a)): maximum = max(a) count += maximum - a[i] print(count) ```
3
639
C
Bear and Polynomials
PROGRAMMING
2,200
[ "hashing", "implementation", "math" ]
null
null
Limak is a little polar bear. He doesn't have many toys and thus he often plays with polynomials. He considers a polynomial valid if its degree is *n* and its coefficients are integers not exceeding *k* by the absolute value. More formally: Let *a*0,<=*a*1,<=...,<=*a**n* denote the coefficients, so . Then, a polynomial *P*(*x*) is valid if all the following conditions are satisfied: - *a**i* is integer for every *i*; - |*a**i*|<=≤<=*k* for every *i*; - *a**n*<=≠<=0. Limak has recently got a valid polynomial *P* with coefficients *a*0,<=*a*1,<=*a*2,<=...,<=*a**n*. He noticed that *P*(2)<=≠<=0 and he wants to change it. He is going to change one coefficient to get a valid polynomial *Q* of degree *n* that *Q*(2)<==<=0. Count the number of ways to do so. You should count two ways as a distinct if coefficients of target polynoms differ.
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=200<=000,<=1<=≤<=*k*<=≤<=109) — the degree of the polynomial and the limit for absolute values of coefficients. The second line contains *n*<=+<=1 integers *a*0,<=*a*1,<=...,<=*a**n* (|*a**i*|<=≤<=*k*,<=*a**n*<=≠<=0) — describing a valid polynomial . It's guaranteed that *P*(2)<=≠<=0.
Print the number of ways to change one coefficient to get a valid polynomial *Q* that *Q*(2)<==<=0.
[ "3 1000000000\n10 -9 -3 5\n", "3 12\n10 -9 -3 5\n", "2 20\n14 -7 19\n" ]
[ "3\n", "2\n", "0\n" ]
In the first sample, we are given a polynomial *P*(*x*) = 10 - 9*x* - 3*x*<sup class="upper-index">2</sup> + 5*x*<sup class="upper-index">3</sup>. Limak can change one coefficient in three ways: 1. He can set *a*<sub class="lower-index">0</sub> =  - 10. Then he would get *Q*(*x*) =  - 10 - 9*x* - 3*x*<sup class="upper-index">2</sup> + 5*x*<sup class="upper-index">3</sup> and indeed *Q*(2) =  - 10 - 18 - 12 + 40 = 0. 1. Or he can set *a*<sub class="lower-index">2</sub> =  - 8. Then *Q*(*x*) = 10 - 9*x* - 8*x*<sup class="upper-index">2</sup> + 5*x*<sup class="upper-index">3</sup> and indeed *Q*(2) = 10 - 18 - 32 + 40 = 0. 1. Or he can set *a*<sub class="lower-index">1</sub> =  - 19. Then *Q*(*x*) = 10 - 19*x* - 3*x*<sup class="upper-index">2</sup> + 5*x*<sup class="upper-index">3</sup> and indeed *Q*(2) = 10 - 38 - 12 + 40 = 0. In the second sample, we are given the same polynomial. This time though, *k* is equal to 12 instead of 10<sup class="upper-index">9</sup>. Two first of ways listed above are still valid but in the third way we would get |*a*<sub class="lower-index">1</sub>| &gt; *k* what is not allowed. Thus, the answer is 2 this time.
1,000
[ { "input": "3 1000000000\n10 -9 -3 5", "output": "3" }, { "input": "3 12\n10 -9 -3 5", "output": "2" }, { "input": "2 20\n14 -7 19", "output": "0" }, { "input": "5 5\n0 -4 -2 -2 0 5", "output": "1" }, { "input": "6 10\n-2 -1 7 -3 2 7 -6", "output": "2" }, { "input": "7 100\n2 21 11 45 58 85 -59 38", "output": "1" }, { "input": "100 1000\n-62 57 -27 -67 49 -10 66 -64 -36 -78 62 -75 -39 75 -47 -36 41 -88 62 -43 22 29 -20 58 40 16 71 -2 -87 12 86 -90 -92 67 -12 -48 -10 -26 78 68 22 -3 66 -95 -81 34 14 -76 -27 76 -60 87 -84 3 35 -60 46 -65 29 -29 2 -44 -55 18 -75 91 36 34 -86 53 59 -54 -29 33 -95 66 9 72 67 -44 37 44 32 -52 -34 -4 -99 58 7 -22 -53 11 10 10 -25 -100 -95 -27 43 -46 25", "output": "10" }, { "input": "1 5\n5 -3", "output": "0" }, { "input": "1 10\n-6 2", "output": "2" }, { "input": "5 10000\n-160 3408 -4620 5869 7434 -6253", "output": "1" }, { "input": "10 1\n0 0 0 0 0 0 0 0 0 0 1", "output": "0" }, { "input": "10 1\n0 0 1 -1 1 0 0 1 1 -1 -1", "output": "0" }, { "input": "10 2\n-2 -2 1 2 -1 -2 1 -2 1 2 -1", "output": "2" }, { "input": "20 100\n52 -82 36 90 -62 -35 -93 -98 -80 -40 29 8 43 26 35 55 -56 -99 -17 13 11", "output": "1" }, { "input": "90 10\n-4 2 2 5 -1 3 4 1 -2 10 -9 -2 -4 3 8 0 -8 -3 9 1 2 4 8 2 0 2 -10 4 -4 -6 2 -9 3 -9 -3 8 8 9 -7 -10 3 9 -2 -7 5 -7 -5 6 1 5 1 -8 3 8 0 -6 2 2 3 -10 2 1 4 8 -3 1 5 7 -7 -3 2 -2 -9 7 7 -2 7 -6 7 -3 2 -5 10 0 0 9 -1 -4 1 -8 4", "output": "4" }, { "input": "101 20\n4 16 -5 8 -13 -6 -19 -4 18 9 -5 5 3 13 -12 -2 -1 -4 -13 14 2 15 -11 -17 -15 6 9 -15 -10 16 18 -7 8 -19 17 11 -6 -5 -16 -7 -14 5 -17 -6 18 19 -14 -5 1 11 -17 18 4 9 -1 19 1 8 9 -14 11 -8 -18 -12 15 14 -8 0 8 16 2 -20 -19 17 14 -2 3 -9 -13 4 6 -16 3 -12 19 -14 -8 -16 7 -4 5 9 17 7 -3 -15 6 18 -13 10 -8 2", "output": "1" }, { "input": "10 1000\n-538 -553 -281 -270 209 -989 -418 486 330 725 -430", "output": "1" }, { "input": "30 1000\n622 815 -733 -613 -741 571 -761 -432 -7 201 554 730 607 415 -453 820 161 147 406 875 -413 462 998 481 698 661 18 -331 752 -232 -72", "output": "2" }, { "input": "5 2000000\n1038520 -406162 -106421 106958 -807010 850753", "output": "2" }, { "input": "10 1000000000\n-857095622 -567296277 -923645190 -246044525 610990226 -617677619 -239569893 355377587 222686442 250110001 -200293692", "output": "2" }, { "input": "20 1000000000\n-924490890 231431639 -579465017 -690485236 173663728 144784457 364609617 444830562 48833250 1095623 333652904 -901650010 -850265945 844112020 -9178988 -527869441 93581840 607677914 -521131467 -628140952 329057708", "output": "3" }, { "input": "2 2\n1 1 -1", "output": "1" }, { "input": "2 2\n1 1 -1", "output": "1" }, { "input": "2 2\n-1 0 -2", "output": "0" }, { "input": "2 2\n-1 -1 1", "output": "1" }, { "input": "2 2\n1 1 -2", "output": "0" }, { "input": "3 2\n2 -1 -1 1", "output": "2" }, { "input": "35 1000000000\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 536870912", "output": "0" }, { "input": "35 1000000000\n-1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 536870912", "output": "0" }, { "input": "35 1000000000\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -536870912", "output": "0" }, { "input": "35 1000000000\n-1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -536870912", "output": "0" }, { "input": "32 1000000000\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 536870912", "output": "0" }, { "input": "32 1000000000\n-1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 536870912", "output": "0" }, { "input": "32 1000000000\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -536870912", "output": "0" }, { "input": "32 1000000000\n-1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -536870912", "output": "0" }, { "input": "55 1000000000\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 536870912", "output": "0" }, { "input": "55 1000000000\n-1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 536870912", "output": "0" }, { "input": "69 1000000000\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -536870912", "output": "0" }, { "input": "69 1000000000\n-1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -536870912", "output": "0" }, { "input": "61 10\n0 1 0 0 1 1 0 0 0 1 1 1 0 1 0 1 0 1 0 0 0 0 1 0 0 0 0 0 0 1 0 1 1 0 0 1 0 1 0 0 1 1 1 0 1 0 1 0 1 0 1 0 0 1 0 1 1 0 0 1 0 1", "output": "0" }, { "input": "2 10\n1 -2 1", "output": "1" }, { "input": "65 1\n-1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -1", "output": "0" } ]
1,459,188,605
5,705
Python 3
WRONG_ANSWER
PRETESTS
3
61
4,608,000
# coding: utf-8 # In[4]: data = list(map(int, input().split(' '))) a_list = list(map(int, input().split(' '))) n = data[0] k = data[1] a = a_list def count(a, coef): res = 0 a[coef] = 0 for ind in range(n+1): res += a[ind]*(2**ind) return res flag = True j = 0 ans = 0 while (flag and j < n+1): if ((count(a, j)%(2**j) == 0) and ((abs(count(a,j)) // (2**j)) <= k )): j += 1 ans = j+1 if j == n: if (abs(count(a,j)) // (2**j)) == 0: j -= 1 ans -= 1 flag = False else: flag = False print(ans)
Title: Bear and Polynomials Time Limit: None seconds Memory Limit: None megabytes Problem Description: Limak is a little polar bear. He doesn't have many toys and thus he often plays with polynomials. He considers a polynomial valid if its degree is *n* and its coefficients are integers not exceeding *k* by the absolute value. More formally: Let *a*0,<=*a*1,<=...,<=*a**n* denote the coefficients, so . Then, a polynomial *P*(*x*) is valid if all the following conditions are satisfied: - *a**i* is integer for every *i*; - |*a**i*|<=≤<=*k* for every *i*; - *a**n*<=≠<=0. Limak has recently got a valid polynomial *P* with coefficients *a*0,<=*a*1,<=*a*2,<=...,<=*a**n*. He noticed that *P*(2)<=≠<=0 and he wants to change it. He is going to change one coefficient to get a valid polynomial *Q* of degree *n* that *Q*(2)<==<=0. Count the number of ways to do so. You should count two ways as a distinct if coefficients of target polynoms differ. Input Specification: The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=200<=000,<=1<=≤<=*k*<=≤<=109) — the degree of the polynomial and the limit for absolute values of coefficients. The second line contains *n*<=+<=1 integers *a*0,<=*a*1,<=...,<=*a**n* (|*a**i*|<=≤<=*k*,<=*a**n*<=≠<=0) — describing a valid polynomial . It's guaranteed that *P*(2)<=≠<=0. Output Specification: Print the number of ways to change one coefficient to get a valid polynomial *Q* that *Q*(2)<==<=0. Demo Input: ['3 1000000000\n10 -9 -3 5\n', '3 12\n10 -9 -3 5\n', '2 20\n14 -7 19\n'] Demo Output: ['3\n', '2\n', '0\n'] Note: In the first sample, we are given a polynomial *P*(*x*) = 10 - 9*x* - 3*x*<sup class="upper-index">2</sup> + 5*x*<sup class="upper-index">3</sup>. Limak can change one coefficient in three ways: 1. He can set *a*<sub class="lower-index">0</sub> =  - 10. Then he would get *Q*(*x*) =  - 10 - 9*x* - 3*x*<sup class="upper-index">2</sup> + 5*x*<sup class="upper-index">3</sup> and indeed *Q*(2) =  - 10 - 18 - 12 + 40 = 0. 1. Or he can set *a*<sub class="lower-index">2</sub> =  - 8. Then *Q*(*x*) = 10 - 9*x* - 8*x*<sup class="upper-index">2</sup> + 5*x*<sup class="upper-index">3</sup> and indeed *Q*(2) = 10 - 18 - 32 + 40 = 0. 1. Or he can set *a*<sub class="lower-index">1</sub> =  - 19. Then *Q*(*x*) = 10 - 19*x* - 3*x*<sup class="upper-index">2</sup> + 5*x*<sup class="upper-index">3</sup> and indeed *Q*(2) = 10 - 38 - 12 + 40 = 0. In the second sample, we are given the same polynomial. This time though, *k* is equal to 12 instead of 10<sup class="upper-index">9</sup>. Two first of ways listed above are still valid but in the third way we would get |*a*<sub class="lower-index">1</sub>| &gt; *k* what is not allowed. Thus, the answer is 2 this time.
```python # coding: utf-8 # In[4]: data = list(map(int, input().split(' '))) a_list = list(map(int, input().split(' '))) n = data[0] k = data[1] a = a_list def count(a, coef): res = 0 a[coef] = 0 for ind in range(n+1): res += a[ind]*(2**ind) return res flag = True j = 0 ans = 0 while (flag and j < n+1): if ((count(a, j)%(2**j) == 0) and ((abs(count(a,j)) // (2**j)) <= k )): j += 1 ans = j+1 if j == n: if (abs(count(a,j)) // (2**j)) == 0: j -= 1 ans -= 1 flag = False else: flag = False print(ans) ```
0
411
A
Password Check
PROGRAMMING
800
[ "*special", "implementation" ]
null
null
You have probably registered on Internet sites many times. And each time you should enter your invented password. Usually the registration form automatically checks the password's crypt resistance. If the user's password isn't complex enough, a message is displayed. Today your task is to implement such an automatic check. Web-developers of the company Q assume that a password is complex enough, if it meets all of the following conditions: - the password length is at least 5 characters; - the password contains at least one large English letter; - the password contains at least one small English letter; - the password contains at least one digit. You are given a password. Please implement the automatic check of its complexity for company Q.
The first line contains a non-empty sequence of characters (at most 100 characters). Each character is either a large English letter, or a small English letter, or a digit, or one of characters: "!", "?", ".", ",", "_".
If the password is complex enough, print message "Correct" (without the quotes), otherwise print message "Too weak" (without the quotes).
[ "abacaba\n", "X12345\n", "CONTEST_is_STARTED!!11\n" ]
[ "Too weak\n", "Too weak\n", "Correct\n" ]
none
0
[ { "input": "abacaba", "output": "Too weak" }, { "input": "X12345", "output": "Too weak" }, { "input": "CONTEST_is_STARTED!!11", "output": "Correct" }, { "input": "1zA__", "output": "Correct" }, { "input": "1zA_", "output": "Too weak" }, { "input": "zA___", "output": "Too weak" }, { "input": "1A___", "output": "Too weak" }, { "input": "z1___", "output": "Too weak" }, { "input": "0", "output": "Too weak" }, { "input": "_", "output": "Too weak" }, { "input": "a", "output": "Too weak" }, { "input": "D", "output": "Too weak" }, { "input": "_", "output": "Too weak" }, { "input": "?", "output": "Too weak" }, { "input": "?", "output": "Too weak" }, { "input": "._,.!.,...?_,!.", "output": "Too weak" }, { "input": "!_?_,?,?.,.,_!!!.!,.__,?!!,_!,?_,!??,?!..._!?_,?_!,?_.,._,,_.,.", "output": "Too weak" }, { "input": "?..!.,,?,__.,...????_???__!,?...?.,,,,___!,.!,_,,_,??!_?_,!!?_!_??.?,.!!?_?_.,!", "output": "Too weak" }, { "input": "XZX", "output": "Too weak" }, { "input": "R", "output": "Too weak" }, { "input": "H.FZ", "output": "Too weak" }, { "input": "KSHMICWPK,LSBM_JVZ!IPDYDG_GOPCHXFJTKJBIFY,FPHMY,CB?PZEAG..,X,.GFHPIDBB,IQ?MZ", "output": "Too weak" }, { "input": "EFHI,,Y?HMMUI,,FJGAY?FYPBJQMYM!DZHLFCTFWT?JOPDW,S_!OR?ATT?RWFBMAAKUHIDMHSD?LCZQY!UD_CGYGBAIRDPICYS", "output": "Too weak" }, { "input": "T,NDMUYCCXH_L_FJHMCCAGX_XSCPGOUZSY?D?CNDSYRITYS,VAT!PJVKNTBMXGGRYKACLYU.RJQ_?UWKXYIDE_AE", "output": "Too weak" }, { "input": "y", "output": "Too weak" }, { "input": "qgw", "output": "Too weak" }, { "input": "g", "output": "Too weak" }, { "input": "loaray", "output": "Too weak" }, { "input": "d_iymyvxolmjayhwpedocopqwmy.oalrdg!_n?.lrxpamhygps?kkzxydsbcaihfs.j?eu!oszjsy.vzu?!vs.bprz_j", "output": "Too weak" }, { "input": "txguglvclyillwnono", "output": "Too weak" }, { "input": "FwX", "output": "Too weak" }, { "input": "Zi", "output": "Too weak" }, { "input": "PodE", "output": "Too weak" }, { "input": "SdoOuJ?nj_wJyf", "output": "Too weak" }, { "input": "MhnfZjsUyXYw?f?ubKA", "output": "Too weak" }, { "input": "CpWxDVzwHfYFfoXNtXMFuAZr", "output": "Too weak" }, { "input": "9.,0", "output": "Too weak" }, { "input": "5,8", "output": "Too weak" }, { "input": "7", "output": "Too weak" }, { "input": "34__39_02!,!,82!129!2!566", "output": "Too weak" }, { "input": "96156027.65935663!_87!,44,..7914_!0_1,.4!!62!.8350!17_282!!9.2584,!!7__51.526.7", "output": "Too weak" }, { "input": "90328_", "output": "Too weak" }, { "input": "B9", "output": "Too weak" }, { "input": "P1H", "output": "Too weak" }, { "input": "J2", "output": "Too weak" }, { "input": "M6BCAKW!85OSYX1D?.53KDXP42F", "output": "Too weak" }, { "input": "C672F429Y8X6XU7S,.K9111UD3232YXT81S4!729ER7DZ.J7U1R_7VG6.FQO,LDH", "output": "Too weak" }, { "input": "W2PI__!.O91H8OFY6AB__R30L9XOU8800?ZUD84L5KT99818NFNE35V.8LJJ5P2MM.B6B", "output": "Too weak" }, { "input": "z1", "output": "Too weak" }, { "input": "p1j", "output": "Too weak" }, { "input": "j9", "output": "Too weak" }, { "input": "v8eycoylzv0qkix5mfs_nhkn6k!?ovrk9!b69zy!4frc?k", "output": "Too weak" }, { "input": "l4!m_44kpw8.jg!?oh,?y5oraw1tg7_x1.osl0!ny?_aihzhtt0e2!mr92tnk0es!1f,9he40_usa6c50l", "output": "Too weak" }, { "input": "d4r!ak.igzhnu!boghwd6jl", "output": "Too weak" }, { "input": "It0", "output": "Too weak" }, { "input": "Yb1x", "output": "Too weak" }, { "input": "Qf7", "output": "Too weak" }, { "input": "Vu7jQU8.!FvHBYTsDp6AphaGfnEmySP9te", "output": "Correct" }, { "input": "Ka4hGE,vkvNQbNolnfwp", "output": "Correct" }, { "input": "Ee9oluD?amNItsjeQVtOjwj4w_ALCRh7F3eaZah", "output": "Correct" }, { "input": "Um3Fj?QLhNuRE_Gx0cjMLOkGCm", "output": "Correct" }, { "input": "Oq2LYmV9HmlaW", "output": "Correct" }, { "input": "Cq7r3Wrb.lDb_0wsf7!ruUUGSf08RkxD?VsBEDdyE?SHK73TFFy0f8gmcATqGafgTv8OOg8or2HyMPIPiQ2Hsx8q5rn3_WZe", "output": "Correct" }, { "input": "Wx4p1fOrEMDlQpTlIx0p.1cnFD7BnX2K8?_dNLh4cQBx_Zqsv83BnL5hGKNcBE9g3QB,!fmSvgBeQ_qiH7", "output": "Correct" }, { "input": "k673,", "output": "Too weak" }, { "input": "LzuYQ", "output": "Too weak" }, { "input": "Pasq!", "output": "Too weak" }, { "input": "x5hve", "output": "Too weak" }, { "input": "b27fk", "output": "Too weak" }, { "input": "h6y1l", "output": "Too weak" }, { "input": "i9nij", "output": "Too weak" }, { "input": "Gf5Q6", "output": "Correct" }, { "input": "Uf24o", "output": "Correct" }, { "input": "Oj9vu", "output": "Correct" }, { "input": "c7jqaudcqmv8o7zvb5x_gp6zcgl6nwr7tz5or!28.tj8s1m2.wxz5a4id03!rq07?662vy.7.p5?vk2f2mc7ag8q3861rgd0rmbr", "output": "Too weak" }, { "input": "i6a.,8jb,n0kv4.1!7h?p.96pnhhgy6cl7dg7e4o6o384ys3z.t71kkq,,w,oqi4?u,,m5!rzu6wym_4hm,ohjy!.vvksl?pt,,1", "output": "Too weak" }, { "input": "M10V_MN_1K8YX2LA!89EYV7!5V9?,.IDHDP6JEC.OGLY.180LMZ6KW3Z5E17IT94ZNHS!79GN09Q6LH0,F3AYNKP?KM,QP_?XRD6", "output": "Too weak" }, { "input": "Hi7zYuVXCPhaho68YgCMzzgLILM6toQTJq8akMqqrnUn6ZCD36iA1yVVpvlsIiMpCu!1QZd4ycIrQ5Kcrhk5k0jTrwdAAEEP_T2f", "output": "Correct" }, { "input": "Bk2Q38vDSW5JqYu.077iYC.9YoiPc!Dh6FJWOVze6?YXiFjPNa4F1RG?154m9mY2jQobBnbxM,cDV8l1UX1?v?p.tTYIyJO!NYmE", "output": "Correct" }, { "input": "Ro1HcZ.piN,JRR88DLh,WtW!pbFM076?wCSbqfK7N2s5zUySFBtzk7HV,BxHXR0zALAr016z5jvvB.WUdEcKgYFav5TygwHQC..C", "output": "Correct" }, { "input": "!?.,_", "output": "Too weak" } ]
1,642,836,278
2,147,483,647
Python 3
OK
TESTS
81
62
0
n=input() res=False res1=False res2= False if(len(n)<5): print("Too weak") quit() else: for i in range(len(n)): if(n[i].isupper()): res=True elif(n[i].islower()): res1=True elif(n[i].isdigit()): res2=True if(res==True and res1==True and res2==True): print("Correct") else: print("Too weak")
Title: Password Check Time Limit: None seconds Memory Limit: None megabytes Problem Description: You have probably registered on Internet sites many times. And each time you should enter your invented password. Usually the registration form automatically checks the password's crypt resistance. If the user's password isn't complex enough, a message is displayed. Today your task is to implement such an automatic check. Web-developers of the company Q assume that a password is complex enough, if it meets all of the following conditions: - the password length is at least 5 characters; - the password contains at least one large English letter; - the password contains at least one small English letter; - the password contains at least one digit. You are given a password. Please implement the automatic check of its complexity for company Q. Input Specification: The first line contains a non-empty sequence of characters (at most 100 characters). Each character is either a large English letter, or a small English letter, or a digit, or one of characters: "!", "?", ".", ",", "_". Output Specification: If the password is complex enough, print message "Correct" (without the quotes), otherwise print message "Too weak" (without the quotes). Demo Input: ['abacaba\n', 'X12345\n', 'CONTEST_is_STARTED!!11\n'] Demo Output: ['Too weak\n', 'Too weak\n', 'Correct\n'] Note: none
```python n=input() res=False res1=False res2= False if(len(n)<5): print("Too weak") quit() else: for i in range(len(n)): if(n[i].isupper()): res=True elif(n[i].islower()): res1=True elif(n[i].isdigit()): res2=True if(res==True and res1==True and res2==True): print("Correct") else: print("Too weak") ```
3
186
A
Comparing Strings
PROGRAMMING
1,100
[ "implementation", "strings" ]
null
null
Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters. Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not.
The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters. The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters. The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length.
Print "YES", if the dwarves belong to the same race. Otherwise, print "NO".
[ "ab\nba\n", "aa\nab\n" ]
[ "YES\n", "NO\n" ]
- First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b".
500
[ { "input": "ab\nba", "output": "YES" }, { "input": "aa\nab", "output": "NO" }, { "input": "a\nza", "output": "NO" }, { "input": "vvea\nvvae", "output": "YES" }, { "input": "rtfabanpc\natfabrnpc", "output": "YES" }, { "input": "mt\ntm", "output": "YES" }, { "input": "qxolmbkkt\naovlajmlf", "output": "NO" }, { "input": "b\ng", "output": "NO" }, { "input": "ab\naba", "output": "NO" }, { "input": "ba\na", "output": "NO" }, { "input": "a\nab", "output": "NO" }, { "input": "a\naa", "output": "NO" }, { "input": "a\nz", "output": "NO" }, { "input": "aabb\nbbaa", "output": "NO" }, { "input": "ab\nbd", "output": "NO" }, { "input": "bac\ndae", "output": "NO" }, { "input": "abc\nakl", "output": "NO" }, { "input": "cb\naa", "output": "NO" }, { "input": "abaab\naabba", "output": "NO" }, { "input": "aab\naaa", "output": "NO" }, { "input": "abcde\nedcba", "output": "NO" }, { "input": "abab\nbaba", "output": "NO" }, { "input": "ab\nbac", "output": "NO" }, { "input": "abcd\naqcb", "output": "NO" }, { "input": "abc\nbad", "output": "NO" }, { "input": "ab\nca", "output": "NO" }, { "input": "abc\nab", "output": "NO" }, { "input": "ab\nbae", "output": "NO" }, { "input": "aaaabcccca\naaaadccccb", "output": "NO" }, { "input": "acaa\nabca", "output": "NO" }, { "input": "aba\naab", "output": "YES" }, { "input": "ah\nla", "output": "NO" }, { "input": "aab\naa", "output": "NO" }, { "input": "abab\nabcd", "output": "NO" }, { "input": "ed\nab", "output": "NO" } ]
1,619,001,660
2,147,483,647
Python 3
OK
TESTS
53
154
3,174,400
a = list(input()) b = list(input()) answer = "YES" if len(a) != len(b): answer = "NO" else: indexes = [] for i in range(len(a)): if a[i] != b[i]: indexes.append(i) if len(indexes) != 2: answer = "NO" else: temp = a[indexes[0]] a[indexes[0]] = a[indexes[1]] a[indexes[1]] = temp if a != b: answer = "NO" print(answer)
Title: Comparing Strings Time Limit: None seconds Memory Limit: None megabytes Problem Description: Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters. Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not. Input Specification: The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters. The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters. The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length. Output Specification: Print "YES", if the dwarves belong to the same race. Otherwise, print "NO". Demo Input: ['ab\nba\n', 'aa\nab\n'] Demo Output: ['YES\n', 'NO\n'] Note: - First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b".
```python a = list(input()) b = list(input()) answer = "YES" if len(a) != len(b): answer = "NO" else: indexes = [] for i in range(len(a)): if a[i] != b[i]: indexes.append(i) if len(indexes) != 2: answer = "NO" else: temp = a[indexes[0]] a[indexes[0]] = a[indexes[1]] a[indexes[1]] = temp if a != b: answer = "NO" print(answer) ```
3
82
A
Double Cola
PROGRAMMING
1,100
[ "implementation", "math" ]
A. Double Cola
1
256
Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum. For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny. Write a program that will print the name of a man who will drink the *n*-th can. Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon.
The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109). It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers.
Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially.
[ "1\n", "6\n", "1802\n" ]
[ "Sheldon\n", "Sheldon\n", "Penny\n" ]
none
500
[ { "input": "1", "output": "Sheldon" }, { "input": "6", "output": "Sheldon" }, { "input": "1802", "output": "Penny" }, { "input": "1", "output": "Sheldon" }, { "input": "2", "output": "Leonard" }, { "input": "3", "output": "Penny" }, { "input": "4", "output": "Rajesh" }, { "input": "5", "output": "Howard" }, { "input": "10", "output": "Penny" }, { "input": "534", "output": "Rajesh" }, { "input": "5033", "output": "Howard" }, { "input": "10010", "output": "Howard" }, { "input": "500000000", "output": "Penny" }, { "input": "63", "output": "Rajesh" }, { "input": "841", "output": "Leonard" }, { "input": "3667", "output": "Penny" }, { "input": "38614", "output": "Howard" }, { "input": "282798", "output": "Rajesh" }, { "input": "9266286", "output": "Rajesh" }, { "input": "27385966", "output": "Leonard" }, { "input": "121580142", "output": "Penny" }, { "input": "5", "output": "Howard" }, { "input": "300", "output": "Howard" }, { "input": "1745", "output": "Leonard" }, { "input": "8302", "output": "Rajesh" }, { "input": "184518", "output": "Sheldon" }, { "input": "1154414", "output": "Rajesh" }, { "input": "28643950", "output": "Leonard" }, { "input": "159222638", "output": "Howard" }, { "input": "24", "output": "Penny" }, { "input": "505", "output": "Penny" }, { "input": "4425", "output": "Rajesh" }, { "input": "12079", "output": "Sheldon" }, { "input": "469726", "output": "Penny" }, { "input": "3961838", "output": "Penny" }, { "input": "57710446", "output": "Leonard" }, { "input": "80719470", "output": "Howard" }, { "input": "1000000000", "output": "Penny" }, { "input": "999999999", "output": "Penny" }, { "input": "999999998", "output": "Penny" }, { "input": "5", "output": "Howard" } ]
1,649,632,489
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
31
0
names = ["Sheldon", "Leonard", "Penny", "Rajesh", "Howard"] n = int(input()) k = 0 while 5 * (2 ** k) <= n: n -= 5 * (2 ** k) k += 1 print(names[round(n / (2 ** k))])
Title: Double Cola Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum. For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny. Write a program that will print the name of a man who will drink the *n*-th can. Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon. Input Specification: The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109). It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers. Output Specification: Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially. Demo Input: ['1\n', '6\n', '1802\n'] Demo Output: ['Sheldon\n', 'Sheldon\n', 'Penny\n'] Note: none
```python names = ["Sheldon", "Leonard", "Penny", "Rajesh", "Howard"] n = int(input()) k = 0 while 5 * (2 ** k) <= n: n -= 5 * (2 ** k) k += 1 print(names[round(n / (2 ** k))]) ```
0
767
A
Snacktower
PROGRAMMING
1,100
[ "data structures", "implementation" ]
null
null
According to an old legeng, a long time ago Ankh-Morpork residents did something wrong to miss Fortune, and she cursed them. She said that at some time *n* snacks of distinct sizes will fall on the city, and the residents should build a Snacktower of them by placing snacks one on another. Of course, big snacks should be at the bottom of the tower, while small snacks should be at the top. Years passed, and once different snacks started to fall onto the city, and the residents began to build the Snacktower. However, they faced some troubles. Each day exactly one snack fell onto the city, but their order was strange. So, at some days the residents weren't able to put the new stack on the top of the Snacktower: they had to wait until all the bigger snacks fell. Of course, in order to not to anger miss Fortune again, the residents placed each snack on the top of the tower immediately as they could do it. Write a program that models the behavior of Ankh-Morpork residents.
The first line contains single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the total number of snacks. The second line contains *n* integers, the *i*-th of them equals the size of the snack which fell on the *i*-th day. Sizes are distinct integers from 1 to *n*.
Print *n* lines. On the *i*-th of them print the sizes of the snacks which the residents placed on the top of the Snacktower on the *i*-th day in the order they will do that. If no snack is placed on some day, leave the corresponding line empty.
[ "3\n3 1 2\n", "5\n4 5 1 2 3\n" ]
[ "3\n \n2 1", "5 4\n \n \n3 2 1\n" ]
In the example a snack of size 3 fell on the first day, and the residents immediately placed it. On the second day a snack of size 1 fell, and the residents weren't able to place it because they were missing the snack of size 2. On the third day a snack of size 2 fell, and the residents immediately placed it. Right after that they placed the snack of size 1 which had fallen before.
500
[ { "input": "3\n3 1 2", "output": "3 \n\n2 1 " }, { "input": "5\n4 5 1 2 3", "output": "5 4 \n\n\n3 2 1 " }, { "input": "1\n1", "output": "1 " }, { "input": "2\n1 2", "output": "2 1 " }, { "input": "10\n5 1 6 2 8 3 4 10 9 7", "output": "10 \n9 8 \n7 6 5 4 3 2 1 " }, { "input": "30\n16 10 4 29 5 28 12 21 11 30 18 6 14 3 17 22 20 15 9 1 27 19 24 26 13 25 2 23 8 7", "output": "30 29 28 \n\n\n\n\n\n\n\n\n\n\n27 \n\n\n26 \n\n25 24 \n\n23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 \n8 \n7 6 5 4 3 2 1 " }, { "input": "100\n98 52 63 2 18 96 31 58 84 40 41 45 66 100 46 71 26 48 81 20 73 91 68 76 13 93 17 29 64 95 79 21 55 75 19 85 54 51 89 78 15 87 43 59 36 1 90 35 65 56 62 28 86 5 82 49 3 99 33 9 92 32 74 69 27 22 77 16 44 94 34 6 57 70 23 12 61 25 8 11 67 47 83 88 10 14 30 7 97 60 42 37 24 38 53 50 4 80 72 39", "output": "100 \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n99 98 \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 \n\n\n\n\n\n\n\n\n80 79 78 77 76 75 74 73 \n72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 \n39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 " }, { "input": "2\n2 1", "output": "2 \n1 " } ]
1,626,912,671
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
46
6,963,200
from numpy.core.fromnumeric import sort n =int(input()) arr = list(map(int, input().split())) sub = [] temp = arr[0] sub.append(temp) result = [] for i in range(1,n): if temp < arr[i]: temp += 1 if temp == arr[i]: sub.append(arr[i]) if i == n-1: result.append(list(reversed(sub))) else: result.append(list(reversed(sub))) sub = [] sub.append(arr[i]) temp = arr[i] else: result.append(list(reversed(sub))) sub = [] sub.append(arr[i]) temp = arr[i] if i == n-1: sub = [] sub.append(arr[i]) result.append(sub) result.sort(key= lambda x : x[0]) for i in reversed(range(len(result))): if len(result[i]) == 1: print(*result[i]) else: for j in range(len(result[i])-1): print() print(*result[i])
Title: Snacktower Time Limit: None seconds Memory Limit: None megabytes Problem Description: According to an old legeng, a long time ago Ankh-Morpork residents did something wrong to miss Fortune, and she cursed them. She said that at some time *n* snacks of distinct sizes will fall on the city, and the residents should build a Snacktower of them by placing snacks one on another. Of course, big snacks should be at the bottom of the tower, while small snacks should be at the top. Years passed, and once different snacks started to fall onto the city, and the residents began to build the Snacktower. However, they faced some troubles. Each day exactly one snack fell onto the city, but their order was strange. So, at some days the residents weren't able to put the new stack on the top of the Snacktower: they had to wait until all the bigger snacks fell. Of course, in order to not to anger miss Fortune again, the residents placed each snack on the top of the tower immediately as they could do it. Write a program that models the behavior of Ankh-Morpork residents. Input Specification: The first line contains single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the total number of snacks. The second line contains *n* integers, the *i*-th of them equals the size of the snack which fell on the *i*-th day. Sizes are distinct integers from 1 to *n*. Output Specification: Print *n* lines. On the *i*-th of them print the sizes of the snacks which the residents placed on the top of the Snacktower on the *i*-th day in the order they will do that. If no snack is placed on some day, leave the corresponding line empty. Demo Input: ['3\n3 1 2\n', '5\n4 5 1 2 3\n'] Demo Output: ['3\n\xa0\n2 1', '5 4\n\xa0\n\xa0\n3 2 1\n'] Note: In the example a snack of size 3 fell on the first day, and the residents immediately placed it. On the second day a snack of size 1 fell, and the residents weren't able to place it because they were missing the snack of size 2. On the third day a snack of size 2 fell, and the residents immediately placed it. Right after that they placed the snack of size 1 which had fallen before.
```python from numpy.core.fromnumeric import sort n =int(input()) arr = list(map(int, input().split())) sub = [] temp = arr[0] sub.append(temp) result = [] for i in range(1,n): if temp < arr[i]: temp += 1 if temp == arr[i]: sub.append(arr[i]) if i == n-1: result.append(list(reversed(sub))) else: result.append(list(reversed(sub))) sub = [] sub.append(arr[i]) temp = arr[i] else: result.append(list(reversed(sub))) sub = [] sub.append(arr[i]) temp = arr[i] if i == n-1: sub = [] sub.append(arr[i]) result.append(sub) result.sort(key= lambda x : x[0]) for i in reversed(range(len(result))): if len(result[i]) == 1: print(*result[i]) else: for j in range(len(result[i])-1): print() print(*result[i]) ```
-1
832
A
Sasha and Sticks
PROGRAMMING
800
[ "games", "math" ]
null
null
It's one more school day now. Sasha doesn't like classes and is always bored at them. So, each day he invents some game and plays in it alone or with friends. Today he invented one simple game to play with Lena, with whom he shares a desk. The rules are simple. Sasha draws *n* sticks in a row. After that the players take turns crossing out exactly *k* sticks from left or right in each turn. Sasha moves first, because he is the inventor of the game. If there are less than *k* sticks on the paper before some turn, the game ends. Sasha wins if he makes strictly more moves than Lena. Sasha wants to know the result of the game before playing, you are to help him.
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1018, *k*<=≤<=*n*) — the number of sticks drawn by Sasha and the number *k* — the number of sticks to be crossed out on each turn.
If Sasha wins, print "YES" (without quotes), otherwise print "NO" (without quotes). You can print each letter in arbitrary case (upper of lower).
[ "1 1\n", "10 4\n" ]
[ "YES\n", "NO\n" ]
In the first example Sasha crosses out 1 stick, and then there are no sticks. So Lena can't make a move, and Sasha wins. In the second example Sasha crosses out 4 sticks, then Lena crosses out 4 sticks, and after that there are only 2 sticks left. Sasha can't make a move. The players make equal number of moves, so Sasha doesn't win.
500
[ { "input": "1 1", "output": "YES" }, { "input": "10 4", "output": "NO" }, { "input": "251656215122324104 164397544865601257", "output": "YES" }, { "input": "963577813436662285 206326039287271924", "output": "NO" }, { "input": "1000000000000000000 1", "output": "NO" }, { "input": "253308697183523656 25332878317796706", "output": "YES" }, { "input": "669038685745448997 501718093668307460", "output": "YES" }, { "input": "116453141993601660 87060381463547965", "output": "YES" }, { "input": "766959657 370931668", "output": "NO" }, { "input": "255787422422806632 146884995820359999", "output": "YES" }, { "input": "502007866464507926 71266379084204128", "output": "YES" }, { "input": "257439908778973480 64157133126869976", "output": "NO" }, { "input": "232709385 91708542", "output": "NO" }, { "input": "252482458300407528 89907711721009125", "output": "NO" }, { "input": "6 2", "output": "YES" }, { "input": "6 3", "output": "NO" }, { "input": "6 4", "output": "YES" }, { "input": "6 5", "output": "YES" }, { "input": "6 6", "output": "YES" }, { "input": "258266151957056904 30153168463725364", "output": "NO" }, { "input": "83504367885565783 52285355047292458", "output": "YES" }, { "input": "545668929424440387 508692735816921376", "output": "YES" }, { "input": "547321411485639939 36665750286082900", "output": "NO" }, { "input": "548973893546839491 183137237979822911", "output": "NO" }, { "input": "544068082 193116851", "output": "NO" }, { "input": "871412474 749817171", "output": "YES" }, { "input": "999999999 1247", "output": "NO" }, { "input": "851941088 712987048", "output": "YES" }, { "input": "559922900 418944886", "output": "YES" }, { "input": "293908937 37520518", "output": "YES" }, { "input": "650075786 130049650", "output": "NO" }, { "input": "1000000000 1000000000", "output": "YES" }, { "input": "548147654663723363 107422751713800746", "output": "YES" }, { "input": "828159210 131819483", "output": "NO" }, { "input": "6242634 4110365", "output": "YES" }, { "input": "458601973 245084155", "output": "YES" }, { "input": "349593257 18089089", "output": "YES" }, { "input": "814768821 312514745", "output": "NO" }, { "input": "697884949 626323363", "output": "YES" }, { "input": "667011589 54866795", "output": "NO" }, { "input": "1000000000000000000 2", "output": "NO" }, { "input": "1000000000000000000 3", "output": "YES" }, { "input": "1000000000000000000 4", "output": "NO" }, { "input": "999999999999999 1", "output": "YES" }, { "input": "17 4", "output": "NO" }, { "input": "2 2", "output": "YES" }, { "input": "1000000000000000 2", "output": "NO" }, { "input": "12 4", "output": "YES" }, { "input": "6 1", "output": "NO" }, { "input": "2 1", "output": "NO" }, { "input": "10000000005 1", "output": "YES" }, { "input": "10000000000000009 2", "output": "NO" }, { "input": "12457895452123 1", "output": "YES" }, { "input": "999999999999999999 9", "output": "YES" }, { "input": "1000000000000 3", "output": "YES" }, { "input": "13099714659575475 6549849616514894", "output": "NO" }, { "input": "100000000000000001 1", "output": "YES" }, { "input": "825175814723458 324", "output": "YES" }, { "input": "20 4", "output": "YES" }, { "input": "100000176877 4", "output": "YES" }, { "input": "100000 3", "output": "YES" }, { "input": "946744073709551614 10", "output": "YES" } ]
1,584,810,254
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
93
0
n=input().split() n[0]=int(n[0]) n[1]=int(n[1]) l=n[0] c=n[1] if l==c: print('NO') else: if l%c==0: if (l/c)%2==0: print('NO') else: print('YES') else: if int(l/c)%2==0: print('NO') else: print('YES')
Title: Sasha and Sticks Time Limit: None seconds Memory Limit: None megabytes Problem Description: It's one more school day now. Sasha doesn't like classes and is always bored at them. So, each day he invents some game and plays in it alone or with friends. Today he invented one simple game to play with Lena, with whom he shares a desk. The rules are simple. Sasha draws *n* sticks in a row. After that the players take turns crossing out exactly *k* sticks from left or right in each turn. Sasha moves first, because he is the inventor of the game. If there are less than *k* sticks on the paper before some turn, the game ends. Sasha wins if he makes strictly more moves than Lena. Sasha wants to know the result of the game before playing, you are to help him. Input Specification: The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1018, *k*<=≤<=*n*) — the number of sticks drawn by Sasha and the number *k* — the number of sticks to be crossed out on each turn. Output Specification: If Sasha wins, print "YES" (without quotes), otherwise print "NO" (without quotes). You can print each letter in arbitrary case (upper of lower). Demo Input: ['1 1\n', '10 4\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first example Sasha crosses out 1 stick, and then there are no sticks. So Lena can't make a move, and Sasha wins. In the second example Sasha crosses out 4 sticks, then Lena crosses out 4 sticks, and after that there are only 2 sticks left. Sasha can't make a move. The players make equal number of moves, so Sasha doesn't win.
```python n=input().split() n[0]=int(n[0]) n[1]=int(n[1]) l=n[0] c=n[1] if l==c: print('NO') else: if l%c==0: if (l/c)%2==0: print('NO') else: print('YES') else: if int(l/c)%2==0: print('NO') else: print('YES') ```
0
80
A
Panoramix's Prediction
PROGRAMMING
800
[ "brute force" ]
A. Panoramix's Prediction
2
256
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not. The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2. One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside. Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song. Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=&gt;<=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=&lt;<=*m*<=≤<=50). It is guaranteed that *n* is prime. Pretests contain all the cases with restrictions 2<=≤<=*n*<=&lt;<=*m*<=≤<=4.
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
[ "3 5\n", "7 11\n", "7 9\n" ]
[ "YES", "YES", "NO" ]
none
500
[ { "input": "3 5", "output": "YES" }, { "input": "7 11", "output": "YES" }, { "input": "7 9", "output": "NO" }, { "input": "2 3", "output": "YES" }, { "input": "2 4", "output": "NO" }, { "input": "3 4", "output": "NO" }, { "input": "3 5", "output": "YES" }, { "input": "5 7", "output": "YES" }, { "input": "7 11", "output": "YES" }, { "input": "11 13", "output": "YES" }, { "input": "13 17", "output": "YES" }, { "input": "17 19", "output": "YES" }, { "input": "19 23", "output": "YES" }, { "input": "23 29", "output": "YES" }, { "input": "29 31", "output": "YES" }, { "input": "31 37", "output": "YES" }, { "input": "37 41", "output": "YES" }, { "input": "41 43", "output": "YES" }, { "input": "43 47", "output": "YES" }, { "input": "2 5", "output": "NO" }, { "input": "2 7", "output": "NO" }, { "input": "2 6", "output": "NO" }, { "input": "2 11", "output": "NO" }, { "input": "3 6", "output": "NO" }, { "input": "3 7", "output": "NO" }, { "input": "3 9", "output": "NO" }, { "input": "5 6", "output": "NO" }, { "input": "5 9", "output": "NO" }, { "input": "5 11", "output": "NO" }, { "input": "5 13", "output": "NO" }, { "input": "5 15", "output": "NO" }, { "input": "7 8", "output": "NO" }, { "input": "7 13", "output": "NO" }, { "input": "13 15", "output": "NO" }, { "input": "13 17", "output": "YES" }, { "input": "19 21", "output": "NO" }, { "input": "13 20", "output": "NO" }, { "input": "41 49", "output": "NO" }, { "input": "43 49", "output": "NO" }, { "input": "47 50", "output": "NO" }, { "input": "47 49", "output": "NO" }, { "input": "47 48", "output": "NO" }, { "input": "23 25", "output": "NO" }, { "input": "2 50", "output": "NO" }, { "input": "31 33", "output": "NO" } ]
1,659,824,502
2,147,483,647
Python 3
OK
TESTS
45
92
0
def main(): T=input().split(' ') K=Prime(int(T[0])) if K==int(T[1]): print('YES') else: print('NO') def Prime(n): n+=1 while(not(Premier(n))): n+=1 return n def Premier(n): for i in range(2,n//2+1): if n%i==0: return False return True main()
Title: Panoramix's Prediction Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not. The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2. One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside. Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song. Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=&gt;<=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix? Input Specification: The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=&lt;<=*m*<=≤<=50). It is guaranteed that *n* is prime. Pretests contain all the cases with restrictions 2<=≤<=*n*<=&lt;<=*m*<=≤<=4. Output Specification: Print YES, if *m* is the next prime number after *n*, or NO otherwise. Demo Input: ['3 5\n', '7 11\n', '7 9\n'] Demo Output: ['YES', 'YES', 'NO'] Note: none
```python def main(): T=input().split(' ') K=Prime(int(T[0])) if K==int(T[1]): print('YES') else: print('NO') def Prime(n): n+=1 while(not(Premier(n))): n+=1 return n def Premier(n): for i in range(2,n//2+1): if n%i==0: return False return True main() ```
3.977
584
A
Olesya and Rodion
PROGRAMMING
1,000
[ "math" ]
null
null
Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them. Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1.
The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by.
Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them.
[ "3 2\n" ]
[ "712" ]
none
500
[ { "input": "3 2", "output": "222" }, { "input": "2 2", "output": "22" }, { "input": "4 3", "output": "3333" }, { "input": "5 3", "output": "33333" }, { "input": "10 7", "output": "7777777777" }, { "input": "2 9", "output": "99" }, { "input": "18 8", "output": "888888888888888888" }, { "input": "1 5", "output": "5" }, { "input": "1 10", "output": "-1" }, { "input": "100 5", "output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "10 2", "output": "2222222222" }, { "input": "18 10", "output": "111111111111111110" }, { "input": "1 9", "output": "9" }, { "input": "7 6", "output": "6666666" }, { "input": "4 4", "output": "4444" }, { "input": "14 7", "output": "77777777777777" }, { "input": "3 8", "output": "888" }, { "input": "1 3", "output": "3" }, { "input": "2 8", "output": "88" }, { "input": "3 8", "output": "888" }, { "input": "4 3", "output": "3333" }, { "input": "5 9", "output": "99999" }, { "input": "4 8", "output": "8888" }, { "input": "3 4", "output": "444" }, { "input": "9 4", "output": "444444444" }, { "input": "8 10", "output": "11111110" }, { "input": "1 6", "output": "6" }, { "input": "20 3", "output": "33333333333333333333" }, { "input": "15 10", "output": "111111111111110" }, { "input": "31 4", "output": "4444444444444444444444444444444" }, { "input": "18 9", "output": "999999999999999999" }, { "input": "72 4", "output": "444444444444444444444444444444444444444444444444444444444444444444444444" }, { "input": "76 8", "output": "8888888888888888888888888888888888888888888888888888888888888888888888888888" }, { "input": "12 5", "output": "555555555555" }, { "input": "54 5", "output": "555555555555555555555555555555555555555555555555555555" }, { "input": "96 10", "output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "15 9", "output": "999999999999999" }, { "input": "100 2", "output": "2222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222" }, { "input": "99 3", "output": "333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333" }, { "input": "98 4", "output": "44444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444" }, { "input": "97 5", "output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "100 6", "output": "6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666" }, { "input": "99 7", "output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "98 8", "output": "88888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888" }, { "input": "97 9", "output": "9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999" }, { "input": "100 10", "output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "3 10", "output": "110" }, { "input": "2 4", "output": "44" }, { "input": "2 10", "output": "10" }, { "input": "10 10", "output": "1111111110" }, { "input": "4 10", "output": "1110" }, { "input": "25 10", "output": "1111111111111111111111110" }, { "input": "50 10", "output": "11111111111111111111111111111111111111111111111110" }, { "input": "5 10", "output": "11110" }, { "input": "99 10", "output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "100 10", "output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "1 2", "output": "2" }, { "input": "20 10", "output": "11111111111111111110" }, { "input": "99 7", "output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "89 5", "output": "55555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "6 10", "output": "111110" }, { "input": "3 8", "output": "888" }, { "input": "1 9", "output": "9" }, { "input": "1 4", "output": "4" }, { "input": "100 7", "output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" } ]
1,663,046,673
2,147,483,647
PyPy 3-64
TIME_LIMIT_EXCEEDED
TESTS
2
1,000
1,433,600
n,t = input().split(' ') n,t = eval(n),eval(t) s = 1 k = pow(10,n-1) while(k < pow(10,n)): if(k % t == 0): print(k) s = 0 break if s: print(-1)
Title: Olesya and Rodion Time Limit: None seconds Memory Limit: None megabytes Problem Description: Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them. Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1. Input Specification: The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by. Output Specification: Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them. Demo Input: ['3 2\n'] Demo Output: ['712'] Note: none
```python n,t = input().split(' ') n,t = eval(n),eval(t) s = 1 k = pow(10,n-1) while(k < pow(10,n)): if(k % t == 0): print(k) s = 0 break if s: print(-1) ```
0
615
A
Bulbs
PROGRAMMING
800
[ "implementation" ]
null
null
Vasya wants to turn on Christmas lights consisting of *m* bulbs. Initially, all bulbs are turned off. There are *n* buttons, each of them is connected to some set of bulbs. Vasya can press any of these buttons. When the button is pressed, it turns on all the bulbs it's connected to. Can Vasya light up all the bulbs? If Vasya presses the button such that some bulbs connected to it are already turned on, they do not change their state, i.e. remain turned on.
The first line of the input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of buttons and the number of bulbs respectively. Each of the next *n* lines contains *x**i* (0<=≤<=*x**i*<=≤<=*m*) — the number of bulbs that are turned on by the *i*-th button, and then *x**i* numbers *y**ij* (1<=≤<=*y**ij*<=≤<=*m*) — the numbers of these bulbs.
If it's possible to turn on all *m* bulbs print "YES", otherwise print "NO".
[ "3 4\n2 1 4\n3 1 3 1\n1 2\n", "3 3\n1 1\n1 2\n1 1\n" ]
[ "YES\n", "NO\n" ]
In the first sample you can press each button once and turn on all the bulbs. In the 2 sample it is impossible to turn on the 3-rd lamp.
500
[ { "input": "3 4\n2 1 4\n3 1 3 1\n1 2", "output": "YES" }, { "input": "3 3\n1 1\n1 2\n1 1", "output": "NO" }, { "input": "3 4\n1 1\n1 2\n1 3", "output": "NO" }, { "input": "1 5\n5 1 2 3 4 5", "output": "YES" }, { "input": "1 5\n5 4 4 1 2 3", "output": "NO" }, { "input": "1 5\n5 1 1 1 1 5", "output": "NO" }, { "input": "2 5\n4 3 1 4 2\n4 2 3 4 5", "output": "YES" }, { "input": "5 7\n2 6 7\n5 1 1 1 1 1\n3 6 5 4\n0\n4 4 3 2 1", "output": "YES" }, { "input": "100 100\n0\n0\n0\n1 53\n0\n0\n1 34\n1 54\n0\n1 14\n0\n1 33\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 82\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 34\n0\n0\n1 26\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 34\n0\n0\n0\n0\n0\n1 3\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 40\n0\n0\n0\n1 26\n0\n0\n0\n0\n0\n1 97\n0\n1 5\n0\n0\n0\n0\n0", "output": "NO" }, { "input": "100 100\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0", "output": "NO" }, { "input": "5 6\n3 1 2 6\n3 1 2 6\n1 1\n2 3 4\n3 1 5 6", "output": "YES" }, { "input": "5 2\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "NO" }, { "input": "1 4\n3 1 2 3", "output": "NO" }, { "input": "1 4\n3 2 3 4", "output": "NO" }, { "input": "2 4\n3 2 3 4\n1 1", "output": "YES" }, { "input": "2 4\n3 1 2 3\n1 4", "output": "YES" }, { "input": "5 1\n0\n0\n0\n0\n0", "output": "NO" }, { "input": "1 1\n0", "output": "NO" }, { "input": "1 10\n10 1 2 3 4 5 6 7 8 9 10", "output": "YES" }, { "input": "1 1\n1 1", "output": "YES" }, { "input": "1 100\n99 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99", "output": "NO" }, { "input": "1 3\n3 1 2 1", "output": "NO" }, { "input": "1 100\n100 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "YES" } ]
1,604,389,383
2,147,483,647
Python 3
OK
TESTS
45
109
0
n,m=map(int,input().split());bulbs=[] for i in range (n): bulb=[int(x) for x in input().split()] for k in range (0,bulb[0]): bulbs.append(bulb[k+1]) for j in range (0,m): if j+1 not in bulbs: print("NO") break else:print("YES")
Title: Bulbs Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya wants to turn on Christmas lights consisting of *m* bulbs. Initially, all bulbs are turned off. There are *n* buttons, each of them is connected to some set of bulbs. Vasya can press any of these buttons. When the button is pressed, it turns on all the bulbs it's connected to. Can Vasya light up all the bulbs? If Vasya presses the button such that some bulbs connected to it are already turned on, they do not change their state, i.e. remain turned on. Input Specification: The first line of the input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of buttons and the number of bulbs respectively. Each of the next *n* lines contains *x**i* (0<=≤<=*x**i*<=≤<=*m*) — the number of bulbs that are turned on by the *i*-th button, and then *x**i* numbers *y**ij* (1<=≤<=*y**ij*<=≤<=*m*) — the numbers of these bulbs. Output Specification: If it's possible to turn on all *m* bulbs print "YES", otherwise print "NO". Demo Input: ['3 4\n2 1 4\n3 1 3 1\n1 2\n', '3 3\n1 1\n1 2\n1 1\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample you can press each button once and turn on all the bulbs. In the 2 sample it is impossible to turn on the 3-rd lamp.
```python n,m=map(int,input().split());bulbs=[] for i in range (n): bulb=[int(x) for x in input().split()] for k in range (0,bulb[0]): bulbs.append(bulb[k+1]) for j in range (0,m): if j+1 not in bulbs: print("NO") break else:print("YES") ```
3
962
A
Equator
PROGRAMMING
1,300
[ "implementation" ]
null
null
Polycarp has created his own training plan to prepare for the programming contests. He will train for $n$ days, all days are numbered from $1$ to $n$, beginning from the first. On the $i$-th day Polycarp will necessarily solve $a_i$ problems. One evening Polycarp plans to celebrate the equator. He will celebrate it on the first evening of such a day that from the beginning of the training and to this day inclusive he will solve half or more of all the problems. Determine the index of day when Polycarp will celebrate the equator.
The first line contains a single integer $n$ ($1 \le n \le 200\,000$) — the number of days to prepare for the programming contests. The second line contains a sequence $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10\,000$), where $a_i$ equals to the number of problems, which Polycarp will solve on the $i$-th day.
Print the index of the day when Polycarp will celebrate the equator.
[ "4\n1 3 2 1\n", "6\n2 2 2 2 2 2\n" ]
[ "2\n", "3\n" ]
In the first example Polycarp will celebrate the equator on the evening of the second day, because up to this day (inclusive) he will solve $4$ out of $7$ scheduled problems on four days of the training. In the second example Polycarp will celebrate the equator on the evening of the third day, because up to this day (inclusive) he will solve $6$ out of $12$ scheduled problems on six days of the training.
0
[ { "input": "4\n1 3 2 1", "output": "2" }, { "input": "6\n2 2 2 2 2 2", "output": "3" }, { "input": "1\n10000", "output": "1" }, { "input": "3\n2 1 1", "output": "1" }, { "input": "2\n1 3", "output": "2" }, { "input": "4\n2 1 1 3", "output": "3" }, { "input": "3\n1 1 3", "output": "3" }, { "input": "3\n1 1 1", "output": "2" }, { "input": "2\n1 2", "output": "2" }, { "input": "3\n2 1 2", "output": "2" }, { "input": "5\n1 2 4 3 5", "output": "4" }, { "input": "5\n2 2 2 4 3", "output": "4" }, { "input": "4\n1 2 3 1", "output": "3" }, { "input": "6\n7 3 10 7 3 11", "output": "4" }, { "input": "2\n3 4", "output": "2" }, { "input": "5\n1 1 1 1 1", "output": "3" }, { "input": "4\n1 3 2 3", "output": "3" }, { "input": "2\n2 3", "output": "2" }, { "input": "3\n32 10 23", "output": "2" }, { "input": "7\n1 1 1 1 1 1 1", "output": "4" }, { "input": "3\n1 2 4", "output": "3" }, { "input": "6\n3 3 3 2 4 4", "output": "4" }, { "input": "9\n1 1 1 1 1 1 1 1 1", "output": "5" }, { "input": "5\n1 3 3 1 1", "output": "3" }, { "input": "4\n1 1 1 2", "output": "3" }, { "input": "4\n1 2 1 3", "output": "3" }, { "input": "3\n2 2 1", "output": "2" }, { "input": "4\n2 3 3 3", "output": "3" }, { "input": "4\n3 2 3 3", "output": "3" }, { "input": "4\n2 1 1 1", "output": "2" }, { "input": "3\n2 1 4", "output": "3" }, { "input": "2\n6 7", "output": "2" }, { "input": "4\n3 3 4 3", "output": "3" }, { "input": "4\n1 1 2 5", "output": "4" }, { "input": "4\n1 8 7 3", "output": "3" }, { "input": "6\n2 2 2 2 2 3", "output": "4" }, { "input": "3\n2 2 5", "output": "3" }, { "input": "4\n1 1 2 1", "output": "3" }, { "input": "5\n1 1 2 2 3", "output": "4" }, { "input": "5\n9 5 3 4 8", "output": "3" }, { "input": "3\n3 3 1", "output": "2" }, { "input": "4\n1 2 2 2", "output": "3" }, { "input": "3\n1 3 5", "output": "3" }, { "input": "4\n1 1 3 6", "output": "4" }, { "input": "6\n1 2 1 1 1 1", "output": "3" }, { "input": "3\n3 1 3", "output": "2" }, { "input": "5\n3 4 5 1 2", "output": "3" }, { "input": "11\n1 1 1 1 1 1 1 1 1 1 1", "output": "6" }, { "input": "5\n3 1 2 5 2", "output": "4" }, { "input": "4\n1 1 1 4", "output": "4" }, { "input": "4\n2 6 1 10", "output": "4" }, { "input": "4\n2 2 3 2", "output": "3" }, { "input": "4\n4 2 2 1", "output": "2" }, { "input": "6\n1 1 1 1 1 4", "output": "5" }, { "input": "3\n3 2 2", "output": "2" }, { "input": "6\n1 3 5 1 7 4", "output": "5" }, { "input": "5\n1 2 4 8 16", "output": "5" }, { "input": "5\n1 2 4 4 4", "output": "4" }, { "input": "6\n4 2 1 2 3 1", "output": "3" }, { "input": "4\n3 2 1 5", "output": "3" }, { "input": "1\n1", "output": "1" }, { "input": "3\n2 4 7", "output": "3" }, { "input": "5\n1 1 1 1 3", "output": "4" }, { "input": "3\n3 1 5", "output": "3" }, { "input": "4\n1 2 3 7", "output": "4" }, { "input": "3\n1 4 6", "output": "3" }, { "input": "4\n2 1 2 2", "output": "3" }, { "input": "2\n4 5", "output": "2" }, { "input": "5\n1 2 1 2 1", "output": "3" }, { "input": "3\n2 3 6", "output": "3" }, { "input": "6\n1 1 4 1 1 5", "output": "4" }, { "input": "5\n2 2 2 2 1", "output": "3" }, { "input": "2\n5 6", "output": "2" }, { "input": "4\n2 2 1 4", "output": "3" }, { "input": "5\n2 2 3 4 4", "output": "4" }, { "input": "4\n3 1 1 2", "output": "2" }, { "input": "5\n3 4 1 4 5", "output": "4" }, { "input": "4\n1 3 1 6", "output": "4" }, { "input": "5\n1 1 1 2 2", "output": "4" }, { "input": "4\n1 4 2 4", "output": "3" }, { "input": "10\n1 1 1 1 1 1 1 1 1 8", "output": "9" }, { "input": "4\n1 4 5 1", "output": "3" }, { "input": "5\n1 1 1 1 5", "output": "5" }, { "input": "4\n1 3 4 1", "output": "3" }, { "input": "4\n2 2 2 3", "output": "3" }, { "input": "4\n2 3 2 4", "output": "3" }, { "input": "5\n2 2 1 2 2", "output": "3" }, { "input": "3\n4 3 2", "output": "2" }, { "input": "3\n6 5 2", "output": "2" }, { "input": "69\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "35" }, { "input": "6\n1 1 1 1 1 2", "output": "4" }, { "input": "5\n1 2 5 4 5", "output": "4" }, { "input": "2\n9 10", "output": "2" }, { "input": "3\n1 1 5", "output": "3" }, { "input": "4\n3 4 3 5", "output": "3" }, { "input": "4\n1 4 3 3", "output": "3" }, { "input": "4\n7 1 3 4", "output": "2" }, { "input": "3\n100 100 1", "output": "2" }, { "input": "4\n5 2 2 2", "output": "2" } ]
1,603,460,145
2,147,483,647
Python 3
OK
TESTS
106
171
13,516,800
def h(i): return (i >> 1) + (i & 1) input() a = [int(i) for i in input().split()] t, c = h(sum(a)), 0 for i, ai in enumerate(a): c += ai if c >= t: print(i+1) break
Title: Equator Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp has created his own training plan to prepare for the programming contests. He will train for $n$ days, all days are numbered from $1$ to $n$, beginning from the first. On the $i$-th day Polycarp will necessarily solve $a_i$ problems. One evening Polycarp plans to celebrate the equator. He will celebrate it on the first evening of such a day that from the beginning of the training and to this day inclusive he will solve half or more of all the problems. Determine the index of day when Polycarp will celebrate the equator. Input Specification: The first line contains a single integer $n$ ($1 \le n \le 200\,000$) — the number of days to prepare for the programming contests. The second line contains a sequence $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10\,000$), where $a_i$ equals to the number of problems, which Polycarp will solve on the $i$-th day. Output Specification: Print the index of the day when Polycarp will celebrate the equator. Demo Input: ['4\n1 3 2 1\n', '6\n2 2 2 2 2 2\n'] Demo Output: ['2\n', '3\n'] Note: In the first example Polycarp will celebrate the equator on the evening of the second day, because up to this day (inclusive) he will solve $4$ out of $7$ scheduled problems on four days of the training. In the second example Polycarp will celebrate the equator on the evening of the third day, because up to this day (inclusive) he will solve $6$ out of $12$ scheduled problems on six days of the training.
```python def h(i): return (i >> 1) + (i & 1) input() a = [int(i) for i in input().split()] t, c = h(sum(a)), 0 for i, ai in enumerate(a): c += ai if c >= t: print(i+1) break ```
3
141
A
Amusing Joke
PROGRAMMING
800
[ "implementation", "sortings", "strings" ]
null
null
So, the New Year holidays are over. Santa Claus and his colleagues can take a rest and have guests at last. When two "New Year and Christmas Men" meet, thear assistants cut out of cardboard the letters from the guest's name and the host's name in honor of this event. Then the hung the letters above the main entrance. One night, when everyone went to bed, someone took all the letters of our characters' names. Then he may have shuffled the letters and put them in one pile in front of the door. The next morning it was impossible to find the culprit who had made the disorder. But everybody wondered whether it is possible to restore the names of the host and his guests from the letters lying at the door? That is, we need to verify that there are no extra letters, and that nobody will need to cut more letters. Help the "New Year and Christmas Men" and their friends to cope with this problem. You are given both inscriptions that hung over the front door the previous night, and a pile of letters that were found at the front door next morning.
The input file consists of three lines: the first line contains the guest's name, the second line contains the name of the residence host and the third line contains letters in a pile that were found at the door in the morning. All lines are not empty and contain only uppercase Latin letters. The length of each line does not exceed 100.
Print "YES" without the quotes, if the letters in the pile could be permuted to make the names of the "New Year and Christmas Men". Otherwise, print "NO" without the quotes.
[ "SANTACLAUS\nDEDMOROZ\nSANTAMOROZDEDCLAUS\n", "PAPAINOEL\nJOULUPUKKI\nJOULNAPAOILELUPUKKI\n", "BABBONATALE\nFATHERCHRISTMAS\nBABCHRISTMASBONATALLEFATHER\n" ]
[ "YES\n", "NO\n", "NO\n" ]
In the first sample the letters written in the last line can be used to write the names and there won't be any extra letters left. In the second sample letter "P" is missing from the pile and there's an extra letter "L". In the third sample there's an extra letter "L".
500
[ { "input": "SANTACLAUS\nDEDMOROZ\nSANTAMOROZDEDCLAUS", "output": "YES" }, { "input": "PAPAINOEL\nJOULUPUKKI\nJOULNAPAOILELUPUKKI", "output": "NO" }, { "input": "BABBONATALE\nFATHERCHRISTMAS\nBABCHRISTMASBONATALLEFATHER", "output": "NO" }, { "input": "B\nA\nAB", "output": "YES" }, { "input": "ONDOL\nJNPB\nONLNJBODP", "output": "YES" }, { "input": "Y\nW\nYW", "output": "YES" }, { "input": "OI\nM\nIMO", "output": "YES" }, { "input": "VFQRWWWACX\nGHZJPOQUSXRAQDGOGMR\nOPAWDOUSGWWCGQXXQAZJRQRGHRMVF", "output": "YES" }, { "input": "JUTCN\nPIGMZOPMEUFADQBW\nNWQGZMAIPUPOMCDUB", "output": "NO" }, { "input": "Z\nO\nZOCNDOLTBZKQLTBOLDEGXRHZGTTPBJBLSJCVSVXISQZCSFDEBXRCSGBGTHWOVIXYHACAGBRYBKBJAEPIQZHVEGLYH", "output": "NO" }, { "input": "IQ\nOQ\nQOQIGGKFNHJSGCGM", "output": "NO" }, { "input": "ROUWANOPNIGTVMIITVMZ\nOQTUPZMTKUGY\nVTVNGZITGPUNPMQOOATUUIYIWMMKZOTR", "output": "YES" }, { "input": "OVQELLOGFIOLEHXMEMBJDIGBPGEYFG\nJNKFPFFIJOFHRIFHXEWYZOPDJBZTJZKBWQTECNHRFSJPJOAPQT\nYAIPFFFEXJJNEJPLREIGODEGQZVMCOBDFKWTMWJSBEBTOFFQOHIQJLHFNXIGOHEZRZLFOKJBJPTPHPGY", "output": "YES" }, { "input": "NBJGVNGUISUXQTBOBKYHQCOOVQWUXWPXBUDLXPKX\nNSFQDFUMQDQWQ\nWXKKVNTDQQFXCUQBIMQGQHSLVGWSBFYBUPOWPBDUUJUXQNOQDNXOX", "output": "YES" }, { "input": "IJHHGKCXWDBRWJUPRDBZJLNTTNWKXLUGJSBWBOAUKWRAQWGFNL\nNJMWRMBCNPHXTDQQNZ\nWDNJRCLILNQRHWBANLTXWMJBPKUPGKJDJZAQWKTZFBRCTXHHBNXRGUQUNBNMWODGSJWW", "output": "YES" }, { "input": "SRROWANGUGZHCIEFYMQVTWVOMDWPUZJFRDUMVFHYNHNTTGNXCJ\nDJYWGLBFCCECXFHOLORDGDCNRHPWXNHXFCXQCEZUHRRNAEKUIX\nWCUJDNYHNHYOPWMHLDCDYRWBVOGHFFUKOZTXJRXJHRGWICCMRNEVNEGQWTZPNFCSHDRFCFQDCXMHTLUGZAXOFNXNVGUEXIACRERU", "output": "YES" }, { "input": "H\nJKFGHMIAHNDBMFXWYQLZRSVNOTEGCQSVUBYUOZBTNKTXPFQDCMKAGFITEUGOYDFIYQIORMFJEOJDNTFVIQEBICSNGKOSNLNXJWC\nBQSVDOGIHCHXSYNYTQFCHNJGYFIXTSOQINZOKSVQJMTKNTGFNXAVTUYEONMBQMGJLEWJOFGEARIOPKFUFCEMUBRBDNIIDFZDCLWK", "output": "YES" }, { "input": "DSWNZRFVXQ\nPVULCZGOOU\nUOLVZXNUPOQRZGWFVDSCANQTCLEIE", "output": "NO" }, { "input": "EUHTSCENIPXLTSBMLFHD\nIZAVSZPDLXOAGESUSE\nLXAELAZ", "output": "NO" }, { "input": "WYSJFEREGELSKRQRXDXCGBODEFZVSI\nPEJKMGFLBFFDWRCRFSHVEFLEBTJCVCHRJTLDTISHPOGFWPLEWNYJLMXWIAOTYOXMV\nHXERTZWLEXTPIOTFRVMEJVYFFJLRPFMXDEBNSGCEOFFCWTKIDDGCFYSJKGLHBORWEPLDRXRSJYBGASSVCMHEEJFLVI", "output": "NO" }, { "input": "EPBMDIUQAAUGLBIETKOKFLMTCVEPETWJRHHYKCKU\nHGMAETVPCFZYNNKDQXVXUALHYLOTCHM\nECGXACVKEYMCEDOTMKAUFHLHOMT", "output": "NO" }, { "input": "NUBKQEJHALANSHEIFUZHYEZKKDRFHQKAJHLAOWTZIMOCWOVVDW\nEFVOBIGAUAUSQGVSNBKNOBDMINODMFSHDL\nKLAMKNTHBFFOHVKWICHBKNDDQNEISODUSDNLUSIOAVWY", "output": "NO" }, { "input": "VXINHOMEQCATZUGAJEIUIZZLPYFGUTVLNBNWCUVMEENUXKBWBGZTMRJJVJDLVSLBABVCEUDDSQFHOYPYQTWVAGTWOLKYISAGHBMC\nZMRGXPZSHOGCSAECAPGVOIGCWEOWWOJXLGYRDMPXBLOKZVRACPYQLEQGFQCVYXAGBEBELUTDAYEAGPFKXRULZCKFHZCHVCWIRGPK\nRCVUXGQVNWFGRUDLLENNDQEJHYYVWMKTLOVIPELKPWCLSQPTAXAYEMGWCBXEVAIZGGDDRBRT", "output": "NO" }, { "input": "PHBDHHWUUTZAHELGSGGOPOQXSXEZIXHZTOKYFBQLBDYWPVCNQSXHEAXRRPVHFJBVBYCJIFOTQTWSUOWXLKMVJJBNLGTVITWTCZZ\nFUPDLNVIHRWTEEEHOOEC\nLOUSUUSZCHJBPEWIILUOXEXRQNCJEGTOBRVZLTTZAHTKVEJSNGHFTAYGY", "output": "NO" }, { "input": "GDSLNIIKTO\nJF\nPDQYFKDTNOLI", "output": "NO" }, { "input": "AHOKHEKKPJLJIIWJRCGY\nORELJCSIX\nZVWPXVFWFSWOXXLIHJKPXIOKRELYE", "output": "NO" }, { "input": "ZWCOJFORBPHXCOVJIDPKVECMHVHCOC\nTEV\nJVGTBFTLFVIEPCCHODOFOMCVZHWXVCPEH", "output": "NO" }, { "input": "AGFIGYWJLVMYZGNQHEHWKJIAWBPUAQFERMCDROFN\nPMJNHMVNRGCYZAVRWNDSMLSZHFNYIUWFPUSKKIGU\nMCDVPPRXGUAYLSDRHRURZASXUWZSIIEZCPXUVEONKNGNWRYGOSFMCKESMVJZHWWUCHWDQMLASLNNMHAU", "output": "NO" }, { "input": "XLOWVFCZSSXCSYQTIIDKHNTKNKEEDFMDZKXSPVLBIDIREDUAIN\nZKIWNDGBISDB\nSLPKLYFYSRNRMOSWYLJJDGFFENPOXYLPZFTQDANKBDNZDIIEWSUTTKYBKVICLG", "output": "NO" }, { "input": "PMUKBTRKFIAYVGBKHZHUSJYSSEPEOEWPOSPJLWLOCTUYZODLTUAFCMVKGQKRRUSOMPAYOTBTFPXYAZXLOADDEJBDLYOTXJCJYTHA\nTWRRAJLCQJTKOKWCGUH\nEWDPNXVCXWCDQCOYKKSOYTFSZTOOPKPRDKFJDETKSRAJRVCPDOBWUGPYRJPUWJYWCBLKOOTUPBESTOFXZHTYLLMCAXDYAEBUTAHM", "output": "NO" }, { "input": "QMIMGQRQDMJDPNFEFXSXQMCHEJKTWCTCVZPUAYICOIRYOWKUSIWXJLHDYWSBOITHTMINXFKBKAWZTXXBJIVYCRWKXNKIYKLDDXL\nV\nFWACCXBVDOJFIUAVYRALBYJKXXWIIFORRUHKHCXLDBZMXIYJWISFEAWTIQFIZSBXMKNOCQKVKRWDNDAMQSTKYLDNYVTUCGOJXJTW", "output": "NO" }, { "input": "XJXPVOOQODELPPWUISSYVVXRJTYBPDHJNENQEVQNVFIXSESKXVYPVVHPMOSX\nLEXOPFPVPSZK\nZVXVPYEYOYXVOISVLXPOVHEQVXPNQJIOPFDTXEUNMPEPPHELNXKKWSVSOXSBPSJDPVJVSRFQ", "output": "YES" }, { "input": "OSKFHGYNQLSRFSAHPXKGPXUHXTRBJNAQRBSSWJVEENLJCDDHFXVCUNPZAIVVO\nFNUOCXAGRRHNDJAHVVLGGEZQHWARYHENBKHP\nUOEFNWVXCUNERLKVTHAGPSHKHDYFPYWZHJKHQLSNFBJHVJANRXCNSDUGVDABGHVAOVHBJZXGRACHRXEGNRPQEAPORQSILNXFS", "output": "YES" }, { "input": "VYXYVVACMLPDHONBUTQFZTRREERBLKUJYKAHZRCTRLRCLOZYWVPBRGDQPFPQIF\nFE\nRNRPEVDRLYUQFYRZBCQLCYZEABKLRXCJLKVZBVFUEYRATOMDRTHFPGOWQVTIFPPH", "output": "YES" }, { "input": "WYXUZQJQNLASEGLHPMSARWMTTQMQLVAZLGHPIZTRVTCXDXBOLNXZPOFCTEHCXBZ\nBLQZRRWP\nGIQZXPLTTMNHQVWPPEAPLOCDMBSTHRCFLCQRRZXLVAOQEGZBRUZJXXZTMAWLZHSLWNQTYXB", "output": "YES" }, { "input": "MKVJTSSTDGKPVVDPYSRJJYEVGKBMSIOKHLZQAEWLRIBINVRDAJIBCEITKDHUCCVY\nPUJJQFHOGZKTAVNUGKQUHMKTNHCCTI\nQVJKUSIGTSVYUMOMLEGHWYKSKQTGATTKBNTKCJKJPCAIRJIRMHKBIZISEGFHVUVQZBDERJCVAKDLNTHUDCHONDCVVJIYPP", "output": "YES" }, { "input": "OKNJOEYVMZXJMLVJHCSPLUCNYGTDASKSGKKCRVIDGEIBEWRVBVRVZZTLMCJLXHJIA\nDJBFVRTARTFZOWN\nAGHNVUNJVCPLWSVYBJKZSVTFGLELZASLWTIXDDJXCZDICTVIJOTMVEYOVRNMJGRKKHRMEBORAKFCZJBR", "output": "YES" }, { "input": "OQZACLPSAGYDWHFXDFYFRRXWGIEJGSXWUONAFWNFXDTGVNDEWNQPHUXUJNZWWLBPYL\nOHBKWRFDRQUAFRCMT\nWIQRYXRJQWWRUWCYXNXALKFZGXFTLOODWRDPGURFUFUQOHPWBASZNVWXNCAGHWEHFYESJNFBMNFDDAPLDGT", "output": "YES" }, { "input": "OVIRQRFQOOWVDEPLCJETWQSINIOPLTLXHSQWUYUJNFBMKDNOSHNJQQCDHZOJVPRYVSV\nMYYDQKOOYPOOUELCRIT\nNZSOTVLJTTVQLFHDQEJONEOUOFOLYVSOIYUDNOSIQVIRMVOERCLMYSHPCQKIDRDOQPCUPQBWWRYYOXJWJQPNKH", "output": "YES" }, { "input": "WGMBZWNMSJXNGDUQUJTCNXDSJJLYRDOPEGPQXYUGBESDLFTJRZDDCAAFGCOCYCQMDBWK\nYOBMOVYTUATTFGJLYUQD\nDYXVTLQCYFJUNJTUXPUYOPCBCLBWNSDUJRJGWDOJDSQAAMUOJWSYERDYDXYTMTOTMQCGQZDCGNFBALGGDFKZMEBG", "output": "YES" }, { "input": "CWLRBPMEZCXAPUUQFXCUHAQTLPBTXUUKWVXKBHKNSSJFEXLZMXGVFHHVTPYAQYTIKXJJE\nMUFOSEUEXEQTOVLGDSCWM\nJUKEQCXOXWEHCGKFPBIGMWVJLXUONFXBYTUAXERYTXKCESKLXAEHVPZMMUFTHLXTTZSDMBJLQPEUWCVUHSQQVUASPF", "output": "YES" }, { "input": "IDQRX\nWETHO\nODPDGBHVUVSSISROHQJTUKPUCLXABIZQQPPBPKOSEWGEHRSRRNBAVLYEMZISMWWGKHVTXKUGUXEFBSWOIWUHRJGMWBMHQLDZHBWA", "output": "NO" }, { "input": "IXFDY\nJRMOU\nDF", "output": "NO" }, { "input": "JPSPZ\nUGCUB\nJMZZZZZZZZ", "output": "NO" }, { "input": "AC\nA\nBBA", "output": "NO" }, { "input": "UIKWWKXLSHTOOZOVGXKYSOJEHAUEEG\nKZXQDWJJWRXFHKJDQHJK\nXMZHTFOGEXAUJXXJUYVJIFOTKLZHDKELJWERHMGAWGKWAQKEKHIDWGGZVYOHKXRPWSJDPESFJUMKQYWBYUTHQYEFZUGKQOBHYDWB", "output": "NO" }, { "input": "PXWRXRPFLR\nPJRWWXIVHODV\nXW", "output": "NO" }, { "input": "CHTAZVHGSHCVIBK\nEQINEBKXEPYJSAZIMLDF\nZCZZZZDZMCZZEZDZZEZZZZQZZBZZZOZZCZE", "output": "NO" }, { "input": "GXPZFSELJJNDAXYRV\nUYBKPMVBSOVOJWMONLTJOJCNQKMTAHEWLHOWIIBH\nHCWNFWJPEJIWOVPTBMVCRJLSISSVNOHCKLBFMIUAIMASQWPXEYXBOXQGFEMYJLBKDCZIMJNHOJEDGGANIVYKQTUOSOVOPWHVJGXH", "output": "NO" }, { "input": "LFGJCJJDUTUP\nOVSBILTIYCJCRHKCIXCETJQJJ\nGIJJTJCLTJJJ", "output": "NO" }, { "input": "GIO\nPRL\nPRL", "output": "NO" }, { "input": "A\nB\nABC", "output": "NO" }, { "input": "KKK\nKKK\nZZZZZ", "output": "NO" }, { "input": "ZMYGQLDBLAPN\nZFJBKWHROVNPSJQUDFTHOCGREUFLYIWYICD\nZMJZZEDAZANKZZZZZZEZZBZDZZZZZZKHZZFZZZDZNZMDZZA", "output": "NO" } ]
1,684,645,587
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
4
92
0
guest_name = input() host_name = input() pile_letters = input() guest_counts = {} host_counts = {} for letter in guest_name: guest_counts[letter] = guest_counts.get(letter, 0) + 1 for letter in host_name: host_counts[letter] = host_counts.get(letter, 0) + 1 for letter in pile_letters: if letter in guest_counts: guest_counts[letter] -= 1 if guest_counts[letter] < 0: print("NO") exit() elif letter in host_counts: host_counts[letter] -= 1 if host_counts[letter] < 0: print("NO") exit() else: print("NO") exit() if any(guest_counts.values()) or any(host_counts.values()): print("NO") else: print("YES")
Title: Amusing Joke Time Limit: None seconds Memory Limit: None megabytes Problem Description: So, the New Year holidays are over. Santa Claus and his colleagues can take a rest and have guests at last. When two "New Year and Christmas Men" meet, thear assistants cut out of cardboard the letters from the guest's name and the host's name in honor of this event. Then the hung the letters above the main entrance. One night, when everyone went to bed, someone took all the letters of our characters' names. Then he may have shuffled the letters and put them in one pile in front of the door. The next morning it was impossible to find the culprit who had made the disorder. But everybody wondered whether it is possible to restore the names of the host and his guests from the letters lying at the door? That is, we need to verify that there are no extra letters, and that nobody will need to cut more letters. Help the "New Year and Christmas Men" and their friends to cope with this problem. You are given both inscriptions that hung over the front door the previous night, and a pile of letters that were found at the front door next morning. Input Specification: The input file consists of three lines: the first line contains the guest's name, the second line contains the name of the residence host and the third line contains letters in a pile that were found at the door in the morning. All lines are not empty and contain only uppercase Latin letters. The length of each line does not exceed 100. Output Specification: Print "YES" without the quotes, if the letters in the pile could be permuted to make the names of the "New Year and Christmas Men". Otherwise, print "NO" without the quotes. Demo Input: ['SANTACLAUS\nDEDMOROZ\nSANTAMOROZDEDCLAUS\n', 'PAPAINOEL\nJOULUPUKKI\nJOULNAPAOILELUPUKKI\n', 'BABBONATALE\nFATHERCHRISTMAS\nBABCHRISTMASBONATALLEFATHER\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: In the first sample the letters written in the last line can be used to write the names and there won't be any extra letters left. In the second sample letter "P" is missing from the pile and there's an extra letter "L". In the third sample there's an extra letter "L".
```python guest_name = input() host_name = input() pile_letters = input() guest_counts = {} host_counts = {} for letter in guest_name: guest_counts[letter] = guest_counts.get(letter, 0) + 1 for letter in host_name: host_counts[letter] = host_counts.get(letter, 0) + 1 for letter in pile_letters: if letter in guest_counts: guest_counts[letter] -= 1 if guest_counts[letter] < 0: print("NO") exit() elif letter in host_counts: host_counts[letter] -= 1 if host_counts[letter] < 0: print("NO") exit() else: print("NO") exit() if any(guest_counts.values()) or any(host_counts.values()): print("NO") else: print("YES") ```
0
61
A
Ultra-Fast Mathematician
PROGRAMMING
800
[ "implementation" ]
A. Ultra-Fast Mathematician
2
256
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Write one line — the corresponding answer. Do not omit the leading 0s.
[ "1010100\n0100101\n", "000\n111\n", "1110\n1010\n", "01110\n01100\n" ]
[ "1110001\n", "111\n", "0100\n", "00010\n" ]
none
500
[ { "input": "1010100\n0100101", "output": "1110001" }, { "input": "000\n111", "output": "111" }, { "input": "1110\n1010", "output": "0100" }, { "input": "01110\n01100", "output": "00010" }, { "input": "011101\n000001", "output": "011100" }, { "input": "10\n01", "output": "11" }, { "input": "00111111\n11011101", "output": "11100010" }, { "input": "011001100\n101001010", "output": "110000110" }, { "input": "1100100001\n0110101100", "output": "1010001101" }, { "input": "00011101010\n10010100101", "output": "10001001111" }, { "input": "100000101101\n111010100011", "output": "011010001110" }, { "input": "1000001111010\n1101100110001", "output": "0101101001011" }, { "input": "01011111010111\n10001110111010", "output": "11010001101101" }, { "input": "110010000111100\n001100101011010", "output": "111110101100110" }, { "input": "0010010111110000\n0000000011010110", "output": "0010010100100110" }, { "input": "00111110111110000\n01111100001100000", "output": "01000010110010000" }, { "input": "101010101111010001\n001001111101111101", "output": "100011010010101100" }, { "input": "0110010101111100000\n0011000101000000110", "output": "0101010000111100110" }, { "input": "11110100011101010111\n00001000011011000000", "output": "11111100000110010111" }, { "input": "101010101111101101001\n111010010010000011111", "output": "010000111101101110110" }, { "input": "0000111111100011000010\n1110110110110000001010", "output": "1110001001010011001000" }, { "input": "10010010101000110111000\n00101110100110111000111", "output": "10111100001110001111111" }, { "input": "010010010010111100000111\n100100111111100011001110", "output": "110110101101011111001001" }, { "input": "0101110100100111011010010\n0101100011010111001010001", "output": "0000010111110000010000011" }, { "input": "10010010100011110111111011\n10000110101100000001000100", "output": "00010100001111110110111111" }, { "input": "000001111000000100001000000\n011100111101111001110110001", "output": "011101000101111101111110001" }, { "input": "0011110010001001011001011100\n0000101101000011101011001010", "output": "0011011111001010110010010110" }, { "input": "11111000000000010011001101111\n11101110011001010100010000000", "output": "00010110011001000111011101111" }, { "input": "011001110000110100001100101100\n001010000011110000001000101001", "output": "010011110011000100000100000101" }, { "input": "1011111010001100011010110101111\n1011001110010000000101100010101", "output": "0000110100011100011111010111010" }, { "input": "10111000100001000001010110000001\n10111000001100101011011001011000", "output": "00000000101101101010001111011001" }, { "input": "000001010000100001000000011011100\n111111111001010100100001100000111", "output": "111110101001110101100001111011011" }, { "input": "1101000000000010011011101100000110\n1110000001100010011010000011011110", "output": "0011000001100000000001101111011000" }, { "input": "01011011000010100001100100011110001\n01011010111000001010010100001110000", "output": "00000001111010101011110000010000001" }, { "input": "000011111000011001000110111100000100\n011011000110000111101011100111000111", "output": "011000111110011110101101011011000011" }, { "input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000", "output": "1011001001111001001011101010101000010" }, { "input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011", "output": "10001110000010101110000111000011111110" }, { "input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100", "output": "000100001011110000011101110111010001110" }, { "input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001", "output": "1101110101010110000011000000101011110011" }, { "input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100", "output": "11001011110010010000010111001100001001110" }, { "input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110", "output": "001100101000011111111101111011101010111001" }, { "input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001", "output": "0111010010100110110101100010000100010100000" }, { "input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100", "output": "11111110000000100101000100110111001100011001" }, { "input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011", "output": "101011011100100010100011011001101010100100010" }, { "input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001", "output": "1101001100111011010111110110101111001011110111" }, { "input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001", "output": "10010101000101000000011010011110011110011110001" }, { "input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100", "output": "011011011100000000010101110010000000101000111101" }, { "input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100", "output": "0101010111101001011011110110011101010101010100011" }, { "input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011", "output": "11001011010010111000010110011101100100001110111111" }, { "input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011", "output": "111011101010011100001111101001101011110010010110001" }, { "input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001", "output": "0100111110110011111110010010010000110111100101101101" }, { "input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100", "output": "01011001110111010111001100010011010100010000111011000" }, { "input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111", "output": "100011101001001000011011011001111000100000010100100100" }, { "input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110", "output": "1100110010000101101010111111101001001001110101110010110" }, { "input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110", "output": "01000111100111001011110010100011111111110010101100001101" }, { "input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010", "output": "110001010001000011000101110101000100001011111001011001001" }, { "input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111", "output": "1110100010111000101001001011101110011111100111000011011011" }, { "input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110", "output": "01110110101110100100110011010000001000101100101111000111011" }, { "input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011", "output": "111100101000000011101011011001110010101111000110010010000000" }, { "input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111", "output": "0100100010111110010011101010000011111110001110010110010111001" }, { "input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111", "output": "00110100000011001101101100100010110010001100000001100110011101" }, { "input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011", "output": "000000011000111011110011101000010000010100101000000011010110010" }, { "input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010", "output": "0010100110110100111100100100101101010100100111011010001001010101" }, { "input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111", "output": "11010110111100101111101001100001110100010110010110110111100110100" }, { "input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111", "output": "111111010011011100101110100110111111111001111110011010111111110000" }, { "input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110", "output": "1010101010100010001001001001100000111000010010010100010011000100000" }, { "input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000", "output": "00011111011111001000011100010011100011010100101011011000001001111110" }, { "input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111", "output": "001111000011001110100111010101111111011100110011001010010010000111011" }, { "input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101", "output": "0110001100110100010000110111000010011010011000011001010011010100010100" }, { "input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010", "output": "00010000000110110101000011001000000100100110111010011111101010001010000" }, { "input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001", "output": "000100100000000110011100100001010110101001100101110010010011111001110111" }, { "input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000", "output": "1000111100010011010110011101000000101010101100011111100001101111001010010" }, { "input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011", "output": "01000010011110111001011011110000001011000111101101101010010110001010100100" }, { "input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101", "output": "101101110110110010011100001011111100100001110000101100110000100011011100110" }, { "input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001", "output": "1110111111110010111000001100101010101011010100101010100101100011001001111111" }, { "input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111", "output": "10111011000111000101110100101000100111011011100011110110000101010001111010111" }, { "input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110", "output": "110100100110000101010010011010011001100110000111010000010100001011110111111101" }, { "input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111", "output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111" }, { "input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001", "output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001" }, { "input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110", "output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011" }, { "input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111", "output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101" }, { "input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010", "output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101" }, { "input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000", "output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001" }, { "input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011", "output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110" }, { "input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011", "output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011" }, { "input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011", "output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011" }, { "input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010", "output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011" }, { "input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001", "output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110" }, { "input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111", "output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010" }, { "input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011", "output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011" }, { "input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100", "output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000" }, { "input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001", "output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101" }, { "input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110", "output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101" }, { "input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011", "output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110" }, { "input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111", "output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110" }, { "input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000", "output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001" }, { "input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010", "output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101" }, { "input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101", "output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011" }, { "input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011", "output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010" }, { "input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010", "output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011" }, { "input": "0\n0", "output": "0" }, { "input": "0\n1", "output": "1" } ]
1,681,725,001
2,147,483,647
PyPy 3
OK
TESTS
102
170
0
n1 = input() n2 = input() l = [] for i in range(len(n1)): if n1[i]!=n2[i]: l.append('1') else: l.append('0') res = "".join(l) print(res)
Title: Ultra-Fast Mathematician Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate. Input Specification: There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. Output Specification: Write one line — the corresponding answer. Do not omit the leading 0s. Demo Input: ['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n'] Demo Output: ['1110001\n', '111\n', '0100\n', '00010\n'] Note: none
```python n1 = input() n2 = input() l = [] for i in range(len(n1)): if n1[i]!=n2[i]: l.append('1') else: l.append('0') res = "".join(l) print(res) ```
3.9575
994
A
Fingerprints
PROGRAMMING
800
[ "implementation" ]
null
null
You are locked in a room with a door that has a keypad with 10 keys corresponding to digits from 0 to 9. To escape from the room, you need to enter a correct code. You also have a sequence of digits. Some keys on the keypad have fingerprints. You believe the correct code is the longest not necessarily contiguous subsequence of the sequence you have that only contains digits with fingerprints on the corresponding keys. Find such code.
The first line contains two integers $n$ and $m$ ($1 \le n, m \le 10$) representing the number of digits in the sequence you have and the number of keys on the keypad that have fingerprints. The next line contains $n$ distinct space-separated integers $x_1, x_2, \ldots, x_n$ ($0 \le x_i \le 9$) representing the sequence. The next line contains $m$ distinct space-separated integers $y_1, y_2, \ldots, y_m$ ($0 \le y_i \le 9$) — the keys with fingerprints.
In a single line print a space-separated sequence of integers representing the code. If the resulting sequence is empty, both printing nothing and printing a single line break is acceptable.
[ "7 3\n3 5 7 1 6 2 8\n1 2 7\n", "4 4\n3 4 1 0\n0 1 7 9\n" ]
[ "7 1 2\n", "1 0\n" ]
In the first example, the only digits with fingerprints are $1$, $2$ and $7$. All three of them appear in the sequence you know, $7$ first, then $1$ and then $2$. Therefore the output is 7 1 2. Note that the order is important, and shall be the same as the order in the original sequence. In the second example digits $0$, $1$, $7$ and $9$ have fingerprints, however only $0$ and $1$ appear in the original sequence. $1$ appears earlier, so the output is 1 0. Again, the order is important.
500
[ { "input": "7 3\n3 5 7 1 6 2 8\n1 2 7", "output": "7 1 2" }, { "input": "4 4\n3 4 1 0\n0 1 7 9", "output": "1 0" }, { "input": "9 4\n9 8 7 6 5 4 3 2 1\n2 4 6 8", "output": "8 6 4 2" }, { "input": "10 5\n3 7 1 2 4 6 9 0 5 8\n4 3 0 7 9", "output": "3 7 4 9 0" }, { "input": "10 10\n1 2 3 4 5 6 7 8 9 0\n4 5 6 7 1 2 3 0 9 8", "output": "1 2 3 4 5 6 7 8 9 0" }, { "input": "1 1\n4\n4", "output": "4" }, { "input": "3 7\n6 3 4\n4 9 0 1 7 8 6", "output": "6 4" }, { "input": "10 1\n9 0 8 1 7 4 6 5 2 3\n0", "output": "0" }, { "input": "5 10\n6 0 3 8 1\n3 1 0 5 4 7 2 8 9 6", "output": "6 0 3 8 1" }, { "input": "8 2\n7 2 9 6 1 0 3 4\n6 3", "output": "6 3" }, { "input": "5 4\n7 0 1 4 9\n0 9 5 3", "output": "0 9" }, { "input": "10 1\n9 6 2 0 1 8 3 4 7 5\n6", "output": "6" }, { "input": "10 2\n7 1 0 2 4 6 5 9 3 8\n3 2", "output": "2 3" }, { "input": "5 9\n3 7 9 2 4\n3 8 4 5 9 6 1 0 2", "output": "3 9 2 4" }, { "input": "10 6\n7 1 2 3 8 0 6 4 5 9\n1 5 8 2 3 6", "output": "1 2 3 8 6 5" }, { "input": "8 2\n7 4 8 9 2 5 6 1\n6 4", "output": "4 6" }, { "input": "10 2\n1 0 3 5 8 9 4 7 6 2\n0 3", "output": "0 3" }, { "input": "7 6\n9 2 8 6 1 3 7\n4 2 0 3 1 8", "output": "2 8 1 3" }, { "input": "1 6\n3\n6 8 2 4 5 3", "output": "3" }, { "input": "1 8\n0\n9 2 4 8 1 5 0 7", "output": "0" }, { "input": "6 9\n7 3 9 4 1 0\n9 1 5 8 0 6 2 7 4", "output": "7 9 4 1 0" }, { "input": "10 2\n4 9 6 8 3 0 1 5 7 2\n0 1", "output": "0 1" }, { "input": "10 5\n5 2 8 0 9 7 6 1 4 3\n9 6 4 1 2", "output": "2 9 6 1 4" }, { "input": "6 3\n8 3 9 2 7 6\n5 4 3", "output": "3" }, { "input": "4 10\n8 3 9 6\n4 9 6 2 7 0 8 1 3 5", "output": "8 3 9 6" }, { "input": "1 2\n1\n1 0", "output": "1" }, { "input": "3 6\n1 2 3\n4 5 6 1 2 3", "output": "1 2 3" }, { "input": "1 2\n2\n1 2", "output": "2" }, { "input": "1 10\n9\n0 1 2 3 4 5 6 7 8 9", "output": "9" } ]
1,616,760,292
2,147,483,647
Python 3
OK
TESTS
31
62
0
n,m = map(int, input().split(' ')) seq = list(map(int, input().split(' '))) fin = list(map(int, input().split(' '))) code=[] for i in seq: if i in fin: code.append(i) for i in code: print(i, end=" ")
Title: Fingerprints Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are locked in a room with a door that has a keypad with 10 keys corresponding to digits from 0 to 9. To escape from the room, you need to enter a correct code. You also have a sequence of digits. Some keys on the keypad have fingerprints. You believe the correct code is the longest not necessarily contiguous subsequence of the sequence you have that only contains digits with fingerprints on the corresponding keys. Find such code. Input Specification: The first line contains two integers $n$ and $m$ ($1 \le n, m \le 10$) representing the number of digits in the sequence you have and the number of keys on the keypad that have fingerprints. The next line contains $n$ distinct space-separated integers $x_1, x_2, \ldots, x_n$ ($0 \le x_i \le 9$) representing the sequence. The next line contains $m$ distinct space-separated integers $y_1, y_2, \ldots, y_m$ ($0 \le y_i \le 9$) — the keys with fingerprints. Output Specification: In a single line print a space-separated sequence of integers representing the code. If the resulting sequence is empty, both printing nothing and printing a single line break is acceptable. Demo Input: ['7 3\n3 5 7 1 6 2 8\n1 2 7\n', '4 4\n3 4 1 0\n0 1 7 9\n'] Demo Output: ['7 1 2\n', '1 0\n'] Note: In the first example, the only digits with fingerprints are $1$, $2$ and $7$. All three of them appear in the sequence you know, $7$ first, then $1$ and then $2$. Therefore the output is 7 1 2. Note that the order is important, and shall be the same as the order in the original sequence. In the second example digits $0$, $1$, $7$ and $9$ have fingerprints, however only $0$ and $1$ appear in the original sequence. $1$ appears earlier, so the output is 1 0. Again, the order is important.
```python n,m = map(int, input().split(' ')) seq = list(map(int, input().split(' '))) fin = list(map(int, input().split(' '))) code=[] for i in seq: if i in fin: code.append(i) for i in code: print(i, end=" ") ```
3
813
A
The Contest
PROGRAMMING
1,100
[ "implementation" ]
null
null
Pasha is participating in a contest on one well-known website. This time he wants to win the contest and will do anything to get to the first place! This contest consists of *n* problems, and Pasha solves *i*th problem in *a**i* time units (his solutions are always correct). At any moment of time he can be thinking about a solution to only one of the problems (that is, he cannot be solving two problems at the same time). The time Pasha spends to send his solutions is negligible. Pasha can send any number of solutions at the same moment. Unfortunately, there are too many participants, and the website is not always working. Pasha received the information that the website will be working only during *m* time periods, *j*th period is represented by its starting moment *l**j* and ending moment *r**j*. Of course, Pasha can send his solution only when the website is working. In other words, Pasha can send his solution at some moment *T* iff there exists a period *x* such that *l**x*<=≤<=*T*<=≤<=*r**x*. Pasha wants to know his best possible result. We need to tell him the minimal moment of time by which he is able to have solutions to all problems submitted, if he acts optimally, or say that it's impossible no matter how Pasha solves the problems.
The first line contains one integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=105) — the time Pasha needs to solve *i*th problem. The third line contains one integer *m* (0<=≤<=*m*<=≤<=1000) — the number of periods of time when the website is working. Next *m* lines represent these periods. *j*th line contains two numbers *l**j* and *r**j* (1<=≤<=*l**j*<=&lt;<=*r**j*<=≤<=105) — the starting and the ending moment of *j*th period. It is guaranteed that the periods are not intersecting and are given in chronological order, so for every *j*<=&gt;<=1 the condition *l**j*<=&gt;<=*r**j*<=-<=1 is met.
If Pasha can solve and submit all the problems before the end of the contest, print the minimal moment of time by which he can have all the solutions submitted. Otherwise print "-1" (without brackets).
[ "2\n3 4\n2\n1 4\n7 9\n", "1\n5\n1\n1 4\n", "1\n5\n1\n1 5\n" ]
[ "7\n", "-1\n", "5\n" ]
In the first example Pasha can act like this: he solves the second problem in 4 units of time and sends it immediately. Then he spends 3 time units to solve the first problem and sends it 7 time units after the contest starts, because at this moment the website starts working again. In the second example Pasha invents the solution only after the website stops working for the last time. In the third example Pasha sends the solution exactly at the end of the first period.
0
[ { "input": "2\n3 4\n2\n1 4\n7 9", "output": "7" }, { "input": "1\n5\n1\n1 4", "output": "-1" }, { "input": "1\n5\n1\n1 5", "output": "5" }, { "input": "5\n100000 100000 100000 100000 100000\n0", "output": "-1" }, { "input": "5\n886 524 128 4068 298\n3\n416 3755\n4496 11945\n17198 18039", "output": "5904" }, { "input": "10\n575 3526 1144 1161 889 1038 790 19 765 357\n2\n4475 10787\n16364 21678", "output": "10264" }, { "input": "1\n4\n1\n5 9", "output": "5" }, { "input": "1\n200\n4\n1 10\n20 40\n50 55\n190 210", "output": "200" }, { "input": "4\n643 70 173 745\n14\n990 995\n1256 1259\n1494 1499\n1797 1804\n2443 2450\n2854 2859\n3164 3167\n4084 4092\n4615 4622\n5555 5563\n6412 6421\n7173 7180\n7566 7571\n8407 8415", "output": "1797" }, { "input": "42\n749 516 256 497 37 315 184 518 103 726 80 983 474 884 209 706 10 543 587 371 199 315 967 707 948 736 590 734 715 184 230 513 199 898 287 468 250 600 352 29 408 22\n2\n312 314\n1293 1302", "output": "-1" }, { "input": "1\n10000\n2\n1 10\n9998 10000", "output": "10000" }, { "input": "1\n547\n15\n774 779\n1598 1605\n2458 2464\n3138 3140\n3372 3378\n4268 4272\n4730 4733\n5064 5067\n5074 5075\n5483 5490\n5894 5901\n5931 5938\n6750 6756\n7487 7491\n8328 8332", "output": "774" }, { "input": "1\n10\n2\n1 2\n11 12", "output": "11" }, { "input": "2\n4 6\n2\n5 10\n15 20", "output": "10" }, { "input": "2\n16 5\n3\n5 10\n15 20\n25 30", "output": "25" }, { "input": "1\n16\n2\n5 10\n15 20", "output": "16" }, { "input": "44\n750 672 846 969 981 698 380 968 813 587 156 28 446 917 849 449 173 764 226 958 335 622 236 782 416 689 113 728 452 265 585 217 707 50 520 712 946 275 423 123 175 268 583 528\n4\n869 870\n1353 1354\n1683 1685\n2532 2540", "output": "-1" }, { "input": "1\n1\n0", "output": "-1" }, { "input": "3\n1 2 5\n3\n5 6\n7 8\n9 13", "output": "8" }, { "input": "1\n2\n0", "output": "-1" }, { "input": "1\n5\n3\n1 2\n3 4\n10 11", "output": "10" }, { "input": "1\n4\n0", "output": "-1" }, { "input": "1\n5\n0", "output": "-1" }, { "input": "1\n239\n0", "output": "-1" } ]
1,559,209,011
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
1
202
1,331,200
#Bhargey Mehta (Sophomore) #DA-IICT, Gandhinagar import sys, math, queue, bisect #sys.stdin = open("input.txt", "r") MOD = 10**9+7 sys.setrecursionlimit(1000000) n = int(input()) s = sum(map(int, input().split())) ans = -1 for _ in range(int(input())): l, r = map(int, input().split()) if r <= s: if ans == -1: ans = max(s, l) else: ans = min(ans, max(s, l)) print(ans)
Title: The Contest Time Limit: None seconds Memory Limit: None megabytes Problem Description: Pasha is participating in a contest on one well-known website. This time he wants to win the contest and will do anything to get to the first place! This contest consists of *n* problems, and Pasha solves *i*th problem in *a**i* time units (his solutions are always correct). At any moment of time he can be thinking about a solution to only one of the problems (that is, he cannot be solving two problems at the same time). The time Pasha spends to send his solutions is negligible. Pasha can send any number of solutions at the same moment. Unfortunately, there are too many participants, and the website is not always working. Pasha received the information that the website will be working only during *m* time periods, *j*th period is represented by its starting moment *l**j* and ending moment *r**j*. Of course, Pasha can send his solution only when the website is working. In other words, Pasha can send his solution at some moment *T* iff there exists a period *x* such that *l**x*<=≤<=*T*<=≤<=*r**x*. Pasha wants to know his best possible result. We need to tell him the minimal moment of time by which he is able to have solutions to all problems submitted, if he acts optimally, or say that it's impossible no matter how Pasha solves the problems. Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=105) — the time Pasha needs to solve *i*th problem. The third line contains one integer *m* (0<=≤<=*m*<=≤<=1000) — the number of periods of time when the website is working. Next *m* lines represent these periods. *j*th line contains two numbers *l**j* and *r**j* (1<=≤<=*l**j*<=&lt;<=*r**j*<=≤<=105) — the starting and the ending moment of *j*th period. It is guaranteed that the periods are not intersecting and are given in chronological order, so for every *j*<=&gt;<=1 the condition *l**j*<=&gt;<=*r**j*<=-<=1 is met. Output Specification: If Pasha can solve and submit all the problems before the end of the contest, print the minimal moment of time by which he can have all the solutions submitted. Otherwise print "-1" (without brackets). Demo Input: ['2\n3 4\n2\n1 4\n7 9\n', '1\n5\n1\n1 4\n', '1\n5\n1\n1 5\n'] Demo Output: ['7\n', '-1\n', '5\n'] Note: In the first example Pasha can act like this: he solves the second problem in 4 units of time and sends it immediately. Then he spends 3 time units to solve the first problem and sends it 7 time units after the contest starts, because at this moment the website starts working again. In the second example Pasha invents the solution only after the website stops working for the last time. In the third example Pasha sends the solution exactly at the end of the first period.
```python #Bhargey Mehta (Sophomore) #DA-IICT, Gandhinagar import sys, math, queue, bisect #sys.stdin = open("input.txt", "r") MOD = 10**9+7 sys.setrecursionlimit(1000000) n = int(input()) s = sum(map(int, input().split())) ans = -1 for _ in range(int(input())): l, r = map(int, input().split()) if r <= s: if ans == -1: ans = max(s, l) else: ans = min(ans, max(s, l)) print(ans) ```
0
884
A
Book Reading
PROGRAMMING
800
[ "implementation" ]
null
null
Recently Luba bought a very interesting book. She knows that it will take *t* seconds to read the book. Luba wants to finish reading as fast as she can. But she has some work to do in each of *n* next days. The number of seconds that Luba has to spend working during *i*-th day is *a**i*. If some free time remains, she can spend it on reading. Help Luba to determine the minimum number of day when she finishes reading. It is guaranteed that the answer doesn't exceed *n*. Remember that there are 86400 seconds in a day.
The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=100, 1<=≤<=*t*<=≤<=106) — the number of days and the time required to read the book. The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=86400) — the time Luba has to spend on her work during *i*-th day.
Print the minimum day Luba can finish reading the book. It is guaranteed that answer doesn't exceed *n*.
[ "2 2\n86400 86398\n", "2 86400\n0 86400\n" ]
[ "2\n", "1\n" ]
none
0
[ { "input": "2 2\n86400 86398", "output": "2" }, { "input": "2 86400\n0 86400", "output": "1" }, { "input": "2 86400\n1 86399", "output": "2" }, { "input": "100 1000000\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "12" }, { "input": "1 1\n86399", "output": "1" }, { "input": "6 1200\n86400 86400 86000 86000 86000 86400", "output": "5" }, { "input": "6 1200\n86400 86400 86000 86000 86001 86399", "output": "6" }, { "input": "4 172799\n1 1 86400 0", "output": "4" }, { "input": "4 172799\n0 86400 86399 0", "output": "4" }, { "input": "6 1\n1 1 86400 1 86399 1", "output": "1" }, { "input": "4 1\n86400 86399 86400 86400", "output": "2" }, { "input": "4 1\n86400 86400 0 86400", "output": "3" } ]
1,510,238,784
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
46
0
n, x = list(map(int, input().split())) a = list(map(int, input().split())) if (sum(a) == x - (n-1)): print ("YES") else: print ("NO")
Title: Book Reading Time Limit: None seconds Memory Limit: None megabytes Problem Description: Recently Luba bought a very interesting book. She knows that it will take *t* seconds to read the book. Luba wants to finish reading as fast as she can. But she has some work to do in each of *n* next days. The number of seconds that Luba has to spend working during *i*-th day is *a**i*. If some free time remains, she can spend it on reading. Help Luba to determine the minimum number of day when she finishes reading. It is guaranteed that the answer doesn't exceed *n*. Remember that there are 86400 seconds in a day. Input Specification: The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=100, 1<=≤<=*t*<=≤<=106) — the number of days and the time required to read the book. The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=86400) — the time Luba has to spend on her work during *i*-th day. Output Specification: Print the minimum day Luba can finish reading the book. It is guaranteed that answer doesn't exceed *n*. Demo Input: ['2 2\n86400 86398\n', '2 86400\n0 86400\n'] Demo Output: ['2\n', '1\n'] Note: none
```python n, x = list(map(int, input().split())) a = list(map(int, input().split())) if (sum(a) == x - (n-1)): print ("YES") else: print ("NO") ```
0
69
A
Young Physicist
PROGRAMMING
1,000
[ "implementation", "math" ]
A. Young Physicist
2
256
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
[ "3\n4 1 7\n-2 4 -1\n1 -5 -3\n", "3\n3 -1 7\n-5 2 -4\n2 -1 -3\n" ]
[ "NO", "YES" ]
none
500
[ { "input": "3\n4 1 7\n-2 4 -1\n1 -5 -3", "output": "NO" }, { "input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3", "output": "YES" }, { "input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41", "output": "NO" }, { "input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33", "output": "NO" }, { "input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7", "output": "NO" }, { "input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38", "output": "NO" }, { "input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6", "output": "YES" }, { "input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0", "output": "YES" }, { "input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0", "output": "YES" }, { "input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0", "output": "YES" }, { "input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0", "output": "YES" }, { "input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0", "output": "YES" }, { "input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87", "output": "YES" }, { "input": "3\n1 2 3\n3 2 1\n0 0 0", "output": "NO" }, { "input": "2\n5 -23 12\n0 0 0", "output": "NO" }, { "input": "1\n0 0 0", "output": "YES" }, { "input": "1\n1 -2 0", "output": "NO" }, { "input": "2\n-23 77 -86\n23 -77 86", "output": "YES" }, { "input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82", "output": "YES" }, { "input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0", "output": "YES" }, { "input": "3\n96 49 -12\n2 -66 28\n-98 17 -16", "output": "YES" }, { "input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0", "output": "YES" }, { "input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53", "output": "YES" }, { "input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1", "output": "YES" }, { "input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0", "output": "YES" }, { "input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0", "output": "YES" }, { "input": "3\n0 2 -2\n1 -1 3\n-3 0 0", "output": "NO" } ]
1,578,336,366
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
216
0
n=int(input()) arr=[[int(i) for i in input().split(' ')] for j in range(n)] for i in range(n): for j in range(3): sum=sum+arr[i][j] pass pass if(sum==0): print('YES') else: print('NO')
Title: Young Physicist Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. Input Specification: The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). Output Specification: Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. Demo Input: ['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n'] Demo Output: ['NO', 'YES'] Note: none
```python n=int(input()) arr=[[int(i) for i in input().split(' ')] for j in range(n)] for i in range(n): for j in range(3): sum=sum+arr[i][j] pass pass if(sum==0): print('YES') else: print('NO') ```
-1
411
B
Multi-core Processor
PROGRAMMING
1,600
[ "implementation" ]
null
null
The research center Q has developed a new multi-core processor. The processor consists of *n* cores and has *k* cells of cache memory. Consider the work of this processor. At each cycle each core of the processor gets one instruction: either do nothing, or the number of the memory cell (the core will write an information to the cell). After receiving the command, the core executes it immediately. Sometimes it happens that at one cycle, multiple cores try to write the information into a single cell. Unfortunately, the developers did not foresee the possibility of resolving conflicts between cores, so in this case there is a deadlock: all these cores and the corresponding memory cell are locked forever. Each of the locked cores ignores all further commands, and no core in the future will be able to record an information into the locked cell. If any of the cores tries to write an information into some locked cell, it is immediately locked. The development team wants to explore the deadlock situation. Therefore, they need a program that will simulate the processor for a given set of instructions for each core within *m* cycles . You're lucky, this interesting work is entrusted to you. According to the instructions, during the *m* cycles define for each core the number of the cycle, during which it will become locked. It is believed that initially all cores and all memory cells are not locked.
The first line contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=100). Then follow *n* lines describing instructions. The *i*-th line contains *m* integers: *x**i*1,<=*x**i*2,<=...,<=*x**im* (0<=≤<=*x**ij*<=≤<=*k*), where *x**ij* is the instruction that must be executed by the *i*-th core at the *j*-th cycle. If *x**ij* equals 0, then the corresponding instruction is «do nothing». But if *x**ij* is a number from 1 to *k*, then the corresponding instruction is «write information to the memory cell number *x**ij*». We assume that the cores are numbered from 1 to *n*, the work cycles are numbered from 1 to *m* and the memory cells are numbered from 1 to *k*.
Print *n* lines. In the *i*-th line print integer *t**i*. This number should be equal to 0 if the *i*-th core won't be locked, or it should be equal to the number of the cycle when this core will be locked.
[ "4 3 5\n1 0 0\n1 0 2\n2 3 1\n3 2 0\n", "3 2 2\n1 2\n1 2\n2 2\n", "1 1 1\n0\n" ]
[ "1\n1\n3\n0\n", "1\n1\n0\n", "0\n" ]
none
0
[ { "input": "4 3 5\n1 0 0\n1 0 2\n2 3 1\n3 2 0", "output": "1\n1\n3\n0" }, { "input": "3 2 2\n1 2\n1 2\n2 2", "output": "1\n1\n0" }, { "input": "1 1 1\n0", "output": "0" }, { "input": "1 1 1\n1", "output": "0" }, { "input": "2 1 1\n1\n1", "output": "1\n1" }, { "input": "2 1 1\n1\n0", "output": "0\n0" }, { "input": "2 1 1\n0\n1", "output": "0\n0" }, { "input": "2 1 1\n0\n0", "output": "0\n0" }, { "input": "2 1 2\n1\n2", "output": "0\n0" }, { "input": "2 1 1\n1\n1", "output": "1\n1" }, { "input": "2 2 2\n2 1\n0 2", "output": "0\n0" }, { "input": "1 100 100\n32 97 28 73 22 27 27 21 25 26 21 95 45 60 47 64 44 88 24 10 82 55 84 69 86 70 99 99 34 59 71 83 53 90 29 100 98 68 24 82 5 67 49 70 23 85 5 90 57 0 99 26 32 11 81 92 6 45 32 72 54 32 20 37 40 33 55 55 33 61 13 31 67 51 74 96 67 13 28 3 23 99 26 6 91 95 67 29 46 78 85 17 47 83 26 51 88 31 37 15", "output": "0" }, { "input": "100 1 100\n59\n37\n53\n72\n37\n15\n8\n93\n92\n74\n11\n11\n68\n16\n92\n40\n76\n20\n10\n86\n76\n5\n9\n95\n5\n81\n44\n57\n10\n24\n22\n2\n57\n6\n26\n67\n48\n95\n34\n97\n55\n33\n70\n66\n51\n70\n74\n65\n35\n85\n37\n9\n27\n43\n65\n6\n5\n57\n54\n27\n22\n41\n8\n29\n10\n50\n9\n68\n78\n9\n92\n30\n88\n62\n30\n5\n80\n58\n19\n39\n22\n88\n81\n34\n36\n18\n28\n93\n64\n27\n47\n89\n30\n21\n24\n42\n34\n100\n27\n46", "output": "0\n1\n0\n0\n1\n0\n1\n1\n1\n1\n1\n1\n1\n0\n1\n0\n1\n0\n1\n0\n1\n1\n1\n1\n1\n1\n0\n1\n1\n1\n1\n0\n1\n1\n0\n0\n0\n1\n1\n0\n0\n0\n1\n0\n0\n1\n1\n1\n0\n0\n1\n1\n1\n0\n1\n1\n1\n1\n0\n1\n1\n0\n1\n0\n1\n0\n1\n1\n0\n1\n1\n1\n1\n0\n1\n1\n0\n0\n0\n0\n1\n1\n1\n1\n0\n0\n0\n1\n0\n1\n0\n0\n1\n0\n1\n0\n1\n0\n1\n0" }, { "input": "1 100 10\n7 2 8 3 0 10 0 3 0 5 3 6 4 1 2 2 5 1 7 10 7 9 10 6 2 8 6 10 0 10 4 4 4 9 7 0 0 8 6 2 2 4 10 10 5 9 4 6 1 1 9 7 2 7 4 7 2 2 3 3 10 3 8 1 0 4 3 10 9 8 6 2 10 7 5 10 0 3 6 2 3 6 6 2 5 9 10 0 10 4 10 3 4 2 2 10 4 5 7 8", "output": "0" }, { "input": "100 1 10\n10\n6\n8\n2\n4\n3\n3\n2\n0\n2\n10\n5\n10\n4\n10\n2\n6\n9\n1\n1\n1\n3\n7\n3\n9\n10\n6\n1\n4\n1\n4\n1\n4\n4\n5\n1\n9\n4\n10\n3\n3\n2\n8\n10\n1\n2\n10\n4\n8\n8\n4\n8\n6\n3\n8\n6\n8\n1\n2\n3\n2\n2\n9\n4\n1\n10\n10\n7\n8\n10\n8\n8\n10\n9\n2\n0\n5\n0\n9\n0\n2\n6\n7\n4\n5\n4\n2\n3\n1\n9\n7\n0\n10\n7\n2\n1\n1\n9\n6\n7", "output": "1\n1\n1\n1\n1\n1\n1\n1\n0\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n0\n1\n0\n1\n0\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n0\n1\n1\n1\n1\n1\n1\n1\n1" }, { "input": "7 2 98\n0 72\n71 26\n87 23\n26 37\n65 97\n81 30\n19 83", "output": "0\n0\n0\n0\n0\n0\n0" } ]
1,397,541,109
35,509
Python 3
WRONG_ANSWER
TESTS
11
234
204,800
n, m, k = list(map(int, input().split())) mem = [0] * k commands = [] deadmem = [] cproc = 0 def matrot(mat): result = [] for j in range(len(mat[0])): temp = [] for i in range(len(mat)): temp.append(mat[i][j]) result.append(temp) return result answ = [0] * n def checkmem(mat, cycle): global deadmem global m global answ flag = 0 for i in range(n): if mat[i][cycle] in deadmem: mat[i] = [0] * m answ[i] = cycle+1 flag = 1 if flag == 0: answ[i] = 0 for i in range(n): commands.append(list(map(int, input().split()))) #print(commands) #print(commands) for i in range(m): for x in range(1, k+1): if matrot(commands)[i].count(x) > 1: deadmem.append(x) #print(deadmem, i) # print(deadmem) # print(commands) checkmem(commands, i) [print(x) for x in answ]
Title: Multi-core Processor Time Limit: None seconds Memory Limit: None megabytes Problem Description: The research center Q has developed a new multi-core processor. The processor consists of *n* cores and has *k* cells of cache memory. Consider the work of this processor. At each cycle each core of the processor gets one instruction: either do nothing, or the number of the memory cell (the core will write an information to the cell). After receiving the command, the core executes it immediately. Sometimes it happens that at one cycle, multiple cores try to write the information into a single cell. Unfortunately, the developers did not foresee the possibility of resolving conflicts between cores, so in this case there is a deadlock: all these cores and the corresponding memory cell are locked forever. Each of the locked cores ignores all further commands, and no core in the future will be able to record an information into the locked cell. If any of the cores tries to write an information into some locked cell, it is immediately locked. The development team wants to explore the deadlock situation. Therefore, they need a program that will simulate the processor for a given set of instructions for each core within *m* cycles . You're lucky, this interesting work is entrusted to you. According to the instructions, during the *m* cycles define for each core the number of the cycle, during which it will become locked. It is believed that initially all cores and all memory cells are not locked. Input Specification: The first line contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=100). Then follow *n* lines describing instructions. The *i*-th line contains *m* integers: *x**i*1,<=*x**i*2,<=...,<=*x**im* (0<=≤<=*x**ij*<=≤<=*k*), where *x**ij* is the instruction that must be executed by the *i*-th core at the *j*-th cycle. If *x**ij* equals 0, then the corresponding instruction is «do nothing». But if *x**ij* is a number from 1 to *k*, then the corresponding instruction is «write information to the memory cell number *x**ij*». We assume that the cores are numbered from 1 to *n*, the work cycles are numbered from 1 to *m* and the memory cells are numbered from 1 to *k*. Output Specification: Print *n* lines. In the *i*-th line print integer *t**i*. This number should be equal to 0 if the *i*-th core won't be locked, or it should be equal to the number of the cycle when this core will be locked. Demo Input: ['4 3 5\n1 0 0\n1 0 2\n2 3 1\n3 2 0\n', '3 2 2\n1 2\n1 2\n2 2\n', '1 1 1\n0\n'] Demo Output: ['1\n1\n3\n0\n', '1\n1\n0\n', '0\n'] Note: none
```python n, m, k = list(map(int, input().split())) mem = [0] * k commands = [] deadmem = [] cproc = 0 def matrot(mat): result = [] for j in range(len(mat[0])): temp = [] for i in range(len(mat)): temp.append(mat[i][j]) result.append(temp) return result answ = [0] * n def checkmem(mat, cycle): global deadmem global m global answ flag = 0 for i in range(n): if mat[i][cycle] in deadmem: mat[i] = [0] * m answ[i] = cycle+1 flag = 1 if flag == 0: answ[i] = 0 for i in range(n): commands.append(list(map(int, input().split()))) #print(commands) #print(commands) for i in range(m): for x in range(1, k+1): if matrot(commands)[i].count(x) > 1: deadmem.append(x) #print(deadmem, i) # print(deadmem) # print(commands) checkmem(commands, i) [print(x) for x in answ] ```
0
7
C
Line
PROGRAMMING
1,800
[ "math", "number theory" ]
C. Line
1
256
A line on the plane is described by an equation *Ax*<=+<=*By*<=+<=*C*<==<=0. You are to find any point on this line, whose coordinates are integer numbers from <=-<=5·1018 to 5·1018 inclusive, or to find out that such points do not exist.
The first line contains three integers *A*, *B* and *C* (<=-<=2·109<=≤<=*A*,<=*B*,<=*C*<=≤<=2·109) — corresponding coefficients of the line equation. It is guaranteed that *A*2<=+<=*B*2<=&gt;<=0.
If the required point exists, output its coordinates, otherwise output -1.
[ "2 5 3\n" ]
[ "6 -3\n" ]
none
0
[ { "input": "2 5 3", "output": "6 -3" }, { "input": "0 2 3", "output": "-1" }, { "input": "931480234 -1767614767 -320146190", "output": "-98880374013340920 -52107006370101410" }, { "input": "-1548994394 -1586527767 -1203252104", "output": "-878123061596147680 857348814150663048" }, { "input": "296038088 887120955 1338330394", "output": "2114412129515872 -705593211994286" }, { "input": "1906842444 749552572 -1693767003", "output": "-1" }, { "input": "-1638453107 317016895 -430897103", "output": "-23538272620589909 -121653945000687008" }, { "input": "-1183748658 875864960 -1315510852", "output": "-97498198168399474 -131770725522871624" }, { "input": "427055698 738296578 -52640953", "output": "-1" }, { "input": "-1516373701 -584304312 -746376800", "output": "202167007852295200 -524659372900676000" }, { "input": "200000003 200000001 1", "output": "100000000 -100000001" }, { "input": "0 -1 -2", "output": "0 -2" }, { "input": "0 15 -17", "output": "-1" }, { "input": "-13 0 0", "output": "0 0" }, { "input": "-1000 0 -6", "output": "-1" }, { "input": "1233978557 804808375 539283626", "output": "3168196851074932 -4857661898189602" }, { "input": "532430220 -2899704 -328786059", "output": "-1" }, { "input": "546348890 -29226055 -341135185", "output": "50549411713300 944965544604433" }, { "input": "-1061610169 583743042 1503847115", "output": "-333340893817405 -606222356685680" }, { "input": "10273743 174653631 -628469658", "output": "-1" }, { "input": "1 2000000000 -1", "output": "1 0" }, { "input": "592707810 829317963 -753392742", "output": "-15849808632976 11327748563154" }, { "input": "1300000013 0 -800000008", "output": "-1" }, { "input": "853072 -269205 -1778980", "output": "7238140 22936620" }, { "input": "3162 56 674", "output": "-4381 247358" }, { "input": "19 -5 115", "output": "115 460" }, { "input": "7 5 -17", "output": "-34 51" }, { "input": "-1 1 -2", "output": "-2 0" }, { "input": "12453630 -163142553 -74721780", "output": "-780 -60" }, { "input": "-3416750 528845750 -93743375", "output": "-1" }, { "input": "701408733 1134903170 1836311903", "output": "-796030994547383611 491974210728665288" }, { "input": "1000000013 -1 135", "output": "0 135" }, { "input": "-2000000000 1 2000000000", "output": "0 -2000000000" }, { "input": "2000000000 -2000000000 2000000000", "output": "-1 0" }, { "input": "610684570 628836350 933504357", "output": "-1" }, { "input": "827797728 -613880705 854959653", "output": "60828197453915544 82024802605070757" }, { "input": "1044910887 -700497854 -1772517851", "output": "572270531415215165 853638173436907976" }, { "input": "1663473197 -1943214909 -399995353", "output": "90913128604458086 77825438652462521" }, { "input": "1880586355 -177315705 -478540057", "output": "-1" }, { "input": "-957757861 308710346 45337024", "output": "587450634832960 1822535171726016" }, { "input": "19999 -20000 10000", "output": "10000 10000" }, { "input": "1999999 -2000000 1000000", "output": "1000000 1000000" }, { "input": "999999999 -1000000000 500000000", "output": "500000000 500000000" }, { "input": "999999999 -2 1", "output": "-1 -499999999" }, { "input": "999999993 999999991 1", "output": "499999995 -499999996" }, { "input": "999999993 -999999997 1", "output": "-249999999 -249999998" }, { "input": "1999999993 1999999991 -1", "output": "-999999995 999999996" }, { "input": "1999999993 1999999991 -1999999997", "output": "-1999999987000000015 1999999989000000012" } ]
1,461,158,016
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
92
4,608,000
a, b, c = map(int, input().split()) x = 0 c = -c y = (c - a * x) / b print(x, end=' ') print(y)
Title: Line Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: A line on the plane is described by an equation *Ax*<=+<=*By*<=+<=*C*<==<=0. You are to find any point on this line, whose coordinates are integer numbers from <=-<=5·1018 to 5·1018 inclusive, or to find out that such points do not exist. Input Specification: The first line contains three integers *A*, *B* and *C* (<=-<=2·109<=≤<=*A*,<=*B*,<=*C*<=≤<=2·109) — corresponding coefficients of the line equation. It is guaranteed that *A*2<=+<=*B*2<=&gt;<=0. Output Specification: If the required point exists, output its coordinates, otherwise output -1. Demo Input: ['2 5 3\n'] Demo Output: ['6 -3\n'] Note: none
```python a, b, c = map(int, input().split()) x = 0 c = -c y = (c - a * x) / b print(x, end=' ') print(y) ```
0
460
B
Little Dima and Equation
PROGRAMMING
1,500
[ "brute force", "implementation", "math", "number theory" ]
null
null
Little Dima misbehaved during a math lesson a lot and the nasty teacher Mr. Pickles gave him the following problem as a punishment. Find all integer solutions *x* (0<=&lt;<=*x*<=&lt;<=109) of the equation: where *a*, *b*, *c* are some predetermined constant values and function *s*(*x*) determines the sum of all digits in the decimal representation of number *x*. The teacher gives this problem to Dima for each lesson. He changes only the parameters of the equation: *a*, *b*, *c*. Dima got sick of getting bad marks and he asks you to help him solve this challenging problem.
The first line contains three space-separated integers: *a*,<=*b*,<=*c* (1<=≤<=*a*<=≤<=5; 1<=≤<=*b*<=≤<=10000; <=-<=10000<=≤<=*c*<=≤<=10000).
Print integer *n* — the number of the solutions that you've found. Next print *n* integers in the increasing order — the solutions of the given equation. Print only integer solutions that are larger than zero and strictly less than 109.
[ "3 2 8\n", "1 2 -18\n", "2 2 -1\n" ]
[ "3\n10 2008 13726 ", "0\n", "4\n1 31 337 967 " ]
none
1,000
[ { "input": "3 2 8", "output": "3\n10 2008 13726 " }, { "input": "1 2 -18", "output": "0" }, { "input": "2 2 -1", "output": "4\n1 31 337 967 " }, { "input": "1 1 0", "output": "9\n1 2 3 4 5 6 7 8 9 " }, { "input": "1 37 963", "output": "16\n1000 1111 1222 1333 1370 1407 1444 1481 1518 1555 1592 1629 1666 1777 1888 1999 " }, { "input": "1 298 -1665", "output": "17\n123 421 1017 1315 1613 1911 2209 2507 2805 4295 4593 4891 5189 5487 5785 6679 6977 " }, { "input": "1 3034 -9234", "output": "23\n12004 21106 24140 30208 33242 39310 42344 48412 51446 54480 57514 60548 63582 66616 69650 72684 75718 78752 81786 87854 90888 96956 99990 " }, { "input": "5 9998 9998", "output": "0" }, { "input": "5 10000 10000", "output": "0" }, { "input": "5 65 352", "output": "1\n208000352 " }, { "input": "5 9999 9999", "output": "0" }, { "input": "4 2099 -38", "output": "0" }, { "input": "1 1 -6708", "output": "0" }, { "input": "5 36 -46", "output": "0" }, { "input": "5 8975 -4", "output": "0" }, { "input": "3 2794 -3354", "output": "5\n165733932 308990694 392855398 415958984 999999980 " }, { "input": "5 1 4473", "output": "11\n1424330 14353380 17214841 52526348 60470649 69348430 164920697 184532598 205967449 418199966 459169497 " }, { "input": "5 1 -9999", "output": "6\n90001 2466100 17200369 52511876 60456177 205952977 " }, { "input": "4 4 6", "output": "13\n10 1030 40006 114250 202506 262150 521290 937030 1562506 2458630 3694090 4743690 7496650 " }, { "input": "5 19 -666", "output": "0" }, { "input": "5 5 -865", "output": "0" }, { "input": "2 8468 -3666", "output": "2\n7117922 14933886 " }, { "input": "4 9359 -3039", "output": "0" }, { "input": "5 5706 -1856", "output": "0" }, { "input": "2 6828 -39", "output": "2\n7435653 17759589 " }, { "input": "5 3903 -9847", "output": "0" }, { "input": "3 1727 4771", "output": "1\n42124574 " }, { "input": "4 1870 9912", "output": "0" }, { "input": "3 6300 7035", "output": "1\n466761435 " }, { "input": "5 8704 -6190", "output": "0" }, { "input": "2 68 3", "output": "1\n45971 " }, { "input": "5 6 -95", "output": "1\n416063647 " }, { "input": "2 28 12", "output": "2\n4044 7180 " }, { "input": "3 37 -70", "output": "0" }, { "input": "5 3 53", "output": "1\n100663349 " }, { "input": "3 2570 4109", "output": "2\n427587859 999777799 " }, { "input": "3 1139 6335", "output": "2\n12134407 499999999 " }, { "input": "3 2278 -1329", "output": "3\n61504671 145790671 999985999 " }, { "input": "4 30 719", "output": "2\n21219149 899597999 " }, { "input": "4 9023 312", "output": "0" }, { "input": "5 10000 9", "output": "0" }, { "input": "5 7698 5337", "output": "0" }, { "input": "5 1 0", "output": "5\n1 17210368 52521875 60466176 205962976 " }, { "input": "5 12 3", "output": "0" }, { "input": "5 3903 153", "output": "0" }, { "input": "5 10000 0", "output": "1\n10000 " }, { "input": "3 2570 -6691", "output": "1\n999766999 " }, { "input": "5 5 13", "output": "1\n579281018 " } ]
1,651,251,380
2,147,483,647
PyPy 3-64
RUNTIME_ERROR
TESTS
1
62
3,379,200
a, b, c=map(int, input().split(" ")) ans=[] for i in range(1, 81+1): x=b*(i**a)+c if sum(map(int, str(x)))==i and x<int(1e9): ans.append(x) print(len(ans)) print(*ans)
Title: Little Dima and Equation Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Dima misbehaved during a math lesson a lot and the nasty teacher Mr. Pickles gave him the following problem as a punishment. Find all integer solutions *x* (0<=&lt;<=*x*<=&lt;<=109) of the equation: where *a*, *b*, *c* are some predetermined constant values and function *s*(*x*) determines the sum of all digits in the decimal representation of number *x*. The teacher gives this problem to Dima for each lesson. He changes only the parameters of the equation: *a*, *b*, *c*. Dima got sick of getting bad marks and he asks you to help him solve this challenging problem. Input Specification: The first line contains three space-separated integers: *a*,<=*b*,<=*c* (1<=≤<=*a*<=≤<=5; 1<=≤<=*b*<=≤<=10000; <=-<=10000<=≤<=*c*<=≤<=10000). Output Specification: Print integer *n* — the number of the solutions that you've found. Next print *n* integers in the increasing order — the solutions of the given equation. Print only integer solutions that are larger than zero and strictly less than 109. Demo Input: ['3 2 8\n', '1 2 -18\n', '2 2 -1\n'] Demo Output: ['3\n10 2008 13726 ', '0\n', '4\n1 31 337 967 '] Note: none
```python a, b, c=map(int, input().split(" ")) ans=[] for i in range(1, 81+1): x=b*(i**a)+c if sum(map(int, str(x)))==i and x<int(1e9): ans.append(x) print(len(ans)) print(*ans) ```
-1
739
B
Alyona and a tree
PROGRAMMING
1,900
[ "binary search", "data structures", "dfs and similar", "graphs", "trees" ]
null
null
Alyona has a tree with *n* vertices. The root of the tree is the vertex 1. In each vertex Alyona wrote an positive integer, in the vertex *i* she wrote *a**i*. Moreover, the girl wrote a positive integer to every edge of the tree (possibly, different integers on different edges). Let's define *dist*(*v*,<=*u*) as the sum of the integers written on the edges of the simple path from *v* to *u*. The vertex *v* controls the vertex *u* (*v*<=≠<=*u*) if and only if *u* is in the subtree of *v* and *dist*(*v*,<=*u*)<=≤<=*a**u*. Alyona wants to settle in some vertex. In order to do this, she wants to know for each vertex *v* what is the number of vertices *u* such that *v* controls *u*.
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the integers written in the vertices. The next (*n*<=-<=1) lines contain two integers each. The *i*-th of these lines contains integers *p**i* and *w**i* (1<=≤<=*p**i*<=≤<=*n*, 1<=≤<=*w**i*<=≤<=109) — the parent of the (*i*<=+<=1)-th vertex in the tree and the number written on the edge between *p**i* and (*i*<=+<=1). It is guaranteed that the given graph is a tree.
Print *n* integers — the *i*-th of these numbers should be equal to the number of vertices that the *i*-th vertex controls.
[ "5\n2 5 1 4 6\n1 7\n1 1\n3 5\n3 6\n", "5\n9 7 8 6 5\n1 1\n2 1\n3 1\n4 1\n" ]
[ "1 0 1 0 0\n", "4 3 2 1 0\n" ]
In the example test case the vertex 1 controls the vertex 3, the vertex 3 controls the vertex 5 (note that is doesn't mean the vertex 1 controls the vertex 5).
1,000
[ { "input": "5\n2 5 1 4 6\n1 7\n1 1\n3 5\n3 6", "output": "1 0 1 0 0" }, { "input": "5\n9 7 8 6 5\n1 1\n2 1\n3 1\n4 1", "output": "4 3 2 1 0" }, { "input": "1\n1", "output": "0" }, { "input": "2\n1 1\n1 1", "output": "1 0" }, { "input": "10\n40 77 65 14 86 16 2 51 62 79\n1 75\n10 86\n3 52\n6 51\n10 8\n3 61\n3 53\n5 98\n2 7", "output": "1 3 0 0 0 1 0 0 0 2" }, { "input": "10\n52 1 84 16 59 26 56 74 52 97\n5 7\n7 13\n3 98\n7 22\n7 19\n9 54\n4 45\n10 95\n1 94", "output": "1 0 0 1 0 0 3 0 2 0" }, { "input": "10\n68 29 12 14 27 47 95 100 45 14\n10 42\n9 52\n3 44\n2 81\n5 34\n3 46\n6 40\n8 89\n1 85", "output": "0 0 1 0 2 1 0 0 0 0" }, { "input": "10\n84 65 39 20 8 52 49 18 35 32\n3 70\n9 79\n1 99\n3 49\n4 41\n3 43\n3 35\n4 83\n2 72", "output": "0 0 1 1 0 0 0 0 0 0" }, { "input": "10\n96 92 63 25 80 74 95 41 28 54\n6 98\n1 11\n5 45\n3 12\n7 63\n4 39\n7 31\n8 81\n2 59", "output": "2 0 1 1 1 0 2 0 0 0" }, { "input": "10\n4 24 86 31 49 87 42 75 18 71\n4 37\n5 46\n9 88\n1 75\n10 74\n5 32\n4 22\n7 79\n8 50", "output": "0 0 0 1 2 0 0 1 0 1" }, { "input": "10\n19 48 18 37 34 1 96 98 3 85\n7 65\n2 77\n6 34\n3 39\n1 85\n6 24\n2 9\n3 73\n2 41", "output": "0 2 0 0 0 3 1 0 0 0" }, { "input": "10\n31 83 37 43 2 14 39 24 93 7\n6 1\n9 17\n8 84\n3 6\n4 100\n5 21\n1 9\n6 67\n2 29", "output": "1 0 1 0 1 2 0 0 1 0" }, { "input": "10\n47 7 65 49 75 36 93 47 86 24\n3 28\n4 40\n1 35\n3 65\n3 11\n2 17\n5 96\n2 60\n8 24", "output": "1 2 3 2 0 0 0 1 0 0" }, { "input": "10\n1 65 76 59 21 58 97 37 30 84\n6 4\n7 28\n9 19\n2 65\n1 53\n5 10\n5 42\n10 72\n2 89", "output": "2 1 0 0 2 2 1 0 1 0" }, { "input": "5\n1 1 1 1 1\n1 1000000000\n2 1000000000\n3 1000000000\n4 1000000000", "output": "0 0 0 0 0" }, { "input": "6\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000\n1 1000000000\n2 1000000000\n3 1000000000\n4 1000000000\n5 1000000000", "output": "1 1 1 1 1 0" }, { "input": "10\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000\n1 1000000000\n2 1000000000\n3 1000000000\n4 1000000000\n5 1000000000\n6 1000000000\n7 1000000000\n8 1000000000\n9 1000000000", "output": "1 1 1 1 1 1 1 1 1 0" }, { "input": "10\n1 1 1 1 1 1 1 1 1 1\n1 1000000000\n2 1000000000\n3 1000000000\n4 1000000000\n5 1000000000\n6 1000000000\n7 1000000000\n8 1000000000\n9 1000000000", "output": "0 0 0 0 0 0 0 0 0 0" }, { "input": "10\n500000000 500000000 500000000 500000000 500000000 500000000 500000000 500000000 500000000 500000000\n1 1000000000\n2 1000000000\n3 1000000000\n4 1000000000\n5 1000000000\n6 1000000000\n7 1000000000\n8 1000000000\n9 1000000000", "output": "0 0 0 0 0 0 0 0 0 0" }, { "input": "5\n1000000000 1000000000 1000000000 1000000000 1000000000\n1 1000000000\n2 1000000000\n3 1000000000\n4 1000000000", "output": "1 1 1 1 0" } ]
1,692,609,060
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
31
0
print("_RANDOM_GUESS_1692609059.937876")# 1692609059.9378927
Title: Alyona and a tree Time Limit: None seconds Memory Limit: None megabytes Problem Description: Alyona has a tree with *n* vertices. The root of the tree is the vertex 1. In each vertex Alyona wrote an positive integer, in the vertex *i* she wrote *a**i*. Moreover, the girl wrote a positive integer to every edge of the tree (possibly, different integers on different edges). Let's define *dist*(*v*,<=*u*) as the sum of the integers written on the edges of the simple path from *v* to *u*. The vertex *v* controls the vertex *u* (*v*<=≠<=*u*) if and only if *u* is in the subtree of *v* and *dist*(*v*,<=*u*)<=≤<=*a**u*. Alyona wants to settle in some vertex. In order to do this, she wants to know for each vertex *v* what is the number of vertices *u* such that *v* controls *u*. Input Specification: The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the integers written in the vertices. The next (*n*<=-<=1) lines contain two integers each. The *i*-th of these lines contains integers *p**i* and *w**i* (1<=≤<=*p**i*<=≤<=*n*, 1<=≤<=*w**i*<=≤<=109) — the parent of the (*i*<=+<=1)-th vertex in the tree and the number written on the edge between *p**i* and (*i*<=+<=1). It is guaranteed that the given graph is a tree. Output Specification: Print *n* integers — the *i*-th of these numbers should be equal to the number of vertices that the *i*-th vertex controls. Demo Input: ['5\n2 5 1 4 6\n1 7\n1 1\n3 5\n3 6\n', '5\n9 7 8 6 5\n1 1\n2 1\n3 1\n4 1\n'] Demo Output: ['1 0 1 0 0\n', '4 3 2 1 0\n'] Note: In the example test case the vertex 1 controls the vertex 3, the vertex 3 controls the vertex 5 (note that is doesn't mean the vertex 1 controls the vertex 5).
```python print("_RANDOM_GUESS_1692609059.937876")# 1692609059.9378927 ```
0
604
B
More Cowbell
PROGRAMMING
1,400
[ "binary search", "greedy" ]
null
null
Kevin Sun wants to move his precious collection of *n* cowbells from Naperthrill to Exeter, where there is actually grass instead of corn. Before moving, he must pack his cowbells into *k* boxes of a fixed size. In order to keep his collection safe during transportation, he won't place more than two cowbells into a single box. Since Kevin wishes to minimize expenses, he is curious about the smallest size box he can use to pack his entire collection. Kevin is a meticulous cowbell collector and knows that the size of his *i*-th (1<=≤<=*i*<=≤<=*n*) cowbell is an integer *s**i*. In fact, he keeps his cowbells sorted by size, so *s**i*<=-<=1<=≤<=*s**i* for any *i*<=&gt;<=1. Also an expert packer, Kevin can fit one or two cowbells into a box of size *s* if and only if the sum of their sizes does not exceed *s*. Given this information, help Kevin determine the smallest *s* for which it is possible to put all of his cowbells into *k* boxes of size *s*.
The first line of the input contains two space-separated integers *n* and *k* (1<=≤<=*n*<=≤<=2·*k*<=≤<=100<=000), denoting the number of cowbells and the number of boxes, respectively. The next line contains *n* space-separated integers *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*s*1<=≤<=*s*2<=≤<=...<=≤<=*s**n*<=≤<=1<=000<=000), the sizes of Kevin's cowbells. It is guaranteed that the sizes *s**i* are given in non-decreasing order.
Print a single integer, the smallest *s* for which it is possible for Kevin to put all of his cowbells into *k* boxes of size *s*.
[ "2 1\n2 5\n", "4 3\n2 3 5 9\n", "3 2\n3 5 7\n" ]
[ "7\n", "9\n", "8\n" ]
In the first sample, Kevin must pack his two cowbells into the same box. In the second sample, Kevin can pack together the following sets of cowbells: {2, 3}, {5} and {9}. In the third sample, the optimal solution is {3, 5} and {7}.
1,000
[ { "input": "2 1\n2 5", "output": "7" }, { "input": "4 3\n2 3 5 9", "output": "9" }, { "input": "3 2\n3 5 7", "output": "8" }, { "input": "20 11\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "2" }, { "input": "10 10\n3 15 31 61 63 63 68 94 98 100", "output": "100" }, { "input": "100 97\n340 402 415 466 559 565 649 689 727 771 774 776 789 795 973 1088 1212 1293 1429 1514 1587 1599 1929 1997 2278 2529 2656 2677 2839 2894 2951 3079 3237 3250 3556 3568 3569 3578 3615 3641 3673 3892 4142 4418 4515 4766 4846 4916 5225 5269 5352 5460 5472 5635 5732 5886 5941 5976 5984 6104 6113 6402 6409 6460 6550 6563 6925 7006 7289 7401 7441 7451 7709 7731 7742 7750 7752 7827 8101 8154 8376 8379 8432 8534 8578 8630 8706 8814 8882 8972 9041 9053 9109 9173 9473 9524 9547 9775 9791 9983", "output": "9983" }, { "input": "10 9\n7 29 35 38 41 47 54 56 73 74", "output": "74" }, { "input": "1 2342\n12345", "output": "12345" }, { "input": "10 5\n15 15 20 28 38 44 46 52 69 94", "output": "109" }, { "input": "10 9\n6 10 10 32 36 38 69 80 82 93", "output": "93" }, { "input": "10 10\n4 19 22 24 25 43 49 56 78 88", "output": "88" }, { "input": "100 89\n474 532 759 772 803 965 1043 1325 1342 1401 1411 1452 1531 1707 1906 1928 2034 2222 2335 2606 2757 2968 2978 3211 3513 3734 3772 3778 3842 3948 3976 4038 4055 4113 4182 4267 4390 4408 4478 4595 4668 4792 4919 5133 5184 5255 5312 5341 5476 5628 5683 5738 5767 5806 5973 6051 6134 6254 6266 6279 6314 6342 6599 6676 6747 6777 6827 6842 7057 7097 7259 7340 7378 7405 7510 7520 7698 7796 8148 8351 8507 8601 8805 8814 8826 8978 9116 9140 9174 9338 9394 9403 9407 9423 9429 9519 9764 9784 9838 9946", "output": "9946" }, { "input": "100 74\n10 211 323 458 490 592 979 981 1143 1376 1443 1499 1539 1612 1657 1874 2001 2064 2123 2274 2346 2471 2522 2589 2879 2918 2933 2952 3160 3164 3167 3270 3382 3404 3501 3522 3616 3802 3868 3985 4007 4036 4101 4580 4687 4713 4714 4817 4955 5257 5280 5343 5428 5461 5566 5633 5727 5874 5925 6233 6309 6389 6500 6701 6731 6847 6916 7088 7088 7278 7296 7328 7564 7611 7646 7887 7887 8065 8075 8160 8300 8304 8316 8355 8404 8587 8758 8794 8890 9038 9163 9235 9243 9339 9410 9587 9868 9916 9923 9986", "output": "9986" }, { "input": "100 61\n82 167 233 425 432 456 494 507 562 681 683 921 1218 1323 1395 1531 1586 1591 1675 1766 1802 1842 2116 2625 2697 2735 2739 3337 3349 3395 3406 3596 3610 3721 4059 4078 4305 4330 4357 4379 4558 4648 4651 4784 4819 4920 5049 5312 5361 5418 5440 5463 5547 5594 5821 5951 5972 6141 6193 6230 6797 6842 6853 6854 7017 7026 7145 7322 7391 7460 7599 7697 7756 7768 7872 7889 8094 8215 8408 8440 8462 8714 8756 8760 8881 9063 9111 9184 9281 9373 9406 9417 9430 9511 9563 9634 9660 9788 9883 9927", "output": "9927" }, { "input": "100 84\n53 139 150 233 423 570 786 861 995 1017 1072 1196 1276 1331 1680 1692 1739 1748 1826 2067 2280 2324 2368 2389 2607 2633 2760 2782 2855 2996 3030 3093 3513 3536 3557 3594 3692 3707 3823 3832 4009 4047 4088 4095 4408 4537 4565 4601 4784 4878 4935 5029 5252 5322 5389 5407 5511 5567 5857 6182 6186 6198 6280 6290 6353 6454 6458 6567 6843 7166 7216 7257 7261 7375 7378 7539 7542 7762 7771 7797 7980 8363 8606 8612 8663 8801 8808 8823 8918 8975 8997 9240 9245 9259 9356 9755 9759 9760 9927 9970", "output": "9970" }, { "input": "100 50\n130 248 312 312 334 589 702 916 921 1034 1047 1346 1445 1500 1585 1744 1951 2123 2273 2362 2400 2455 2496 2530 2532 2944 3074 3093 3094 3134 3698 3967 4047 4102 4109 4260 4355 4466 4617 4701 4852 4892 4915 4917 4936 4981 4999 5106 5152 5203 5214 5282 5412 5486 5525 5648 5897 5933 5969 6251 6400 6421 6422 6558 6805 6832 6908 6924 6943 6980 7092 7206 7374 7417 7479 7546 7672 7756 7973 8020 8028 8079 8084 8085 8137 8153 8178 8239 8639 8667 8829 9263 9333 9370 9420 9579 9723 9784 9841 9993", "output": "11103" }, { "input": "100 50\n156 182 208 409 496 515 659 761 772 794 827 912 1003 1236 1305 1388 1412 1422 1428 1465 1613 2160 2411 2440 2495 2684 2724 2925 3033 3035 3155 3260 3378 3442 3483 3921 4031 4037 4091 4113 4119 4254 4257 4442 4559 4614 4687 4839 4896 5054 5246 5316 5346 5859 5928 5981 6148 6250 6422 6433 6448 6471 6473 6485 6503 6779 6812 7050 7064 7074 7141 7378 7424 7511 7574 7651 7808 7858 8286 8291 8446 8536 8599 8628 8636 8768 8900 8981 9042 9055 9114 9146 9186 9411 9480 9590 9681 9749 9757 9983", "output": "10676" }, { "input": "100 50\n145 195 228 411 577 606 629 775 1040 1040 1058 1187 1307 1514 1784 1867 1891 2042 2042 2236 2549 2555 2560 2617 2766 2807 2829 2917 3070 3072 3078 3095 3138 3147 3149 3196 3285 3287 3309 3435 3531 3560 3563 3769 3830 3967 4081 4158 4315 4387 4590 4632 4897 4914 5128 5190 5224 5302 5402 5416 5420 5467 5517 5653 5820 5862 5941 6053 6082 6275 6292 6316 6490 6530 6619 6632 6895 7071 7234 7323 7334 7412 7626 7743 8098 8098 8136 8158 8264 8616 8701 8718 8770 8803 8809 8983 9422 9530 9811 9866", "output": "10011" }, { "input": "100 50\n56 298 387 456 518 532 589 792 870 1041 1055 1122 1141 1166 1310 1329 1523 1548 1626 1730 1780 1833 1850 1911 2006 2157 2303 2377 2403 2442 2450 2522 2573 2822 2994 3200 3238 3252 3280 3311 3345 3422 3429 3506 3526 3617 3686 3791 4134 4467 4525 4614 4633 4792 5017 5220 5243 5338 5445 5536 5639 5675 5763 5875 6129 6220 6228 6287 6385 6616 6789 6822 6940 6959 6985 7297 7304 7391 7443 7580 7824 7884 7981 8055 8063 8223 8280 8322 8346 8473 8688 8986 9087 9323 9477 9489 9518 9621 9699 9804", "output": "10009" }, { "input": "100 49990\n221 257 543 613 818 855 884 1195 1233 1293 1327 1474 1567 1568 1728 1789 1809 1957 1994 2198 2217 2289 2298 2360 2441 2454 2517 2519 2597 2652 2909 2958 2970 3271 3310 3409 3450 3646 3950 3965 4016 4116 4134 4159 4462 4624 4631 4783 4804 5031 5276 5538 5729 5845 5880 5894 5959 5961 6028 6105 6184 6335 6370 6523 6532 6677 6762 6868 6998 7066 7245 7360 7490 7492 7645 7677 7786 7804 8038 8131 8207 8400 8507 8556 8575 8599 8673 8676 8712 8816 9123 9158 9216 9369 9628 9707 9768 9800 9876 9934", "output": "9934" }, { "input": "1 50000\n2", "output": "2" }, { "input": "1 40000\n23456", "output": "23456" }, { "input": "1 2\n10", "output": "10" }, { "input": "1 1\n1", "output": "1" }, { "input": "2 2\n2 3", "output": "3" }, { "input": "4 2\n1 2 8 9", "output": "10" } ]
1,637,203,669
2,147,483,647
Python 3
OK
TESTS
54
108
7,372,800
n, k = map(int, input().split()) s = list(map(int, input().split())) maxim = s[-1] twoBells = n - k for i in range(twoBells): maxim = max(maxim, s[i] + s[2*twoBells-i-1]) print(maxim)
Title: More Cowbell Time Limit: None seconds Memory Limit: None megabytes Problem Description: Kevin Sun wants to move his precious collection of *n* cowbells from Naperthrill to Exeter, where there is actually grass instead of corn. Before moving, he must pack his cowbells into *k* boxes of a fixed size. In order to keep his collection safe during transportation, he won't place more than two cowbells into a single box. Since Kevin wishes to minimize expenses, he is curious about the smallest size box he can use to pack his entire collection. Kevin is a meticulous cowbell collector and knows that the size of his *i*-th (1<=≤<=*i*<=≤<=*n*) cowbell is an integer *s**i*. In fact, he keeps his cowbells sorted by size, so *s**i*<=-<=1<=≤<=*s**i* for any *i*<=&gt;<=1. Also an expert packer, Kevin can fit one or two cowbells into a box of size *s* if and only if the sum of their sizes does not exceed *s*. Given this information, help Kevin determine the smallest *s* for which it is possible to put all of his cowbells into *k* boxes of size *s*. Input Specification: The first line of the input contains two space-separated integers *n* and *k* (1<=≤<=*n*<=≤<=2·*k*<=≤<=100<=000), denoting the number of cowbells and the number of boxes, respectively. The next line contains *n* space-separated integers *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*s*1<=≤<=*s*2<=≤<=...<=≤<=*s**n*<=≤<=1<=000<=000), the sizes of Kevin's cowbells. It is guaranteed that the sizes *s**i* are given in non-decreasing order. Output Specification: Print a single integer, the smallest *s* for which it is possible for Kevin to put all of his cowbells into *k* boxes of size *s*. Demo Input: ['2 1\n2 5\n', '4 3\n2 3 5 9\n', '3 2\n3 5 7\n'] Demo Output: ['7\n', '9\n', '8\n'] Note: In the first sample, Kevin must pack his two cowbells into the same box. In the second sample, Kevin can pack together the following sets of cowbells: {2, 3}, {5} and {9}. In the third sample, the optimal solution is {3, 5} and {7}.
```python n, k = map(int, input().split()) s = list(map(int, input().split())) maxim = s[-1] twoBells = n - k for i in range(twoBells): maxim = max(maxim, s[i] + s[2*twoBells-i-1]) print(maxim) ```
3
369
C
Valera and Elections
PROGRAMMING
1,600
[ "dfs and similar", "graphs", "trees" ]
null
null
The city Valera lives in is going to hold elections to the city Parliament. The city has *n* districts and *n*<=-<=1 bidirectional roads. We know that from any district there is a path along the roads to any other district. Let's enumerate all districts in some way by integers from 1 to *n*, inclusive. Furthermore, for each road the residents decided if it is the problem road or not. A problem road is a road that needs to be repaired. There are *n* candidates running the elections. Let's enumerate all candidates in some way by integers from 1 to *n*, inclusive. If the candidate number *i* will be elected in the city Parliament, he will perform exactly one promise — to repair all problem roads on the way from the *i*-th district to the district 1, where the city Parliament is located. Help Valera and determine the subset of candidates such that if all candidates from the subset will be elected to the city Parliament, all problem roads in the city will be repaired. If there are several such subsets, you should choose the subset consisting of the minimum number of candidates.
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=105) — the number of districts in the city. Then *n*<=-<=1 lines follow. Each line contains the description of a city road as three positive integers *x**i*, *y**i*, *t**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, 1<=≤<=*t**i*<=≤<=2) — the districts connected by the *i*-th bidirectional road and the road type. If *t**i* equals to one, then the *i*-th road isn't the problem road; if *t**i* equals to two, then the *i*-th road is the problem road. It's guaranteed that the graph structure of the city is a tree.
In the first line print a single non-negative number *k* — the minimum size of the required subset of candidates. Then on the second line print *k* space-separated integers *a*1,<=*a*2,<=... *a**k* — the numbers of the candidates that form the required subset. If there are multiple solutions, you are allowed to print any of them.
[ "5\n1 2 2\n2 3 2\n3 4 2\n4 5 2\n", "5\n1 2 1\n2 3 2\n2 4 1\n4 5 1\n", "5\n1 2 2\n1 3 2\n1 4 2\n1 5 2\n" ]
[ "1\n5 \n", "1\n3 \n", "4\n5 4 3 2 \n" ]
none
1,500
[ { "input": "5\n1 2 2\n2 3 2\n3 4 2\n4 5 2", "output": "1\n5 " }, { "input": "5\n1 2 1\n2 3 2\n2 4 1\n4 5 1", "output": "1\n3 " }, { "input": "5\n1 2 2\n1 3 2\n1 4 2\n1 5 2", "output": "4\n5 4 3 2 " }, { "input": "5\n1 5 1\n5 4 2\n4 3 1\n3 2 2", "output": "1\n2 " }, { "input": "2\n1 2 1", "output": "0" }, { "input": "10\n7 5 1\n2 1 2\n8 7 2\n2 4 1\n4 5 2\n9 5 1\n3 2 2\n2 10 1\n6 5 2", "output": "3\n8 6 3 " }, { "input": "2\n2 1 1", "output": "0" }, { "input": "2\n1 2 2", "output": "1\n2 " }, { "input": "5\n3 1 1\n4 5 1\n1 4 1\n1 2 1", "output": "0" }, { "input": "5\n1 3 2\n5 4 2\n2 1 2\n4 3 2", "output": "2\n5 2 " }, { "input": "10\n1 9 1\n3 2 2\n1 2 2\n4 7 2\n3 5 2\n4 3 2\n10 3 2\n7 8 2\n3 6 1", "output": "3\n8 10 5 " }, { "input": "10\n7 9 2\n2 6 2\n7 4 1\n5 4 2\n3 2 1\n8 5 2\n4 3 2\n7 10 1\n1 2 2", "output": "3\n9 8 6 " }, { "input": "10\n3 9 1\n2 10 2\n1 7 1\n3 4 1\n7 8 2\n1 2 1\n5 3 1\n5 6 2\n2 3 2", "output": "3\n6 10 8 " }, { "input": "10\n1 10 2\n10 9 2\n10 8 2\n9 7 2\n8 6 1\n7 5 1\n6 4 1\n5 3 1\n4 2 1", "output": "2\n7 8 " }, { "input": "10\n1 10 2\n10 9 2\n10 8 2\n9 7 2\n8 6 2\n7 5 2\n6 4 2\n5 3 2\n4 2 2", "output": "2\n3 2 " }, { "input": "4\n1 2 2\n2 3 1\n2 4 2", "output": "1\n4 " } ]
1,568,500,148
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
93
0
n = int(input()) listaAdj = [[] for i in range(n)] broken = set() for i in range(n - 1): x, y, t = map(int, input().split()) listaAdj[x - 1].append(y - 1) listaAdj[y - 1].append(x - 1) if t == 2: broken.add(x) broken.add(y) stack = [(index, [0], 0) for index in listaAdj[0]] while stack: cur = stack.pop() idx1 = cur[0] pai = cur[1] idx2 = cur[2] if idx1 in broken: broken.difference_update(pai) pai=[] listaAdj[idx1].remove(idx2) pai.append(idx1) stack += [(index, pai, idx1) for index in listaAdj[idx1]] candidatos = [idx + 1 for idx in broken] print(len(candidatos)) print(*candidatos)
Title: Valera and Elections Time Limit: None seconds Memory Limit: None megabytes Problem Description: The city Valera lives in is going to hold elections to the city Parliament. The city has *n* districts and *n*<=-<=1 bidirectional roads. We know that from any district there is a path along the roads to any other district. Let's enumerate all districts in some way by integers from 1 to *n*, inclusive. Furthermore, for each road the residents decided if it is the problem road or not. A problem road is a road that needs to be repaired. There are *n* candidates running the elections. Let's enumerate all candidates in some way by integers from 1 to *n*, inclusive. If the candidate number *i* will be elected in the city Parliament, he will perform exactly one promise — to repair all problem roads on the way from the *i*-th district to the district 1, where the city Parliament is located. Help Valera and determine the subset of candidates such that if all candidates from the subset will be elected to the city Parliament, all problem roads in the city will be repaired. If there are several such subsets, you should choose the subset consisting of the minimum number of candidates. Input Specification: The first line contains a single integer *n* (2<=≤<=*n*<=≤<=105) — the number of districts in the city. Then *n*<=-<=1 lines follow. Each line contains the description of a city road as three positive integers *x**i*, *y**i*, *t**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, 1<=≤<=*t**i*<=≤<=2) — the districts connected by the *i*-th bidirectional road and the road type. If *t**i* equals to one, then the *i*-th road isn't the problem road; if *t**i* equals to two, then the *i*-th road is the problem road. It's guaranteed that the graph structure of the city is a tree. Output Specification: In the first line print a single non-negative number *k* — the minimum size of the required subset of candidates. Then on the second line print *k* space-separated integers *a*1,<=*a*2,<=... *a**k* — the numbers of the candidates that form the required subset. If there are multiple solutions, you are allowed to print any of them. Demo Input: ['5\n1 2 2\n2 3 2\n3 4 2\n4 5 2\n', '5\n1 2 1\n2 3 2\n2 4 1\n4 5 1\n', '5\n1 2 2\n1 3 2\n1 4 2\n1 5 2\n'] Demo Output: ['1\n5 \n', '1\n3 \n', '4\n5 4 3 2 \n'] Note: none
```python n = int(input()) listaAdj = [[] for i in range(n)] broken = set() for i in range(n - 1): x, y, t = map(int, input().split()) listaAdj[x - 1].append(y - 1) listaAdj[y - 1].append(x - 1) if t == 2: broken.add(x) broken.add(y) stack = [(index, [0], 0) for index in listaAdj[0]] while stack: cur = stack.pop() idx1 = cur[0] pai = cur[1] idx2 = cur[2] if idx1 in broken: broken.difference_update(pai) pai=[] listaAdj[idx1].remove(idx2) pai.append(idx1) stack += [(index, pai, idx1) for index in listaAdj[idx1]] candidatos = [idx + 1 for idx in broken] print(len(candidatos)) print(*candidatos) ```
0
604
A
Uncowed Forces
PROGRAMMING
1,000
[ "implementation" ]
null
null
Kevin Sun has just finished competing in Codeforces Round #334! The round was 120 minutes long and featured five problems with maximum point values of 500, 1000, 1500, 2000, and 2500, respectively. Despite the challenging tasks, Kevin was uncowed and bulldozed through all of them, distinguishing himself from the herd as the best cowmputer scientist in all of Bovinia. Kevin knows his submission time for each problem, the number of wrong submissions that he made on each problem, and his total numbers of successful and unsuccessful hacks. Because Codeforces scoring is complicated, Kevin wants you to write a program to compute his final score. Codeforces scores are computed as follows: If the maximum point value of a problem is *x*, and Kevin submitted correctly at minute *m* but made *w* wrong submissions, then his score on that problem is . His total score is equal to the sum of his scores for each problem. In addition, Kevin's total score gets increased by 100 points for each successful hack, but gets decreased by 50 points for each unsuccessful hack. All arithmetic operations are performed with absolute precision and no rounding. It is guaranteed that Kevin's final score is an integer.
The first line of the input contains five space-separated integers *m*1, *m*2, *m*3, *m*4, *m*5, where *m**i* (0<=≤<=*m**i*<=≤<=119) is the time of Kevin's last submission for problem *i*. His last submission is always correct and gets accepted. The second line contains five space-separated integers *w*1, *w*2, *w*3, *w*4, *w*5, where *w**i* (0<=≤<=*w**i*<=≤<=10) is Kevin's number of wrong submissions on problem *i*. The last line contains two space-separated integers *h**s* and *h**u* (0<=≤<=*h**s*,<=*h**u*<=≤<=20), denoting the Kevin's numbers of successful and unsuccessful hacks, respectively.
Print a single integer, the value of Kevin's final score.
[ "20 40 60 80 100\n0 1 2 3 4\n1 0\n", "119 119 119 119 119\n0 0 0 0 0\n10 0\n" ]
[ "4900\n", "4930\n" ]
In the second sample, Kevin takes 119 minutes on all of the problems. Therefore, he gets <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/42158dc2bc78cd21fa679530ae9ef8b9ea298d15.png" style="max-width: 100.0%;max-height: 100.0%;"/> of the points on each problem. So his score from solving problems is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/fdf392d8508500b57f8057ac0c4c892ab5f925a2.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Adding in 10·100 = 1000 points from hacks, his total score becomes 3930 + 1000 = 4930.
500
[ { "input": "20 40 60 80 100\n0 1 2 3 4\n1 0", "output": "4900" }, { "input": "119 119 119 119 119\n0 0 0 0 0\n10 0", "output": "4930" }, { "input": "3 6 13 38 60\n6 10 10 3 8\n9 9", "output": "5088" }, { "input": "21 44 11 68 75\n6 2 4 8 4\n2 8", "output": "4522" }, { "input": "16 112 50 114 68\n1 4 8 4 9\n19 11", "output": "5178" }, { "input": "55 66 75 44 47\n6 0 6 6 10\n19 0", "output": "6414" }, { "input": "47 11 88 5 110\n6 10 4 2 3\n10 6", "output": "5188" }, { "input": "5 44 61 103 92\n9 0 10 4 8\n15 7", "output": "4914" }, { "input": "115 53 96 62 110\n7 8 1 7 9\n7 16", "output": "3416" }, { "input": "102 83 26 6 11\n3 4 1 8 3\n17 14", "output": "6704" }, { "input": "36 102 73 101 19\n5 9 2 2 6\n4 13", "output": "4292" }, { "input": "40 115 93 107 113\n5 7 2 6 8\n6 17", "output": "2876" }, { "input": "53 34 53 107 81\n4 3 1 10 8\n7 7", "output": "4324" }, { "input": "113 37 4 84 66\n2 0 10 3 0\n20 19", "output": "6070" }, { "input": "10 53 101 62 1\n8 0 9 7 9\n0 11", "output": "4032" }, { "input": "45 45 75 36 76\n6 2 2 0 0\n8 17", "output": "5222" }, { "input": "47 16 44 78 111\n7 9 8 0 2\n1 19", "output": "3288" }, { "input": "7 54 39 102 31\n6 0 2 10 1\n18 3", "output": "6610" }, { "input": "0 46 86 72 40\n1 5 5 5 9\n6 5", "output": "4924" }, { "input": "114 4 45 78 113\n0 4 8 10 2\n10 12", "output": "4432" }, { "input": "56 56 96 105 107\n4 9 10 4 8\n2 1", "output": "3104" }, { "input": "113 107 59 50 56\n3 7 10 6 3\n10 12", "output": "4586" }, { "input": "96 104 9 94 84\n6 10 7 8 3\n14 11", "output": "4754" }, { "input": "98 15 116 43 55\n4 3 0 9 3\n10 7", "output": "5400" }, { "input": "0 26 99 108 35\n0 4 3 0 10\n9 5", "output": "5388" }, { "input": "89 24 51 49 84\n5 6 2 2 9\n2 14", "output": "4066" }, { "input": "57 51 76 45 96\n1 0 4 3 6\n12 15", "output": "5156" }, { "input": "79 112 37 36 116\n2 8 4 7 5\n4 12", "output": "3872" }, { "input": "71 42 60 20 7\n7 1 1 10 6\n1 7", "output": "5242" }, { "input": "86 10 66 80 55\n0 2 5 10 5\n15 6", "output": "5802" }, { "input": "66 109 22 22 62\n3 1 5 4 5\n10 5", "output": "5854" }, { "input": "97 17 43 84 58\n2 8 3 8 6\n10 7", "output": "5028" }, { "input": "109 83 5 114 104\n6 0 3 9 5\n5 2", "output": "4386" }, { "input": "94 18 24 91 105\n2 0 7 10 3\n1 4", "output": "4118" }, { "input": "64 17 86 59 45\n8 0 10 2 2\n4 4", "output": "5144" }, { "input": "70 84 31 57 2\n7 0 0 2 7\n12 5", "output": "6652" }, { "input": "98 118 117 86 4\n2 10 9 7 5\n11 15", "output": "4476" }, { "input": "103 110 101 97 70\n4 2 1 0 5\n7 5", "output": "4678" }, { "input": "78 96 6 97 62\n7 7 9 2 9\n10 3", "output": "4868" }, { "input": "95 28 3 31 115\n1 9 0 7 3\n10 13", "output": "5132" }, { "input": "45 17 116 58 3\n8 8 7 6 4\n3 19", "output": "3992" }, { "input": "19 12 0 113 77\n3 0 10 9 2\n8 6", "output": "5040" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0", "output": "7500" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n20 0", "output": "9500" }, { "input": "119 119 119 119 119\n10 10 10 10 10\n0 20", "output": "1310" }, { "input": "0 0 0 0 0\n10 10 10 10 10\n0 20", "output": "4150" }, { "input": "119 0 0 0 0\n10 0 0 0 0\n5 5", "output": "7400" }, { "input": "0 119 0 0 0\n0 10 0 0 0\n5 5", "output": "7050" }, { "input": "0 0 119 0 0\n0 0 10 0 0\n0 0", "output": "6450" }, { "input": "0 0 0 119 0\n0 0 0 10 0\n5 5", "output": "6350" }, { "input": "0 0 0 0 119\n0 0 0 0 10\n5 5", "output": "6060" }, { "input": "119 0 0 0 0\n2 0 0 0 0\n5 5", "output": "7412" }, { "input": "0 119 0 0 0\n0 2 0 0 0\n5 5", "output": "7174" }, { "input": "0 0 119 0 0\n0 0 2 0 0\n5 5", "output": "6936" }, { "input": "0 0 0 119 0\n0 0 0 2 0\n5 5", "output": "6698" }, { "input": "0 0 0 0 119\n0 0 0 0 2\n5 5", "output": "6460" }, { "input": "119 0 0 0 0\n0 0 0 0 0\n4 9", "output": "7212" } ]
1,503,994,160
1,160
Python 3
OK
TESTS
57
62
0
import sys m = list(map(int,input().split())) w = list(map(int,input().split())) hs,hu = map(int,input().split()) point = [500,1000,1500,2000,2500] res = 0 for i in range(5): res += max(0.3*point[i],((1- (m[i]/250) )*point[i] - 50*w[i])) res += hs*100 - hu*50 print(int(res))
Title: Uncowed Forces Time Limit: None seconds Memory Limit: None megabytes Problem Description: Kevin Sun has just finished competing in Codeforces Round #334! The round was 120 minutes long and featured five problems with maximum point values of 500, 1000, 1500, 2000, and 2500, respectively. Despite the challenging tasks, Kevin was uncowed and bulldozed through all of them, distinguishing himself from the herd as the best cowmputer scientist in all of Bovinia. Kevin knows his submission time for each problem, the number of wrong submissions that he made on each problem, and his total numbers of successful and unsuccessful hacks. Because Codeforces scoring is complicated, Kevin wants you to write a program to compute his final score. Codeforces scores are computed as follows: If the maximum point value of a problem is *x*, and Kevin submitted correctly at minute *m* but made *w* wrong submissions, then his score on that problem is . His total score is equal to the sum of his scores for each problem. In addition, Kevin's total score gets increased by 100 points for each successful hack, but gets decreased by 50 points for each unsuccessful hack. All arithmetic operations are performed with absolute precision and no rounding. It is guaranteed that Kevin's final score is an integer. Input Specification: The first line of the input contains five space-separated integers *m*1, *m*2, *m*3, *m*4, *m*5, where *m**i* (0<=≤<=*m**i*<=≤<=119) is the time of Kevin's last submission for problem *i*. His last submission is always correct and gets accepted. The second line contains five space-separated integers *w*1, *w*2, *w*3, *w*4, *w*5, where *w**i* (0<=≤<=*w**i*<=≤<=10) is Kevin's number of wrong submissions on problem *i*. The last line contains two space-separated integers *h**s* and *h**u* (0<=≤<=*h**s*,<=*h**u*<=≤<=20), denoting the Kevin's numbers of successful and unsuccessful hacks, respectively. Output Specification: Print a single integer, the value of Kevin's final score. Demo Input: ['20 40 60 80 100\n0 1 2 3 4\n1 0\n', '119 119 119 119 119\n0 0 0 0 0\n10 0\n'] Demo Output: ['4900\n', '4930\n'] Note: In the second sample, Kevin takes 119 minutes on all of the problems. Therefore, he gets <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/42158dc2bc78cd21fa679530ae9ef8b9ea298d15.png" style="max-width: 100.0%;max-height: 100.0%;"/> of the points on each problem. So his score from solving problems is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/fdf392d8508500b57f8057ac0c4c892ab5f925a2.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Adding in 10·100 = 1000 points from hacks, his total score becomes 3930 + 1000 = 4930.
```python import sys m = list(map(int,input().split())) w = list(map(int,input().split())) hs,hu = map(int,input().split()) point = [500,1000,1500,2000,2500] res = 0 for i in range(5): res += max(0.3*point[i],((1- (m[i]/250) )*point[i] - 50*w[i])) res += hs*100 - hu*50 print(int(res)) ```
3
96
A
Football
PROGRAMMING
900
[ "implementation", "strings" ]
A. Football
2
256
Petya loves football very much. One day, as he was watching a football match, he was writing the players' current positions on a piece of paper. To simplify the situation he depicted it as a string consisting of zeroes and ones. A zero corresponds to players of one team; a one corresponds to players of another team. If there are at least 7 players of some team standing one after another, then the situation is considered dangerous. For example, the situation 00100110111111101 is dangerous and 11110111011101 is not. You are given the current situation. Determine whether it is dangerous or not.
The first input line contains a non-empty string consisting of characters "0" and "1", which represents players. The length of the string does not exceed 100 characters. There's at least one player from each team present on the field.
Print "YES" if the situation is dangerous. Otherwise, print "NO".
[ "001001\n", "1000000001\n" ]
[ "NO\n", "YES\n" ]
none
500
[ { "input": "001001", "output": "NO" }, { "input": "1000000001", "output": "YES" }, { "input": "00100110111111101", "output": "YES" }, { "input": "11110111111111111", "output": "YES" }, { "input": "01", "output": "NO" }, { "input": "10100101", "output": "NO" }, { "input": "1010010100000000010", "output": "YES" }, { "input": "101010101", "output": "NO" }, { "input": "000000000100000000000110101100000", "output": "YES" }, { "input": "100001000000110101100000", "output": "NO" }, { "input": "100001000011010110000", "output": "NO" }, { "input": "010", "output": "NO" }, { "input": "10101011111111111111111111111100", "output": "YES" }, { "input": "1001101100", "output": "NO" }, { "input": "1001101010", "output": "NO" }, { "input": "1111100111", "output": "NO" }, { "input": "00110110001110001111", "output": "NO" }, { "input": "11110001001111110001", "output": "NO" }, { "input": "10001111001011111101", "output": "NO" }, { "input": "10000010100000001000110001010100001001001010011", "output": "YES" }, { "input": "01111011111010111100101100001011001010111110000010", "output": "NO" }, { "input": "00100000100100101110011001011011101110110110010100", "output": "NO" }, { "input": "10110100110001001011110101110010100010000000000100101010111110111110100011", "output": "YES" }, { "input": "00011101010101111001011011001101101011111101000010100000111000011100101011", "output": "NO" }, { "input": "01110000110100110101110100111000101101011101011110110100100111100001110111", "output": "NO" }, { "input": "11110110011000100111100111101101011111110100010101011011111101110110110111", "output": "YES" }, { "input": "100100010101110010001011001110100011100010011110100101100011010001001010001001101111001100", "output": "NO" }, { "input": "111110010001011010010011111100110110001111000010100011011100111101111101110010101111011110000001010", "output": "NO" }, { "input": "111110111100010100000100001010111011101011000111011011011010110010100010000101011111000011010011110", "output": "NO" }, { "input": "1011110110111010110111111010010010100011111011110000011000110010011110111010110100011010100010111000", "output": "NO" }, { "input": "0010100111100010110110000011100111110100111110001010000100111111111010111100101101010101001011010110", "output": "YES" }, { "input": "1111010100010100101011101100101101110011000010100010000001111100010011100101010001101111000001011000", "output": "NO" }, { "input": "0101100011001110001110100111100011010101011000000000110110010010111100101111010111100011101100100101", "output": "YES" }, { "input": "0001101110011101110000000010011111101001101111100001001010110000110001100000010001111011011110001101", "output": "YES" }, { "input": "1000010000100000100010000100001000010000100001000010000100001000010000100001000010000100001000010000", "output": "NO" }, { "input": "1000000000100000000010000000001000000000100000000010000000001000000000100000000010000000001000000000", "output": "YES" }, { "input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001", "output": "YES" }, { "input": "1111111111111111111111111111111111111111011111111111111111111111111111111111111111111111111111111111", "output": "YES" }, { "input": "10100101000", "output": "NO" }, { "input": "11110111011101", "output": "NO" }, { "input": "10000000", "output": "YES" }, { "input": "00000001", "output": "YES" }, { "input": "01111111", "output": "YES" }, { "input": "11111110", "output": "YES" } ]
1,675,023,457
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
62
0
num = int(input()) num_s = str(num) i = 0 count = 0 count0 = 0 count1 = 0 list0 = [] list1 = [] while i < len(num_s): if num_s[i] == '0': count1 = 0 count0 += 1 if count0 >= 7: print('YES') count += 1 elif num_s[i] == '1': count0 = 0 count1 += 1 if count1 >= 7: print('YES') count += 1 i += 1 if count == 0: print('NO')
Title: Football Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Petya loves football very much. One day, as he was watching a football match, he was writing the players' current positions on a piece of paper. To simplify the situation he depicted it as a string consisting of zeroes and ones. A zero corresponds to players of one team; a one corresponds to players of another team. If there are at least 7 players of some team standing one after another, then the situation is considered dangerous. For example, the situation 00100110111111101 is dangerous and 11110111011101 is not. You are given the current situation. Determine whether it is dangerous or not. Input Specification: The first input line contains a non-empty string consisting of characters "0" and "1", which represents players. The length of the string does not exceed 100 characters. There's at least one player from each team present on the field. Output Specification: Print "YES" if the situation is dangerous. Otherwise, print "NO". Demo Input: ['001001\n', '1000000001\n'] Demo Output: ['NO\n', 'YES\n'] Note: none
```python num = int(input()) num_s = str(num) i = 0 count = 0 count0 = 0 count1 = 0 list0 = [] list1 = [] while i < len(num_s): if num_s[i] == '0': count1 = 0 count0 += 1 if count0 >= 7: print('YES') count += 1 elif num_s[i] == '1': count0 = 0 count1 += 1 if count1 >= 7: print('YES') count += 1 i += 1 if count == 0: print('NO') ```
0
478
B
Random Teams
PROGRAMMING
1,300
[ "combinatorics", "constructive algorithms", "greedy", "math" ]
null
null
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends. Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
[ "5 1\n", "3 2\n", "6 3\n" ]
[ "10 10\n", "1 1\n", "3 6\n" ]
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends. In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one. In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
1,000
[ { "input": "5 1", "output": "10 10" }, { "input": "3 2", "output": "1 1" }, { "input": "6 3", "output": "3 6" }, { "input": "5 3", "output": "2 3" }, { "input": "10 2", "output": "20 36" }, { "input": "10 6", "output": "4 10" }, { "input": "1000000000 1", "output": "499999999500000000 499999999500000000" }, { "input": "5000000 12", "output": "1041664166668 12499942500066" }, { "input": "1833 195", "output": "7722 1342341" }, { "input": "1000000000 1000000000", "output": "0 0" }, { "input": "1000000000 1000000", "output": "499500000000 499000500499500000" }, { "input": "1000000000 32170", "output": "15541930838100 499967831017438365" }, { "input": "1000000 1000", "output": "499500000 499000999500" }, { "input": "1234 1123", "output": "111 6216" }, { "input": "599222887 298488", "output": "601178656545 179355218158217800" }, { "input": "999999999 500000000", "output": "499999999 124999999750000000" }, { "input": "1000000000 384842119", "output": "845473643 189209609585784021" }, { "input": "1000000000 384842119", "output": "845473643 189209609585784021" }, { "input": "1000000000 2", "output": "249999999500000000 499999998500000001" }, { "input": "1000000000 999999999", "output": "1 1" }, { "input": "38447 383", "output": "1910550 724453080" }, { "input": "100000000 99999799", "output": "201 20301" }, { "input": "1 1", "output": "0 0" }, { "input": "2 1", "output": "1 1" }, { "input": "2 2", "output": "0 0" }, { "input": "10 10", "output": "0 0" } ]
1,694,535,922
2,147,483,647
Python 3
OK
TESTS
26
46
0
n,m=map(int,input().split()) max=((n-m+1)*(n-m))//2 remainder=(n-m)%m q=(n-m)//m min= (((q+1)*(q))//2)*(m-remainder) min += (((q+2)*(q+1))//2)*(remainder) print(min, max)
Title: Random Teams Time Limit: None seconds Memory Limit: None megabytes Problem Description: *n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends. Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition. Input Specification: The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively. Output Specification: The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively. Demo Input: ['5 1\n', '3 2\n', '6 3\n'] Demo Output: ['10 10\n', '1 1\n', '3 6\n'] Note: In the first sample all the participants get into one team, so there will be exactly ten pairs of friends. In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one. In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
```python n,m=map(int,input().split()) max=((n-m+1)*(n-m))//2 remainder=(n-m)%m q=(n-m)//m min= (((q+1)*(q))//2)*(m-remainder) min += (((q+2)*(q+1))//2)*(remainder) print(min, max) ```
3
180
F
Mathematical Analysis Rocks!
PROGRAMMING
1,200
[ "constructive algorithms", "implementation", "math" ]
null
null
Students of group 199 have written their lectures dismally. Now an exam on Mathematical Analysis is approaching and something has to be done asap (that is, quickly). Let's number the students of the group from 1 to *n*. Each student *i* (1<=≤<=*i*<=≤<=*n*) has a best friend *p*[*i*] (1<=≤<=*p*[*i*]<=≤<=*n*). In fact, each student is a best friend of exactly one student. In other words, all *p*[*i*] are different. It is possible that the group also has some really "special individuals" for who *i*<==<=*p*[*i*]. Each student wrote exactly one notebook of lecture notes. We know that the students agreed to act by the following algorithm: - on the first day of revising each student studies his own Mathematical Analysis notes, - in the morning of each following day each student gives the notebook to his best friend and takes a notebook from the student who calls him the best friend. Thus, on the second day the student *p*[*i*] (1<=≤<=*i*<=≤<=*n*) studies the *i*-th student's notes, on the third day the notes go to student *p*[*p*[*i*]] and so on. Due to some characteristics of the boys' friendship (see paragraph 1), each day each student has exactly one notebook to study. You are given two sequences that describe the situation on the third and fourth days of revising: - *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* means the student who gets the *i*-th student's notebook on the third day of revising; - *b*1,<=*b*2,<=...,<=*b**n*, where *b**i* means the student who gets the *i*-th student's notebook on the fourth day of revising. You do not know array *p*, that is you do not know who is the best friend to who. Write a program that finds *p* by the given sequences *a* and *b*.
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of students in the group. The second line contains sequence of different integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*). The third line contains the sequence of different integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=*n*).
Print sequence *n* of different integers *p*[1],<=*p*[2],<=...,<=*p*[*n*] (1<=≤<=*p*[*i*]<=≤<=*n*). It is guaranteed that the solution exists and that it is unique.
[ "4\n2 1 4 3\n3 4 2 1\n", "5\n5 2 3 1 4\n1 3 2 4 5\n", "2\n1 2\n2 1\n" ]
[ "4 3 1 2 ", "4 3 2 5 1 ", "2 1 " ]
none
0
[ { "input": "4\n2 1 4 3\n3 4 2 1", "output": "4 3 1 2 " }, { "input": "5\n5 2 3 1 4\n1 3 2 4 5", "output": "4 3 2 5 1 " }, { "input": "2\n1 2\n2 1", "output": "2 1 " }, { "input": "1\n1\n1", "output": "1 " }, { "input": "2\n1 2\n1 2", "output": "1 2 " }, { "input": "3\n2 3 1\n1 2 3", "output": "3 1 2 " }, { "input": "3\n1 2 3\n2 1 3", "output": "2 1 3 " }, { "input": "3\n1 2 3\n1 2 3", "output": "1 2 3 " }, { "input": "4\n1 2 3 4\n2 1 4 3", "output": "2 1 4 3 " }, { "input": "5\n4 1 2 5 3\n2 3 5 1 4", "output": "3 5 4 2 1 " }, { "input": "10\n2 9 1 7 6 8 5 4 10 3\n6 8 5 1 9 10 2 3 4 7", "output": "5 6 7 3 2 9 1 10 8 4 " }, { "input": "10\n5 9 7 1 4 10 3 6 2 8\n8 3 9 10 6 5 2 1 7 4", "output": "10 7 2 6 8 1 9 4 3 5 " }, { "input": "10\n9 10 6 8 5 3 1 7 4 2\n7 6 2 9 5 10 8 4 1 3", "output": "8 3 10 1 5 2 4 9 7 6 " } ]
1,698,245,647
2,147,483,647
PyPy 3-64
OK
TESTS
40
342
17,612,800
n = int(input()) a = list(map(int, input().split())) b = list(map(int, input().split())) d = [0] * n for i in range(n): a[i] -= 1 b[i] -= 1 d[a[i]] = i for i in range(n): print(d[b[i]] + 1, end=" ")# 1698245647.4107454
Title: Mathematical Analysis Rocks! Time Limit: None seconds Memory Limit: None megabytes Problem Description: Students of group 199 have written their lectures dismally. Now an exam on Mathematical Analysis is approaching and something has to be done asap (that is, quickly). Let's number the students of the group from 1 to *n*. Each student *i* (1<=≤<=*i*<=≤<=*n*) has a best friend *p*[*i*] (1<=≤<=*p*[*i*]<=≤<=*n*). In fact, each student is a best friend of exactly one student. In other words, all *p*[*i*] are different. It is possible that the group also has some really "special individuals" for who *i*<==<=*p*[*i*]. Each student wrote exactly one notebook of lecture notes. We know that the students agreed to act by the following algorithm: - on the first day of revising each student studies his own Mathematical Analysis notes, - in the morning of each following day each student gives the notebook to his best friend and takes a notebook from the student who calls him the best friend. Thus, on the second day the student *p*[*i*] (1<=≤<=*i*<=≤<=*n*) studies the *i*-th student's notes, on the third day the notes go to student *p*[*p*[*i*]] and so on. Due to some characteristics of the boys' friendship (see paragraph 1), each day each student has exactly one notebook to study. You are given two sequences that describe the situation on the third and fourth days of revising: - *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* means the student who gets the *i*-th student's notebook on the third day of revising; - *b*1,<=*b*2,<=...,<=*b**n*, where *b**i* means the student who gets the *i*-th student's notebook on the fourth day of revising. You do not know array *p*, that is you do not know who is the best friend to who. Write a program that finds *p* by the given sequences *a* and *b*. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of students in the group. The second line contains sequence of different integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*). The third line contains the sequence of different integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=*n*). Output Specification: Print sequence *n* of different integers *p*[1],<=*p*[2],<=...,<=*p*[*n*] (1<=≤<=*p*[*i*]<=≤<=*n*). It is guaranteed that the solution exists and that it is unique. Demo Input: ['4\n2 1 4 3\n3 4 2 1\n', '5\n5 2 3 1 4\n1 3 2 4 5\n', '2\n1 2\n2 1\n'] Demo Output: ['4 3 1 2 ', '4 3 2 5 1 ', '2 1 '] Note: none
```python n = int(input()) a = list(map(int, input().split())) b = list(map(int, input().split())) d = [0] * n for i in range(n): a[i] -= 1 b[i] -= 1 d[a[i]] = i for i in range(n): print(d[b[i]] + 1, end=" ")# 1698245647.4107454 ```
3
855
A
Tom Riddle's Diary
PROGRAMMING
800
[ "brute force", "implementation", "strings" ]
null
null
Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence. He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not. Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=&lt;<=*i*, otherwise, output "NO" (without quotes).
First line of input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of names in the list. Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100.
Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not. You can print each letter in any case (upper or lower).
[ "6\ntom\nlucius\nginny\nharry\nginny\nharry\n", "3\na\na\na\n" ]
[ "NO\nNO\nNO\nNO\nYES\nYES\n", "NO\nYES\nYES\n" ]
In test case 1, for *i* = 5 there exists *j* = 3 such that *s*<sub class="lower-index">*i*</sub> = *s*<sub class="lower-index">*j*</sub> and *j* &lt; *i*, which means that answer for *i* = 5 is "YES".
500
[ { "input": "6\ntom\nlucius\nginny\nharry\nginny\nharry", "output": "NO\nNO\nNO\nNO\nYES\nYES" }, { "input": "3\na\na\na", "output": "NO\nYES\nYES" }, { "input": "1\nzn", "output": "NO" }, { "input": "9\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nhrtm\nssjqvixduertmotgagizamvfucfwtxqnhuowbqbzctgznivehelpcyigwrbbdsxnewfqvcf\nhyrtxvozpbveexfkgalmguozzakitjiwsduqxonb\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nbdbivqzvhggth", "output": "NO\nYES\nYES\nNO\nNO\nNO\nNO\nYES\nNO" }, { "input": "10\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nmvutw\nqooeqoxzxwetlpecqiwgdbogiqqulttysyohwhzxzphvsfmnplizxoebzcvvfyppqbhxjksuzepuezqqzxlfmdanoeaoqmor\nmvutw\nvchawxjoreboqzuklifv\nvchawxjoreboqzuklifv\nnivijte\nrflybruq\nvchawxjoreboqzuklifv", "output": "NO\nYES\nNO\nNO\nYES\nNO\nYES\nNO\nNO\nYES" }, { "input": "1\nz", "output": "NO" }, { "input": "9\nl\ny\nm\nj\nn\nr\nj\nk\nf", "output": "NO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO" }, { "input": "14\nw\na\nh\np\nk\nw\ny\nv\ns\nf\nx\nd\nk\nr", "output": "NO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO" }, { "input": "25\np\nk\nu\nl\nf\nt\nc\ns\nq\nd\nb\nq\no\ni\ni\nd\ni\nw\nn\ng\nw\nt\na\ne\ni", "output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nYES\nYES\nYES\nNO\nNO\nNO\nYES\nYES\nNO\nNO\nYES" }, { "input": "20\nd\nh\ng\no\np\ne\nt\nj\nv\ni\nt\nh\ns\ni\nw\nf\nx\na\nl\ni", "output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nYES\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nYES" }, { "input": "3\nbbbbbbb\nbbbbbbbbb\nbbbbbbbbbbbbbbbbbbbbbbbbbbbb", "output": "NO\nNO\nNO" }, { "input": "2\nab\nba", "output": "NO\nNO" }, { "input": "6\ntom\nlucius\nginnys\nharpy\nginny\nharry", "output": "NO\nNO\nNO\nNO\nNO\nNO" }, { "input": "2\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde", "output": "NO\nYES" }, { "input": "42\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na", "output": "NO\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES" } ]
1,588,258,958
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
93
0
n = int(input()) lis = [] for i in range(n): s = input() lis.append(s) flag = 0 for i in range(n): for j in range(n): if j<i and lis[j]==lis[i]: flag=1 if flag==1: print("YES") else: print("NO")
Title: Tom Riddle's Diary Time Limit: None seconds Memory Limit: None megabytes Problem Description: Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence. He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not. Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=&lt;<=*i*, otherwise, output "NO" (without quotes). Input Specification: First line of input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of names in the list. Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100. Output Specification: Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not. You can print each letter in any case (upper or lower). Demo Input: ['6\ntom\nlucius\nginny\nharry\nginny\nharry\n', '3\na\na\na\n'] Demo Output: ['NO\nNO\nNO\nNO\nYES\nYES\n', 'NO\nYES\nYES\n'] Note: In test case 1, for *i* = 5 there exists *j* = 3 such that *s*<sub class="lower-index">*i*</sub> = *s*<sub class="lower-index">*j*</sub> and *j* &lt; *i*, which means that answer for *i* = 5 is "YES".
```python n = int(input()) lis = [] for i in range(n): s = input() lis.append(s) flag = 0 for i in range(n): for j in range(n): if j<i and lis[j]==lis[i]: flag=1 if flag==1: print("YES") else: print("NO") ```
0
931
A
Friends Meeting
PROGRAMMING
800
[ "brute force", "greedy", "implementation", "math" ]
null
null
Two friends are on the coordinate axis *Ox* in points with integer coordinates. One of them is in the point *x*1<==<=*a*, another one is in the point *x*2<==<=*b*. Each of the friends can move by one along the line in any direction unlimited number of times. When a friend moves, the tiredness of a friend changes according to the following rules: the first move increases the tiredness by 1, the second move increases the tiredness by 2, the third — by 3 and so on. For example, if a friend moves first to the left, then to the right (returning to the same point), and then again to the left his tiredness becomes equal to 1<=+<=2<=+<=3<==<=6. The friends want to meet in a integer point. Determine the minimum total tiredness they should gain, if they meet in the same point.
The first line contains a single integer *a* (1<=≤<=*a*<=≤<=1000) — the initial position of the first friend. The second line contains a single integer *b* (1<=≤<=*b*<=≤<=1000) — the initial position of the second friend. It is guaranteed that *a*<=≠<=*b*.
Print the minimum possible total tiredness if the friends meet in the same point.
[ "3\n4\n", "101\n99\n", "5\n10\n" ]
[ "1\n", "2\n", "9\n" ]
In the first example the first friend should move by one to the right (then the meeting happens at point 4), or the second friend should move by one to the left (then the meeting happens at point 3). In both cases, the total tiredness becomes 1. In the second example the first friend should move by one to the left, and the second friend should move by one to the right. Then they meet in the point 100, and the total tiredness becomes 1 + 1 = 2. In the third example one of the optimal ways is the following. The first friend should move three times to the right, and the second friend — two times to the left. Thus the friends meet in the point 8, and the total tiredness becomes 1 + 2 + 3 + 1 + 2 = 9.
500
[ { "input": "3\n4", "output": "1" }, { "input": "101\n99", "output": "2" }, { "input": "5\n10", "output": "9" }, { "input": "1\n2", "output": "1" }, { "input": "1\n1000", "output": "250000" }, { "input": "999\n1000", "output": "1" }, { "input": "1000\n999", "output": "1" }, { "input": "1000\n1", "output": "250000" }, { "input": "2\n1", "output": "1" }, { "input": "2\n999", "output": "249001" }, { "input": "2\n998", "output": "248502" }, { "input": "999\n2", "output": "249001" }, { "input": "998\n2", "output": "248502" }, { "input": "2\n1000", "output": "249500" }, { "input": "1000\n2", "output": "249500" }, { "input": "1\n999", "output": "249500" }, { "input": "999\n1", "output": "249500" }, { "input": "188\n762", "output": "82656" }, { "input": "596\n777", "output": "8281" }, { "input": "773\n70", "output": "123904" }, { "input": "825\n729", "output": "2352" }, { "input": "944\n348", "output": "89102" }, { "input": "352\n445", "output": "2209" }, { "input": "529\n656", "output": "4096" }, { "input": "19\n315", "output": "22052" }, { "input": "138\n370", "output": "13572" }, { "input": "546\n593", "output": "576" }, { "input": "285\n242", "output": "484" }, { "input": "773\n901", "output": "4160" }, { "input": "892\n520", "output": "34782" }, { "input": "864\n179", "output": "117649" }, { "input": "479\n470", "output": "25" }, { "input": "967\n487", "output": "57840" }, { "input": "648\n106", "output": "73712" }, { "input": "58\n765", "output": "125316" }, { "input": "235\n56", "output": "8100" }, { "input": "285\n153", "output": "4422" }, { "input": "943\n13", "output": "216690" }, { "input": "675\n541", "output": "4556" }, { "input": "4\n912", "output": "206570" } ]
1,636,603,226
2,147,483,647
Python 3
OK
TESTS
40
46
4,505,600
def friendsMeeting(a, b): diff = abs(a - b) if diff == 1: return 1 xa = diff // 2 xb = diff - xa return doSum(xa) + doSum(xb) def doSum(n): return n * (n + 1) // 2 a, b = int(input()), int(input()) print(friendsMeeting(a, b))
Title: Friends Meeting Time Limit: None seconds Memory Limit: None megabytes Problem Description: Two friends are on the coordinate axis *Ox* in points with integer coordinates. One of them is in the point *x*1<==<=*a*, another one is in the point *x*2<==<=*b*. Each of the friends can move by one along the line in any direction unlimited number of times. When a friend moves, the tiredness of a friend changes according to the following rules: the first move increases the tiredness by 1, the second move increases the tiredness by 2, the third — by 3 and so on. For example, if a friend moves first to the left, then to the right (returning to the same point), and then again to the left his tiredness becomes equal to 1<=+<=2<=+<=3<==<=6. The friends want to meet in a integer point. Determine the minimum total tiredness they should gain, if they meet in the same point. Input Specification: The first line contains a single integer *a* (1<=≤<=*a*<=≤<=1000) — the initial position of the first friend. The second line contains a single integer *b* (1<=≤<=*b*<=≤<=1000) — the initial position of the second friend. It is guaranteed that *a*<=≠<=*b*. Output Specification: Print the minimum possible total tiredness if the friends meet in the same point. Demo Input: ['3\n4\n', '101\n99\n', '5\n10\n'] Demo Output: ['1\n', '2\n', '9\n'] Note: In the first example the first friend should move by one to the right (then the meeting happens at point 4), or the second friend should move by one to the left (then the meeting happens at point 3). In both cases, the total tiredness becomes 1. In the second example the first friend should move by one to the left, and the second friend should move by one to the right. Then they meet in the point 100, and the total tiredness becomes 1 + 1 = 2. In the third example one of the optimal ways is the following. The first friend should move three times to the right, and the second friend — two times to the left. Thus the friends meet in the point 8, and the total tiredness becomes 1 + 2 + 3 + 1 + 2 = 9.
```python def friendsMeeting(a, b): diff = abs(a - b) if diff == 1: return 1 xa = diff // 2 xb = diff - xa return doSum(xa) + doSum(xb) def doSum(n): return n * (n + 1) // 2 a, b = int(input()), int(input()) print(friendsMeeting(a, b)) ```
3
463
B
Caisa and Pylons
PROGRAMMING
1,100
[ "brute force", "implementation", "math" ]
null
null
Caisa solved the problem with the sugar and now he is on the way back to home. Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=&gt;<=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time. Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game?
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=≤<=<=*h**i*<=<=≤<=<=105) representing the heights of the pylons.
Print a single number representing the minimum number of dollars paid by Caisa.
[ "5\n3 4 3 2 4\n", "3\n4 4 4\n" ]
[ "4\n", "4\n" ]
In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon.
1,000
[ { "input": "5\n3 4 3 2 4", "output": "4" }, { "input": "3\n4 4 4", "output": "4" }, { "input": "99\n1401 2019 1748 3785 3236 3177 3443 3772 2138 1049 353 908 310 2388 1322 88 2160 2783 435 2248 1471 706 2468 2319 3156 3506 2794 1999 1983 2519 2597 3735 537 344 3519 3772 3872 2961 3895 2010 10 247 3269 671 2986 942 758 1146 77 1545 3745 1547 2250 2565 217 1406 2070 3010 3404 404 1528 2352 138 2065 3047 3656 2188 2919 2616 2083 1280 2977 2681 548 4000 1667 1489 1109 3164 1565 2653 3260 3463 903 1824 3679 2308 245 2689 2063 648 568 766 785 2984 3812 440 1172 2730", "output": "4000" }, { "input": "68\n477 1931 3738 3921 2306 1823 3328 2057 661 3993 2967 3520 171 1739 1525 1817 209 3475 1902 2666 518 3283 3412 3040 3383 2331 1147 1460 1452 1800 1327 2280 82 1416 2200 2388 3238 1879 796 250 1872 114 121 2042 1853 1645 211 2061 1472 2464 726 1989 1746 489 1380 1128 2819 2527 2939 622 678 265 2902 1111 2032 1453 3850 1621", "output": "3993" }, { "input": "30\n30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "30" }, { "input": "3\n3 2 1", "output": "3" }, { "input": "1\n69", "output": "69" } ]
1,677,387,012
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
2
46
0
n = int(input()) l = [0] + [int(i) for i in input().split()] c = 0 for i in range(n): c += l[i]-l[i+1] print(0 if c >= 0 else c*-1)
Title: Caisa and Pylons Time Limit: None seconds Memory Limit: None megabytes Problem Description: Caisa solved the problem with the sugar and now he is on the way back to home. Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=&gt;<=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time. Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game? Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=≤<=<=*h**i*<=<=≤<=<=105) representing the heights of the pylons. Output Specification: Print a single number representing the minimum number of dollars paid by Caisa. Demo Input: ['5\n3 4 3 2 4\n', '3\n4 4 4\n'] Demo Output: ['4\n', '4\n'] Note: In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon.
```python n = int(input()) l = [0] + [int(i) for i in input().split()] c = 0 for i in range(n): c += l[i]-l[i+1] print(0 if c >= 0 else c*-1) ```
0
0
none
none
none
0
[ "none" ]
null
null
A positive integer is called a 2-3-integer, if it is equal to 2*x*·3*y* for some non-negative integers *x* and *y*. In other words, these integers are such integers that only have 2 and 3 among their prime divisors. For example, integers 1, 6, 9, 16 and 108 — are 2-3 integers, while 5, 10, 21 and 120 are not. Print the number of 2-3-integers on the given segment [*l*,<=*r*], i. e. the number of sich 2-3-integers *t* that *l*<=≤<=*t*<=≤<=*r*.
The only line contains two integers *l* and *r* (1<=≤<=*l*<=≤<=*r*<=≤<=2·109).
Print a single integer the number of 2-3-integers on the segment [*l*,<=*r*].
[ "1 10\n", "100 200\n", "1 2000000000\n" ]
[ "7\n", "5\n", "326\n" ]
In the first example the 2-3-integers are 1, 2, 3, 4, 6, 8 and 9. In the second example the 2-3-integers are 108, 128, 144, 162 and 192.
0
[ { "input": "1 10", "output": "7" }, { "input": "100 200", "output": "5" }, { "input": "1 2000000000", "output": "326" }, { "input": "1088391168 1934917632", "output": "17" }, { "input": "1088391167 1934917632", "output": "17" }, { "input": "1088391169 1934917632", "output": "16" }, { "input": "1088391168 1934917631", "output": "16" }, { "input": "1088391168 1934917633", "output": "17" }, { "input": "4 134217728", "output": "250" }, { "input": "209952 43046722", "output": "112" }, { "input": "25165825 43046719", "output": "13" }, { "input": "5183 25165825", "output": "153" }, { "input": "388645 455910", "output": "3" }, { "input": "472069 972050", "output": "14" }, { "input": "1 1", "output": "1" }, { "input": "2 2", "output": "1" }, { "input": "12 1999999931", "output": "319" }, { "input": "1999999999 1999999999", "output": "0" }, { "input": "2000000000 2000000000", "output": "0" }, { "input": "1934917632 1934917632", "output": "1" }, { "input": "1836660096 1836660096", "output": "1" }, { "input": "1811939328 1811939328", "output": "1" }, { "input": "1719926784 1719926784", "output": "1" }, { "input": "1632586752 1632586752", "output": "1" }, { "input": "1610612736 1610612736", "output": "1" }, { "input": "1207959552 1207959552", "output": "1" }, { "input": "129140163 129140163", "output": "1" }, { "input": "12345 54321", "output": "21" }, { "input": "1889569 25165826", "output": "56" }, { "input": "73 7077888", "output": "165" }, { "input": "7077888 45349631", "output": "43" }, { "input": "6144 7077886", "output": "122" }, { "input": "3779135 4194302", "output": "2" }, { "input": "214 161243134", "output": "232" }, { "input": "214 18874369", "output": "180" }, { "input": "28 863", "output": "26" }, { "input": "1417174 172186886", "output": "112" }, { "input": "27 102036671", "output": "234" }, { "input": "147458 102036672", "output": "138" }, { "input": "33554431 102036671", "output": "28" }, { "input": "1572863 33554433", "output": "68" }, { "input": "33554434 181398528", "output": "43" }, { "input": "373247 17915905", "output": "81" }, { "input": "4251526 68024450", "output": "65" }, { "input": "553599 555493", "output": "0" }, { "input": "69739 671621", "output": "40" }, { "input": "618583 755045", "output": "4" }, { "input": "838469 943236", "output": "2" }, { "input": "509607936 1836660096", "output": "38" }, { "input": "509607935 1836660096", "output": "38" }, { "input": "509607937 1836660096", "output": "37" }, { "input": "509607936 1836660095", "output": "37" }, { "input": "509607936 1836660097", "output": "38" } ]
1,521,305,846
4,946
Python 3
OK
TESTS
53
109
7,065,600
def main(): a, b = map(int, input().split()); count=0; for two_fact in range(0,40): for three_fact in range(0,40): if(a<=(2**two_fact)*(3**three_fact) and b>=(2**two_fact)*(3**three_fact)): count+=1; print(count); main();
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: A positive integer is called a 2-3-integer, if it is equal to 2*x*·3*y* for some non-negative integers *x* and *y*. In other words, these integers are such integers that only have 2 and 3 among their prime divisors. For example, integers 1, 6, 9, 16 and 108 — are 2-3 integers, while 5, 10, 21 and 120 are not. Print the number of 2-3-integers on the given segment [*l*,<=*r*], i. e. the number of sich 2-3-integers *t* that *l*<=≤<=*t*<=≤<=*r*. Input Specification: The only line contains two integers *l* and *r* (1<=≤<=*l*<=≤<=*r*<=≤<=2·109). Output Specification: Print a single integer the number of 2-3-integers on the segment [*l*,<=*r*]. Demo Input: ['1 10\n', '100 200\n', '1 2000000000\n'] Demo Output: ['7\n', '5\n', '326\n'] Note: In the first example the 2-3-integers are 1, 2, 3, 4, 6, 8 and 9. In the second example the 2-3-integers are 108, 128, 144, 162 and 192.
```python def main(): a, b = map(int, input().split()); count=0; for two_fact in range(0,40): for three_fact in range(0,40): if(a<=(2**two_fact)*(3**three_fact) and b>=(2**two_fact)*(3**three_fact)): count+=1; print(count); main(); ```
3
716
A
Crazy Computer
PROGRAMMING
800
[ "implementation" ]
null
null
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear! More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=&gt;<=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen. For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen. You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively. The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=&lt;<=*t*2<=&lt;<=...<=&lt;<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
[ "6 5\n1 3 8 14 19 20\n", "6 1\n1 3 5 7 9 10\n" ]
[ "3", "2" ]
The first sample is already explained in the problem statement. For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 &gt; 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
500
[ { "input": "6 5\n1 3 8 14 19 20", "output": "3" }, { "input": "6 1\n1 3 5 7 9 10", "output": "2" }, { "input": "1 1\n1000000000", "output": "1" }, { "input": "5 5\n1 7 12 13 14", "output": "4" }, { "input": "2 1000000000\n1 1000000000", "output": "2" }, { "input": "3 5\n1 10 20", "output": "1" }, { "input": "3 10\n1 2 3", "output": "3" }, { "input": "2 1\n1 100", "output": "1" }, { "input": "3 1\n1 2 10", "output": "1" }, { "input": "2 1\n1 2", "output": "2" } ]
1,666,374,600
2,147,483,647
Python 3
OK
TESTS
81
109
8,396,800
n, c = map(int, input().split()) t = list(map(int, input().split())) counter = 1 for i in range(n - 1): if t[i + 1] - t[i] > c: counter = 1 else: counter += 1 print(counter)
Title: Crazy Computer Time Limit: None seconds Memory Limit: None megabytes Problem Description: ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear! More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=&gt;<=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen. For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen. You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything. Input Specification: The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively. The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=&lt;<=*t*2<=&lt;<=...<=&lt;<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word. Output Specification: Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*. Demo Input: ['6 5\n1 3 8 14 19 20\n', '6 1\n1 3 5 7 9 10\n'] Demo Output: ['3', '2'] Note: The first sample is already explained in the problem statement. For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 &gt; 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
```python n, c = map(int, input().split()) t = list(map(int, input().split())) counter = 1 for i in range(n - 1): if t[i + 1] - t[i] > c: counter = 1 else: counter += 1 print(counter) ```
3
877
E
Danil and a Part-time Job
PROGRAMMING
2,000
[ "bitmasks", "data structures", "trees" ]
null
null
Danil decided to earn some money, so he had found a part-time job. The interview have went well, so now he is a light switcher. Danil works in a rooted tree (undirected connected acyclic graph) with *n* vertices, vertex 1 is the root of the tree. There is a room in each vertex, light can be switched on or off in each room. Danil's duties include switching light in all rooms of the subtree of the vertex. It means that if light is switched on in some room of the subtree, he should switch it off. Otherwise, he should switch it on. Unfortunately (or fortunately), Danil is very lazy. He knows that his boss is not going to personally check the work. Instead, he will send Danil tasks using Workforces personal messages. There are two types of tasks: 1. pow v describes a task to switch lights in the subtree of vertex *v*.1. get v describes a task to count the number of rooms in the subtree of *v*, in which the light is turned on. Danil should send the answer to his boss using Workforces messages. A subtree of vertex *v* is a set of vertices for which the shortest path from them to the root passes through *v*. In particular, the vertex *v* is in the subtree of *v*. Danil is not going to perform his duties. He asks you to write a program, which answers the boss instead of him.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of vertices in the tree. The second line contains *n*<=-<=1 space-separated integers *p*2,<=*p*3,<=...,<=*p**n* (1<=≤<=*p**i*<=&lt;<=*i*), where *p**i* is the ancestor of vertex *i*. The third line contains *n* space-separated integers *t*1,<=*t*2,<=...,<=*t**n* (0<=≤<=*t**i*<=≤<=1), where *t**i* is 1, if the light is turned on in vertex *i* and 0 otherwise. The fourth line contains a single integer *q* (1<=≤<=*q*<=≤<=200<=000) — the number of tasks. The next *q* lines are get v or pow v (1<=≤<=*v*<=≤<=*n*) — the tasks described above.
For each task get v print the number of rooms in the subtree of *v*, in which the light is turned on.
[ "4\n1 1 1\n1 0 0 1\n9\nget 1\nget 2\nget 3\nget 4\npow 1\nget 1\nget 2\nget 3\nget 4\n" ]
[ "2\n0\n0\n1\n2\n1\n1\n0\n" ]
<img class="tex-graphics" src="https://espresso.codeforces.com/839c4a0a06cc547ffb8d937bfe52730b51c842b4.png" style="max-width: 100.0%;max-height: 100.0%;"/> The tree after the task pow 1.
2,250
[ { "input": "4\n1 1 1\n1 0 0 1\n9\nget 1\nget 2\nget 3\nget 4\npow 1\nget 1\nget 2\nget 3\nget 4", "output": "2\n0\n0\n1\n2\n1\n1\n0" }, { "input": "1\n\n1\n4\npow 1\nget 1\npow 1\nget 1", "output": "0\n1" }, { "input": "10\n1 2 3 4 2 4 1 7 8\n1 1 0 1 1 0 0 0 1 1\n10\npow 1\nget 2\npow 2\npow 8\nget 6\npow 6\npow 10\nget 6\npow 8\npow 3", "output": "3\n0\n1" }, { "input": "10\n1 1 1 4 5 3 5 6 3\n0 0 0 0 0 0 1 0 0 0\n10\nget 2\nget 4\nget 7\nget 3\npow 2\npow 5\npow 2\nget 7\npow 6\nget 10", "output": "0\n0\n1\n1\n1\n0" }, { "input": "10\n1 1 3 1 3 1 4 6 3\n0 1 1 1 1 1 1 1 0 0\n10\nget 9\nget 10\nget 4\nget 5\nget 5\nget 5\nget 10\nget 7\nget 5\nget 2", "output": "0\n0\n2\n1\n1\n1\n0\n1\n1\n1" }, { "input": "10\n1 2 3 3 5 5 7 7 8\n0 0 0 0 1 1 1 1 0 0\n10\npow 3\nget 1\npow 9\nget 1\nget 1\nget 8\npow 8\npow 4\nget 10\npow 2", "output": "4\n3\n3\n1\n0" }, { "input": "10\n1 2 3 3 5 5 7 7 9\n1 1 0 1 0 0 1 0 0 0\n10\nget 2\nget 6\nget 4\nget 2\nget 1\nget 2\nget 6\nget 9\nget 10\nget 7", "output": "3\n0\n1\n3\n4\n3\n0\n0\n0\n1" }, { "input": "10\n1 1 2 2 3 3 5 5 6\n1 1 1 1 0 0 1 1 0 0\n10\nget 2\nget 8\nget 10\nget 5\nget 5\npow 10\nget 10\nget 1\nget 7\npow 4", "output": "3\n1\n0\n1\n1\n1\n7\n1" }, { "input": "10\n1 1 2 2 3 3 4 4 5\n1 1 0 1 0 0 0 0 0 0\n10\nget 2\nget 5\npow 2\npow 4\nget 2\nget 4\npow 7\nget 10\npow 5\nget 6", "output": "2\n0\n3\n1\n1\n0" } ]
1,627,352,259
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
3
108
20,480,000
# ------------------- fast io -------------------- import os import sys from io import BytesIO, IOBase BUFSIZE = 8192 class FastIO(IOBase): newlines = 0 def __init__(self, file): self._fd = file.fileno() self.buffer = BytesIO() self.writable = "x" in file.mode or "r" not in file.mode self.write = self.buffer.write if self.writable else None def read(self): while True: b = os.read(self._fd, max(os.fstat(self._fd).st_size, BUFSIZE)) if not b: break ptr = self.buffer.tell() self.buffer.seek(0, 2), self.buffer.write(b), self.buffer.seek(ptr) self.newlines = 0 return self.buffer.read() def readline(self): while self.newlines == 0: b = os.read(self._fd, max(os.fstat(self._fd).st_size, BUFSIZE)) self.newlines = b.count(b"\n") + (not b) ptr = self.buffer.tell() self.buffer.seek(0, 2), self.buffer.write(b), self.buffer.seek(ptr) self.newlines -= 1 return self.buffer.readline() def flush(self): if self.writable: os.write(self._fd, self.buffer.getvalue()) self.buffer.truncate(0), self.buffer.seek(0) class IOWrapper(IOBase): def __init__(self, file): self.buffer = FastIO(file) self.flush = self.buffer.flush self.writable = self.buffer.writable self.write = lambda s: self.buffer.write(s.encode("ascii")) self.read = lambda: self.buffer.read().decode("ascii") self.readline = lambda: self.buffer.readline().decode("ascii") sys.stdin, sys.stdout = IOWrapper(sys.stdin), IOWrapper(sys.stdout) input = lambda: sys.stdin.readline().rstrip("\r\n") # ------------------- fast io -------------------- from math import ceil def prod(a, mod=10 ** 9 + 7): ans = 1 for each in a: ans = (ans * each) % mod return ans def gcd(x, y): while y: x, y = y, x % y return x def lcm(a, b): return a * b // gcd(a, b) def binary(x, length=16): y = bin(x)[2:] return y if len(y) >= length else "0" * (length - len(y)) + y from math import inf, log2 class LazySegmentTree: def __init__(self, array, func=max): self.n = len(array) self.size = 2 ** (int(log2(self.n - 1)) + 1) if self.n != 1 else 1 self.func = func self.default = 0 self.data = [self.default] * (2 * self.size) self.segsize = [0] * (2 * self.size) self.lazy = [0] * (2 * self.size) self.process(array) def process(self, array): self.data[self.size: self.size + self.n] = array self.segsize[self.size: self.size + self.n] = [1] * len(array) for i in range(self.size - 1, -1, -1): self.data[i] = self.data[2 * i] + self.data[2 * i + 1] self.segsize[i] = self.segsize[2 * i] + self.segsize[2 * i + 1] def push(self, index): """Push the information of the root to it's children!""" self.lazy[2 * index] += self.lazy[index] self.lazy[2 * index + 1] += self.lazy[index] if self.lazy[index] % 2: self.data[index] = self.segsize[index] - self.data[index] self.lazy[index] = 0 def build(self, index): """Build data with the new changes!""" index >>= 1 while index: left, right = self.data[2 * index], self.data[2 * index + 1] if self.lazy[2 * index] % 2: left = self.segsize[2 * index] - left if self.lazy[2 * index + 1] % 2: right = self.segsize[2 * index + 1] - right self.data[index] = left + right index >>= 1 def query(self, alpha, omega): """Returns the result of function over the range (inclusive)!""" res = self.default alpha += self.size omega += self.size + 1 for i in range(len(bin(alpha)[2:]) - 1, 0, -1): self.push(alpha >> i) for i in range(len(bin(omega - 1)[2:]) - 1, 0, -1): self.push((omega - 1) >> i) while alpha < omega: if alpha & 1: if self.lazy[alpha] % 2: res += self.segsize[alpha] - self.data[alpha] else: res += self.data[alpha] alpha += 1 if omega & 1: omega -= 1 if self.lazy[omega] % 2: res += self.segsize[omega] - self.data[omega] else: res += self.data[omega] alpha >>= 1 omega >>= 1 return res def update(self, alpha, omega): """Increases all elements in the range (inclusive) by given value!""" alpha += self.size omega += self.size + 1 l, r = alpha, omega for i in range(len(bin(alpha)[2:]) - 1, 0, -1): self.push(alpha >> i) for i in range(len(bin(omega - 1)[2:]) - 1, 0, -1): self.push((omega - 1) >> i) while alpha < omega: if alpha & 1: self.lazy[alpha] += 1 alpha += 1 if omega & 1: omega -= 1 self.lazy[omega] += 1 alpha >>= 1 omega >>= 1 self.build(l) self.build(r - 1) def dfs(graph, alpha): """Depth First Search on a graph!""" n = len(graph) visited = [False] * n finished = [False] * n dp = [0] * n subtree = [0] * n order = [] stack = [alpha] while stack: v = stack[-1] if not visited[v]: visited[v] = True for u in graph[v]: if not visited[u]: stack.append(u) else: order += [stack.pop()] dp[v] = (switch[v] == 1) subtree[v] = 1 for child in graph[v]: if finished[child]: dp[v] += dp[child] subtree[v] += subtree[child] finished[v] = True return dp, order[::-1], subtree for _ in range(int(input()) if not True else 1): n = int(input()) # n, k = map(int, input().split()) # a, b = map(int, input().split()) # c, d = map(int, input().split()) a = list(map(int, input().split())) switch = [0] + list(map(int, input().split())) # s = input() graph = [[] for i in range(n + 1)] for i in range(len(a)): x, y = i + 2, a[i] graph[x] += [y] graph[y] += [x] dp, order, subtree = dfs(graph, 1) index = [0] * (n + 1) for i in range(len(order)): index[order[i]] = i + 1 st = LazySegmentTree(switch, func=lambda a, b: a + b) #for i in range(1, n + 1): # if switch[i]: # st.update(index[i], i) for __ in range(int(input())): s = input().split() x = int(s[1]) count = subtree[x] if s[0] == 'get': print(st.query(index[x], index[x] + count - 1)) else: st.update(index[x], index[x] + count - 1)
Title: Danil and a Part-time Job Time Limit: None seconds Memory Limit: None megabytes Problem Description: Danil decided to earn some money, so he had found a part-time job. The interview have went well, so now he is a light switcher. Danil works in a rooted tree (undirected connected acyclic graph) with *n* vertices, vertex 1 is the root of the tree. There is a room in each vertex, light can be switched on or off in each room. Danil's duties include switching light in all rooms of the subtree of the vertex. It means that if light is switched on in some room of the subtree, he should switch it off. Otherwise, he should switch it on. Unfortunately (or fortunately), Danil is very lazy. He knows that his boss is not going to personally check the work. Instead, he will send Danil tasks using Workforces personal messages. There are two types of tasks: 1. pow v describes a task to switch lights in the subtree of vertex *v*.1. get v describes a task to count the number of rooms in the subtree of *v*, in which the light is turned on. Danil should send the answer to his boss using Workforces messages. A subtree of vertex *v* is a set of vertices for which the shortest path from them to the root passes through *v*. In particular, the vertex *v* is in the subtree of *v*. Danil is not going to perform his duties. He asks you to write a program, which answers the boss instead of him. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of vertices in the tree. The second line contains *n*<=-<=1 space-separated integers *p*2,<=*p*3,<=...,<=*p**n* (1<=≤<=*p**i*<=&lt;<=*i*), where *p**i* is the ancestor of vertex *i*. The third line contains *n* space-separated integers *t*1,<=*t*2,<=...,<=*t**n* (0<=≤<=*t**i*<=≤<=1), where *t**i* is 1, if the light is turned on in vertex *i* and 0 otherwise. The fourth line contains a single integer *q* (1<=≤<=*q*<=≤<=200<=000) — the number of tasks. The next *q* lines are get v or pow v (1<=≤<=*v*<=≤<=*n*) — the tasks described above. Output Specification: For each task get v print the number of rooms in the subtree of *v*, in which the light is turned on. Demo Input: ['4\n1 1 1\n1 0 0 1\n9\nget 1\nget 2\nget 3\nget 4\npow 1\nget 1\nget 2\nget 3\nget 4\n'] Demo Output: ['2\n0\n0\n1\n2\n1\n1\n0\n'] Note: <img class="tex-graphics" src="https://espresso.codeforces.com/839c4a0a06cc547ffb8d937bfe52730b51c842b4.png" style="max-width: 100.0%;max-height: 100.0%;"/> The tree after the task pow 1.
```python # ------------------- fast io -------------------- import os import sys from io import BytesIO, IOBase BUFSIZE = 8192 class FastIO(IOBase): newlines = 0 def __init__(self, file): self._fd = file.fileno() self.buffer = BytesIO() self.writable = "x" in file.mode or "r" not in file.mode self.write = self.buffer.write if self.writable else None def read(self): while True: b = os.read(self._fd, max(os.fstat(self._fd).st_size, BUFSIZE)) if not b: break ptr = self.buffer.tell() self.buffer.seek(0, 2), self.buffer.write(b), self.buffer.seek(ptr) self.newlines = 0 return self.buffer.read() def readline(self): while self.newlines == 0: b = os.read(self._fd, max(os.fstat(self._fd).st_size, BUFSIZE)) self.newlines = b.count(b"\n") + (not b) ptr = self.buffer.tell() self.buffer.seek(0, 2), self.buffer.write(b), self.buffer.seek(ptr) self.newlines -= 1 return self.buffer.readline() def flush(self): if self.writable: os.write(self._fd, self.buffer.getvalue()) self.buffer.truncate(0), self.buffer.seek(0) class IOWrapper(IOBase): def __init__(self, file): self.buffer = FastIO(file) self.flush = self.buffer.flush self.writable = self.buffer.writable self.write = lambda s: self.buffer.write(s.encode("ascii")) self.read = lambda: self.buffer.read().decode("ascii") self.readline = lambda: self.buffer.readline().decode("ascii") sys.stdin, sys.stdout = IOWrapper(sys.stdin), IOWrapper(sys.stdout) input = lambda: sys.stdin.readline().rstrip("\r\n") # ------------------- fast io -------------------- from math import ceil def prod(a, mod=10 ** 9 + 7): ans = 1 for each in a: ans = (ans * each) % mod return ans def gcd(x, y): while y: x, y = y, x % y return x def lcm(a, b): return a * b // gcd(a, b) def binary(x, length=16): y = bin(x)[2:] return y if len(y) >= length else "0" * (length - len(y)) + y from math import inf, log2 class LazySegmentTree: def __init__(self, array, func=max): self.n = len(array) self.size = 2 ** (int(log2(self.n - 1)) + 1) if self.n != 1 else 1 self.func = func self.default = 0 self.data = [self.default] * (2 * self.size) self.segsize = [0] * (2 * self.size) self.lazy = [0] * (2 * self.size) self.process(array) def process(self, array): self.data[self.size: self.size + self.n] = array self.segsize[self.size: self.size + self.n] = [1] * len(array) for i in range(self.size - 1, -1, -1): self.data[i] = self.data[2 * i] + self.data[2 * i + 1] self.segsize[i] = self.segsize[2 * i] + self.segsize[2 * i + 1] def push(self, index): """Push the information of the root to it's children!""" self.lazy[2 * index] += self.lazy[index] self.lazy[2 * index + 1] += self.lazy[index] if self.lazy[index] % 2: self.data[index] = self.segsize[index] - self.data[index] self.lazy[index] = 0 def build(self, index): """Build data with the new changes!""" index >>= 1 while index: left, right = self.data[2 * index], self.data[2 * index + 1] if self.lazy[2 * index] % 2: left = self.segsize[2 * index] - left if self.lazy[2 * index + 1] % 2: right = self.segsize[2 * index + 1] - right self.data[index] = left + right index >>= 1 def query(self, alpha, omega): """Returns the result of function over the range (inclusive)!""" res = self.default alpha += self.size omega += self.size + 1 for i in range(len(bin(alpha)[2:]) - 1, 0, -1): self.push(alpha >> i) for i in range(len(bin(omega - 1)[2:]) - 1, 0, -1): self.push((omega - 1) >> i) while alpha < omega: if alpha & 1: if self.lazy[alpha] % 2: res += self.segsize[alpha] - self.data[alpha] else: res += self.data[alpha] alpha += 1 if omega & 1: omega -= 1 if self.lazy[omega] % 2: res += self.segsize[omega] - self.data[omega] else: res += self.data[omega] alpha >>= 1 omega >>= 1 return res def update(self, alpha, omega): """Increases all elements in the range (inclusive) by given value!""" alpha += self.size omega += self.size + 1 l, r = alpha, omega for i in range(len(bin(alpha)[2:]) - 1, 0, -1): self.push(alpha >> i) for i in range(len(bin(omega - 1)[2:]) - 1, 0, -1): self.push((omega - 1) >> i) while alpha < omega: if alpha & 1: self.lazy[alpha] += 1 alpha += 1 if omega & 1: omega -= 1 self.lazy[omega] += 1 alpha >>= 1 omega >>= 1 self.build(l) self.build(r - 1) def dfs(graph, alpha): """Depth First Search on a graph!""" n = len(graph) visited = [False] * n finished = [False] * n dp = [0] * n subtree = [0] * n order = [] stack = [alpha] while stack: v = stack[-1] if not visited[v]: visited[v] = True for u in graph[v]: if not visited[u]: stack.append(u) else: order += [stack.pop()] dp[v] = (switch[v] == 1) subtree[v] = 1 for child in graph[v]: if finished[child]: dp[v] += dp[child] subtree[v] += subtree[child] finished[v] = True return dp, order[::-1], subtree for _ in range(int(input()) if not True else 1): n = int(input()) # n, k = map(int, input().split()) # a, b = map(int, input().split()) # c, d = map(int, input().split()) a = list(map(int, input().split())) switch = [0] + list(map(int, input().split())) # s = input() graph = [[] for i in range(n + 1)] for i in range(len(a)): x, y = i + 2, a[i] graph[x] += [y] graph[y] += [x] dp, order, subtree = dfs(graph, 1) index = [0] * (n + 1) for i in range(len(order)): index[order[i]] = i + 1 st = LazySegmentTree(switch, func=lambda a, b: a + b) #for i in range(1, n + 1): # if switch[i]: # st.update(index[i], i) for __ in range(int(input())): s = input().split() x = int(s[1]) count = subtree[x] if s[0] == 'get': print(st.query(index[x], index[x] + count - 1)) else: st.update(index[x], index[x] + count - 1) ```
0
628
A
Tennis Tournament
PROGRAMMING
1,000
[ "implementation", "math" ]
null
null
A tennis tournament with *n* participants is running. The participants are playing by an olympic system, so the winners move on and the losers drop out. The tournament takes place in the following way (below, *m* is the number of the participants of the current round): - let *k* be the maximal power of the number 2 such that *k*<=≤<=*m*, - *k* participants compete in the current round and a half of them passes to the next round, the other *m*<=-<=*k* participants pass to the next round directly, - when only one participant remains, the tournament finishes. Each match requires *b* bottles of water for each participant and one bottle for the judge. Besides *p* towels are given to each participant for the whole tournament. Find the number of bottles and towels needed for the tournament. Note that it's a tennis tournament so in each match two participants compete (one of them will win and the other will lose).
The only line contains three integers *n*,<=*b*,<=*p* (1<=≤<=*n*,<=*b*,<=*p*<=≤<=500) — the number of participants and the parameters described in the problem statement.
Print two integers *x* and *y* — the number of bottles and towels need for the tournament.
[ "5 2 3\n", "8 2 4\n" ]
[ "20 15\n", "35 32\n" ]
In the first example will be three rounds: 1. in the first round will be two matches and for each match 5 bottles of water are needed (two for each of the participants and one for the judge), 1. in the second round will be only one match, so we need another 5 bottles of water, 1. in the third round will also be only one match, so we need another 5 bottles of water. So in total we need 20 bottles of water. In the second example no participant will move on to some round directly.
0
[ { "input": "5 2 3", "output": "20 15" }, { "input": "8 2 4", "output": "35 32" }, { "input": "10 1 500", "output": "27 5000" }, { "input": "20 500 1", "output": "19019 20" }, { "input": "100 123 99", "output": "24453 9900" }, { "input": "500 1 1", "output": "1497 500" }, { "input": "500 500 500", "output": "499499 250000" }, { "input": "500 237 474", "output": "237025 237000" }, { "input": "1 2 3", "output": "0 3" }, { "input": "1 2 133", "output": "0 133" }, { "input": "1 2 100", "output": "0 100" }, { "input": "1 3 4", "output": "0 4" }, { "input": "1 10 15", "output": "0 15" }, { "input": "1 1 1", "output": "0 1" }, { "input": "1 2 5", "output": "0 5" }, { "input": "1 500 500", "output": "0 500" }, { "input": "1 3 8", "output": "0 8" }, { "input": "10 10 10", "output": "189 100" }, { "input": "1 3 5", "output": "0 5" }, { "input": "1 2 1", "output": "0 1" }, { "input": "1 2 4", "output": "0 4" }, { "input": "1 10 10", "output": "0 10" }, { "input": "1 345 345", "output": "0 345" }, { "input": "7 12 13", "output": "150 91" }, { "input": "1 500 1", "output": "0 1" }, { "input": "1 12 13", "output": "0 13" }, { "input": "1 500 499", "output": "0 499" }, { "input": "1 100 90", "output": "0 90" }, { "input": "2 100 90", "output": "201 180" }, { "input": "53 1 1", "output": "156 53" }, { "input": "73 73 73", "output": "10584 5329" }, { "input": "67 1 1", "output": "198 67" }, { "input": "63 1 1", "output": "186 63" }, { "input": "59 1 1", "output": "174 59" }, { "input": "57 1 1", "output": "168 57" }, { "input": "13 1 1", "output": "36 13" }, { "input": "349 2 5", "output": "1740 1745" }, { "input": "456 456 456", "output": "415415 207936" } ]
1,456,303,126
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
46
0
n, b, p = map(int, input().splist) print((n-1)*(b+b+1), n*p)
Title: Tennis Tournament Time Limit: None seconds Memory Limit: None megabytes Problem Description: A tennis tournament with *n* participants is running. The participants are playing by an olympic system, so the winners move on and the losers drop out. The tournament takes place in the following way (below, *m* is the number of the participants of the current round): - let *k* be the maximal power of the number 2 such that *k*<=≤<=*m*, - *k* participants compete in the current round and a half of them passes to the next round, the other *m*<=-<=*k* participants pass to the next round directly, - when only one participant remains, the tournament finishes. Each match requires *b* bottles of water for each participant and one bottle for the judge. Besides *p* towels are given to each participant for the whole tournament. Find the number of bottles and towels needed for the tournament. Note that it's a tennis tournament so in each match two participants compete (one of them will win and the other will lose). Input Specification: The only line contains three integers *n*,<=*b*,<=*p* (1<=≤<=*n*,<=*b*,<=*p*<=≤<=500) — the number of participants and the parameters described in the problem statement. Output Specification: Print two integers *x* and *y* — the number of bottles and towels need for the tournament. Demo Input: ['5 2 3\n', '8 2 4\n'] Demo Output: ['20 15\n', '35 32\n'] Note: In the first example will be three rounds: 1. in the first round will be two matches and for each match 5 bottles of water are needed (two for each of the participants and one for the judge), 1. in the second round will be only one match, so we need another 5 bottles of water, 1. in the third round will also be only one match, so we need another 5 bottles of water. So in total we need 20 bottles of water. In the second example no participant will move on to some round directly.
```python n, b, p = map(int, input().splist) print((n-1)*(b+b+1), n*p) ```
-1
722
B
Verse Pattern
PROGRAMMING
1,200
[ "implementation", "strings" ]
null
null
You are given a text consisting of *n* lines. Each line contains some space-separated words, consisting of lowercase English letters. We define a syllable as a string that contains exactly one vowel and any arbitrary number (possibly none) of consonants. In English alphabet following letters are considered to be vowels: 'a', 'e', 'i', 'o', 'u' and 'y'. Each word of the text that contains at least one vowel can be divided into syllables. Each character should be a part of exactly one syllable. For example, the word "mamma" can be divided into syllables as "ma" and "mma", "mam" and "ma", and "mamm" and "a". Words that consist of only consonants should be ignored. The verse patterns for the given text is a sequence of *n* integers *p*1,<=*p*2,<=...,<=*p**n*. Text matches the given verse pattern if for each *i* from 1 to *n* one can divide words of the *i*-th line in syllables in such a way that the total number of syllables is equal to *p**i*. You are given the text and the verse pattern. Check, if the given text matches the given verse pattern.
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the text. The second line contains integers *p*1,<=...,<=*p**n* (0<=≤<=*p**i*<=≤<=100) — the verse pattern. Next *n* lines contain the text itself. Text consists of lowercase English letters and spaces. It's guaranteed that all lines are non-empty, each line starts and ends with a letter and words are separated by exactly one space. The length of each line doesn't exceed 100 characters.
If the given text matches the given verse pattern, then print "YES" (without quotes) in the only line of the output. Otherwise, print "NO" (without quotes).
[ "3\n2 2 3\nintel\ncode\nch allenge\n", "4\n1 2 3 1\na\nbcdefghi\njklmnopqrstu\nvwxyz\n", "4\n13 11 15 15\nto be or not to be that is the question\nwhether tis nobler in the mind to suffer\nthe slings and arrows of outrageous fortune\nor to take arms against a sea of troubles\n" ]
[ "YES\n", "NO\n", "YES\n" ]
In the first sample, one can split words into syllables in the following way: Since the word "ch" in the third line doesn't contain vowels, we can ignore it. As the result we get 2 syllabels in first two lines and 3 syllables in the third one.
500
[ { "input": "3\n2 2 3\nintel\ncode\nch allenge", "output": "YES" }, { "input": "4\n1 2 3 1\na\nbcdefghi\njklmnopqrstu\nvwxyz", "output": "NO" }, { "input": "4\n13 11 15 15\nto be or not to be that is the question\nwhether tis nobler in the mind to suffer\nthe slings and arrows of outrageous fortune\nor to take arms against a sea of troubles", "output": "YES" }, { "input": "5\n2 2 1 1 1\nfdbie\naaj\ni\ni n\nshi", "output": "YES" }, { "input": "5\n2 11 10 7 9\nhy of\nyur pjyacbatdoylojayu\nemd ibweioiimyxya\nyocpyivudobua\nuiraueect impxqhzpty e", "output": "NO" }, { "input": "5\n6 9 7 3 10\nabtbdaa\nom auhz ub iaravozegs\ncieulibsdhj ufki\nadu pnpurt\nh naony i jaysjsjxpwuuc", "output": "NO" }, { "input": "2\n26 35\ngouojxaoobw iu bkaadyo degnjkubeabt kbap thwki dyebailrhnoh ooa\npiaeaebaocptyswuc wezesazipu osebhaonouygasjrciyiqaejtqsioubiuakg umynbsvw xpfqdwxo", "output": "NO" }, { "input": "5\n1 0 0 1 1\ngqex\nw\nh\nzsvu\nqcqd", "output": "NO" }, { "input": "5\n0 0 0 0 0\njtv\nl\nqg\ntp\nfgd", "output": "YES" }, { "input": "10\n0 0 0 0 0 0 0 0 0 0\nj t fr\nn\nnhcgx\np\nmb hmhtz\ndbjc\ncwdxj\nn j whkbt\nzk m cwh\nqr n", "output": "YES" }, { "input": "5\n4 5 1 0 0\noa\nqfohq\ni l\naik\nx", "output": "NO" }, { "input": "10\n2 9 0 3 2 4 1 2 4 2\nxtwl oy\nafgeju fi\nr hy\nddsowagw\nxoredo f\nwufnxy k uh\nod\nlejrinw\nsueecohfjl\nedufg", "output": "NO" }, { "input": "10\n1 1 0 0 0 4 0 4 0 0\na bn\nhnwss f\nd s bn\nbdzxzgsxq\nghh v\neimblv i er\nca kn k\nzm ffc zcb\nn\nz hkhvfkwhg", "output": "NO" }, { "input": "5\n0 10 6 6 0\nfgthrxst\nsohnweymewnnmbobj\nj\nfwwt acdtfvkpv khbxokn\nhndovkkgfhnhqod", "output": "NO" }, { "input": "5\n3 2 2 4 2\ni yu\niu\noa\naiio\nuo", "output": "YES" }, { "input": "5\n11 12 11 4 6\nuuuayoiaoiy\nuaiee iai eieu\nooayaayeuee\noii o\noea uuo", "output": "YES" }, { "input": "3\n2 3 2\nintel\ncode\nch allenge", "output": "NO" }, { "input": "2\n1 2\ncode\na", "output": "NO" }, { "input": "2\n1 1\nbababa\nbababa", "output": "NO" }, { "input": "1\n1\naa", "output": "NO" }, { "input": "1\n1\naaa", "output": "NO" }, { "input": "2\n2 3\naee\nae", "output": "NO" } ]
1,563,468,609
2,147,483,647
Python 3
OK
TESTS
54
124
0
n=int(input()) lst = list(map(int,input().split(' '))) ok = True for _ in range(n): st = input() p_ = lst[_] a = st.count('a') a+= st.count('e') a+= st.count('i') a+= st.count('o') a+= st.count('u') a+= st.count('y') if p_!=a: ok=False if ok: print('YES') else: print('NO')
Title: Verse Pattern Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a text consisting of *n* lines. Each line contains some space-separated words, consisting of lowercase English letters. We define a syllable as a string that contains exactly one vowel and any arbitrary number (possibly none) of consonants. In English alphabet following letters are considered to be vowels: 'a', 'e', 'i', 'o', 'u' and 'y'. Each word of the text that contains at least one vowel can be divided into syllables. Each character should be a part of exactly one syllable. For example, the word "mamma" can be divided into syllables as "ma" and "mma", "mam" and "ma", and "mamm" and "a". Words that consist of only consonants should be ignored. The verse patterns for the given text is a sequence of *n* integers *p*1,<=*p*2,<=...,<=*p**n*. Text matches the given verse pattern if for each *i* from 1 to *n* one can divide words of the *i*-th line in syllables in such a way that the total number of syllables is equal to *p**i*. You are given the text and the verse pattern. Check, if the given text matches the given verse pattern. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the text. The second line contains integers *p*1,<=...,<=*p**n* (0<=≤<=*p**i*<=≤<=100) — the verse pattern. Next *n* lines contain the text itself. Text consists of lowercase English letters and spaces. It's guaranteed that all lines are non-empty, each line starts and ends with a letter and words are separated by exactly one space. The length of each line doesn't exceed 100 characters. Output Specification: If the given text matches the given verse pattern, then print "YES" (without quotes) in the only line of the output. Otherwise, print "NO" (without quotes). Demo Input: ['3\n2 2 3\nintel\ncode\nch allenge\n', '4\n1 2 3 1\na\nbcdefghi\njklmnopqrstu\nvwxyz\n', '4\n13 11 15 15\nto be or not to be that is the question\nwhether tis nobler in the mind to suffer\nthe slings and arrows of outrageous fortune\nor to take arms against a sea of troubles\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: In the first sample, one can split words into syllables in the following way: Since the word "ch" in the third line doesn't contain vowels, we can ignore it. As the result we get 2 syllabels in first two lines and 3 syllables in the third one.
```python n=int(input()) lst = list(map(int,input().split(' '))) ok = True for _ in range(n): st = input() p_ = lst[_] a = st.count('a') a+= st.count('e') a+= st.count('i') a+= st.count('o') a+= st.count('u') a+= st.count('y') if p_!=a: ok=False if ok: print('YES') else: print('NO') ```
3
399
A
Pages
PROGRAMMING
0
[ "implementation" ]
null
null
User ainta is making a web site. This time he is going to make a navigation of the pages. In his site, there are *n* pages numbered by integers from 1 to *n*. Assume that somebody is on the *p*-th page now. The navigation will look like this: When someone clicks the button "&lt;&lt;" he is redirected to page 1, and when someone clicks the button "&gt;&gt;" he is redirected to page *n*. Of course if someone clicks on a number, he is redirected to the corresponding page. There are some conditions in the navigation: - If page 1 is in the navigation, the button "&lt;&lt;" must not be printed. - If page *n* is in the navigation, the button "&gt;&gt;" must not be printed. - If the page number is smaller than 1 or greater than *n*, it must not be printed. You can see some examples of the navigations. Make a program that prints the navigation.
The first and the only line contains three integers *n*, *p*, *k* (3<=≤<=*n*<=≤<=100; 1<=≤<=*p*<=≤<=*n*; 1<=≤<=*k*<=≤<=*n*)
Print the proper navigation. Follow the format of the output from the test samples.
[ "17 5 2\n", "6 5 2\n", "6 1 2\n", "6 2 2\n", "9 6 3\n", "10 6 3\n", "8 5 4\n" ]
[ "&lt;&lt; 3 4 (5) 6 7 &gt;&gt; ", "&lt;&lt; 3 4 (5) 6 ", "(1) 2 3 &gt;&gt; ", "1 (2) 3 4 &gt;&gt;", "&lt;&lt; 3 4 5 (6) 7 8 9", "&lt;&lt; 3 4 5 (6) 7 8 9 &gt;&gt;", "1 2 3 4 (5) 6 7 8 " ]
none
500
[ { "input": "17 5 2", "output": "<< 3 4 (5) 6 7 >> " }, { "input": "6 5 2", "output": "<< 3 4 (5) 6 " }, { "input": "6 1 2", "output": "(1) 2 3 >> " }, { "input": "6 2 2", "output": "1 (2) 3 4 >> " }, { "input": "9 6 3", "output": "<< 3 4 5 (6) 7 8 9 " }, { "input": "10 6 3", "output": "<< 3 4 5 (6) 7 8 9 >> " }, { "input": "8 5 4", "output": "1 2 3 4 (5) 6 7 8 " }, { "input": "100 10 20", "output": "1 2 3 4 5 6 7 8 9 (10) 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 >> " }, { "input": "100 25 11", "output": "<< 14 15 16 17 18 19 20 21 22 23 24 (25) 26 27 28 29 30 31 32 33 34 35 36 >> " }, { "input": "5 2 1", "output": "1 (2) 3 >> " }, { "input": "5 3 1", "output": "<< 2 (3) 4 >> " }, { "input": "79 35 12", "output": "<< 23 24 25 26 27 28 29 30 31 32 33 34 (35) 36 37 38 39 40 41 42 43 44 45 46 47 >> " }, { "input": "100 99 5", "output": "<< 94 95 96 97 98 (99) 100 " }, { "input": "100 99 15", "output": "<< 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 (99) 100 " }, { "input": "100 100 17", "output": "<< 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 (100) " }, { "input": "100 35 28", "output": "<< 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 (35) 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 >> " }, { "input": "100 46 38", "output": "<< 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 (46) 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 >> " }, { "input": "100 46 48", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 (46) 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 >> " }, { "input": "100 10 100", "output": "1 2 3 4 5 6 7 8 9 (10) 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 " }, { "input": "3 1 1", "output": "(1) 2 >> " }, { "input": "3 2 1", "output": "1 (2) 3 " }, { "input": "17 5 3", "output": "<< 2 3 4 (5) 6 7 8 >> " }, { "input": "3 1 3", "output": "(1) 2 3 " }, { "input": "7 5 1", "output": "<< 4 (5) 6 >> " }, { "input": "5 5 5", "output": "1 2 3 4 (5) " }, { "input": "5 3 5", "output": "1 2 (3) 4 5 " } ]
1,541,076,644
2,147,483,647
Python 3
OK
TESTS
26
109
0
n, p, k = map(int, input().split()) if p - k > 1: print('<<', end=' ') for i in range(max(1, p - k), p): print(i, end=' ') print('(', p, ')', sep='', end='') for i in range(p + 1, min(n, p + k) + 1): print(' ' + str(i), end='') if p + k < n: print(' >>', end='')
Title: Pages Time Limit: None seconds Memory Limit: None megabytes Problem Description: User ainta is making a web site. This time he is going to make a navigation of the pages. In his site, there are *n* pages numbered by integers from 1 to *n*. Assume that somebody is on the *p*-th page now. The navigation will look like this: When someone clicks the button "&lt;&lt;" he is redirected to page 1, and when someone clicks the button "&gt;&gt;" he is redirected to page *n*. Of course if someone clicks on a number, he is redirected to the corresponding page. There are some conditions in the navigation: - If page 1 is in the navigation, the button "&lt;&lt;" must not be printed. - If page *n* is in the navigation, the button "&gt;&gt;" must not be printed. - If the page number is smaller than 1 or greater than *n*, it must not be printed. You can see some examples of the navigations. Make a program that prints the navigation. Input Specification: The first and the only line contains three integers *n*, *p*, *k* (3<=≤<=*n*<=≤<=100; 1<=≤<=*p*<=≤<=*n*; 1<=≤<=*k*<=≤<=*n*) Output Specification: Print the proper navigation. Follow the format of the output from the test samples. Demo Input: ['17 5 2\n', '6 5 2\n', '6 1 2\n', '6 2 2\n', '9 6 3\n', '10 6 3\n', '8 5 4\n'] Demo Output: ['&lt;&lt; 3 4 (5) 6 7 &gt;&gt; ', '&lt;&lt; 3 4 (5) 6 ', '(1) 2 3 &gt;&gt; ', '1 (2) 3 4 &gt;&gt;', '&lt;&lt; 3 4 5 (6) 7 8 9', '&lt;&lt; 3 4 5 (6) 7 8 9 &gt;&gt;', '1 2 3 4 (5) 6 7 8 '] Note: none
```python n, p, k = map(int, input().split()) if p - k > 1: print('<<', end=' ') for i in range(max(1, p - k), p): print(i, end=' ') print('(', p, ')', sep='', end='') for i in range(p + 1, min(n, p + k) + 1): print(' ' + str(i), end='') if p + k < n: print(' >>', end='') ```
3
557
A
Ilya and Diplomas
PROGRAMMING
1,100
[ "greedy", "implementation", "math" ]
null
null
Soon a school Olympiad in Informatics will be held in Berland, *n* schoolchildren will participate there. At a meeting of the jury of the Olympiad it was decided that each of the *n* participants, depending on the results, will get a diploma of the first, second or third degree. Thus, each student will receive exactly one diploma. They also decided that there must be given at least *min*1 and at most *max*1 diplomas of the first degree, at least *min*2 and at most *max*2 diplomas of the second degree, and at least *min*3 and at most *max*3 diplomas of the third degree. After some discussion it was decided to choose from all the options of distributing diplomas satisfying these limitations the one that maximizes the number of participants who receive diplomas of the first degree. Of all these options they select the one which maximizes the number of the participants who receive diplomas of the second degree. If there are multiple of these options, they select the option that maximizes the number of diplomas of the third degree. Choosing the best option of distributing certificates was entrusted to Ilya, one of the best programmers of Berland. However, he found more important things to do, so it is your task now to choose the best option of distributing of diplomas, based on the described limitations. It is guaranteed that the described limitations are such that there is a way to choose such an option of distributing diplomas that all *n* participants of the Olympiad will receive a diploma of some degree.
The first line of the input contains a single integer *n* (3<=≤<=*n*<=≤<=3·106) — the number of schoolchildren who will participate in the Olympiad. The next line of the input contains two integers *min*1 and *max*1 (1<=≤<=*min*1<=≤<=*max*1<=≤<=106) — the minimum and maximum limits on the number of diplomas of the first degree that can be distributed. The third line of the input contains two integers *min*2 and *max*2 (1<=≤<=*min*2<=≤<=*max*2<=≤<=106) — the minimum and maximum limits on the number of diplomas of the second degree that can be distributed. The next line of the input contains two integers *min*3 and *max*3 (1<=≤<=*min*3<=≤<=*max*3<=≤<=106) — the minimum and maximum limits on the number of diplomas of the third degree that can be distributed. It is guaranteed that *min*1<=+<=*min*2<=+<=*min*3<=≤<=*n*<=≤<=*max*1<=+<=*max*2<=+<=*max*3.
In the first line of the output print three numbers, showing how many diplomas of the first, second and third degree will be given to students in the optimal variant of distributing diplomas. The optimal variant of distributing diplomas is the one that maximizes the number of students who receive diplomas of the first degree. Of all the suitable options, the best one is the one which maximizes the number of participants who receive diplomas of the second degree. If there are several of these options, the best one is the one that maximizes the number of diplomas of the third degree.
[ "6\n1 5\n2 6\n3 7\n", "10\n1 2\n1 3\n1 5\n", "6\n1 3\n2 2\n2 2\n" ]
[ "1 2 3 \n", "2 3 5 \n", "2 2 2 \n" ]
none
500
[ { "input": "6\n1 5\n2 6\n3 7", "output": "1 2 3 " }, { "input": "10\n1 2\n1 3\n1 5", "output": "2 3 5 " }, { "input": "6\n1 3\n2 2\n2 2", "output": "2 2 2 " }, { "input": "55\n1 1000000\n40 50\n10 200", "output": "5 40 10 " }, { "input": "3\n1 1\n1 1\n1 1", "output": "1 1 1 " }, { "input": "3\n1 1000000\n1 1000000\n1 1000000", "output": "1 1 1 " }, { "input": "1000\n100 400\n300 500\n400 1200", "output": "300 300 400 " }, { "input": "3000000\n1 1000000\n1 1000000\n1 1000000", "output": "1000000 1000000 1000000 " }, { "input": "11\n3 5\n3 5\n3 5", "output": "5 3 3 " }, { "input": "12\n3 5\n3 5\n3 5", "output": "5 4 3 " }, { "input": "13\n3 5\n3 5\n3 5", "output": "5 5 3 " }, { "input": "3000000\n1000000 1000000\n1000000 1000000\n1000000 1000000", "output": "1000000 1000000 1000000 " }, { "input": "50\n1 100\n1 100\n1 100", "output": "48 1 1 " }, { "input": "1279\n123 670\n237 614\n846 923", "output": "196 237 846 " }, { "input": "1589\n213 861\n5 96\n506 634", "output": "861 96 632 " }, { "input": "2115\n987 987\n112 483\n437 959", "output": "987 483 645 " }, { "input": "641\n251 960\n34 370\n149 149", "output": "458 34 149 " }, { "input": "1655\n539 539\n10 425\n605 895", "output": "539 425 691 " }, { "input": "1477\n210 336\n410 837\n448 878", "output": "336 693 448 " }, { "input": "1707\n149 914\n190 422\n898 899", "output": "619 190 898 " }, { "input": "1529\n515 515\n563 869\n169 451", "output": "515 845 169 " }, { "input": "1543\n361 994\n305 407\n102 197", "output": "994 407 142 " }, { "input": "1107\n471 849\n360 741\n71 473", "output": "676 360 71 " }, { "input": "1629279\n267360 999930\n183077 674527\n202618 786988", "output": "999930 426731 202618 " }, { "input": "1233589\n2850 555444\n500608 921442\n208610 607343", "output": "524371 500608 208610 " }, { "input": "679115\n112687 183628\n101770 982823\n81226 781340", "output": "183628 414261 81226 " }, { "input": "1124641\n117999 854291\n770798 868290\n76651 831405", "output": "277192 770798 76651 " }, { "input": "761655\n88152 620061\n60403 688549\n79370 125321", "output": "620061 62224 79370 " }, { "input": "2174477\n276494 476134\n555283 954809\n319941 935631", "output": "476134 954809 743534 " }, { "input": "1652707\n201202 990776\n34796 883866\n162979 983308", "output": "990776 498952 162979 " }, { "input": "2065529\n43217 891429\n434379 952871\n650231 855105", "output": "891429 523869 650231 " }, { "input": "1702543\n405042 832833\n50931 747750\n381818 796831", "output": "832833 487892 381818 " }, { "input": "501107\n19061 859924\n126478 724552\n224611 489718", "output": "150018 126478 224611 " }, { "input": "1629279\n850831 967352\n78593 463906\n452094 885430", "output": "967352 209833 452094 " }, { "input": "1233589\n2850 157021\n535109 748096\n392212 475634", "output": "157021 684356 392212 " }, { "input": "679115\n125987 786267\n70261 688983\n178133 976789", "output": "430721 70261 178133 " }, { "input": "1124641\n119407 734250\n213706 860770\n102149 102149", "output": "734250 288242 102149 " }, { "input": "761655\n325539 325539\n280794 792505\n18540 106895", "output": "325539 417576 18540 " }, { "input": "2174477\n352351 791072\n365110 969163\n887448 955610", "output": "791072 495957 887448 " }, { "input": "1652707\n266774 638522\n65688 235422\n924898 992826", "output": "638522 89287 924898 " }, { "input": "2065529\n608515 608515\n751563 864337\n614898 705451", "output": "608515 842116 614898 " }, { "input": "1702543\n5784 996578\n47395 300407\n151614 710197", "output": "996578 300407 405558 " }, { "input": "501107\n8073 390048\n190494 647328\n274071 376923", "output": "36542 190494 274071 " }, { "input": "200\n50 50\n100 100\n50 50", "output": "50 100 50 " }, { "input": "14\n1 100\n1 100\n8 9", "output": "5 1 8 " }, { "input": "300\n200 400\n50 100\n40 80", "output": "210 50 40 " }, { "input": "10\n3 6\n3 6\n3 6", "output": "4 3 3 " }, { "input": "14\n3 6\n3 6\n3 6", "output": "6 5 3 " }, { "input": "17\n3 6\n3 6\n3 6", "output": "6 6 5 " }, { "input": "1000000\n300000 600000\n300000 600000\n300000 600000", "output": "400000 300000 300000 " }, { "input": "1400000\n300000 600000\n300000 600000\n300000 600000", "output": "600000 500000 300000 " }, { "input": "1700000\n300000 600000\n300000 600000\n300000 600000", "output": "600000 600000 500000 " }, { "input": "561\n400 400\n80 80\n81 81", "output": "400 80 81 " }, { "input": "2000\n100 1000\n1 1\n1 2000", "output": "1000 1 999 " }, { "input": "1000002\n1 1000000\n1 1000000\n999999 1000000", "output": "2 1 999999 " }, { "input": "1000002\n1 1000000\n1 1000000\n1000000 1000000", "output": "1 1 1000000 " } ]
1,456,096,070
2,147,483,647
Python 3
OK
TESTS
56
77
0
n = int(input()) minis, maxis = [], [] for i in range(3): s = list(map(int, input().split())) minis.append(s[0]) maxis.append(s[1]) left = n diploms = [0 for i in range(3)] for i in range(3): diploms[i] = minis[i] left -= minis[i] for i in range(3): d = min(left, maxis[i] - minis[i]) diploms[i] += d left -= d print(' '.join(map(str, diploms)))
Title: Ilya and Diplomas Time Limit: None seconds Memory Limit: None megabytes Problem Description: Soon a school Olympiad in Informatics will be held in Berland, *n* schoolchildren will participate there. At a meeting of the jury of the Olympiad it was decided that each of the *n* participants, depending on the results, will get a diploma of the first, second or third degree. Thus, each student will receive exactly one diploma. They also decided that there must be given at least *min*1 and at most *max*1 diplomas of the first degree, at least *min*2 and at most *max*2 diplomas of the second degree, and at least *min*3 and at most *max*3 diplomas of the third degree. After some discussion it was decided to choose from all the options of distributing diplomas satisfying these limitations the one that maximizes the number of participants who receive diplomas of the first degree. Of all these options they select the one which maximizes the number of the participants who receive diplomas of the second degree. If there are multiple of these options, they select the option that maximizes the number of diplomas of the third degree. Choosing the best option of distributing certificates was entrusted to Ilya, one of the best programmers of Berland. However, he found more important things to do, so it is your task now to choose the best option of distributing of diplomas, based on the described limitations. It is guaranteed that the described limitations are such that there is a way to choose such an option of distributing diplomas that all *n* participants of the Olympiad will receive a diploma of some degree. Input Specification: The first line of the input contains a single integer *n* (3<=≤<=*n*<=≤<=3·106) — the number of schoolchildren who will participate in the Olympiad. The next line of the input contains two integers *min*1 and *max*1 (1<=≤<=*min*1<=≤<=*max*1<=≤<=106) — the minimum and maximum limits on the number of diplomas of the first degree that can be distributed. The third line of the input contains two integers *min*2 and *max*2 (1<=≤<=*min*2<=≤<=*max*2<=≤<=106) — the minimum and maximum limits on the number of diplomas of the second degree that can be distributed. The next line of the input contains two integers *min*3 and *max*3 (1<=≤<=*min*3<=≤<=*max*3<=≤<=106) — the minimum and maximum limits on the number of diplomas of the third degree that can be distributed. It is guaranteed that *min*1<=+<=*min*2<=+<=*min*3<=≤<=*n*<=≤<=*max*1<=+<=*max*2<=+<=*max*3. Output Specification: In the first line of the output print three numbers, showing how many diplomas of the first, second and third degree will be given to students in the optimal variant of distributing diplomas. The optimal variant of distributing diplomas is the one that maximizes the number of students who receive diplomas of the first degree. Of all the suitable options, the best one is the one which maximizes the number of participants who receive diplomas of the second degree. If there are several of these options, the best one is the one that maximizes the number of diplomas of the third degree. Demo Input: ['6\n1 5\n2 6\n3 7\n', '10\n1 2\n1 3\n1 5\n', '6\n1 3\n2 2\n2 2\n'] Demo Output: ['1 2 3 \n', '2 3 5 \n', '2 2 2 \n'] Note: none
```python n = int(input()) minis, maxis = [], [] for i in range(3): s = list(map(int, input().split())) minis.append(s[0]) maxis.append(s[1]) left = n diploms = [0 for i in range(3)] for i in range(3): diploms[i] = minis[i] left -= minis[i] for i in range(3): d = min(left, maxis[i] - minis[i]) diploms[i] += d left -= d print(' '.join(map(str, diploms))) ```
3
275
A
Lights Out
PROGRAMMING
900
[ "implementation" ]
null
null
Lenny is playing a game on a 3<=×<=3 grid of lights. In the beginning of the game all lights are switched on. Pressing any of the lights will toggle it and all side-adjacent lights. The goal of the game is to switch all the lights off. We consider the toggling as follows: if the light was switched on then it will be switched off, if it was switched off then it will be switched on. Lenny has spent some time playing with the grid and by now he has pressed each light a certain number of times. Given the number of times each light is pressed, you have to print the current state of each light.
The input consists of three rows. Each row contains three integers each between 0 to 100 inclusive. The *j*-th number in the *i*-th row is the number of times the *j*-th light of the *i*-th row of the grid is pressed.
Print three lines, each containing three characters. The *j*-th character of the *i*-th line is "1" if and only if the corresponding light is switched on, otherwise it's "0".
[ "1 0 0\n0 0 0\n0 0 1\n", "1 0 1\n8 8 8\n2 0 3\n" ]
[ "001\n010\n100\n", "010\n011\n100\n" ]
none
500
[ { "input": "1 0 0\n0 0 0\n0 0 1", "output": "001\n010\n100" }, { "input": "1 0 1\n8 8 8\n2 0 3", "output": "010\n011\n100" }, { "input": "13 85 77\n25 50 45\n65 79 9", "output": "000\n010\n000" }, { "input": "96 95 5\n8 84 74\n67 31 61", "output": "011\n011\n101" }, { "input": "24 54 37\n60 63 6\n1 84 26", "output": "110\n101\n011" }, { "input": "23 10 40\n15 6 40\n92 80 77", "output": "101\n100\n000" }, { "input": "62 74 80\n95 74 93\n2 47 95", "output": "010\n001\n110" }, { "input": "80 83 48\n26 0 66\n47 76 37", "output": "000\n000\n010" }, { "input": "32 15 65\n7 54 36\n5 51 3", "output": "111\n101\n001" }, { "input": "22 97 12\n71 8 24\n100 21 64", "output": "100\n001\n100" }, { "input": "46 37 13\n87 0 50\n90 8 55", "output": "111\n011\n000" }, { "input": "57 43 58\n20 82 83\n66 16 52", "output": "111\n010\n110" }, { "input": "45 56 93\n47 51 59\n18 51 63", "output": "101\n011\n100" }, { "input": "47 66 67\n14 1 37\n27 81 69", "output": "001\n001\n110" }, { "input": "26 69 69\n85 18 23\n14 22 74", "output": "110\n001\n010" }, { "input": "10 70 65\n94 27 25\n74 66 30", "output": "111\n010\n100" }, { "input": "97 1 74\n15 99 1\n88 68 86", "output": "001\n011\n000" }, { "input": "36 48 42\n45 41 66\n26 64 1", "output": "001\n111\n010" }, { "input": "52 81 97\n29 77 71\n66 11 2", "output": "100\n100\n111" }, { "input": "18 66 33\n19 49 49\n48 46 26", "output": "011\n100\n000" }, { "input": "68 79 52\n51 39 100\n29 14 26", "output": "110\n000\n111" }, { "input": "91 69 77\n91 26 64\n91 88 57", "output": "001\n011\n110" }, { "input": "16 69 64\n48 21 80\n81 51 51", "output": "010\n101\n111" }, { "input": "96 14 2\n100 18 12\n65 34 89", "output": "111\n010\n010" }, { "input": "93 95 90\n8 59 42\n53 13 19", "output": "100\n001\n111" }, { "input": "71 84 18\n100 19 67\n9 76 15", "output": "010\n010\n001" }, { "input": "38 93 85\n21 88 64\n4 96 25", "output": "111\n011\n000" }, { "input": "75 20 20\n60 5 78\n77 4 69", "output": "011\n001\n000" }, { "input": "65 70 96\n19 6 83\n33 37 82", "output": "100\n000\n011" }, { "input": "11 13 60\n17 13 46\n42 21 39", "output": "000\n011\n101" }, { "input": "0 0 0\n0 0 0\n0 0 0", "output": "111\n111\n111" }, { "input": "0 0 0\n0 1 0\n0 0 0", "output": "101\n000\n101" }, { "input": "0 0 0\n0 0 0\n0 0 1", "output": "111\n110\n100" } ]
1,671,594,632
2,147,483,647
PyPy 3-64
OK
TESTS
33
62
0
inp = [] for i in range(3): row = input().split() inp.append(row) ans = [[1,1,1], [1,1,1], [1,1,1]] for i in range(3): for j in range(3): if int(inp[i][j]) % 2 == 1: if (i - 1) >= 0: ans[i - 1][j] = 1 - ans[i - 1][j] if (j - 1) >= 0: ans[i][j - 1] = 1 - ans[i][j - 1] for i in range(2, -1, -1): for j in range(2, -1, -1): if int(inp[i][j]) % 2 == 1: if (i + 1) <= 2: ans[i + 1][j] = 1 - ans[i + 1][j] if (j + 1) <= 2: ans[i][j + 1] = 1 - ans[i][j + 1] for i in range(3): for j in range(3): if int(inp[i][j]) % 2 == 1: ans[i][j] = 1 - ans[i][j] print(ans[i][j], end = '') print('')
Title: Lights Out Time Limit: None seconds Memory Limit: None megabytes Problem Description: Lenny is playing a game on a 3<=×<=3 grid of lights. In the beginning of the game all lights are switched on. Pressing any of the lights will toggle it and all side-adjacent lights. The goal of the game is to switch all the lights off. We consider the toggling as follows: if the light was switched on then it will be switched off, if it was switched off then it will be switched on. Lenny has spent some time playing with the grid and by now he has pressed each light a certain number of times. Given the number of times each light is pressed, you have to print the current state of each light. Input Specification: The input consists of three rows. Each row contains three integers each between 0 to 100 inclusive. The *j*-th number in the *i*-th row is the number of times the *j*-th light of the *i*-th row of the grid is pressed. Output Specification: Print three lines, each containing three characters. The *j*-th character of the *i*-th line is "1" if and only if the corresponding light is switched on, otherwise it's "0". Demo Input: ['1 0 0\n0 0 0\n0 0 1\n', '1 0 1\n8 8 8\n2 0 3\n'] Demo Output: ['001\n010\n100\n', '010\n011\n100\n'] Note: none
```python inp = [] for i in range(3): row = input().split() inp.append(row) ans = [[1,1,1], [1,1,1], [1,1,1]] for i in range(3): for j in range(3): if int(inp[i][j]) % 2 == 1: if (i - 1) >= 0: ans[i - 1][j] = 1 - ans[i - 1][j] if (j - 1) >= 0: ans[i][j - 1] = 1 - ans[i][j - 1] for i in range(2, -1, -1): for j in range(2, -1, -1): if int(inp[i][j]) % 2 == 1: if (i + 1) <= 2: ans[i + 1][j] = 1 - ans[i + 1][j] if (j + 1) <= 2: ans[i][j + 1] = 1 - ans[i][j + 1] for i in range(3): for j in range(3): if int(inp[i][j]) % 2 == 1: ans[i][j] = 1 - ans[i][j] print(ans[i][j], end = '') print('') ```
3
599
A
Patrick and Shopping
PROGRAMMING
800
[ "implementation" ]
null
null
Today Patrick waits for a visit from his friend Spongebob. To prepare for the visit, Patrick needs to buy some goodies in two stores located near his house. There is a *d*1 meter long road between his house and the first shop and a *d*2 meter long road between his house and the second shop. Also, there is a road of length *d*3 directly connecting these two shops to each other. Help Patrick calculate the minimum distance that he needs to walk in order to go to both shops and return to his house. Patrick always starts at his house. He should visit both shops moving only along the three existing roads and return back to his house. He doesn't mind visiting the same shop or passing the same road multiple times. The only goal is to minimize the total distance traveled.
The first line of the input contains three integers *d*1, *d*2, *d*3 (1<=≤<=*d*1,<=*d*2,<=*d*3<=≤<=108) — the lengths of the paths. - *d*1 is the length of the path connecting Patrick's house and the first shop; - *d*2 is the length of the path connecting Patrick's house and the second shop; - *d*3 is the length of the path connecting both shops.
Print the minimum distance that Patrick will have to walk in order to visit both shops and return to his house.
[ "10 20 30\n", "1 1 5\n" ]
[ "60\n", "4\n" ]
The first sample is shown on the picture in the problem statement. One of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house. In the second sample one of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house.
500
[ { "input": "10 20 30", "output": "60" }, { "input": "1 1 5", "output": "4" }, { "input": "100 33 34", "output": "134" }, { "input": "777 777 777", "output": "2331" }, { "input": "2 2 8", "output": "8" }, { "input": "12 34 56", "output": "92" }, { "input": "789 101112 131415", "output": "203802" }, { "input": "27485716 99999999 35182", "output": "55041796" }, { "input": "1 293548 5", "output": "12" }, { "input": "12059 259855 5874875", "output": "543828" }, { "input": "46981 105809 585858", "output": "305580" }, { "input": "9889 1221 2442", "output": "7326" }, { "input": "100500 200600 300700", "output": "601800" }, { "input": "318476 318476 318476", "output": "955428" }, { "input": "23985 3353 75633", "output": "54676" }, { "input": "120 1298 2222", "output": "2836" }, { "input": "98437 23487 666672", "output": "243848" }, { "input": "100000000 100000000 100000000", "output": "300000000" }, { "input": "2 5 2", "output": "8" }, { "input": "1 1000 1", "output": "4" }, { "input": "1 100000000 1", "output": "4" } ]
1,615,560,275
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
61
0
d1,d2,d3=map(int,input().split()) if (d1 + d2)<d3: print(2*(d1+d2)) else: print(d1+d2+d3)
Title: Patrick and Shopping Time Limit: None seconds Memory Limit: None megabytes Problem Description: Today Patrick waits for a visit from his friend Spongebob. To prepare for the visit, Patrick needs to buy some goodies in two stores located near his house. There is a *d*1 meter long road between his house and the first shop and a *d*2 meter long road between his house and the second shop. Also, there is a road of length *d*3 directly connecting these two shops to each other. Help Patrick calculate the minimum distance that he needs to walk in order to go to both shops and return to his house. Patrick always starts at his house. He should visit both shops moving only along the three existing roads and return back to his house. He doesn't mind visiting the same shop or passing the same road multiple times. The only goal is to minimize the total distance traveled. Input Specification: The first line of the input contains three integers *d*1, *d*2, *d*3 (1<=≤<=*d*1,<=*d*2,<=*d*3<=≤<=108) — the lengths of the paths. - *d*1 is the length of the path connecting Patrick's house and the first shop; - *d*2 is the length of the path connecting Patrick's house and the second shop; - *d*3 is the length of the path connecting both shops. Output Specification: Print the minimum distance that Patrick will have to walk in order to visit both shops and return to his house. Demo Input: ['10 20 30\n', '1 1 5\n'] Demo Output: ['60\n', '4\n'] Note: The first sample is shown on the picture in the problem statement. One of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house. In the second sample one of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house.
```python d1,d2,d3=map(int,input().split()) if (d1 + d2)<d3: print(2*(d1+d2)) else: print(d1+d2+d3) ```
0
0
none
none
none
0
[ "none" ]
null
null
You are an experienced Codeforces user. Today you found out that during your activity on Codeforces you have made *y* submissions, out of which *x* have been successful. Thus, your current success rate on Codeforces is equal to *x*<=/<=*y*. Your favorite rational number in the [0;1] range is *p*<=/<=*q*. Now you wonder: what is the smallest number of submissions you have to make if you want your success rate to be *p*<=/<=*q*?
The first line contains a single integer *t* (1<=≤<=*t*<=≤<=1000) — the number of test cases. Each of the next *t* lines contains four integers *x*, *y*, *p* and *q* (0<=≤<=*x*<=≤<=*y*<=≤<=109; 0<=≤<=*p*<=≤<=*q*<=≤<=109; *y*<=&gt;<=0; *q*<=&gt;<=0). It is guaranteed that *p*<=/<=*q* is an irreducible fraction. Hacks. For hacks, an additional constraint of *t*<=≤<=5 must be met.
For each test case, output a single integer equal to the smallest number of submissions you have to make if you want your success rate to be equal to your favorite rational number, or -1 if this is impossible to achieve.
[ "4\n3 10 1 2\n7 14 3 8\n20 70 2 7\n5 6 1 1\n" ]
[ "4\n10\n0\n-1\n" ]
In the first example, you have to make 4 successful submissions. Your success rate will be equal to 7 / 14, or 1 / 2. In the second example, you have to make 2 successful and 8 unsuccessful submissions. Your success rate will be equal to 9 / 24, or 3 / 8. In the third example, there is no need to make any new submissions. Your success rate is already equal to 20 / 70, or 2 / 7. In the fourth example, the only unsuccessful submission breaks your hopes of having the success rate equal to 1.
0
[ { "input": "4\n3 10 1 2\n7 14 3 8\n20 70 2 7\n5 6 1 1", "output": "4\n10\n0\n-1" }, { "input": "8\n0 1 0 1\n0 2 1 2\n0 3 1 1\n1 2 0 1\n1 2 1 1\n2 2 0 1\n3 3 1 2\n4 4 1 1", "output": "0\n2\n-1\n-1\n-1\n-1\n3\n0" }, { "input": "5\n1 1000000000 1 2\n1 1000000000 1 2\n1 1000000000 1 2\n1 1000000000 1 2\n1 1000000000 1 2", "output": "999999998\n999999998\n999999998\n999999998\n999999998" }, { "input": "5\n999999999 1000000000 1 1000000000\n999999999 1000000000 1 1000000000\n999999999 1000000000 1 1000000000\n999999999 1000000000 1 1000000000\n999999999 1000000000 1 1000000000", "output": "999999998000000000\n999999998000000000\n999999998000000000\n999999998000000000\n999999998000000000" }, { "input": "5\n0 1000000000 999999999 1000000000\n0 1000000000 999999999 1000000000\n0 1000000000 999999999 1000000000\n0 1000000000 999999999 1000000000\n0 1000000000 999999999 1000000000", "output": "999999999000000000\n999999999000000000\n999999999000000000\n999999999000000000\n999999999000000000" }, { "input": "1\n999999999 1000000000 1 2", "output": "999999998" }, { "input": "1\n50 50 1 1", "output": "0" }, { "input": "1\n100000000 100000000 1 2", "output": "100000000" }, { "input": "1\n3 999999990 1 1000000000", "output": "2000000010" }, { "input": "5\n3 10 1 2\n7 14 3 8\n20 70 2 7\n5 6 1 1\n1 1 1 1", "output": "4\n10\n0\n-1\n0" }, { "input": "5\n9999999 10000000 1 1000000000\n9999999 10000000 1 1000000000\n9999999 10000000 1 1000000000\n9999999 10000000 1 1000000000\n9999999 10000000 1 1000000000", "output": "9999998990000000\n9999998990000000\n9999998990000000\n9999998990000000\n9999998990000000" }, { "input": "1\n0 1000000000 999999999 1000000000", "output": "999999999000000000" }, { "input": "5\n1 1000000000 999999999 1000000000\n1 1000000000 999999999 1000000000\n1 1000000000 999999999 1000000000\n1 1000000000 999999999 1000000000\n1 1000000000 999999999 1000000000", "output": "999999998000000000\n999999998000000000\n999999998000000000\n999999998000000000\n999999998000000000" }, { "input": "5\n1 1000000000 999999999 1000000000\n2 1000000000 999999999 1000000000\n3 1000000000 999999999 1000000000\n4 1000000000 999999999 1000000000\n5 1000000000 999999999 1000000000", "output": "999999998000000000\n999999997000000000\n999999996000000000\n999999995000000000\n999999994000000000" }, { "input": "1\n1 1 1 1", "output": "0" }, { "input": "5\n999999997 999999998 2 999999999\n999999997 999999998 2 999999999\n999999997 999999998 2 999999999\n999999997 999999998 2 999999999\n999999997 999999998 2 999999999", "output": "499999997500000003\n499999997500000003\n499999997500000003\n499999997500000003\n499999997500000003" }, { "input": "5\n1000000000 1000000000 1 1000000000\n1000000000 1000000000 1 1000000000\n1000000000 1000000000 1 1000000000\n1000000000 1000000000 1 1000000000\n1000000000 1000000000 1 1000000000", "output": "999999999000000000\n999999999000000000\n999999999000000000\n999999999000000000\n999999999000000000" }, { "input": "5\n99999997 999999998 999999998 999999999\n99999996 999999997 999999997 999999999\n99999997 999999998 999999998 999999999\n99999996 999999997 999999997 999999999\n99999997 999999998 999999998 999999999", "output": "899999999100000001\n449999999550000002\n899999999100000001\n449999999550000002\n899999999100000001" }, { "input": "1\n1000000000 1000000000 1 1000000000", "output": "999999999000000000" }, { "input": "1\n7 7 1 1", "output": "0" }, { "input": "5\n1000000000 1000000000 1 2\n1000000000 1000000000 1 2\n1000000000 1000000000 1 2\n1000000000 1000000000 1 2\n1000000000 1000000000 1 2", "output": "1000000000\n1000000000\n1000000000\n1000000000\n1000000000" }, { "input": "1\n1000000000 1000000000 1 1", "output": "0" }, { "input": "1\n1 1000000000 999999999 1000000000", "output": "999999998000000000" }, { "input": "4\n1 1000000000 999999999 1000000000\n999999999 1000000000 1 1000000000\n1 2 0 1\n0 1 0 1", "output": "999999998000000000\n999999998000000000\n-1\n0" }, { "input": "1\n1 1000000000 1 2", "output": "999999998" }, { "input": "5\n1 982449707 1 2\n1 982449707 1 2\n1 982449707 1 2\n1 982449707 1 2\n1 982449707 1 2", "output": "982449705\n982449705\n982449705\n982449705\n982449705" }, { "input": "5\n13 900000007 900000007 900000009\n13 900000007 900000007 900000009\n13 900000007 900000007 900000009\n13 900000007 900000007 900000009\n13 900000007 900000007 900000009", "output": "405000000449999966\n405000000449999966\n405000000449999966\n405000000449999966\n405000000449999966" }, { "input": "1\n5 10 0 1", "output": "-1" }, { "input": "1\n2 2 1 1", "output": "0" }, { "input": "5\n0 999999999 999999999 1000000000\n0 999999999 999999999 1000000000\n0 999999999 999999999 1000000000\n0 999999999 999999999 1000000000\n0 999999999 999999999 1000000000", "output": "999999998000000001\n999999998000000001\n999999998000000001\n999999998000000001\n999999998000000001" }, { "input": "1\n0 5 0 1", "output": "0" }, { "input": "5\n999999999 1000000000 1 9999\n999999999 1000000000 1 9999\n999999999 1000000000 1 9999\n999999999 1000000000 1 9999\n999999999 1000000000 1 9999", "output": "9997999990001\n9997999990001\n9997999990001\n9997999990001\n9997999990001" }, { "input": "5\n999999997 1000000000 3 1000000000\n999999997 1000000000 3 1000000000\n999999997 1000000000 3 1000000000\n999999997 1000000000 3 1000000000\n999999997 1000000000 3 1000000000", "output": "333333332000000000\n333333332000000000\n333333332000000000\n333333332000000000\n333333332000000000" }, { "input": "5\n1000000000 1000000000 1 1000000000\n1000000000 1000000000 1 1000000000\n1 1000000000 999999999 1000000000\n1 1000000000 999999999 1000000000\n1 1000000000 999999999 1000000000", "output": "999999999000000000\n999999999000000000\n999999998000000000\n999999998000000000\n999999998000000000" }, { "input": "5\n1000000000 1000000000 1 1000000000\n1000000000 1000000000 1 1000000000\n1000000000 1000000000 1 1000000000\n1 1000000000 999999999 1000000000\n1 1000000000 999999999 1000000000", "output": "999999999000000000\n999999999000000000\n999999999000000000\n999999998000000000\n999999998000000000" }, { "input": "1\n999999998 999999999 1 10", "output": "8999999981" }, { "input": "5\n1 1 1 1\n2 2 1 1\n100 100 1 1\n1000000000 1000000000 1 1\n1000000000 1000000000 1 1", "output": "0\n0\n0\n0\n0" }, { "input": "4\n1 1000000000 999999999 1000000000\n1 1000000000 999999999 1000000000\n1 1000000000 999999999 1000000000\n1 1000000000 999999999 1000000000", "output": "999999998000000000\n999999998000000000\n999999998000000000\n999999998000000000" } ]
1,494,316,818
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
1
2,000
0
from math import ceil n=int(input()) i=0 while i<n: x,y,p,q=map(int,input().split()) if y*p==x*q: print(0) elif x!=y and p==q: print(-1) else: if p!=0: r=max(int(ceil((y-x)/(q-p))),int(ceil(x/p))) w=0 t=0 while w<=0 or t<=0 or w<t: w=q*r-y t=p*r-x r+=1 print(w) else: r=int(ceil((y-x)/(q-p))) w=0 t=0 while w<=0 or t<=0 or w<t: w=q*r-y t=p*r-x r+=1 print(w) i+=1
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are an experienced Codeforces user. Today you found out that during your activity on Codeforces you have made *y* submissions, out of which *x* have been successful. Thus, your current success rate on Codeforces is equal to *x*<=/<=*y*. Your favorite rational number in the [0;1] range is *p*<=/<=*q*. Now you wonder: what is the smallest number of submissions you have to make if you want your success rate to be *p*<=/<=*q*? Input Specification: The first line contains a single integer *t* (1<=≤<=*t*<=≤<=1000) — the number of test cases. Each of the next *t* lines contains four integers *x*, *y*, *p* and *q* (0<=≤<=*x*<=≤<=*y*<=≤<=109; 0<=≤<=*p*<=≤<=*q*<=≤<=109; *y*<=&gt;<=0; *q*<=&gt;<=0). It is guaranteed that *p*<=/<=*q* is an irreducible fraction. Hacks. For hacks, an additional constraint of *t*<=≤<=5 must be met. Output Specification: For each test case, output a single integer equal to the smallest number of submissions you have to make if you want your success rate to be equal to your favorite rational number, or -1 if this is impossible to achieve. Demo Input: ['4\n3 10 1 2\n7 14 3 8\n20 70 2 7\n5 6 1 1\n'] Demo Output: ['4\n10\n0\n-1\n'] Note: In the first example, you have to make 4 successful submissions. Your success rate will be equal to 7 / 14, or 1 / 2. In the second example, you have to make 2 successful and 8 unsuccessful submissions. Your success rate will be equal to 9 / 24, or 3 / 8. In the third example, there is no need to make any new submissions. Your success rate is already equal to 20 / 70, or 2 / 7. In the fourth example, the only unsuccessful submission breaks your hopes of having the success rate equal to 1.
```python from math import ceil n=int(input()) i=0 while i<n: x,y,p,q=map(int,input().split()) if y*p==x*q: print(0) elif x!=y and p==q: print(-1) else: if p!=0: r=max(int(ceil((y-x)/(q-p))),int(ceil(x/p))) w=0 t=0 while w<=0 or t<=0 or w<t: w=q*r-y t=p*r-x r+=1 print(w) else: r=int(ceil((y-x)/(q-p))) w=0 t=0 while w<=0 or t<=0 or w<t: w=q*r-y t=p*r-x r+=1 print(w) i+=1 ```
0
938
A
Word Correction
PROGRAMMING
800
[ "implementation" ]
null
null
Victor tries to write his own text editor, with word correction included. However, the rules of word correction are really strange. Victor thinks that if a word contains two consecutive vowels, then it's kinda weird and it needs to be replaced. So the word corrector works in such a way: as long as there are two consecutive vowels in the word, it deletes the first vowel in a word such that there is another vowel right before it. If there are no two consecutive vowels in the word, it is considered to be correct. You are given a word *s*. Can you predict what will it become after correction? In this problem letters a, e, i, o, u and y are considered to be vowels.
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of letters in word *s* before the correction. The second line contains a string *s* consisting of exactly *n* lowercase Latin letters — the word before the correction.
Output the word *s* after the correction.
[ "5\nweird\n", "4\nword\n", "5\naaeaa\n" ]
[ "werd\n", "word\n", "a\n" ]
Explanations of the examples: 1. There is only one replace: weird <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> werd;1. No replace needed since there are no two consecutive vowels;1. aaeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> a.
0
[ { "input": "5\nweird", "output": "werd" }, { "input": "4\nword", "output": "word" }, { "input": "5\naaeaa", "output": "a" }, { "input": "100\naaaaabbbbboyoyoyoyoyacadabbbbbiuiufgiuiuaahjabbbklboyoyoyoyoyaaaaabbbbbiuiuiuiuiuaaaaabbbbbeyiyuyzyw", "output": "abbbbbocadabbbbbifgihjabbbklbobbbbbibbbbbezyw" }, { "input": "69\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb", "output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb" }, { "input": "12\nmmmmmmmmmmmm", "output": "mmmmmmmmmmmm" }, { "input": "18\nyaywptqwuyiqypwoyw", "output": "ywptqwuqypwow" }, { "input": "85\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb", "output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb" }, { "input": "13\nmmmmmmmmmmmmm", "output": "mmmmmmmmmmmmm" }, { "input": "10\nmmmmmmmmmm", "output": "mmmmmmmmmm" }, { "input": "11\nmmmmmmmmmmm", "output": "mmmmmmmmmmm" }, { "input": "15\nmmmmmmmmmmmmmmm", "output": "mmmmmmmmmmmmmmm" }, { "input": "1\na", "output": "a" }, { "input": "14\nmmmmmmmmmmmmmm", "output": "mmmmmmmmmmmmmm" }, { "input": "33\nmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm", "output": "mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm" }, { "input": "79\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb", "output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb" }, { "input": "90\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb", "output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb" }, { "input": "2\naa", "output": "a" }, { "input": "18\niuiuqpyyaoaetiwliu", "output": "iqpytiwli" }, { "input": "5\nxxxxx", "output": "xxxxx" }, { "input": "6\nxxxahg", "output": "xxxahg" }, { "input": "3\nzcv", "output": "zcv" }, { "input": "4\naepo", "output": "apo" }, { "input": "5\nqqqqq", "output": "qqqqq" }, { "input": "6\naaaaaa", "output": "a" }, { "input": "4\naeta", "output": "ata" }, { "input": "20\nttyttlwaoieulyiluuri", "output": "ttyttlwalyluri" }, { "input": "1\nb", "output": "b" }, { "input": "3\nanc", "output": "anc" }, { "input": "1\ne", "output": "e" }, { "input": "3\naie", "output": "a" }, { "input": "3\nvio", "output": "vi" }, { "input": "2\nea", "output": "e" }, { "input": "3\nuas", "output": "us" }, { "input": "2\nba", "output": "ba" }, { "input": "2\naq", "output": "aq" }, { "input": "2\nya", "output": "y" }, { "input": "2\nou", "output": "o" }, { "input": "2\nbb", "output": "bb" }, { "input": "7\nayylmao", "output": "alma" }, { "input": "2\nab", "output": "ab" }, { "input": "19\nyuouiyaoiiweqrryqqp", "output": "yweqrryqqp" }, { "input": "25\niqypwqpriiioetiuqqqttouei", "output": "iqypwqpritiqqqtto" }, { "input": "100\naaaaabbbbboyoyoyoyoyacadabbbbbiuiufgiuiuaahjabbbklboyoyoyoyoyaaaaabbbbbiuiuiuiuiuaaaaabbbbbeyiyuyzyz", "output": "abbbbbocadabbbbbifgihjabbbklbobbbbbibbbbbezyz" }, { "input": "17\naccccccccccccccca", "output": "accccccccccccccca" }, { "input": "5\nababa", "output": "ababa" }, { "input": "10\naaaaaaaaaa", "output": "a" }, { "input": "22\naaaaabbbbboyoyoyoyoyac", "output": "abbbbboc" }, { "input": "7\nmahmoud", "output": "mahmod" } ]
1,563,008,646
2,147,483,647
PyPy 3
OK
TESTS
49
140
0
g = ['a', 'e', 'i', 'o', 'u', 'y'] n = int(input()) s = input() ans = '' i, j = 0, 0 while i < n: ans += s[i] if s[i] in g: j = i + 1 while j < n: if s[j] in g: j += 1 else: break i = j - 1 i += 1 print(ans)
Title: Word Correction Time Limit: None seconds Memory Limit: None megabytes Problem Description: Victor tries to write his own text editor, with word correction included. However, the rules of word correction are really strange. Victor thinks that if a word contains two consecutive vowels, then it's kinda weird and it needs to be replaced. So the word corrector works in such a way: as long as there are two consecutive vowels in the word, it deletes the first vowel in a word such that there is another vowel right before it. If there are no two consecutive vowels in the word, it is considered to be correct. You are given a word *s*. Can you predict what will it become after correction? In this problem letters a, e, i, o, u and y are considered to be vowels. Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of letters in word *s* before the correction. The second line contains a string *s* consisting of exactly *n* lowercase Latin letters — the word before the correction. Output Specification: Output the word *s* after the correction. Demo Input: ['5\nweird\n', '4\nword\n', '5\naaeaa\n'] Demo Output: ['werd\n', 'word\n', 'a\n'] Note: Explanations of the examples: 1. There is only one replace: weird <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> werd;1. No replace needed since there are no two consecutive vowels;1. aaeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> a.
```python g = ['a', 'e', 'i', 'o', 'u', 'y'] n = int(input()) s = input() ans = '' i, j = 0, 0 while i < n: ans += s[i] if s[i] in g: j = i + 1 while j < n: if s[j] in g: j += 1 else: break i = j - 1 i += 1 print(ans) ```
3
580
A
Kefa and First Steps
PROGRAMMING
900
[ "brute force", "dp", "implementation" ]
null
null
Kefa decided to make some money doing business on the Internet for exactly *n* days. He knows that on the *i*-th day (1<=≤<=*i*<=≤<=*n*) he makes *a**i* money. Kefa loves progress, that's why he wants to know the length of the maximum non-decreasing subsegment in sequence *a**i*. Let us remind you that the subsegment of the sequence is its continuous fragment. A subsegment of numbers is called non-decreasing if all numbers in it follow in the non-decreasing order. Help Kefa cope with this task!
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The second line contains *n* integers *a*1,<=<=*a*2,<=<=...,<=<=*a**n* (1<=≤<=*a**i*<=≤<=109).
Print a single integer — the length of the maximum non-decreasing subsegment of sequence *a*.
[ "6\n2 2 1 3 4 1\n", "3\n2 2 9\n" ]
[ "3", "3" ]
In the first test the maximum non-decreasing subsegment is the numbers from the third to the fifth one. In the second test the maximum non-decreasing subsegment is the numbers from the first to the third one.
750
[ { "input": "6\n2 2 1 3 4 1", "output": "3" }, { "input": "3\n2 2 9", "output": "3" }, { "input": "5\n10 100 111 1 2", "output": "3" }, { "input": "10\n1 2 3 4 1 2 3 4 5 6", "output": "6" }, { "input": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "50" }, { "input": "100\n1 838 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1 605 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1 27 533 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1 835 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1 992", "output": "42" }, { "input": "1\n1", "output": "1" }, { "input": "2\n1 1", "output": "2" }, { "input": "6\n5 4 3 2 1 2", "output": "2" }, { "input": "9\n1 2 3 4 5 6 7 8 9", "output": "9" }, { "input": "7\n99 100 1 2 3 4 5", "output": "5" }, { "input": "5\n3 3 1 2 3", "output": "3" }, { "input": "1\n100", "output": "1" }, { "input": "1\n5", "output": "1" } ]
1,697,987,578
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
1
46
0
a = int(input()) b = list(map(int, input().split())) count = 0 main = 0 for i in range(0, a-1): if b[i] <= b[i + 1]: count +=1 else: if main < count: main = count count = 0 print(main)
Title: Kefa and First Steps Time Limit: None seconds Memory Limit: None megabytes Problem Description: Kefa decided to make some money doing business on the Internet for exactly *n* days. He knows that on the *i*-th day (1<=≤<=*i*<=≤<=*n*) he makes *a**i* money. Kefa loves progress, that's why he wants to know the length of the maximum non-decreasing subsegment in sequence *a**i*. Let us remind you that the subsegment of the sequence is its continuous fragment. A subsegment of numbers is called non-decreasing if all numbers in it follow in the non-decreasing order. Help Kefa cope with this task! Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The second line contains *n* integers *a*1,<=<=*a*2,<=<=...,<=<=*a**n* (1<=≤<=*a**i*<=≤<=109). Output Specification: Print a single integer — the length of the maximum non-decreasing subsegment of sequence *a*. Demo Input: ['6\n2 2 1 3 4 1\n', '3\n2 2 9\n'] Demo Output: ['3', '3'] Note: In the first test the maximum non-decreasing subsegment is the numbers from the third to the fifth one. In the second test the maximum non-decreasing subsegment is the numbers from the first to the third one.
```python a = int(input()) b = list(map(int, input().split())) count = 0 main = 0 for i in range(0, a-1): if b[i] <= b[i + 1]: count +=1 else: if main < count: main = count count = 0 print(main) ```
0
902
A
Visiting a Friend
PROGRAMMING
1,100
[ "greedy", "implementation" ]
null
null
Pig is visiting a friend. Pig's house is located at point 0, and his friend's house is located at point *m* on an axis. Pig can use teleports to move along the axis. To use a teleport, Pig should come to a certain point (where the teleport is located) and choose where to move: for each teleport there is the rightmost point it can move Pig to, this point is known as the limit of the teleport. Formally, a teleport located at point *x* with limit *y* can move Pig from point *x* to any point within the segment [*x*;<=*y*], including the bounds. Determine if Pig can visit the friend using teleports only, or he should use his car.
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=100) — the number of teleports and the location of the friend's house. The next *n* lines contain information about teleports. The *i*-th of these lines contains two integers *a**i* and *b**i* (0<=≤<=*a**i*<=≤<=*b**i*<=≤<=*m*), where *a**i* is the location of the *i*-th teleport, and *b**i* is its limit. It is guaranteed that *a**i*<=≥<=*a**i*<=-<=1 for every *i* (2<=≤<=*i*<=≤<=*n*).
Print "YES" if there is a path from Pig's house to his friend's house that uses only teleports, and "NO" otherwise. You can print each letter in arbitrary case (upper or lower).
[ "3 5\n0 2\n2 4\n3 5\n", "3 7\n0 4\n2 5\n6 7\n" ]
[ "YES\n", "NO\n" ]
The first example is shown on the picture below: Pig can use the first teleport from his house (point 0) to reach point 2, then using the second teleport go from point 2 to point 3, then using the third teleport go from point 3 to point 5, where his friend lives. The second example is shown on the picture below: You can see that there is no path from Pig's house to his friend's house that uses only teleports.
500
[ { "input": "3 5\n0 2\n2 4\n3 5", "output": "YES" }, { "input": "3 7\n0 4\n2 5\n6 7", "output": "NO" }, { "input": "1 1\n0 0", "output": "NO" }, { "input": "30 10\n0 7\n1 2\n1 2\n1 4\n1 4\n1 3\n2 2\n2 4\n2 6\n2 9\n2 2\n3 5\n3 8\n4 8\n4 5\n4 6\n5 6\n5 7\n6 6\n6 9\n6 7\n6 9\n7 7\n7 7\n8 8\n8 8\n9 9\n9 9\n10 10\n10 10", "output": "NO" }, { "input": "30 100\n0 27\n4 82\n11 81\n14 32\n33 97\n33 34\n37 97\n38 52\n45 91\n49 56\n50 97\n57 70\n59 94\n59 65\n62 76\n64 65\n65 95\n67 77\n68 100\n71 73\n80 94\n81 92\n84 85\n85 100\n88 91\n91 95\n92 98\n92 98\n99 100\n100 100", "output": "YES" }, { "input": "70 10\n0 4\n0 4\n0 8\n0 9\n0 1\n0 5\n0 7\n1 3\n1 8\n1 8\n1 6\n1 6\n1 2\n1 3\n1 2\n1 3\n2 5\n2 4\n2 3\n2 4\n2 6\n2 2\n2 5\n2 7\n3 7\n3 4\n3 7\n3 4\n3 8\n3 4\n3 9\n3 3\n3 7\n3 9\n3 3\n3 9\n4 6\n4 7\n4 5\n4 7\n5 8\n5 5\n5 9\n5 7\n5 5\n6 6\n6 9\n6 7\n6 8\n6 9\n6 8\n7 7\n7 8\n7 7\n7 8\n8 9\n8 8\n8 9\n8 8\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10", "output": "NO" }, { "input": "30 10\n0 7\n1 2\n1 2\n1 4\n1 4\n1 3\n2 2\n2 4\n2 6\n2 9\n2 2\n3 5\n3 8\n4 8\n4 5\n4 6\n5 6\n5 7\n6 6\n6 9\n6 7\n6 9\n7 7\n7 7\n8 10\n8 10\n9 9\n9 9\n10 10\n10 10", "output": "YES" }, { "input": "50 100\n0 95\n1 100\n1 38\n2 82\n5 35\n7 71\n8 53\n11 49\n15 27\n17 84\n17 75\n18 99\n18 43\n18 69\n21 89\n27 60\n27 29\n38 62\n38 77\n39 83\n40 66\n48 80\n48 100\n50 51\n50 61\n53 77\n53 63\n55 58\n56 68\n60 82\n62 95\n66 74\n67 83\n69 88\n69 81\n69 88\n69 98\n70 91\n70 76\n71 90\n72 99\n81 99\n85 87\n88 97\n88 93\n90 97\n90 97\n92 98\n98 99\n100 100", "output": "YES" }, { "input": "70 10\n0 4\n0 4\n0 8\n0 9\n0 1\n0 5\n0 7\n1 3\n1 8\n1 8\n1 10\n1 9\n1 6\n1 2\n1 3\n1 2\n2 6\n2 5\n2 4\n2 3\n2 10\n2 2\n2 6\n2 2\n3 10\n3 7\n3 7\n3 4\n3 7\n3 4\n3 8\n3 4\n3 10\n3 5\n3 3\n3 7\n4 8\n4 8\n4 9\n4 6\n5 7\n5 10\n5 7\n5 8\n5 5\n6 8\n6 9\n6 10\n6 6\n6 9\n6 7\n7 8\n7 9\n7 10\n7 10\n8 8\n8 8\n8 9\n8 10\n9 10\n9 9\n9 10\n9 10\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10", "output": "YES" }, { "input": "85 10\n0 9\n0 4\n0 2\n0 5\n0 1\n0 8\n0 7\n1 2\n1 4\n1 5\n1 9\n1 1\n1 6\n1 6\n2 5\n2 7\n2 7\n2 7\n2 7\n3 4\n3 7\n3 9\n3 5\n3 3\n4 4\n4 6\n4 5\n5 6\n5 6\n5 6\n5 6\n5 7\n5 8\n5 5\n5 7\n5 8\n5 9\n5 8\n6 8\n6 7\n6 8\n6 9\n6 9\n6 6\n6 9\n6 7\n7 7\n7 7\n7 7\n7 8\n7 7\n7 8\n7 8\n7 9\n8 8\n8 8\n8 8\n8 8\n8 8\n8 9\n8 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10", "output": "NO" }, { "input": "30 40\n0 0\n4 8\n5 17\n7 32\n7 16\n8 16\n10 19\n12 22\n12 27\n13 21\n13 28\n13 36\n14 28\n14 18\n18 21\n21 26\n21 36\n22 38\n23 32\n24 30\n26 35\n29 32\n29 32\n31 34\n31 31\n33 33\n33 35\n35 40\n38 38\n40 40", "output": "NO" }, { "input": "70 100\n0 99\n1 87\n1 94\n1 4\n2 72\n3 39\n3 69\n4 78\n5 85\n7 14\n8 59\n12 69\n14 15\n14 76\n17 17\n19 53\n19 57\n19 21\n21 35\n21 83\n24 52\n24 33\n27 66\n27 97\n30 62\n30 74\n30 64\n32 63\n35 49\n37 60\n40 99\n40 71\n41 83\n42 66\n42 46\n45 83\n51 76\n53 69\n54 82\n54 96\n54 88\n55 91\n56 88\n58 62\n62 87\n64 80\n67 90\n67 69\n68 92\n72 93\n74 93\n77 79\n77 91\n78 97\n78 98\n81 85\n81 83\n81 83\n84 85\n86 88\n89 94\n89 92\n92 97\n96 99\n97 98\n97 99\n99 99\n100 100\n100 100\n100 100", "output": "NO" }, { "input": "1 10\n0 10", "output": "YES" }, { "input": "70 40\n0 34\n1 16\n3 33\n4 36\n4 22\n5 9\n5 9\n7 16\n8 26\n9 29\n9 25\n10 15\n10 22\n10 29\n10 20\n11 27\n11 26\n11 12\n12 19\n13 21\n14 31\n14 36\n15 34\n15 37\n16 21\n17 31\n18 22\n20 27\n20 32\n20 20\n20 29\n21 29\n21 34\n21 30\n22 40\n23 23\n23 28\n24 29\n25 38\n26 35\n27 37\n28 39\n28 33\n28 40\n28 33\n29 31\n29 33\n30 38\n30 36\n30 30\n30 38\n31 37\n31 35\n31 32\n31 36\n33 39\n33 40\n35 38\n36 38\n37 38\n37 40\n38 39\n38 40\n38 39\n39 39\n39 40\n40 40\n40 40\n40 40\n40 40", "output": "YES" }, { "input": "50 40\n0 9\n1 26\n1 27\n2 33\n2 5\n3 30\n4 28\n5 31\n5 27\n5 29\n7 36\n8 32\n8 13\n9 24\n10 10\n10 30\n11 26\n11 22\n11 40\n11 31\n12 26\n13 25\n14 32\n17 19\n21 29\n22 36\n24 27\n25 39\n25 27\n27 32\n27 29\n27 39\n27 29\n28 38\n30 38\n32 40\n32 38\n33 33\n33 40\n34 35\n34 34\n34 38\n34 38\n35 37\n36 39\n36 39\n37 37\n38 40\n39 39\n40 40", "output": "YES" }, { "input": "70 40\n0 34\n1 16\n3 33\n4 36\n4 22\n5 9\n5 9\n7 16\n8 26\n9 29\n9 25\n10 15\n10 22\n10 29\n10 20\n11 27\n11 26\n11 12\n12 19\n13 21\n14 31\n14 36\n15 34\n15 37\n16 21\n17 31\n18 22\n20 27\n20 32\n20 20\n20 29\n21 29\n21 34\n21 30\n22 22\n23 28\n23 39\n24 24\n25 27\n26 38\n27 39\n28 33\n28 39\n28 34\n28 33\n29 30\n29 35\n30 30\n30 38\n30 34\n30 31\n31 36\n31 31\n31 32\n31 38\n33 34\n33 34\n35 36\n36 38\n37 38\n37 39\n38 38\n38 38\n38 38\n39 39\n39 39\n40 40\n40 40\n40 40\n40 40", "output": "NO" }, { "input": "10 100\n0 34\n8 56\n17 79\n24 88\n28 79\n45 79\n48 93\n55 87\n68 93\n88 99", "output": "NO" }, { "input": "10 10\n0 2\n3 8\n3 5\n3 3\n3 9\n3 8\n5 7\n6 10\n7 10\n9 10", "output": "NO" }, { "input": "50 10\n0 2\n0 2\n0 6\n1 9\n1 3\n1 2\n1 6\n1 1\n1 1\n2 7\n2 6\n2 4\n3 9\n3 8\n3 8\n3 8\n3 6\n3 4\n3 7\n3 4\n3 6\n3 5\n4 8\n5 5\n5 7\n6 7\n6 6\n7 7\n7 7\n7 7\n7 8\n7 8\n8 8\n8 8\n8 9\n8 8\n8 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10", "output": "NO" }, { "input": "10 40\n0 21\n1 19\n4 33\n6 26\n8 39\n15 15\n20 24\n27 27\n29 39\n32 37", "output": "NO" }, { "input": "50 10\n0 2\n0 2\n0 6\n1 9\n1 3\n1 2\n1 6\n1 1\n1 1\n2 7\n2 6\n2 4\n3 9\n3 8\n3 8\n3 8\n3 6\n3 4\n3 7\n3 4\n3 6\n3 10\n4 6\n5 9\n5 5\n6 7\n6 10\n7 8\n7 7\n7 7\n7 7\n7 10\n8 8\n8 8\n8 10\n8 8\n8 8\n9 10\n9 10\n9 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10", "output": "YES" }, { "input": "1 1\n0 1", "output": "YES" }, { "input": "30 40\n0 0\n4 8\n5 17\n7 32\n7 16\n8 16\n10 19\n12 22\n12 27\n13 21\n13 28\n13 36\n14 28\n14 18\n18 21\n21 26\n21 36\n22 38\n23 32\n24 30\n26 35\n29 32\n29 32\n31 34\n31 31\n33 33\n33 35\n35 36\n38 38\n40 40", "output": "NO" }, { "input": "30 100\n0 27\n4 82\n11 81\n14 32\n33 97\n33 34\n37 97\n38 52\n45 91\n49 56\n50 97\n57 70\n59 94\n59 65\n62 76\n64 65\n65 95\n67 77\n68 82\n71 94\n80 90\n81 88\n84 93\n85 89\n88 92\n91 97\n92 99\n92 97\n99 99\n100 100", "output": "NO" }, { "input": "10 100\n0 34\n8 56\n17 79\n24 88\n28 79\n45 79\n48 93\n55 87\n68 93\n79 100", "output": "YES" }, { "input": "10 40\n0 21\n1 19\n4 33\n6 26\n8 39\n15 15\n20 24\n27 27\n29 39\n37 40", "output": "YES" }, { "input": "85 10\n0 9\n0 4\n0 2\n0 5\n0 1\n0 8\n0 7\n1 2\n1 10\n1 2\n1 5\n1 10\n1 8\n1 1\n2 8\n2 7\n2 5\n2 5\n2 7\n3 5\n3 7\n3 5\n3 4\n3 7\n4 7\n4 8\n4 6\n5 7\n5 10\n5 5\n5 6\n5 6\n5 6\n5 6\n5 7\n5 8\n5 5\n5 7\n6 10\n6 9\n6 7\n6 10\n6 8\n6 7\n6 10\n6 10\n7 8\n7 9\n7 8\n7 8\n7 8\n7 8\n7 7\n7 7\n8 8\n8 8\n8 10\n8 9\n8 9\n8 9\n8 9\n9 9\n9 10\n9 9\n9 9\n9 9\n9 9\n9 10\n9 10\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10", "output": "YES" }, { "input": "50 100\n0 95\n1 7\n1 69\n2 83\n5 67\n7 82\n8 31\n11 25\n15 44\n17 75\n17 27\n18 43\n18 69\n18 40\n21 66\n27 29\n27 64\n38 77\n38 90\n39 52\n40 60\n48 91\n48 98\n50 89\n50 63\n53 54\n53 95\n55 76\n56 59\n60 96\n62 86\n66 70\n67 77\n69 88\n69 98\n69 80\n69 95\n70 74\n70 77\n71 99\n72 73\n81 87\n85 99\n88 96\n88 91\n90 97\n90 99\n92 92\n98 99\n100 100", "output": "NO" }, { "input": "50 40\n0 9\n1 26\n1 27\n2 33\n2 5\n3 30\n4 28\n5 31\n5 27\n5 29\n7 36\n8 32\n8 13\n9 24\n10 10\n10 30\n11 26\n11 22\n11 35\n11 23\n12 36\n13 31\n14 31\n17 17\n21 25\n22 33\n24 26\n25 32\n25 25\n27 39\n27 29\n27 34\n27 32\n28 34\n30 36\n32 37\n32 33\n33 35\n33 33\n34 38\n34 38\n34 36\n34 36\n35 36\n36 36\n36 39\n37 37\n38 39\n39 39\n40 40", "output": "NO" }, { "input": "10 10\n0 2\n3 8\n3 5\n3 3\n3 9\n3 8\n5 7\n6 9\n7 7\n9 9", "output": "NO" }, { "input": "70 100\n0 99\n1 87\n1 94\n1 4\n2 72\n3 39\n3 69\n4 78\n5 85\n7 14\n8 59\n12 69\n14 15\n14 76\n17 17\n19 53\n19 57\n19 21\n21 35\n21 83\n24 52\n24 33\n27 66\n27 97\n30 62\n30 74\n30 64\n32 63\n35 49\n37 60\n40 99\n40 71\n41 83\n42 66\n42 46\n45 83\n51 76\n53 69\n54 82\n54 96\n54 88\n55 91\n56 88\n58 62\n62 87\n64 80\n67 90\n67 69\n68 92\n72 93\n74 93\n77 79\n77 91\n78 97\n78 98\n81 85\n81 83\n81 83\n84 85\n86 88\n89 94\n89 100\n92 97\n96 96\n97 98\n97 100\n99 100\n100 100\n100 100\n100 100", "output": "YES" }, { "input": "2 2\n0 2\n0 1", "output": "YES" }, { "input": "2 100\n0 49\n50 100", "output": "NO" }, { "input": "2 100\n0 50\n50 100", "output": "YES" }, { "input": "10 100\n0 10\n10 20\n20 30\n30 40\n40 50\n50 60\n60 70\n70 80\n80 90\n90 100", "output": "YES" }, { "input": "100 10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 10", "output": "YES" }, { "input": "1 4\n1 4", "output": "NO" }, { "input": "3 5\n0 2\n2 5\n3 4", "output": "YES" }, { "input": "2 5\n0 5\n1 2", "output": "YES" }, { "input": "5 5\n0 2\n0 2\n3 5\n3 5\n3 5", "output": "NO" }, { "input": "4 10\n0 3\n2 10\n4 10\n5 7", "output": "YES" }, { "input": "3 8\n0 0\n1 8\n2 8", "output": "NO" }, { "input": "6 8\n0 3\n1 5\n2 3\n5 6\n6 7\n7 8", "output": "YES" } ]
1,513,698,585
885
Python 3
WRONG_ANSWER
PRETESTS
4
46
5,529,600
n, m = map(int, input().split()) t = [] for _ in range(n): a, b = map(int, input().split()) t.append((a, b)) c_l = 0 for i in range(n): l, r = t[i][0], t[i][1] if l > c_l: print('NO') exit() c_l = r if c_l >= m: print('YES') exit() print('NO')
Title: Visiting a Friend Time Limit: None seconds Memory Limit: None megabytes Problem Description: Pig is visiting a friend. Pig's house is located at point 0, and his friend's house is located at point *m* on an axis. Pig can use teleports to move along the axis. To use a teleport, Pig should come to a certain point (where the teleport is located) and choose where to move: for each teleport there is the rightmost point it can move Pig to, this point is known as the limit of the teleport. Formally, a teleport located at point *x* with limit *y* can move Pig from point *x* to any point within the segment [*x*;<=*y*], including the bounds. Determine if Pig can visit the friend using teleports only, or he should use his car. Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=100) — the number of teleports and the location of the friend's house. The next *n* lines contain information about teleports. The *i*-th of these lines contains two integers *a**i* and *b**i* (0<=≤<=*a**i*<=≤<=*b**i*<=≤<=*m*), where *a**i* is the location of the *i*-th teleport, and *b**i* is its limit. It is guaranteed that *a**i*<=≥<=*a**i*<=-<=1 for every *i* (2<=≤<=*i*<=≤<=*n*). Output Specification: Print "YES" if there is a path from Pig's house to his friend's house that uses only teleports, and "NO" otherwise. You can print each letter in arbitrary case (upper or lower). Demo Input: ['3 5\n0 2\n2 4\n3 5\n', '3 7\n0 4\n2 5\n6 7\n'] Demo Output: ['YES\n', 'NO\n'] Note: The first example is shown on the picture below: Pig can use the first teleport from his house (point 0) to reach point 2, then using the second teleport go from point 2 to point 3, then using the third teleport go from point 3 to point 5, where his friend lives. The second example is shown on the picture below: You can see that there is no path from Pig's house to his friend's house that uses only teleports.
```python n, m = map(int, input().split()) t = [] for _ in range(n): a, b = map(int, input().split()) t.append((a, b)) c_l = 0 for i in range(n): l, r = t[i][0], t[i][1] if l > c_l: print('NO') exit() c_l = r if c_l >= m: print('YES') exit() print('NO') ```
0
1
A
Theatre Square
PROGRAMMING
1,000
[ "math" ]
A. Theatre Square
1
256
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Write the needed number of flagstones.
[ "6 6 4\n" ]
[ "4\n" ]
none
0
[ { "input": "6 6 4", "output": "4" }, { "input": "1 1 1", "output": "1" }, { "input": "2 1 1", "output": "2" }, { "input": "1 2 1", "output": "2" }, { "input": "2 2 1", "output": "4" }, { "input": "2 1 2", "output": "1" }, { "input": "1 1 3", "output": "1" }, { "input": "2 3 4", "output": "1" }, { "input": "1000000000 1000000000 1", "output": "1000000000000000000" }, { "input": "12 13 4", "output": "12" }, { "input": "222 332 5", "output": "3015" }, { "input": "1000 1000 10", "output": "10000" }, { "input": "1001 1000 10", "output": "10100" }, { "input": "100 10001 1000000000", "output": "1" }, { "input": "1000000000 1000000000 1000000000", "output": "1" }, { "input": "1000000000 1000000000 999999999", "output": "4" }, { "input": "1000000000 1000000000 192", "output": "27126743055556" }, { "input": "1000000000 987654321 1", "output": "987654321000000000" }, { "input": "456784567 1000000000 51", "output": "175618850864484" }, { "input": "39916800 134217728 40320", "output": "3295710" } ]
1,665,401,903
2,147,483,647
PyPy 3
COMPILATION_ERROR
TESTS
0
0
0
x,y,n = [int(i) for i in input().split(' ')] print(ceil((x*y)/n)
Title: Theatre Square Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. Input Specification: The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). Output Specification: Write the needed number of flagstones. Demo Input: ['6 6 4\n'] Demo Output: ['4\n'] Note: none
```python x,y,n = [int(i) for i in input().split(' ')] print(ceil((x*y)/n) ```
-1
263
A
Beautiful Matrix
PROGRAMMING
800
[ "implementation" ]
null
null
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix: 1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=&lt;<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=&lt;<=5). You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
[ "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n", "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n" ]
[ "3\n", "1\n" ]
none
500
[ { "input": "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "0" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1", "output": "4" }, { "input": "0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "4" }, { "input": "0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "4" }, { "input": "0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0", "output": "4" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0", "output": "3" } ]
1,697,739,762
2,147,483,647
Python 3
OK
TESTS
25
92
0
matrix = [list(map(int, input().split())) for _ in range(5)] output = 0 for i, row in enumerate(matrix): # Acum, 'i' este indicele rândului și 'row' este rândul însuși # ... restul codului tău ... if i == 0 or i == 4: if row[0] == 1 or row[-1] == 1: output = 4 break if row[1] == 1 or row[-2] == 1: output = 3 break if row[2] == 1: output = 2 break elif i == 1 or i == 3: if row[0] == 1 or row[-1] == 1: output = 3 break if row[1] == 1 or row[-2] == 1: output = 2 break if row[2] == 1: output = 1 break elif i == 2: if row[0] == 1 or row[-1] == 1: output = 2 break if row[1] == 1 or row[-2] == 1: output = 1 break print(output)
Title: Beautiful Matrix Time Limit: None seconds Memory Limit: None megabytes Problem Description: You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix: 1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=&lt;<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=&lt;<=5). You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful. Input Specification: The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one. Output Specification: Print a single integer — the minimum number of moves needed to make the matrix beautiful. Demo Input: ['0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n', '0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n'] Demo Output: ['3\n', '1\n'] Note: none
```python matrix = [list(map(int, input().split())) for _ in range(5)] output = 0 for i, row in enumerate(matrix): # Acum, 'i' este indicele rândului și 'row' este rândul însuși # ... restul codului tău ... if i == 0 or i == 4: if row[0] == 1 or row[-1] == 1: output = 4 break if row[1] == 1 or row[-2] == 1: output = 3 break if row[2] == 1: output = 2 break elif i == 1 or i == 3: if row[0] == 1 or row[-1] == 1: output = 3 break if row[1] == 1 or row[-2] == 1: output = 2 break if row[2] == 1: output = 1 break elif i == 2: if row[0] == 1 or row[-1] == 1: output = 2 break if row[1] == 1 or row[-2] == 1: output = 1 break print(output) ```
3
320
A
Magic Numbers
PROGRAMMING
900
[ "brute force", "greedy" ]
null
null
A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not. You're given a number. Determine if it is a magic number or not.
The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros.
Print "YES" if *n* is a magic number or print "NO" if it's not.
[ "114114\n", "1111\n", "441231\n" ]
[ "YES\n", "YES\n", "NO\n" ]
none
500
[ { "input": "114114", "output": "YES" }, { "input": "1111", "output": "YES" }, { "input": "441231", "output": "NO" }, { "input": "1", "output": "YES" }, { "input": "14", "output": "YES" }, { "input": "114", "output": "YES" }, { "input": "9", "output": "NO" }, { "input": "414", "output": "NO" }, { "input": "1000000000", "output": "NO" }, { "input": "144144144", "output": "YES" }, { "input": "1444", "output": "NO" }, { "input": "11", "output": "YES" }, { "input": "141414141", "output": "YES" }, { "input": "11110111", "output": "NO" }, { "input": "114114144", "output": "YES" }, { "input": "444", "output": "NO" }, { "input": "9999", "output": "NO" }, { "input": "111444", "output": "NO" }, { "input": "11114", "output": "YES" }, { "input": "41111", "output": "NO" }, { "input": "114414441", "output": "NO" }, { "input": "144414441", "output": "NO" }, { "input": "144244144", "output": "NO" }, { "input": "111111111", "output": "YES" }, { "input": "144444444", "output": "NO" }, { "input": "444444444", "output": "NO" }, { "input": "141441441", "output": "YES" }, { "input": "441", "output": "NO" }, { "input": "15", "output": "NO" }, { "input": "14444", "output": "NO" }, { "input": "11444", "output": "NO" }, { "input": "144", "output": "YES" }, { "input": "1414414", "output": "YES" }, { "input": "141444", "output": "NO" }, { "input": "14144", "output": "YES" }, { "input": "4", "output": "NO" }, { "input": "1144", "output": "YES" }, { "input": "141111444", "output": "NO" }, { "input": "14414414", "output": "YES" }, { "input": "141414144", "output": "YES" }, { "input": "1414", "output": "YES" }, { "input": "1441", "output": "YES" }, { "input": "12", "output": "NO" }, { "input": "144144141", "output": "YES" }, { "input": "144144", "output": "YES" }, { "input": "14414411", "output": "YES" }, { "input": "14414", "output": "YES" } ]
1,629,731,971
2,147,483,647
PyPy 3
OK
TESTS
47
218
20,172,800
s = input() i=0 while True: if s[i]=="1": if i+1<len(s): if s[i]+s[i+1]=="14": if i+2<len(s): if s[i]+s[i+1]+s[i+2]=="144": i+=3 else: i+=2 else: i+=2 else: i+=1 else: i+=1 else: print("NO") break if i>=len(s): print("YES") break
Title: Magic Numbers Time Limit: None seconds Memory Limit: None megabytes Problem Description: A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not. You're given a number. Determine if it is a magic number or not. Input Specification: The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros. Output Specification: Print "YES" if *n* is a magic number or print "NO" if it's not. Demo Input: ['114114\n', '1111\n', '441231\n'] Demo Output: ['YES\n', 'YES\n', 'NO\n'] Note: none
```python s = input() i=0 while True: if s[i]=="1": if i+1<len(s): if s[i]+s[i+1]=="14": if i+2<len(s): if s[i]+s[i+1]+s[i+2]=="144": i+=3 else: i+=2 else: i+=2 else: i+=1 else: i+=1 else: print("NO") break if i>=len(s): print("YES") break ```
3
32
B
Borze
PROGRAMMING
800
[ "expression parsing", "implementation" ]
B. Borze
2
256
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output the decoded ternary number. It can have leading zeroes.
[ ".-.--\n", "--.\n", "-..-.--\n" ]
[ "012", "20", "1012" ]
none
1,000
[ { "input": ".-.--", "output": "012" }, { "input": "--.", "output": "20" }, { "input": "-..-.--", "output": "1012" }, { "input": "---..", "output": "210" }, { "input": "..--.---..", "output": "0020210" }, { "input": "-.....----.", "output": "10000220" }, { "input": ".", "output": "0" }, { "input": "-.", "output": "1" }, { "input": "--", "output": "2" }, { "input": "..", "output": "00" }, { "input": "--.", "output": "20" }, { "input": ".--.", "output": "020" }, { "input": ".-.-..", "output": "0110" }, { "input": "----.-.", "output": "2201" }, { "input": "-..--.-.", "output": "10201" }, { "input": "..--..--.", "output": "0020020" }, { "input": "-.-.---.--..-..-.-.-..-..-.--.", "output": "112120010111010120" }, { "input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.", "output": "21112220010101011012011011221011" }, { "input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------", "output": "11020111110111222212021020002022111100201121222020012022110010222" }, { "input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..", "output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110" }, { "input": ".-..-.-.---.-----.--.---...-.--.-.-....-..", "output": "01011212212021001201100010" }, { "input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..", "output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210" }, { "input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.", "output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220" }, { "input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----", "output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122" }, { "input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..", "output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110" }, { "input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.", "output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020" }, { "input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..", "output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200" }, { "input": "-.---...----...--.--...-.--.----", "output": "121002200020200012022" }, { "input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.", "output": "202020212012111010201021100001021221200011222112012201012220" } ]
1,632,664,387
2,147,483,647
Python 3
OK
TESTS
30
124
6,963,200
# -*- coding: utf-8 -*- """ Created on Sun Sep 26 21:39:24 2021 @author: cheeh """ s=list(input()) y=[] k=0 while k<len(s): if s[k]=='.': y.append('0') k+=1 elif s[k]=='-': if k!=(len(s)-1): if s[k+1]=='-': y.append('2') k+=2 else: y.append('1') k+=2 else: y.append('1') k+=1 if y!=[]: print(''.join(y)) else: print('')
Title: Borze Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet. Input Specification: The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes). Output Specification: Output the decoded ternary number. It can have leading zeroes. Demo Input: ['.-.--\n', '--.\n', '-..-.--\n'] Demo Output: ['012', '20', '1012'] Note: none
```python # -*- coding: utf-8 -*- """ Created on Sun Sep 26 21:39:24 2021 @author: cheeh """ s=list(input()) y=[] k=0 while k<len(s): if s[k]=='.': y.append('0') k+=1 elif s[k]=='-': if k!=(len(s)-1): if s[k+1]=='-': y.append('2') k+=2 else: y.append('1') k+=2 else: y.append('1') k+=1 if y!=[]: print(''.join(y)) else: print('') ```
3.95603
414
B
Mashmokh and ACM
PROGRAMMING
1,400
[ "combinatorics", "dp", "number theory" ]
null
null
Mashmokh's boss, Bimokh, didn't like Mashmokh. So he fired him. Mashmokh decided to go to university and participate in ACM instead of finding a new job. He wants to become a member of Bamokh's team. In order to join he was given some programming tasks and one week to solve them. Mashmokh is not a very experienced programmer. Actually he is not a programmer at all. So he wasn't able to solve them. That's why he asked you to help him with these tasks. One of these tasks is the following. A sequence of *l* integers *b*1,<=*b*2,<=...,<=*b**l* (1<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**l*<=≤<=*n*) is called good if each number divides (without a remainder) by the next number in the sequence. More formally for all *i* (1<=≤<=*i*<=≤<=*l*<=-<=1). Given *n* and *k* find the number of good sequences of length *k*. As the answer can be rather large print it modulo 1000000007 (109<=+<=7).
The first line of input contains two space-separated integers *n*,<=*k* (1<=≤<=*n*,<=*k*<=≤<=2000).
Output a single integer — the number of good sequences of length *k* modulo 1000000007 (109<=+<=7).
[ "3 2\n", "6 4\n", "2 1\n" ]
[ "5\n", "39\n", "2\n" ]
In the first sample the good sequences are: [1, 1], [2, 2], [3, 3], [1, 2], [1, 3].
1,000
[ { "input": "3 2", "output": "5" }, { "input": "6 4", "output": "39" }, { "input": "2 1", "output": "2" }, { "input": "1478 194", "output": "312087753" }, { "input": "1415 562", "output": "953558593" }, { "input": "1266 844", "output": "735042656" }, { "input": "680 1091", "output": "351905328" }, { "input": "1229 1315", "output": "100240813" }, { "input": "1766 1038", "output": "435768250" }, { "input": "1000 1", "output": "1000" }, { "input": "2000 100", "output": "983281065" }, { "input": "1 1", "output": "1" }, { "input": "2000 1000", "output": "228299266" }, { "input": "1928 1504", "output": "81660104" }, { "input": "2000 2000", "output": "585712681" }, { "input": "29 99", "output": "23125873" }, { "input": "56 48", "output": "20742237" }, { "input": "209 370", "output": "804680894" }, { "input": "83 37", "output": "22793555" }, { "input": "49 110", "output": "956247348" }, { "input": "217 3", "output": "4131" }, { "input": "162 161", "output": "591739753" }, { "input": "273 871", "output": "151578252" }, { "input": "43 1640", "output": "173064407" }, { "input": "1472 854", "output": "748682383" }, { "input": "1639 1056", "output": "467464129" }, { "input": "359 896", "output": "770361185" }, { "input": "1544 648", "output": "9278889" }, { "input": "436 1302", "output": "874366220" }, { "input": "1858 743", "output": "785912917" }, { "input": "991 1094", "output": "483493131" }, { "input": "1013 1550", "output": "613533467" }, { "input": "675 741", "output": "474968598" }, { "input": "1420 1223", "output": "922677437" }, { "input": "1544 1794", "output": "933285446" }, { "input": "1903 1612", "output": "620810276" }, { "input": "500 1304", "output": "706176027" }, { "input": "525 314", "output": "245394744" }, { "input": "39 1930", "output": "992125404" }, { "input": "1895 753", "output": "180474828" }, { "input": "1722 1474", "output": "742424590" }, { "input": "1153 1823", "output": "791493066" }, { "input": "1409 734", "output": "627413973" }, { "input": "478 1301", "output": "476483030" }, { "input": "1887 1729", "output": "730033374" }, { "input": "1610 774", "output": "50897314" }, { "input": "1770 679", "output": "235295539" }, { "input": "987 1292", "output": "560110556" }, { "input": "1707 1117", "output": "237674323" }, { "input": "1424 1431", "output": "184145444" }, { "input": "86 1078", "output": "252515343" }, { "input": "1066 995", "output": "180753612" }, { "input": "1024 133", "output": "392603027" }, { "input": "659 974", "output": "397026719" }, { "input": "1349 1606", "output": "522392901" }, { "input": "473 211", "output": "809550224" }, { "input": "634 1825", "output": "438513382" }, { "input": "22 373", "output": "907321755" }, { "input": "531 147", "output": "242883376" }, { "input": "1307 1247", "output": "21512331" }, { "input": "415 735", "output": "393705804" }, { "input": "1659 1501", "output": "225266660" }, { "input": "1454 296", "output": "750032659" }, { "input": "158 772", "output": "850911301" }, { "input": "2000 1", "output": "2000" } ]
1,559,744,997
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
93
0
#!/usr/bin/env python3 # -*- coding: utf-8 -*- """ Created on Wed Jun 5 19:39:24 2019 @author: adarsh """ dp=[[-1 for i in range(k+1)] for i in range(n+1)] def cal(num, i): global dp, n, k if i>=k: return 0 if num>n: return 0 if i==k-1: return 1 if dp[num][i]==-1: dp[num][i]=sum([cal(j,i+1) for j in range(num,n+1, num)]) return dp[num][i] else: return dp[num][i] n, k=[int(i) for i in input().strip().split(' ')] print(sum([cal(i,0) for i in range(1, n+1)]))
Title: Mashmokh and ACM Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mashmokh's boss, Bimokh, didn't like Mashmokh. So he fired him. Mashmokh decided to go to university and participate in ACM instead of finding a new job. He wants to become a member of Bamokh's team. In order to join he was given some programming tasks and one week to solve them. Mashmokh is not a very experienced programmer. Actually he is not a programmer at all. So he wasn't able to solve them. That's why he asked you to help him with these tasks. One of these tasks is the following. A sequence of *l* integers *b*1,<=*b*2,<=...,<=*b**l* (1<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**l*<=≤<=*n*) is called good if each number divides (without a remainder) by the next number in the sequence. More formally for all *i* (1<=≤<=*i*<=≤<=*l*<=-<=1). Given *n* and *k* find the number of good sequences of length *k*. As the answer can be rather large print it modulo 1000000007 (109<=+<=7). Input Specification: The first line of input contains two space-separated integers *n*,<=*k* (1<=≤<=*n*,<=*k*<=≤<=2000). Output Specification: Output a single integer — the number of good sequences of length *k* modulo 1000000007 (109<=+<=7). Demo Input: ['3 2\n', '6 4\n', '2 1\n'] Demo Output: ['5\n', '39\n', '2\n'] Note: In the first sample the good sequences are: [1, 1], [2, 2], [3, 3], [1, 2], [1, 3].
```python #!/usr/bin/env python3 # -*- coding: utf-8 -*- """ Created on Wed Jun 5 19:39:24 2019 @author: adarsh """ dp=[[-1 for i in range(k+1)] for i in range(n+1)] def cal(num, i): global dp, n, k if i>=k: return 0 if num>n: return 0 if i==k-1: return 1 if dp[num][i]==-1: dp[num][i]=sum([cal(j,i+1) for j in range(num,n+1, num)]) return dp[num][i] else: return dp[num][i] n, k=[int(i) for i in input().strip().split(' ')] print(sum([cal(i,0) for i in range(1, n+1)])) ```
-1
841
A
Generous Kefa
PROGRAMMING
900
[ "brute force", "implementation" ]
null
null
One day Kefa found *n* baloons. For convenience, we denote color of *i*-th baloon as *s**i* — lowercase letter of the Latin alphabet. Also Kefa has *k* friends. Friend will be upset, If he get two baloons of the same color. Kefa want to give out all baloons to his friends. Help Kefa to find out, can he give out all his baloons, such that no one of his friens will be upset — print «YES», if he can, and «NO», otherwise. Note, that Kefa's friend will not upset, if he doesn't get baloons at all.
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100) — the number of baloons and friends. Next line contains string *s* — colors of baloons.
Answer to the task — «YES» or «NO» in a single line. You can choose the case (lower or upper) for each letter arbitrary.
[ "4 2\naabb\n", "6 3\naacaab\n" ]
[ "YES\n", "NO\n" ]
In the first sample Kefa can give 1-st and 3-rd baloon to the first friend, and 2-nd and 4-th to the second. In the second sample Kefa needs to give to all his friends baloons of color a, but one baloon will stay, thats why answer is «NO».
500
[ { "input": "4 2\naabb", "output": "YES" }, { "input": "6 3\naacaab", "output": "NO" }, { "input": "2 2\nlu", "output": "YES" }, { "input": "5 3\novvoo", "output": "YES" }, { "input": "36 13\nbzbzcffczzcbcbzzfzbbfzfzzbfbbcbfccbf", "output": "YES" }, { "input": "81 3\nooycgmvvrophvcvpoupepqllqttwcocuilvyxbyumdmmfapvpnxhjhxfuagpnntonibicaqjvwfhwxhbv", "output": "NO" }, { "input": "100 100\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx", "output": "YES" }, { "input": "100 1\nnubcvvjvbjgnjsdkajimdcxvewbcytvfkihunycdrlconddlwgzjasjlsrttlrzsumzpyumpveglfqzmaofbshbojmwuwoxxvrod", "output": "NO" }, { "input": "100 13\nvyldolgryldqrvoldvzvrdrgorlorszddtgqvrlisxxrxdxlqtvtgsrqlzixoyrozxzogqxlsgzdddzqrgitxxritoolzolgrtvl", "output": "YES" }, { "input": "18 6\njzwtnkvmscqhmdlsxy", "output": "YES" }, { "input": "21 2\nfscegcqgzesefghhwcexs", "output": "NO" }, { "input": "32 22\ncduamsptaklqtxlyoutlzepxgyfkvngc", "output": "YES" }, { "input": "49 27\noxyorfnkzwsfllnyvdhdanppuzrnbxehugvmlkgeymqjlmfxd", "output": "YES" }, { "input": "50 24\nxxutzjwbggcwvxztttkmzovtmuwttzcbwoztttohzzxghuuthv", "output": "YES" }, { "input": "57 35\nglxshztrqqfyxthqamagvtmrdparhelnzrqvcwqxjytkbuitovkdxueul", "output": "YES" }, { "input": "75 23\nittttiiuitutuiiuuututiuttiuiuutuuuiuiuuuuttuuttuutuiiuiuiiuiitttuututuiuuii", "output": "NO" }, { "input": "81 66\nfeqevfqfebhvubhuuvfuqheuqhbeeuebehuvhffvbqvqvfbqqvvhevqffbqqhvvqhfeehuhqeqhueuqqq", "output": "YES" }, { "input": "93 42\npqeiafraiavfcteumflpcbpozcomlvpovlzdbldvoopnhdoeqaopzthiuzbzmeieiatthdeqovaqfipqlddllmfcrrnhb", "output": "YES" }, { "input": "100 53\nizszyqyndzwzyzgsdagdwdazadiawizinagqqgczaqqnawgijziziawzszdjdcqjdjqiwgadydcnqisaayjiqqsscwwzjzaycwwc", "output": "YES" }, { "input": "100 14\nvkrdcqbvkwuckpmnbydmczdxoagdsgtqxvhaxntdcxhjcrjyvukhugoglbmyoaqexgtcfdgemmizoniwtmisqqwcwfusmygollab", "output": "YES" }, { "input": "100 42\naaaaaiiiiaiiiaaiaiiaaiiiiiaaaaaiaiiiaiiiiaiiiaaaaaiiiaaaiiaaiiiaiiiaiaaaiaiiiiaaiiiaiiaiaiiaiiiaaaia", "output": "NO" }, { "input": "100 89\ntjbkmydejporbqhcbztkcumxjjgsrvxpuulbhzeeckkbchpbxwhedrlhjsabcexcohgdzouvsgphjdthpuqrlkgzxvqbuhqxdsmf", "output": "YES" }, { "input": "100 100\njhpyiuuzizhubhhpxbbhpyxzhbpjphzppuhiahihiappbhuypyauhizpbibzixjbzxzpbphuiaypyujappuxiyuyaajaxjupbahb", "output": "YES" }, { "input": "100 3\nsszoovvzysavsvzsozzvoozvysozsaszayaszasaysszzzysosyayyvzozovavzoyavsooaoyvoozvvozsaosvayyovazzszzssa", "output": "NO" }, { "input": "100 44\ndluthkxwnorabqsukgnxnvhmsmzilyulpursnxkdsavgemiuizbyzebhyjejgqrvuckhaqtuvdmpziesmpmewpvozdanjyvwcdgo", "output": "YES" }, { "input": "100 90\ntljonbnwnqounictqqctgonktiqoqlocgoblngijqokuquoolciqwnctgoggcbojtwjlculoikbggquqncittwnjbkgkgubnioib", "output": "YES" }, { "input": "100 79\nykxptzgvbqxlregvkvucewtydvnhqhuggdsyqlvcfiuaiddnrrnstityyehiamrggftsqyduwxpuldztyzgmfkehprrneyvtknmf", "output": "YES" }, { "input": "100 79\naagwekyovbviiqeuakbqbqifwavkfkutoriovgfmittulhwojaptacekdirgqoovlleeoqkkdukpadygfwavppohgdrmymmulgci", "output": "YES" }, { "input": "100 93\nearrehrehenaddhdnrdddhdahnadndheeennrearrhraharddreaeraddhehhhrdnredanndneheddrraaneerreedhnadnerhdn", "output": "YES" }, { "input": "100 48\nbmmaebaebmmmbbmxvmammbvvebvaemvbbaxvbvmaxvvmveaxmbbxaaemxmxvxxxvxbmmxaaaevvaxmvamvvmaxaxavexbmmbmmev", "output": "YES" }, { "input": "100 55\nhsavbkehaaesffaeeffakhkhfehbbvbeasahbbbvkesbfvkefeesesevbsvfkbffakvshsbkahfkfakebsvafkbvsskfhfvaasss", "output": "YES" }, { "input": "100 2\ncscffcffsccffsfsfffccssfsscfsfsssffcffsscfccssfffcfscfsscsccccfsssffffcfcfsfffcsfsccffscffcfccccfffs", "output": "NO" }, { "input": "100 3\nzrgznxgdpgfoiifrrrsjfuhvtqxjlgochhyemismjnanfvvpzzvsgajcbsulxyeoepjfwvhkqogiiwqxjkrpsyaqdlwffoockxnc", "output": "NO" }, { "input": "100 5\njbltyyfjakrjeodqepxpkjideulofbhqzxjwlarufwzwsoxhaexpydpqjvhybmvjvntuvhvflokhshpicbnfgsqsmrkrfzcrswwi", "output": "NO" }, { "input": "100 1\nfnslnqktlbmxqpvcvnemxcutebdwepoxikifkzaaixzzydffpdxodmsxjribmxuqhueifdlwzytxkklwhljswqvlejedyrgguvah", "output": "NO" }, { "input": "100 21\nddjenetwgwmdtjbpzssyoqrtirvoygkjlqhhdcjgeurqpunxpupwaepcqkbjjfhnvgpyqnozhhrmhfwararmlcvpgtnopvjqsrka", "output": "YES" }, { "input": "100 100\nnjrhiauqlgkkpkuvciwzivjbbplipvhslqgdkfnmqrxuxnycmpheenmnrglotzuyxycosfediqcuadklsnzjqzfxnbjwvfljnlvq", "output": "YES" }, { "input": "100 100\nbbbbbbbtbbttbtbbbttbttbtbbttttbbbtbttbbbtbttbtbbttttbbbbbtbbttbtbbtbttbbbtbtbtbtbtbtbbbttbbtbtbtbbtb", "output": "YES" }, { "input": "14 5\nfssmmsfffmfmmm", "output": "NO" }, { "input": "2 1\nff", "output": "NO" }, { "input": "2 1\nhw", "output": "YES" }, { "input": "2 2\nss", "output": "YES" }, { "input": "1 1\nl", "output": "YES" }, { "input": "100 50\nfffffttttttjjjuuuvvvvvdddxxxxwwwwgggbsssncccczzyyyyyhhhhhkrreeeeeeaaaaaiiillllllllooooqqqqqqmmpppppp", "output": "YES" }, { "input": "100 50\nbbbbbbbbgggggggggggaaaaaaaahhhhhhhhhhpppppppppsssssssrrrrrrrrllzzzzzzzeeeeeeekkkkkkkwwwwwwwwjjjjjjjj", "output": "YES" }, { "input": "100 50\nwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxxxxzzzzzzzzzzzzzzzzzzbbbbbbbbbbbbbbbbbbbbjjjjjjjjjjjjjjjjjjjjjjjj", "output": "YES" }, { "input": "100 80\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm", "output": "YES" }, { "input": "100 10\nbbttthhhhiiiiiiijjjjjvvvvpppssssseeeeeeewwwwgggkkkkkkkkmmmddddduuuzzzzllllnnnnnxxyyyffffccraaaaooooq", "output": "YES" }, { "input": "100 20\nssssssssssbbbbbbbhhhhhhhyyyyyyyzzzzzzzzzzzzcccccxxxxxxxxxxddddmmmmmmmeeeeeeejjjjjjjjjwwwwwwwtttttttt", "output": "YES" }, { "input": "1 2\na", "output": "YES" }, { "input": "3 1\nabb", "output": "NO" }, { "input": "2 1\naa", "output": "NO" }, { "input": "2 1\nab", "output": "YES" }, { "input": "6 2\naaaaaa", "output": "NO" }, { "input": "8 4\naaaaaaaa", "output": "NO" }, { "input": "4 2\naaaa", "output": "NO" }, { "input": "4 3\naaaa", "output": "NO" }, { "input": "1 3\na", "output": "YES" }, { "input": "4 3\nzzzz", "output": "NO" }, { "input": "4 1\naaaa", "output": "NO" }, { "input": "3 4\nabc", "output": "YES" }, { "input": "2 5\nab", "output": "YES" }, { "input": "2 4\nab", "output": "YES" }, { "input": "1 10\na", "output": "YES" }, { "input": "5 2\nzzzzz", "output": "NO" }, { "input": "53 26\naaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbb", "output": "NO" }, { "input": "4 1\nabab", "output": "NO" }, { "input": "4 1\nabcb", "output": "NO" }, { "input": "4 2\nabbb", "output": "NO" }, { "input": "5 2\nabccc", "output": "NO" }, { "input": "2 3\nab", "output": "YES" }, { "input": "4 3\nbbbs", "output": "YES" }, { "input": "10 2\nazzzzzzzzz", "output": "NO" }, { "input": "1 2\nb", "output": "YES" }, { "input": "1 3\nb", "output": "YES" }, { "input": "4 5\nabcd", "output": "YES" }, { "input": "4 6\naabb", "output": "YES" }, { "input": "5 2\naaaab", "output": "NO" }, { "input": "3 5\naaa", "output": "YES" }, { "input": "5 3\nazzzz", "output": "NO" }, { "input": "4 100\naabb", "output": "YES" }, { "input": "3 10\naaa", "output": "YES" }, { "input": "3 4\naaa", "output": "YES" }, { "input": "12 5\naaaaabbbbbbb", "output": "NO" }, { "input": "5 2\naabbb", "output": "NO" }, { "input": "10 5\nzzzzzzzzzz", "output": "NO" }, { "input": "2 4\naa", "output": "YES" }, { "input": "1 5\na", "output": "YES" }, { "input": "10 5\naaaaaaaaaa", "output": "NO" }, { "input": "6 3\naaaaaa", "output": "NO" }, { "input": "7 1\nabcdeee", "output": "NO" }, { "input": "18 3\naaaaaabbbbbbcccccc", "output": "NO" }, { "input": "8 2\naabbccdd", "output": "YES" }, { "input": "4 2\nzzzz", "output": "NO" }, { "input": "4 2\nabaa", "output": "NO" }, { "input": "3 2\naaa", "output": "NO" }, { "input": "3 1\nzzz", "output": "NO" }, { "input": "5 4\nzzzzz", "output": "NO" }, { "input": "6 2\naabbbc", "output": "NO" }, { "input": "3 6\naaa", "output": "YES" }, { "input": "2 1\nzz", "output": "NO" }, { "input": "10 3\naaaeeeeeee", "output": "NO" }, { "input": "4 5\naabb", "output": "YES" }, { "input": "3 1\naaa", "output": "NO" }, { "input": "5 2\naazzz", "output": "NO" }, { "input": "6 2\nabbbbc", "output": "NO" }, { "input": "4 2\nxxxx", "output": "NO" }, { "input": "6 3\nzzzzzz", "output": "NO" }, { "input": "3 2\nabb", "output": "YES" }, { "input": "3 2\nzzz", "output": "NO" }, { "input": "6 5\nzzzzzz", "output": "NO" }, { "input": "6 3\nbcaaaa", "output": "NO" }, { "input": "100 100\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "YES" }, { "input": "3 6\nabc", "output": "YES" } ]
1,529,411,747
2,147,483,647
Python 3
OK
TESTS
114
124
102,400
n, k = map(int, input().split()) from collections import Counter s = Counter(list(input())) for i in s: if s[i]/k > 1: print('NO') exit() print ('YES')
Title: Generous Kefa Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Kefa found *n* baloons. For convenience, we denote color of *i*-th baloon as *s**i* — lowercase letter of the Latin alphabet. Also Kefa has *k* friends. Friend will be upset, If he get two baloons of the same color. Kefa want to give out all baloons to his friends. Help Kefa to find out, can he give out all his baloons, such that no one of his friens will be upset — print «YES», if he can, and «NO», otherwise. Note, that Kefa's friend will not upset, if he doesn't get baloons at all. Input Specification: The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100) — the number of baloons and friends. Next line contains string *s* — colors of baloons. Output Specification: Answer to the task — «YES» or «NO» in a single line. You can choose the case (lower or upper) for each letter arbitrary. Demo Input: ['4 2\naabb\n', '6 3\naacaab\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample Kefa can give 1-st and 3-rd baloon to the first friend, and 2-nd and 4-th to the second. In the second sample Kefa needs to give to all his friends baloons of color a, but one baloon will stay, thats why answer is «NO».
```python n, k = map(int, input().split()) from collections import Counter s = Counter(list(input())) for i in s: if s[i]/k > 1: print('NO') exit() print ('YES') ```
3
633
E
Startup Funding
PROGRAMMING
2,400
[ "binary search", "constructive algorithms", "data structures", "probabilities", "two pointers" ]
null
null
An e-commerce startup pitches to the investors to get funding. They have been functional for *n* weeks now and also have a website! For each week they know the number of unique visitors during this week *v**i* and the revenue *c**i*. To evaluate the potential of the startup at some range of weeks from *l* to *r* inclusive investors use the minimum among the maximum number of visitors multiplied by 100 and the minimum revenue during this period, that is: The truth is that investors have no idea how to efficiently evaluate the startup, so they are going to pick some *k* random distinct weeks *l**i* and give them to managers of the startup. For each *l**i* they should pick some *r**i*<=≥<=*l**i* and report maximum number of visitors and minimum revenue during this period. Then, investors will calculate the potential of the startup for each of these ranges and take minimum value of *p*(*l**i*,<=*r**i*) as the total evaluation grade of the startup. Assuming that managers of the startup always report the optimal values of *r**i* for some particular *l**i*, i.e., the value such that the resulting grade of the startup is maximized, what is the expected resulting grade of the startup?
The first line of the input contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1<=000<=000). The second line contains *n* integers *v**i* (1<=≤<=*v**i*<=≤<=107) — the number of unique visitors during each week. The third line contains *n* integers *c**i* (1<=≤<=*c**i*<=≤<=107) —the revenue for each week.
Print a single real value — the expected grade of the startup. Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6. Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
[ "3 2\n3 2 1\n300 200 300\n" ]
[ "133.3333333\n" ]
Consider the first sample. If the investors ask for *l*<sub class="lower-index">*i*</sub> = 1 onwards, startup will choose *r*<sub class="lower-index">*i*</sub> = 1, such that max number of visitors is 3 and minimum revenue is 300. Thus, potential in this case is *min*(3·100, 300) = 300. If the investors ask for *l*<sub class="lower-index">*i*</sub> = 2 onwards, startup will choose *r*<sub class="lower-index">*i*</sub> = 3, such that max number of visitors is 2 and minimum revenue is 200. Thus, potential in this case is *min*(2·100, 200) = 200. If the investors ask for *l*<sub class="lower-index">*i*</sub> = 3 onwards, startup will choose *r*<sub class="lower-index">*i*</sub> = 3, such that max number of visitors is 1 and minimum revenue is 300. Thus, potential in this case is *min*(1·100, 300) = 100. We have to choose a set of size 2 equi-probably and take minimum of each. The possible sets here are : {200, 300},{100, 300},{100, 200}, effectively the set of possible values as perceived by investors equi-probably: {200, 100, 100}. Thus, the expected value is (100 + 200 + 100) / 3 = 133.(3).
2,500
[]
1,456,515,881
8,981
Python 3
MEMORY_LIMIT_EXCEEDED
PRETESTS
0
451
268,390,400
v=[] a=[] b=[]; btmi=[] btma=[]; fac=[] fac.append(1) fac.append(1) for i in range(2,1000005): fac.append(fac[i-1]*i) def ch(a,b): if a<0 or b<0 or b>a: return 0 return (fac[a]//(fac[a-b]*fac[b])) def build(p, l, r): if l==r: btmi[p]=l btma[p]=a[l] return 0 mid=(l+r)/2 build(p*2,l,mid) build(p*2+1,mid+1,r) if b[btmi[p*2]]<b[btmi[p*2+1]]: btmi[p]=btmi[p*2] elif b[btmi[p*2]]>b[btmi[p*2+1]]: btmi[p]=btmi[p*2+1] else: btmi[p]=min(btmi[p*2],btmi[p*2+1]) btma[p]=max(btma[p*2],btma[p*2+1]); def query1(p,l,r,ql,qr): if ql>r or qr<l: return 0; if ql<=l and qr>=r: return btma[p] return max(query1(p*2,l,(l+r)/2,ql,qr),query1(p*2+1,(l+r)/2+1,r,ql,qr)); def query2(p,l,r,ql,qr): if ql>r or qr<l: return 1000005 if ql<=l and qr>=r: return btma[p] le=query2(p*2,l,(l+r)/2,ql,qr) re=query2(p*2+1,(l+r)/2+1,r,ql,qr) if b[le]<b[re]: return le elif b[re]<b[le]: return re return min(le,re) def main(): n,k=input().split() n=int(n) k=int(k) for i in range(10000007): btma.append(0) btmi.append(0) b[1000005]=10000000000000000000000 a=list(map(int,input().split())) b=list(map(int,input().split())) for i in range(n): aa=min(100*a[i],b[i]) #//cout << aa << endl; xx=query2(1,0,n-1,i,n-1); aa=min(aa,b[xx]); #//cout << aa << endl; v.append(aa) v.sort() ans=0 co=0 for i in range(n): ans=ans+v[i]*max(0,ch(n-i-1-k,k-1)) co=co+max(0,ch(n-i-1-k,k-1)) print(ans/co) main()
Title: Startup Funding Time Limit: None seconds Memory Limit: None megabytes Problem Description: An e-commerce startup pitches to the investors to get funding. They have been functional for *n* weeks now and also have a website! For each week they know the number of unique visitors during this week *v**i* and the revenue *c**i*. To evaluate the potential of the startup at some range of weeks from *l* to *r* inclusive investors use the minimum among the maximum number of visitors multiplied by 100 and the minimum revenue during this period, that is: The truth is that investors have no idea how to efficiently evaluate the startup, so they are going to pick some *k* random distinct weeks *l**i* and give them to managers of the startup. For each *l**i* they should pick some *r**i*<=≥<=*l**i* and report maximum number of visitors and minimum revenue during this period. Then, investors will calculate the potential of the startup for each of these ranges and take minimum value of *p*(*l**i*,<=*r**i*) as the total evaluation grade of the startup. Assuming that managers of the startup always report the optimal values of *r**i* for some particular *l**i*, i.e., the value such that the resulting grade of the startup is maximized, what is the expected resulting grade of the startup? Input Specification: The first line of the input contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1<=000<=000). The second line contains *n* integers *v**i* (1<=≤<=*v**i*<=≤<=107) — the number of unique visitors during each week. The third line contains *n* integers *c**i* (1<=≤<=*c**i*<=≤<=107) —the revenue for each week. Output Specification: Print a single real value — the expected grade of the startup. Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6. Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if . Demo Input: ['3 2\n3 2 1\n300 200 300\n'] Demo Output: ['133.3333333\n'] Note: Consider the first sample. If the investors ask for *l*<sub class="lower-index">*i*</sub> = 1 onwards, startup will choose *r*<sub class="lower-index">*i*</sub> = 1, such that max number of visitors is 3 and minimum revenue is 300. Thus, potential in this case is *min*(3·100, 300) = 300. If the investors ask for *l*<sub class="lower-index">*i*</sub> = 2 onwards, startup will choose *r*<sub class="lower-index">*i*</sub> = 3, such that max number of visitors is 2 and minimum revenue is 200. Thus, potential in this case is *min*(2·100, 200) = 200. If the investors ask for *l*<sub class="lower-index">*i*</sub> = 3 onwards, startup will choose *r*<sub class="lower-index">*i*</sub> = 3, such that max number of visitors is 1 and minimum revenue is 300. Thus, potential in this case is *min*(1·100, 300) = 100. We have to choose a set of size 2 equi-probably and take minimum of each. The possible sets here are : {200, 300},{100, 300},{100, 200}, effectively the set of possible values as perceived by investors equi-probably: {200, 100, 100}. Thus, the expected value is (100 + 200 + 100) / 3 = 133.(3).
```python v=[] a=[] b=[]; btmi=[] btma=[]; fac=[] fac.append(1) fac.append(1) for i in range(2,1000005): fac.append(fac[i-1]*i) def ch(a,b): if a<0 or b<0 or b>a: return 0 return (fac[a]//(fac[a-b]*fac[b])) def build(p, l, r): if l==r: btmi[p]=l btma[p]=a[l] return 0 mid=(l+r)/2 build(p*2,l,mid) build(p*2+1,mid+1,r) if b[btmi[p*2]]<b[btmi[p*2+1]]: btmi[p]=btmi[p*2] elif b[btmi[p*2]]>b[btmi[p*2+1]]: btmi[p]=btmi[p*2+1] else: btmi[p]=min(btmi[p*2],btmi[p*2+1]) btma[p]=max(btma[p*2],btma[p*2+1]); def query1(p,l,r,ql,qr): if ql>r or qr<l: return 0; if ql<=l and qr>=r: return btma[p] return max(query1(p*2,l,(l+r)/2,ql,qr),query1(p*2+1,(l+r)/2+1,r,ql,qr)); def query2(p,l,r,ql,qr): if ql>r or qr<l: return 1000005 if ql<=l and qr>=r: return btma[p] le=query2(p*2,l,(l+r)/2,ql,qr) re=query2(p*2+1,(l+r)/2+1,r,ql,qr) if b[le]<b[re]: return le elif b[re]<b[le]: return re return min(le,re) def main(): n,k=input().split() n=int(n) k=int(k) for i in range(10000007): btma.append(0) btmi.append(0) b[1000005]=10000000000000000000000 a=list(map(int,input().split())) b=list(map(int,input().split())) for i in range(n): aa=min(100*a[i],b[i]) #//cout << aa << endl; xx=query2(1,0,n-1,i,n-1); aa=min(aa,b[xx]); #//cout << aa << endl; v.append(aa) v.sort() ans=0 co=0 for i in range(n): ans=ans+v[i]*max(0,ch(n-i-1-k,k-1)) co=co+max(0,ch(n-i-1-k,k-1)) print(ans/co) main() ```
0
439
A
Devu, the Singer and Churu, the Joker
PROGRAMMING
900
[ "greedy", "implementation" ]
null
null
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited. Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly. The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly. People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest. You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions: - The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible. If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100).
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
[ "3 30\n2 2 1\n", "3 20\n2 1 1\n" ]
[ "5\n", "-1\n" ]
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way: - First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes. Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes. Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
500
[ { "input": "3 30\n2 2 1", "output": "5" }, { "input": "3 20\n2 1 1", "output": "-1" }, { "input": "50 10000\n5 4 10 9 9 6 7 7 7 3 3 7 7 4 7 4 10 10 1 7 10 3 1 4 5 7 2 10 10 10 2 3 4 7 6 1 8 4 7 3 8 8 4 10 1 1 9 2 6 1", "output": "1943" }, { "input": "50 10000\n4 7 15 9 11 12 20 9 14 14 10 13 6 13 14 17 6 8 20 12 10 15 13 17 5 12 13 11 7 5 5 2 3 15 13 7 14 14 19 2 13 14 5 15 3 19 15 16 4 1", "output": "1891" }, { "input": "100 9000\n5 2 3 1 1 3 4 9 9 6 7 10 10 10 2 10 6 8 8 6 7 9 9 5 6 2 1 10 10 9 4 5 9 2 4 3 8 5 6 1 1 5 3 6 2 6 6 6 5 8 3 6 7 3 1 10 9 1 8 3 10 9 5 6 3 4 1 1 10 10 2 3 4 8 10 10 5 1 5 3 6 8 10 6 10 2 1 8 10 1 7 6 9 10 5 2 3 5 3 2", "output": "1688" }, { "input": "100 8007\n5 19 14 18 9 6 15 8 1 14 11 20 3 17 7 12 2 6 3 17 7 20 1 14 20 17 2 10 13 7 18 18 9 10 16 8 1 11 11 9 13 18 9 20 12 12 7 15 12 17 11 5 11 15 9 2 15 1 18 3 18 16 15 4 10 5 18 13 13 12 3 8 17 2 12 2 13 3 1 13 2 4 9 10 18 10 14 4 4 17 12 19 2 9 6 5 5 20 18 12", "output": "1391" }, { "input": "39 2412\n1 1 1 1 1 1 26 1 1 1 99 1 1 1 1 1 1 1 1 1 1 88 7 1 1 1 1 76 1 1 1 93 40 1 13 1 68 1 32", "output": "368" }, { "input": "39 2617\n47 1 1 1 63 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 70 1 99 63 1 1 1 1 1 1 1 1 64 1 1", "output": "435" }, { "input": "39 3681\n83 77 1 94 85 47 1 98 29 16 1 1 1 71 96 85 31 97 96 93 40 50 98 1 60 51 1 96 100 72 1 1 1 89 1 93 1 92 100", "output": "326" }, { "input": "45 894\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 28 1 1 1 1 1 1 1 1 1 1 1 1 1 1 99 3 1 1", "output": "139" }, { "input": "45 4534\n1 99 65 99 4 46 54 80 51 30 96 1 28 30 44 70 78 1 1 100 1 62 1 1 1 85 1 1 1 61 1 46 75 1 61 77 97 26 67 1 1 63 81 85 86", "output": "514" }, { "input": "72 3538\n52 1 8 1 1 1 7 1 1 1 1 48 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 40 1 1 38 1 1 1 1 1 1 1 1 1 1 1 35 1 93 79 1 1 1 1 1 1 1 1 1 51 1 1 1 1 1 1 1 1 1 1 1 1 96 1", "output": "586" }, { "input": "81 2200\n1 59 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 93 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 50 1 1 1 1 1 1 1 1 1 1 1", "output": "384" }, { "input": "81 2577\n85 91 1 1 2 1 1 100 1 80 1 1 17 86 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 37 1 66 24 1 1 96 49 1 66 1 44 1 1 1 1 98 1 1 1 1 35 1 37 3 35 1 1 87 64 1 24 1 58 1 1 42 83 5 1 1 1 1 1 95 1 94 1 50 1 1", "output": "174" }, { "input": "81 4131\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 16 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "807" }, { "input": "81 6315\n1 1 67 100 1 99 36 1 92 5 1 96 42 12 1 57 91 1 1 66 41 30 74 95 1 37 1 39 91 69 1 52 77 47 65 1 1 93 96 74 90 35 85 76 71 92 92 1 1 67 92 74 1 1 86 76 35 1 56 16 27 57 37 95 1 40 20 100 51 1 80 60 45 79 95 1 46 1 25 100 96", "output": "490" }, { "input": "96 1688\n1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 25 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 71 1 1 1 30 1 1 1", "output": "284" }, { "input": "96 8889\n1 1 18 1 1 1 1 1 1 1 1 1 99 1 1 1 1 88 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 96 1 1 1 1 21 1 1 1 1 1 1 1 73 1 1 1 1 1 10 1 1 1 1 1 1 1 46 43 1 1 1 1 1 98 1 1 1 1 1 1 6 1 1 1 1 1 74 1 25 1 55 1 1 1 13 1 1 54 1 1 1", "output": "1589" }, { "input": "10 100\n1 1 1 1 1 1 1 1 1 1", "output": "18" }, { "input": "100 10000\n54 46 72 94 79 83 91 54 73 3 24 55 54 31 28 20 19 6 25 19 47 23 1 70 15 87 51 39 54 77 55 5 60 3 15 99 56 88 22 78 79 21 38 27 28 86 7 88 12 59 55 70 25 1 70 49 1 45 69 72 50 17 4 56 8 100 90 34 35 20 61 76 88 79 4 74 65 68 75 26 40 72 59 94 10 67 96 85 29 90 47 24 44 1 66 93 55 36 1 99", "output": "1017" }, { "input": "100 6000\n41 31 23 17 24 78 26 96 93 48 46 2 49 33 35 9 73 100 34 48 83 36 33 69 43 24 3 74 8 81 27 33 94 38 77 9 76 90 62 90 21 67 22 22 12 2 17 27 61 18 72 85 59 65 71 38 90 75 74 66 60 47 58 50 90 95 75 10 5 100 97 29 83 88 65 26 93 90 22 98 36 55 70 38 50 92 88 72 99 96 25 14 74 16 25 92 67 94 77 96", "output": "-1" }, { "input": "1 1\n1", "output": "0" }, { "input": "1 6\n1", "output": "1" }, { "input": "1 5\n1", "output": "0" }, { "input": "1 3\n4", "output": "-1" }, { "input": "3 24\n2 1 2", "output": "-1" } ]
1,654,101,375
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
2
62
0
a, b = map(int, input().split()) myList = list(map(int, input().split())) ans, jokes_co = 0, 0 for i in myList: ans += i + 10 jokes_co += 2 jokes_co -= 2 ans -= 10 if ans < b: print(jokes_co + (b - jokes_co) % 5) elif ans == b: print(jokes_co) else: print(-1)
Title: Devu, the Singer and Churu, the Joker Time Limit: None seconds Memory Limit: None megabytes Problem Description: Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited. Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly. The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly. People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest. You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions: - The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible. If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event. Input Specification: The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100). Output Specification: If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event. Demo Input: ['3 30\n2 2 1\n', '3 20\n2 1 1\n'] Demo Output: ['5\n', '-1\n'] Note: Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way: - First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes. Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes. Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
```python a, b = map(int, input().split()) myList = list(map(int, input().split())) ans, jokes_co = 0, 0 for i in myList: ans += i + 10 jokes_co += 2 jokes_co -= 2 ans -= 10 if ans < b: print(jokes_co + (b - jokes_co) % 5) elif ans == b: print(jokes_co) else: print(-1) ```
0
136
A
Presents
PROGRAMMING
800
[ "implementation" ]
null
null
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there. If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift. Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
[ "4\n2 3 4 1\n", "3\n1 3 2\n", "2\n1 2\n" ]
[ "4 1 2 3\n", "1 3 2\n", "1 2\n" ]
none
500
[ { "input": "4\n2 3 4 1", "output": "4 1 2 3" }, { "input": "3\n1 3 2", "output": "1 3 2" }, { "input": "2\n1 2", "output": "1 2" }, { "input": "1\n1", "output": "1" }, { "input": "10\n1 3 2 6 4 5 7 9 8 10", "output": "1 3 2 5 6 4 7 9 8 10" }, { "input": "5\n5 4 3 2 1", "output": "5 4 3 2 1" }, { "input": "20\n2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19" }, { "input": "21\n3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19", "output": "3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19" }, { "input": "10\n3 4 5 6 7 8 9 10 1 2", "output": "9 10 1 2 3 4 5 6 7 8" }, { "input": "8\n1 5 3 7 2 6 4 8", "output": "1 5 3 7 2 6 4 8" }, { "input": "50\n49 22 4 2 20 46 7 32 5 19 48 24 26 15 45 21 44 11 50 43 39 17 31 1 42 34 3 27 36 25 12 30 13 33 28 35 18 6 8 37 38 14 10 9 29 16 40 23 41 47", "output": "24 4 27 3 9 38 7 39 44 43 18 31 33 42 14 46 22 37 10 5 16 2 48 12 30 13 28 35 45 32 23 8 34 26 36 29 40 41 21 47 49 25 20 17 15 6 50 11 1 19" }, { "input": "34\n13 20 33 30 15 11 27 4 8 2 29 25 24 7 3 22 18 10 26 16 5 1 32 9 34 6 12 14 28 19 31 21 23 17", "output": "22 10 15 8 21 26 14 9 24 18 6 27 1 28 5 20 34 17 30 2 32 16 33 13 12 19 7 29 11 4 31 23 3 25" }, { "input": "92\n23 1 6 4 84 54 44 76 63 34 61 20 48 13 28 78 26 46 90 72 24 55 91 89 53 38 82 5 79 92 29 32 15 64 11 88 60 70 7 66 18 59 8 57 19 16 42 21 80 71 62 27 75 86 36 9 83 73 74 50 43 31 56 30 17 33 40 81 49 12 10 41 22 77 25 68 51 2 47 3 58 69 87 67 39 37 35 65 14 45 52 85", "output": "2 78 80 4 28 3 39 43 56 71 35 70 14 89 33 46 65 41 45 12 48 73 1 21 75 17 52 15 31 64 62 32 66 10 87 55 86 26 85 67 72 47 61 7 90 18 79 13 69 60 77 91 25 6 22 63 44 81 42 37 11 51 9 34 88 40 84 76 82 38 50 20 58 59 53 8 74 16 29 49 68 27 57 5 92 54 83 36 24 19 23 30" }, { "input": "49\n30 24 33 48 7 3 17 2 8 35 10 39 23 40 46 32 18 21 26 22 1 16 47 45 41 28 31 6 12 43 27 11 13 37 19 15 44 5 29 42 4 38 20 34 14 9 25 36 49", "output": "21 8 6 41 38 28 5 9 46 11 32 29 33 45 36 22 7 17 35 43 18 20 13 2 47 19 31 26 39 1 27 16 3 44 10 48 34 42 12 14 25 40 30 37 24 15 23 4 49" }, { "input": "12\n3 8 7 4 6 5 2 1 11 9 10 12", "output": "8 7 1 4 6 5 3 2 10 11 9 12" }, { "input": "78\n16 56 36 78 21 14 9 77 26 57 70 61 41 47 18 44 5 31 50 74 65 52 6 39 22 62 67 69 43 7 64 29 24 40 48 51 73 54 72 12 19 34 4 25 55 33 17 35 23 53 10 8 27 32 42 68 20 63 3 2 1 71 58 46 13 30 49 11 37 66 38 60 28 75 15 59 45 76", "output": "61 60 59 43 17 23 30 52 7 51 68 40 65 6 75 1 47 15 41 57 5 25 49 33 44 9 53 73 32 66 18 54 46 42 48 3 69 71 24 34 13 55 29 16 77 64 14 35 67 19 36 22 50 38 45 2 10 63 76 72 12 26 58 31 21 70 27 56 28 11 62 39 37 20 74 78 8 4" }, { "input": "64\n64 57 40 3 15 8 62 18 33 59 51 19 22 13 4 37 47 45 50 35 63 11 58 42 46 21 7 2 41 48 32 23 28 38 17 12 24 27 49 31 60 6 30 25 61 52 26 54 9 14 29 20 44 39 55 10 34 16 5 56 1 36 53 43", "output": "61 28 4 15 59 42 27 6 49 56 22 36 14 50 5 58 35 8 12 52 26 13 32 37 44 47 38 33 51 43 40 31 9 57 20 62 16 34 54 3 29 24 64 53 18 25 17 30 39 19 11 46 63 48 55 60 2 23 10 41 45 7 21 1" }, { "input": "49\n38 20 49 32 14 41 39 45 25 48 40 19 26 43 34 12 10 3 35 42 5 7 46 47 4 2 13 22 16 24 33 15 11 18 29 31 23 9 44 36 6 17 37 1 30 28 8 21 27", "output": "44 26 18 25 21 41 22 47 38 17 33 16 27 5 32 29 42 34 12 2 48 28 37 30 9 13 49 46 35 45 36 4 31 15 19 40 43 1 7 11 6 20 14 39 8 23 24 10 3" }, { "input": "78\n17 50 30 48 33 12 42 4 18 53 76 67 38 3 20 72 51 55 60 63 46 10 57 45 54 32 24 62 8 11 35 44 65 74 58 28 2 6 56 52 39 23 47 49 61 1 66 41 15 77 7 27 78 13 14 34 5 31 37 21 40 16 29 69 59 43 64 36 70 19 25 73 71 75 9 68 26 22", "output": "46 37 14 8 57 38 51 29 75 22 30 6 54 55 49 62 1 9 70 15 60 78 42 27 71 77 52 36 63 3 58 26 5 56 31 68 59 13 41 61 48 7 66 32 24 21 43 4 44 2 17 40 10 25 18 39 23 35 65 19 45 28 20 67 33 47 12 76 64 69 73 16 72 34 74 11 50 53" }, { "input": "29\n14 21 27 1 4 18 10 17 20 23 2 24 7 9 28 22 8 25 12 15 11 6 16 29 3 26 19 5 13", "output": "4 11 25 5 28 22 13 17 14 7 21 19 29 1 20 23 8 6 27 9 2 16 10 12 18 26 3 15 24" }, { "input": "82\n6 1 10 75 28 66 61 81 78 63 17 19 58 34 49 12 67 50 41 44 3 15 59 38 51 72 36 11 46 29 18 64 27 23 13 53 56 68 2 25 47 40 69 54 42 5 60 55 4 16 24 79 57 20 7 73 32 80 76 52 82 37 26 31 65 8 39 62 33 71 30 9 77 43 48 74 70 22 14 45 35 21", "output": "2 39 21 49 46 1 55 66 72 3 28 16 35 79 22 50 11 31 12 54 82 78 34 51 40 63 33 5 30 71 64 57 69 14 81 27 62 24 67 42 19 45 74 20 80 29 41 75 15 18 25 60 36 44 48 37 53 13 23 47 7 68 10 32 65 6 17 38 43 77 70 26 56 76 4 59 73 9 52 58 8 61" }, { "input": "82\n74 18 15 69 71 77 19 26 80 20 66 7 30 82 22 48 21 44 52 65 64 61 35 49 12 8 53 81 54 16 11 9 40 46 13 1 29 58 5 41 55 4 78 60 6 51 56 2 38 36 34 62 63 25 17 67 45 14 32 37 75 79 10 47 27 39 31 68 59 24 50 43 72 70 42 28 76 23 57 3 73 33", "output": "36 48 80 42 39 45 12 26 32 63 31 25 35 58 3 30 55 2 7 10 17 15 78 70 54 8 65 76 37 13 67 59 82 51 23 50 60 49 66 33 40 75 72 18 57 34 64 16 24 71 46 19 27 29 41 47 79 38 69 44 22 52 53 21 20 11 56 68 4 74 5 73 81 1 61 77 6 43 62 9 28 14" }, { "input": "45\n2 32 34 13 3 15 16 33 22 12 31 38 42 14 27 7 36 8 4 19 45 41 5 35 10 11 39 20 29 44 17 9 6 40 37 28 25 21 1 30 24 18 43 26 23", "output": "39 1 5 19 23 33 16 18 32 25 26 10 4 14 6 7 31 42 20 28 38 9 45 41 37 44 15 36 29 40 11 2 8 3 24 17 35 12 27 34 22 13 43 30 21" }, { "input": "45\n4 32 33 39 43 21 22 35 45 7 14 5 16 9 42 31 24 36 17 29 41 25 37 34 27 20 11 44 3 13 19 2 1 10 26 30 38 18 6 8 15 23 40 28 12", "output": "33 32 29 1 12 39 10 40 14 34 27 45 30 11 41 13 19 38 31 26 6 7 42 17 22 35 25 44 20 36 16 2 3 24 8 18 23 37 4 43 21 15 5 28 9" }, { "input": "74\n48 72 40 67 17 4 27 53 11 32 25 9 74 2 41 24 56 22 14 21 33 5 18 55 20 7 29 36 69 13 52 19 38 30 68 59 66 34 63 6 47 45 54 44 62 12 50 71 16 10 8 64 57 73 46 26 49 42 3 23 35 1 61 39 70 60 65 43 15 28 37 51 58 31", "output": "62 14 59 6 22 40 26 51 12 50 9 46 30 19 69 49 5 23 32 25 20 18 60 16 11 56 7 70 27 34 74 10 21 38 61 28 71 33 64 3 15 58 68 44 42 55 41 1 57 47 72 31 8 43 24 17 53 73 36 66 63 45 39 52 67 37 4 35 29 65 48 2 54 13" }, { "input": "47\n9 26 27 10 6 34 28 42 39 22 45 21 11 43 14 47 38 15 40 32 46 1 36 29 17 25 2 23 31 5 24 4 7 8 12 19 16 44 37 20 18 33 30 13 35 41 3", "output": "22 27 47 32 30 5 33 34 1 4 13 35 44 15 18 37 25 41 36 40 12 10 28 31 26 2 3 7 24 43 29 20 42 6 45 23 39 17 9 19 46 8 14 38 11 21 16" }, { "input": "49\n14 38 6 29 9 49 36 43 47 3 44 20 34 15 7 11 1 28 12 40 16 37 31 10 42 41 33 21 18 30 5 27 17 35 25 26 45 19 2 13 23 32 4 22 46 48 24 39 8", "output": "17 39 10 43 31 3 15 49 5 24 16 19 40 1 14 21 33 29 38 12 28 44 41 47 35 36 32 18 4 30 23 42 27 13 34 7 22 2 48 20 26 25 8 11 37 45 9 46 6" }, { "input": "100\n78 56 31 91 90 95 16 65 58 77 37 89 33 61 10 76 62 47 35 67 69 7 63 83 22 25 49 8 12 30 39 44 57 64 48 42 32 11 70 43 55 50 99 24 85 73 45 14 54 21 98 84 74 2 26 18 9 36 80 53 75 46 66 86 59 93 87 68 94 13 72 28 79 88 92 29 52 82 34 97 19 38 1 41 27 4 40 5 96 100 51 6 20 23 81 15 17 3 60 71", "output": "83 54 98 86 88 92 22 28 57 15 38 29 70 48 96 7 97 56 81 93 50 25 94 44 26 55 85 72 76 30 3 37 13 79 19 58 11 82 31 87 84 36 40 32 47 62 18 35 27 42 91 77 60 49 41 2 33 9 65 99 14 17 23 34 8 63 20 68 21 39 100 71 46 53 61 16 10 1 73 59 95 78 24 52 45 64 67 74 12 5 4 75 66 69 6 89 80 51 43 90" }, { "input": "22\n12 8 11 2 16 7 13 6 22 21 20 10 4 14 18 1 5 15 3 19 17 9", "output": "16 4 19 13 17 8 6 2 22 12 3 1 7 14 18 5 21 15 20 11 10 9" }, { "input": "72\n16 11 49 51 3 27 60 55 23 40 66 7 53 70 13 5 15 32 18 72 33 30 8 31 46 12 28 67 25 38 50 22 69 34 71 52 58 39 24 35 42 9 41 26 62 1 63 65 36 64 68 61 37 14 45 47 6 57 54 20 17 2 56 59 29 10 4 48 21 43 19 44", "output": "46 62 5 67 16 57 12 23 42 66 2 26 15 54 17 1 61 19 71 60 69 32 9 39 29 44 6 27 65 22 24 18 21 34 40 49 53 30 38 10 43 41 70 72 55 25 56 68 3 31 4 36 13 59 8 63 58 37 64 7 52 45 47 50 48 11 28 51 33 14 35 20" }, { "input": "63\n21 56 11 10 62 24 20 42 28 52 38 2 37 43 48 22 7 8 40 14 13 46 53 1 23 4 60 63 51 36 25 12 39 32 49 16 58 44 31 61 33 50 55 54 45 6 47 41 9 57 30 29 26 18 19 27 15 34 3 35 59 5 17", "output": "24 12 59 26 62 46 17 18 49 4 3 32 21 20 57 36 63 54 55 7 1 16 25 6 31 53 56 9 52 51 39 34 41 58 60 30 13 11 33 19 48 8 14 38 45 22 47 15 35 42 29 10 23 44 43 2 50 37 61 27 40 5 28" }, { "input": "18\n2 16 8 4 18 12 3 6 5 9 10 15 11 17 14 13 1 7", "output": "17 1 7 4 9 8 18 3 10 11 13 6 16 15 12 2 14 5" }, { "input": "47\n6 9 10 41 25 3 4 37 20 1 36 22 29 27 11 24 43 31 12 17 34 42 38 39 13 2 7 21 18 5 15 35 44 26 33 46 19 40 30 14 28 23 47 32 45 8 16", "output": "10 26 6 7 30 1 27 46 2 3 15 19 25 40 31 47 20 29 37 9 28 12 42 16 5 34 14 41 13 39 18 44 35 21 32 11 8 23 24 38 4 22 17 33 45 36 43" }, { "input": "96\n41 91 48 88 29 57 1 19 44 43 37 5 10 75 25 63 30 78 76 53 8 92 18 70 39 17 49 60 9 16 3 34 86 59 23 79 55 45 72 51 28 33 96 40 26 54 6 32 89 61 85 74 7 82 52 31 64 66 94 95 11 22 2 73 35 13 42 71 14 47 84 69 50 67 58 12 77 46 38 68 15 36 20 93 27 90 83 56 87 4 21 24 81 62 80 65", "output": "7 63 31 90 12 47 53 21 29 13 61 76 66 69 81 30 26 23 8 83 91 62 35 92 15 45 85 41 5 17 56 48 42 32 65 82 11 79 25 44 1 67 10 9 38 78 70 3 27 73 40 55 20 46 37 88 6 75 34 28 50 94 16 57 96 58 74 80 72 24 68 39 64 52 14 19 77 18 36 95 93 54 87 71 51 33 89 4 49 86 2 22 84 59 60 43" }, { "input": "73\n67 24 39 22 23 20 48 34 42 40 19 70 65 69 64 21 53 11 59 15 26 10 30 33 72 29 55 25 56 71 8 9 57 49 41 61 13 12 6 27 66 36 47 50 73 60 2 37 7 4 51 17 1 46 14 62 35 3 45 63 43 58 54 32 31 5 28 44 18 52 68 38 16", "output": "53 47 58 50 66 39 49 31 32 22 18 38 37 55 20 73 52 69 11 6 16 4 5 2 28 21 40 67 26 23 65 64 24 8 57 42 48 72 3 10 35 9 61 68 59 54 43 7 34 44 51 70 17 63 27 29 33 62 19 46 36 56 60 15 13 41 1 71 14 12 30 25 45" }, { "input": "81\n25 2 78 40 12 80 69 13 49 43 17 33 23 54 32 61 77 66 27 71 24 26 42 55 60 9 5 30 7 37 45 63 53 11 38 44 68 34 28 52 67 22 57 46 47 50 8 16 79 62 4 36 20 14 73 64 6 76 35 74 58 10 29 81 59 31 19 1 75 39 70 18 41 21 72 65 3 48 15 56 51", "output": "68 2 77 51 27 57 29 47 26 62 34 5 8 54 79 48 11 72 67 53 74 42 13 21 1 22 19 39 63 28 66 15 12 38 59 52 30 35 70 4 73 23 10 36 31 44 45 78 9 46 81 40 33 14 24 80 43 61 65 25 16 50 32 56 76 18 41 37 7 71 20 75 55 60 69 58 17 3 49 6 64" }, { "input": "12\n12 3 1 5 11 6 7 10 2 8 9 4", "output": "3 9 2 12 4 6 7 10 11 8 5 1" }, { "input": "47\n7 21 41 18 40 31 12 28 24 14 43 23 33 10 19 38 26 8 34 15 29 44 5 13 39 25 3 27 20 42 35 9 2 1 30 46 36 32 4 22 37 45 6 47 11 16 17", "output": "34 33 27 39 23 43 1 18 32 14 45 7 24 10 20 46 47 4 15 29 2 40 12 9 26 17 28 8 21 35 6 38 13 19 31 37 41 16 25 5 3 30 11 22 42 36 44" }, { "input": "8\n1 3 5 2 4 8 6 7", "output": "1 4 2 5 3 7 8 6" }, { "input": "38\n28 8 2 33 20 32 26 29 23 31 15 38 11 37 18 21 22 19 4 34 1 35 16 7 17 6 27 30 36 12 9 24 25 13 5 3 10 14", "output": "21 3 36 19 35 26 24 2 31 37 13 30 34 38 11 23 25 15 18 5 16 17 9 32 33 7 27 1 8 28 10 6 4 20 22 29 14 12" }, { "input": "10\n2 9 4 6 10 1 7 5 3 8", "output": "6 1 9 3 8 4 7 10 2 5" }, { "input": "23\n20 11 15 1 5 12 23 9 2 22 13 19 16 14 7 4 8 21 6 17 18 10 3", "output": "4 9 23 16 5 19 15 17 8 22 2 6 11 14 3 13 20 21 12 1 18 10 7" }, { "input": "10\n2 4 9 3 6 8 10 5 1 7", "output": "9 1 4 2 8 5 10 6 3 7" }, { "input": "55\n9 48 23 49 11 24 4 22 34 32 17 45 39 13 14 21 19 25 2 31 37 7 55 36 20 51 5 12 54 10 35 40 43 1 46 18 53 41 38 26 29 50 3 42 52 27 8 28 47 33 6 16 30 44 15", "output": "34 19 43 7 27 51 22 47 1 30 5 28 14 15 55 52 11 36 17 25 16 8 3 6 18 40 46 48 41 53 20 10 50 9 31 24 21 39 13 32 38 44 33 54 12 35 49 2 4 42 26 45 37 29 23" }, { "input": "58\n49 13 12 54 2 38 56 11 33 25 26 19 28 8 23 41 20 36 46 55 15 35 9 7 32 37 58 6 3 14 47 31 40 30 53 44 4 50 29 34 10 43 39 57 5 22 27 45 51 42 24 16 18 21 52 17 48 1", "output": "58 5 29 37 45 28 24 14 23 41 8 3 2 30 21 52 56 53 12 17 54 46 15 51 10 11 47 13 39 34 32 25 9 40 22 18 26 6 43 33 16 50 42 36 48 19 31 57 1 38 49 55 35 4 20 7 44 27" }, { "input": "34\n20 25 2 3 33 29 1 16 14 7 21 9 32 31 6 26 22 4 27 23 24 10 34 12 19 15 5 18 28 17 13 8 11 30", "output": "7 3 4 18 27 15 10 32 12 22 33 24 31 9 26 8 30 28 25 1 11 17 20 21 2 16 19 29 6 34 14 13 5 23" }, { "input": "53\n47 29 46 25 23 13 7 31 33 4 38 11 35 16 42 14 15 43 34 39 28 18 6 45 30 1 40 20 2 37 5 32 24 12 44 26 27 3 19 51 36 21 22 9 10 50 41 48 49 53 8 17 52", "output": "26 29 38 10 31 23 7 51 44 45 12 34 6 16 17 14 52 22 39 28 42 43 5 33 4 36 37 21 2 25 8 32 9 19 13 41 30 11 20 27 47 15 18 35 24 3 1 48 49 46 40 53 50" }, { "input": "99\n77 87 90 48 53 38 68 6 28 57 35 82 63 71 60 41 3 12 86 65 10 59 22 67 33 74 93 27 24 1 61 43 25 4 51 52 15 88 9 31 30 42 89 49 23 21 29 32 46 73 37 16 5 69 56 26 92 64 20 54 75 14 98 13 94 2 95 7 36 66 58 8 50 78 84 45 11 96 76 62 97 80 40 39 47 85 34 79 83 17 91 72 19 44 70 81 55 99 18", "output": "30 66 17 34 53 8 68 72 39 21 77 18 64 62 37 52 90 99 93 59 46 23 45 29 33 56 28 9 47 41 40 48 25 87 11 69 51 6 84 83 16 42 32 94 76 49 85 4 44 73 35 36 5 60 97 55 10 71 22 15 31 80 13 58 20 70 24 7 54 95 14 92 50 26 61 79 1 74 88 82 96 12 89 75 86 19 2 38 43 3 91 57 27 65 67 78 81 63 98" }, { "input": "32\n17 29 2 6 30 8 26 7 1 27 10 9 13 24 31 21 15 19 22 18 4 11 25 28 32 3 23 12 5 14 20 16", "output": "9 3 26 21 29 4 8 6 12 11 22 28 13 30 17 32 1 20 18 31 16 19 27 14 23 7 10 24 2 5 15 25" }, { "input": "65\n18 40 1 60 17 19 4 6 12 49 28 58 2 25 13 14 64 56 61 34 62 30 59 51 26 8 33 63 36 48 46 7 43 21 31 27 11 44 29 5 32 23 35 9 53 57 52 50 15 38 42 3 54 65 55 41 20 24 22 47 45 10 39 16 37", "output": "3 13 52 7 40 8 32 26 44 62 37 9 15 16 49 64 5 1 6 57 34 59 42 58 14 25 36 11 39 22 35 41 27 20 43 29 65 50 63 2 56 51 33 38 61 31 60 30 10 48 24 47 45 53 55 18 46 12 23 4 19 21 28 17 54" }, { "input": "71\n35 50 55 58 25 32 26 40 63 34 44 53 24 18 37 7 64 27 56 65 1 19 2 43 42 14 57 47 22 13 59 61 39 67 30 45 54 38 33 48 6 5 3 69 36 21 41 4 16 46 20 17 15 12 10 70 68 23 60 31 52 29 66 28 51 49 62 11 8 9 71", "output": "21 23 43 48 42 41 16 69 70 55 68 54 30 26 53 49 52 14 22 51 46 29 58 13 5 7 18 64 62 35 60 6 39 10 1 45 15 38 33 8 47 25 24 11 36 50 28 40 66 2 65 61 12 37 3 19 27 4 31 59 32 67 9 17 20 63 34 57 44 56 71" }, { "input": "74\n33 8 42 63 64 61 31 74 11 50 68 14 36 25 57 30 7 44 21 15 6 9 23 59 46 3 73 16 62 51 40 60 41 54 5 39 35 28 48 4 58 12 66 69 13 26 71 1 24 19 29 52 37 2 20 43 18 72 17 56 34 38 65 67 27 10 47 70 53 32 45 55 49 22", "output": "48 54 26 40 35 21 17 2 22 66 9 42 45 12 20 28 59 57 50 55 19 74 23 49 14 46 65 38 51 16 7 70 1 61 37 13 53 62 36 31 33 3 56 18 71 25 67 39 73 10 30 52 69 34 72 60 15 41 24 32 6 29 4 5 63 43 64 11 44 68 47 58 27 8" }, { "input": "96\n78 10 82 46 38 91 77 69 2 27 58 80 79 44 59 41 6 31 76 11 42 48 51 37 19 87 43 25 52 32 1 39 63 29 21 65 53 74 92 16 15 95 90 83 30 73 71 5 50 17 96 33 86 60 67 64 20 26 61 40 55 88 94 93 9 72 47 57 14 45 22 3 54 68 13 24 4 7 56 81 89 70 49 8 84 28 18 62 35 36 75 23 66 85 34 12", "output": "31 9 72 77 48 17 78 84 65 2 20 96 75 69 41 40 50 87 25 57 35 71 92 76 28 58 10 86 34 45 18 30 52 95 89 90 24 5 32 60 16 21 27 14 70 4 67 22 83 49 23 29 37 73 61 79 68 11 15 54 59 88 33 56 36 93 55 74 8 82 47 66 46 38 91 19 7 1 13 12 80 3 44 85 94 53 26 62 81 43 6 39 64 63 42 51" }, { "input": "7\n2 1 5 7 3 4 6", "output": "2 1 5 6 3 7 4" }, { "input": "51\n8 33 37 2 16 22 24 30 4 9 5 15 27 3 18 39 31 26 10 17 46 41 25 14 6 1 29 48 36 20 51 49 21 43 19 13 38 50 47 34 11 23 28 12 42 7 32 40 44 45 35", "output": "26 4 14 9 11 25 46 1 10 19 41 44 36 24 12 5 20 15 35 30 33 6 42 7 23 18 13 43 27 8 17 47 2 40 51 29 3 37 16 48 22 45 34 49 50 21 39 28 32 38 31" }, { "input": "27\n12 14 7 3 20 21 25 13 22 15 23 4 2 24 10 17 19 8 26 11 27 18 9 5 6 1 16", "output": "26 13 4 12 24 25 3 18 23 15 20 1 8 2 10 27 16 22 17 5 6 9 11 14 7 19 21" }, { "input": "71\n51 13 20 48 54 23 24 64 14 62 71 67 57 53 3 30 55 43 33 25 39 40 66 6 46 18 5 19 61 16 32 68 70 41 60 44 29 49 27 69 50 38 10 17 45 56 9 21 26 63 28 35 7 59 1 65 2 15 8 11 12 34 37 47 58 22 31 4 36 42 52", "output": "55 57 15 68 27 24 53 59 47 43 60 61 2 9 58 30 44 26 28 3 48 66 6 7 20 49 39 51 37 16 67 31 19 62 52 69 63 42 21 22 34 70 18 36 45 25 64 4 38 41 1 71 14 5 17 46 13 65 54 35 29 10 50 8 56 23 12 32 40 33 11" }, { "input": "9\n8 5 2 6 1 9 4 7 3", "output": "5 3 9 7 2 4 8 1 6" }, { "input": "29\n10 24 11 5 26 25 2 9 22 15 8 14 29 21 4 1 23 17 3 12 13 16 18 28 19 20 7 6 27", "output": "16 7 19 15 4 28 27 11 8 1 3 20 21 12 10 22 18 23 25 26 14 9 17 2 6 5 29 24 13" }, { "input": "60\n39 25 42 4 55 60 16 18 47 1 11 40 7 50 19 35 49 54 12 3 30 38 2 58 17 26 45 6 33 43 37 32 52 36 15 23 27 59 24 20 28 14 8 9 13 29 44 46 41 21 5 48 51 22 31 56 57 53 10 34", "output": "10 23 20 4 51 28 13 43 44 59 11 19 45 42 35 7 25 8 15 40 50 54 36 39 2 26 37 41 46 21 55 32 29 60 16 34 31 22 1 12 49 3 30 47 27 48 9 52 17 14 53 33 58 18 5 56 57 24 38 6" }, { "input": "50\n37 45 22 5 12 21 28 24 18 47 20 25 8 50 14 2 34 43 11 16 49 41 48 1 19 31 39 46 32 23 15 42 3 35 38 30 44 26 10 9 40 36 7 17 33 4 27 6 13 29", "output": "24 16 33 46 4 48 43 13 40 39 19 5 49 15 31 20 44 9 25 11 6 3 30 8 12 38 47 7 50 36 26 29 45 17 34 42 1 35 27 41 22 32 18 37 2 28 10 23 21 14" }, { "input": "30\n8 29 28 16 17 25 27 15 21 11 6 20 2 13 1 30 5 4 24 10 14 3 23 18 26 9 12 22 19 7", "output": "15 13 22 18 17 11 30 1 26 20 10 27 14 21 8 4 5 24 29 12 9 28 23 19 6 25 7 3 2 16" }, { "input": "46\n15 2 44 43 38 19 31 42 4 37 29 30 24 45 27 41 8 20 33 7 35 3 18 46 36 26 1 28 21 40 16 22 32 11 14 13 12 9 25 39 10 6 23 17 5 34", "output": "27 2 22 9 45 42 20 17 38 41 34 37 36 35 1 31 44 23 6 18 29 32 43 13 39 26 15 28 11 12 7 33 19 46 21 25 10 5 40 30 16 8 4 3 14 24" }, { "input": "9\n4 8 6 5 3 9 2 7 1", "output": "9 7 5 1 4 3 8 2 6" }, { "input": "46\n31 30 33 23 45 7 36 8 11 3 32 39 41 20 1 28 6 27 18 24 17 5 16 37 26 13 22 14 2 38 15 46 9 4 19 21 12 44 10 35 25 34 42 43 40 29", "output": "15 29 10 34 22 17 6 8 33 39 9 37 26 28 31 23 21 19 35 14 36 27 4 20 41 25 18 16 46 2 1 11 3 42 40 7 24 30 12 45 13 43 44 38 5 32" }, { "input": "66\n27 12 37 48 46 21 34 58 38 28 66 2 64 32 44 31 13 36 40 15 19 11 22 5 30 29 6 7 61 39 20 42 23 54 51 33 50 9 60 8 57 45 49 10 62 41 59 3 55 63 52 24 25 26 43 56 65 4 16 14 1 35 18 17 53 47", "output": "61 12 48 58 24 27 28 40 38 44 22 2 17 60 20 59 64 63 21 31 6 23 33 52 53 54 1 10 26 25 16 14 36 7 62 18 3 9 30 19 46 32 55 15 42 5 66 4 43 37 35 51 65 34 49 56 41 8 47 39 29 45 50 13 57 11" }, { "input": "13\n3 12 9 2 8 5 13 4 11 1 10 7 6", "output": "10 4 1 8 6 13 12 5 3 11 9 2 7" }, { "input": "80\n21 25 56 50 20 61 7 74 51 69 8 2 46 57 45 71 14 52 17 43 9 30 70 78 31 10 38 13 23 15 37 79 6 16 77 73 80 4 49 48 18 28 26 58 33 41 64 22 54 72 59 60 40 63 53 27 1 5 75 67 62 34 19 39 68 65 44 55 3 32 11 42 76 12 35 47 66 36 24 29", "output": "57 12 69 38 58 33 7 11 21 26 71 74 28 17 30 34 19 41 63 5 1 48 29 79 2 43 56 42 80 22 25 70 45 62 75 78 31 27 64 53 46 72 20 67 15 13 76 40 39 4 9 18 55 49 68 3 14 44 51 52 6 61 54 47 66 77 60 65 10 23 16 50 36 8 59 73 35 24 32 37" }, { "input": "63\n9 49 53 25 40 46 43 51 54 22 58 16 23 26 10 47 5 27 2 8 61 59 19 35 63 56 28 20 34 4 62 38 6 55 36 31 57 15 29 33 1 48 50 37 7 30 18 42 32 52 12 41 14 21 45 11 24 17 39 13 44 60 3", "output": "41 19 63 30 17 33 45 20 1 15 56 51 60 53 38 12 58 47 23 28 54 10 13 57 4 14 18 27 39 46 36 49 40 29 24 35 44 32 59 5 52 48 7 61 55 6 16 42 2 43 8 50 3 9 34 26 37 11 22 62 21 31 25" }, { "input": "26\n11 4 19 13 17 9 2 24 6 5 22 23 14 15 3 25 16 8 18 10 21 1 12 26 7 20", "output": "22 7 15 2 10 9 25 18 6 20 1 23 4 13 14 17 5 19 3 26 21 11 12 8 16 24" }, { "input": "69\n40 22 11 66 4 27 31 29 64 53 37 55 51 2 7 36 18 52 6 1 30 21 17 20 14 9 59 62 49 68 3 50 65 57 44 5 67 46 33 13 34 15 24 48 63 58 38 25 41 35 16 54 32 10 60 61 39 12 69 8 23 45 26 47 56 43 28 19 42", "output": "20 14 31 5 36 19 15 60 26 54 3 58 40 25 42 51 23 17 68 24 22 2 61 43 48 63 6 67 8 21 7 53 39 41 50 16 11 47 57 1 49 69 66 35 62 38 64 44 29 32 13 18 10 52 12 65 34 46 27 55 56 28 45 9 33 4 37 30 59" }, { "input": "6\n4 3 6 5 1 2", "output": "5 6 2 1 4 3" }, { "input": "9\n7 8 5 3 1 4 2 9 6", "output": "5 7 4 6 3 9 1 2 8" }, { "input": "41\n27 24 16 30 25 8 32 2 26 20 39 33 41 22 40 14 36 9 28 4 34 11 31 23 19 18 17 35 3 10 6 13 5 15 29 38 7 21 1 12 37", "output": "39 8 29 20 33 31 37 6 18 30 22 40 32 16 34 3 27 26 25 10 38 14 24 2 5 9 1 19 35 4 23 7 12 21 28 17 41 36 11 15 13" }, { "input": "1\n1", "output": "1" }, { "input": "20\n2 6 4 18 7 10 17 13 16 8 14 9 20 5 19 12 1 3 15 11", "output": "17 1 18 3 14 2 5 10 12 6 20 16 8 11 19 9 7 4 15 13" }, { "input": "2\n2 1", "output": "2 1" }, { "input": "60\n2 4 31 51 11 7 34 20 3 14 18 23 48 54 15 36 38 60 49 40 5 33 41 26 55 58 10 8 13 9 27 30 37 1 21 59 44 57 35 19 46 43 42 45 12 22 39 32 24 16 6 56 53 52 25 17 47 29 50 28", "output": "34 1 9 2 21 51 6 28 30 27 5 45 29 10 15 50 56 11 40 8 35 46 12 49 55 24 31 60 58 32 3 48 22 7 39 16 33 17 47 20 23 43 42 37 44 41 57 13 19 59 4 54 53 14 25 52 38 26 36 18" }, { "input": "14\n14 6 3 12 11 2 7 1 10 9 8 5 4 13", "output": "8 6 3 13 12 2 7 11 10 9 5 4 14 1" }, { "input": "81\n13 43 79 8 7 21 73 46 63 4 62 78 56 11 70 68 61 53 60 49 16 27 59 47 69 5 22 44 77 57 52 48 1 9 72 81 28 55 58 33 51 18 31 17 41 20 42 3 32 54 19 2 75 34 64 10 65 50 30 29 67 12 71 66 74 15 26 23 6 38 25 35 37 24 80 76 40 45 39 36 14", "output": "33 52 48 10 26 69 5 4 34 56 14 62 1 81 66 21 44 42 51 46 6 27 68 74 71 67 22 37 60 59 43 49 40 54 72 80 73 70 79 77 45 47 2 28 78 8 24 32 20 58 41 31 18 50 38 13 30 39 23 19 17 11 9 55 57 64 61 16 25 15 63 35 7 65 53 76 29 12 3 75 36" }, { "input": "42\n41 11 10 8 21 37 32 19 31 25 1 15 36 5 6 27 4 3 13 7 16 17 2 23 34 24 38 28 12 20 30 42 18 26 39 35 33 40 9 14 22 29", "output": "11 23 18 17 14 15 20 4 39 3 2 29 19 40 12 21 22 33 8 30 5 41 24 26 10 34 16 28 42 31 9 7 37 25 36 13 6 27 35 38 1 32" }, { "input": "97\n20 6 76 42 4 18 35 59 39 63 27 7 66 47 61 52 15 36 88 93 19 33 10 92 1 34 46 86 78 57 51 94 77 29 26 73 41 2 58 97 43 65 17 74 21 49 25 3 91 82 95 12 96 13 84 90 69 24 72 37 16 55 54 71 64 62 48 89 11 70 80 67 30 40 44 85 53 83 79 9 56 45 75 87 22 14 81 68 8 38 60 50 28 23 31 32 5", "output": "25 38 48 5 97 2 12 89 80 23 69 52 54 86 17 61 43 6 21 1 45 85 94 58 47 35 11 93 34 73 95 96 22 26 7 18 60 90 9 74 37 4 41 75 82 27 14 67 46 92 31 16 77 63 62 81 30 39 8 91 15 66 10 65 42 13 72 88 57 70 64 59 36 44 83 3 33 29 79 71 87 50 78 55 76 28 84 19 68 56 49 24 20 32 51 53 40" }, { "input": "62\n15 27 46 6 8 51 14 56 23 48 42 49 52 22 20 31 29 12 47 3 62 34 37 35 32 57 19 25 5 60 61 38 18 10 11 55 45 53 17 30 9 36 4 50 41 16 44 28 40 59 24 1 13 39 26 7 33 58 2 43 21 54", "output": "52 59 20 43 29 4 56 5 41 34 35 18 53 7 1 46 39 33 27 15 61 14 9 51 28 55 2 48 17 40 16 25 57 22 24 42 23 32 54 49 45 11 60 47 37 3 19 10 12 44 6 13 38 62 36 8 26 58 50 30 31 21" }, { "input": "61\n35 27 4 61 52 32 41 46 14 37 17 54 55 31 11 26 44 49 15 30 9 50 45 39 7 38 53 3 58 40 13 56 18 19 28 6 43 5 21 42 20 34 2 25 36 12 33 57 16 60 1 8 59 10 22 23 24 48 51 47 29", "output": "51 43 28 3 38 36 25 52 21 54 15 46 31 9 19 49 11 33 34 41 39 55 56 57 44 16 2 35 61 20 14 6 47 42 1 45 10 26 24 30 7 40 37 17 23 8 60 58 18 22 59 5 27 12 13 32 48 29 53 50 4" }, { "input": "59\n31 26 36 15 17 19 10 53 11 34 13 46 55 9 44 7 8 37 32 52 47 25 51 22 35 39 41 4 43 24 5 27 20 57 6 38 3 28 21 40 50 18 14 56 33 45 12 2 49 59 54 29 16 48 42 58 1 30 23", "output": "57 48 37 28 31 35 16 17 14 7 9 47 11 43 4 53 5 42 6 33 39 24 59 30 22 2 32 38 52 58 1 19 45 10 25 3 18 36 26 40 27 55 29 15 46 12 21 54 49 41 23 20 8 51 13 44 34 56 50" }, { "input": "10\n2 10 7 4 1 5 8 6 3 9", "output": "5 1 9 4 6 8 3 7 10 2" }, { "input": "14\n14 2 1 8 6 12 11 10 9 7 3 4 5 13", "output": "3 2 11 12 13 5 10 4 9 8 7 6 14 1" }, { "input": "43\n28 38 15 14 31 42 27 30 19 33 43 26 22 29 18 32 3 13 1 8 35 34 4 12 11 17 41 21 5 25 39 37 20 23 7 24 16 10 40 9 6 36 2", "output": "19 43 17 23 29 41 35 20 40 38 25 24 18 4 3 37 26 15 9 33 28 13 34 36 30 12 7 1 14 8 5 16 10 22 21 42 32 2 31 39 27 6 11" }, { "input": "86\n39 11 20 31 28 76 29 64 35 21 41 71 12 82 5 37 80 73 38 26 79 75 23 15 59 45 47 6 3 62 50 49 51 22 2 65 86 60 70 42 74 17 1 30 55 44 8 66 81 27 57 77 43 13 54 32 72 46 48 56 14 34 78 52 36 85 24 19 69 83 25 61 7 4 84 33 63 58 18 40 68 10 67 9 16 53", "output": "43 35 29 74 15 28 73 47 84 82 2 13 54 61 24 85 42 79 68 3 10 34 23 67 71 20 50 5 7 44 4 56 76 62 9 65 16 19 1 80 11 40 53 46 26 58 27 59 32 31 33 64 86 55 45 60 51 78 25 38 72 30 77 8 36 48 83 81 69 39 12 57 18 41 22 6 52 63 21 17 49 14 70 75 66 37" }, { "input": "99\n65 78 56 98 33 24 61 40 29 93 1 64 57 22 25 52 67 95 50 3 31 15 90 68 71 83 38 36 6 46 89 26 4 87 14 88 72 37 23 43 63 12 80 96 5 34 73 86 9 48 92 62 99 10 16 20 66 27 28 2 82 70 30 94 49 8 84 69 18 60 58 59 44 39 21 7 91 76 54 19 75 85 74 47 55 32 97 77 51 13 35 79 45 42 11 41 17 81 53", "output": "11 60 20 33 45 29 76 66 49 54 95 42 90 35 22 55 97 69 80 56 75 14 39 6 15 32 58 59 9 63 21 86 5 46 91 28 38 27 74 8 96 94 40 73 93 30 84 50 65 19 89 16 99 79 85 3 13 71 72 70 7 52 41 12 1 57 17 24 68 62 25 37 47 83 81 78 88 2 92 43 98 61 26 67 82 48 34 36 31 23 77 51 10 64 18 44 87 4 53" }, { "input": "100\n42 23 48 88 36 6 18 70 96 1 34 40 46 22 39 55 85 93 45 67 71 75 59 9 21 3 86 63 65 68 20 38 73 31 84 90 50 51 56 95 72 33 49 19 83 76 54 74 100 30 17 98 15 94 4 97 5 99 81 27 92 32 89 12 13 91 87 29 60 11 52 43 35 58 10 25 16 80 28 2 44 61 8 82 66 69 41 24 57 62 78 37 79 77 53 7 14 47 26 64", "output": "10 80 26 55 57 6 96 83 24 75 70 64 65 97 53 77 51 7 44 31 25 14 2 88 76 99 60 79 68 50 34 62 42 11 73 5 92 32 15 12 87 1 72 81 19 13 98 3 43 37 38 71 95 47 16 39 89 74 23 69 82 90 28 100 29 85 20 30 86 8 21 41 33 48 22 46 94 91 93 78 59 84 45 35 17 27 67 4 63 36 66 61 18 54 40 9 56 52 58 49" }, { "input": "99\n8 68 94 75 71 60 57 58 6 11 5 48 65 41 49 12 46 72 95 59 13 70 74 7 84 62 17 36 55 76 38 79 2 85 23 10 32 99 87 50 83 28 54 91 53 51 1 3 97 81 21 89 93 78 61 26 82 96 4 98 25 40 31 44 24 47 30 52 14 16 39 27 9 29 45 18 67 63 37 43 90 66 19 69 88 22 92 77 34 42 73 80 56 64 20 35 15 33 86", "output": "47 33 48 59 11 9 24 1 73 36 10 16 21 69 97 70 27 76 83 95 51 86 35 65 61 56 72 42 74 67 63 37 98 89 96 28 79 31 71 62 14 90 80 64 75 17 66 12 15 40 46 68 45 43 29 93 7 8 20 6 55 26 78 94 13 82 77 2 84 22 5 18 91 23 4 30 88 54 32 92 50 57 41 25 34 99 39 85 52 81 44 87 53 3 19 58 49 60 38" }, { "input": "99\n12 99 88 13 7 19 74 47 23 90 16 29 26 11 58 60 64 98 37 18 82 67 72 46 51 85 17 92 87 20 77 36 78 71 57 35 80 54 73 15 14 62 97 45 31 79 94 56 76 96 28 63 8 44 38 86 49 2 52 66 61 59 10 43 55 50 22 34 83 53 95 40 81 21 30 42 27 3 5 41 1 70 69 25 93 48 65 6 24 89 91 33 39 68 9 4 32 84 75", "output": "81 58 78 96 79 88 5 53 95 63 14 1 4 41 40 11 27 20 6 30 74 67 9 89 84 13 77 51 12 75 45 97 92 68 36 32 19 55 93 72 80 76 64 54 44 24 8 86 57 66 25 59 70 38 65 48 35 15 62 16 61 42 52 17 87 60 22 94 83 82 34 23 39 7 99 49 31 33 46 37 73 21 69 98 26 56 29 3 90 10 91 28 85 47 71 50 43 18 2" }, { "input": "99\n20 79 26 75 99 69 98 47 93 62 18 42 43 38 90 66 67 8 13 84 76 58 81 60 64 46 56 23 78 17 86 36 19 52 85 39 48 27 96 49 37 95 5 31 10 24 12 1 80 35 92 33 16 68 57 54 32 29 45 88 72 77 4 87 97 89 59 3 21 22 61 94 83 15 44 34 70 91 55 9 51 50 73 11 14 6 40 7 63 25 2 82 41 65 28 74 71 30 53", "output": "48 91 68 63 43 86 88 18 80 45 84 47 19 85 74 53 30 11 33 1 69 70 28 46 90 3 38 95 58 98 44 57 52 76 50 32 41 14 36 87 93 12 13 75 59 26 8 37 40 82 81 34 99 56 79 27 55 22 67 24 71 10 89 25 94 16 17 54 6 77 97 61 83 96 4 21 62 29 2 49 23 92 73 20 35 31 64 60 66 15 78 51 9 72 42 39 65 7 5" }, { "input": "99\n74 20 9 1 60 85 65 13 4 25 40 99 5 53 64 3 36 31 73 44 55 50 45 63 98 51 68 6 47 37 71 82 88 34 84 18 19 12 93 58 86 7 11 46 90 17 33 27 81 69 42 59 56 32 95 52 76 61 96 62 78 43 66 21 49 97 75 14 41 72 89 16 30 79 22 23 15 83 91 38 48 2 87 26 28 80 94 70 54 92 57 10 8 35 67 77 29 24 39", "output": "4 82 16 9 13 28 42 93 3 92 43 38 8 68 77 72 46 36 37 2 64 75 76 98 10 84 48 85 97 73 18 54 47 34 94 17 30 80 99 11 69 51 62 20 23 44 29 81 65 22 26 56 14 89 21 53 91 40 52 5 58 60 24 15 7 63 95 27 50 88 31 70 19 1 67 57 96 61 74 86 49 32 78 35 6 41 83 33 71 45 79 90 39 87 55 59 66 25 12" }, { "input": "99\n50 94 2 18 69 90 59 83 75 68 77 97 39 78 25 7 16 9 49 4 42 89 44 48 17 96 61 70 3 10 5 81 56 57 88 6 98 1 46 67 92 37 11 30 85 41 8 36 51 29 20 71 19 79 74 93 43 34 55 40 38 21 64 63 32 24 72 14 12 86 82 15 65 23 66 22 28 53 13 26 95 99 91 52 76 27 60 45 47 33 73 84 31 35 54 80 58 62 87", "output": "38 3 29 20 31 36 16 47 18 30 43 69 79 68 72 17 25 4 53 51 62 76 74 66 15 80 86 77 50 44 93 65 90 58 94 48 42 61 13 60 46 21 57 23 88 39 89 24 19 1 49 84 78 95 59 33 34 97 7 87 27 98 64 63 73 75 40 10 5 28 52 67 91 55 9 85 11 14 54 96 32 71 8 92 45 70 99 35 22 6 83 41 56 2 81 26 12 37 82" }, { "input": "99\n19 93 14 34 39 37 33 15 52 88 7 43 69 27 9 77 94 31 48 22 63 70 79 17 50 6 81 8 76 58 23 74 86 11 57 62 41 87 75 51 12 18 68 56 95 3 80 83 84 29 24 61 71 78 59 96 20 85 90 28 45 36 38 97 1 49 40 98 44 67 13 73 72 91 47 10 30 54 35 42 4 2 92 26 64 60 53 21 5 82 46 32 55 66 16 89 99 65 25", "output": "65 82 46 81 89 26 11 28 15 76 34 41 71 3 8 95 24 42 1 57 88 20 31 51 99 84 14 60 50 77 18 92 7 4 79 62 6 63 5 67 37 80 12 69 61 91 75 19 66 25 40 9 87 78 93 44 35 30 55 86 52 36 21 85 98 94 70 43 13 22 53 73 72 32 39 29 16 54 23 47 27 90 48 49 58 33 38 10 96 59 74 83 2 17 45 56 64 68 97" }, { "input": "99\n86 25 50 51 62 39 41 67 44 20 45 14 80 88 66 7 36 59 13 84 78 58 96 75 2 43 48 47 69 12 19 98 22 38 28 55 11 76 68 46 53 70 85 34 16 33 91 30 8 40 74 60 94 82 87 32 37 4 5 10 89 73 90 29 35 26 23 57 27 65 24 3 9 83 77 72 6 31 15 92 93 79 64 18 63 42 56 1 52 97 17 81 71 21 49 99 54 95 61", "output": "88 25 72 58 59 77 16 49 73 60 37 30 19 12 79 45 91 84 31 10 94 33 67 71 2 66 69 35 64 48 78 56 46 44 65 17 57 34 6 50 7 86 26 9 11 40 28 27 95 3 4 89 41 97 36 87 68 22 18 52 99 5 85 83 70 15 8 39 29 42 93 76 62 51 24 38 75 21 82 13 92 54 74 20 43 1 55 14 61 63 47 80 81 53 98 23 90 32 96" }, { "input": "100\n66 44 99 15 43 79 28 33 88 90 49 68 82 38 9 74 4 58 29 81 31 94 10 42 89 21 63 40 62 61 18 6 84 72 48 25 67 69 71 85 98 34 83 70 65 78 91 77 93 41 23 24 87 11 55 12 59 73 36 97 7 14 26 39 30 27 45 20 50 17 53 2 57 47 95 56 75 19 37 96 16 35 8 3 76 60 13 86 5 32 64 80 46 51 54 100 1 22 52 92", "output": "97 72 84 17 89 32 61 83 15 23 54 56 87 62 4 81 70 31 78 68 26 98 51 52 36 63 66 7 19 65 21 90 8 42 82 59 79 14 64 28 50 24 5 2 67 93 74 35 11 69 94 99 71 95 55 76 73 18 57 86 30 29 27 91 45 1 37 12 38 44 39 34 58 16 77 85 48 46 6 92 20 13 43 33 40 88 53 9 25 10 47 100 49 22 75 80 60 41 3 96" }, { "input": "99\n3 73 32 37 25 15 93 63 85 8 91 78 80 5 39 48 46 7 83 70 23 96 9 29 77 53 30 20 56 50 13 45 21 76 87 99 65 31 16 18 14 72 51 28 43 2 81 34 38 40 66 54 74 26 71 4 61 17 58 24 22 33 49 36 42 11 12 55 60 27 62 90 79 92 94 68 1 52 84 41 86 35 69 75 47 10 64 88 97 98 67 19 89 95 59 82 57 44 6", "output": "77 46 1 56 14 99 18 10 23 86 66 67 31 41 6 39 58 40 92 28 33 61 21 60 5 54 70 44 24 27 38 3 62 48 82 64 4 49 15 50 80 65 45 98 32 17 85 16 63 30 43 78 26 52 68 29 97 59 95 69 57 71 8 87 37 51 91 76 83 20 55 42 2 53 84 34 25 12 73 13 47 96 19 79 9 81 35 88 93 72 11 74 7 75 94 22 89 90 36" }, { "input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1" } ]
1,699,097,359
2,147,483,647
Python 3
OK
TESTS
101
92
0
x=int(input()) liss=list(map(int,input().split())) akrem=[] for i in range(x): for j in range (x): if i+1==liss[j]: akrem.append(j+1) break else: continue print(" ".join(map(str, akrem)))
Title: Presents Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there. If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift. Now Petya wants to know for each friend *i* the number of a friend who has given him a gift. Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves. Output Specification: Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*. Demo Input: ['4\n2 3 4 1\n', '3\n1 3 2\n', '2\n1 2\n'] Demo Output: ['4 1 2 3\n', '1 3 2\n', '1 2\n'] Note: none
```python x=int(input()) liss=list(map(int,input().split())) akrem=[] for i in range(x): for j in range (x): if i+1==liss[j]: akrem.append(j+1) break else: continue print(" ".join(map(str, akrem))) ```
3
976
A
Minimum Binary Number
PROGRAMMING
800
[ "implementation" ]
null
null
String can be called correct if it consists of characters "0" and "1" and there are no redundant leading zeroes. Here are some examples: "0", "10", "1001". You are given a correct string *s*. You can perform two different operations on this string: 1. swap any pair of adjacent characters (for example, "101" "110"); 1. replace "11" with "1" (for example, "110" "10"). Let *val*(*s*) be such a number that *s* is its binary representation. Correct string *a* is less than some other correct string *b* iff *val*(*a*)<=&lt;<=*val*(*b*). Your task is to find the minimum correct string that you can obtain from the given one using the operations described above. You can use these operations any number of times in any order (or even use no operations at all).
The first line contains integer number *n* (1<=≤<=*n*<=≤<=100) — the length of string *s*. The second line contains the string *s* consisting of characters "0" and "1". It is guaranteed that the string *s* is correct.
Print one string — the minimum correct string that you can obtain from the given one.
[ "4\n1001\n", "1\n1\n" ]
[ "100\n", "1\n" ]
In the first example you can obtain the answer by the following sequence of operations: "1001" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "1010" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "1100" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "100". In the second example you can't obtain smaller answer no matter what operations you use.
0
[ { "input": "4\n1001", "output": "100" }, { "input": "1\n1", "output": "1" }, { "input": "100\n1110111100001111011111111010110011111111011110000111101101011100110110001011000000101010110101011100", "output": "1000000000000000000000000000000000000000" }, { "input": "100\n1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000" }, { "input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "1" }, { "input": "100\n1111111111111111111111111111111111111111111111111111111110111111111111111111111111111111111111111111", "output": "10" }, { "input": "1\n0", "output": "0" }, { "input": "8\n10101010", "output": "10000" }, { "input": "2\n10", "output": "10" }, { "input": "3\n111", "output": "1" }, { "input": "5\n11100", "output": "100" }, { "input": "2\n11", "output": "1" }, { "input": "3\n110", "output": "10" }, { "input": "50\n10010010000000000000000000000000000000001000000000", "output": "10000000000000000000000000000000000000000000000" } ]
1,670,420,628
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
6
31
0
h=input() str=str(input()) lista_liter=[] odpowiedz='1' for i in str: lista_liter.append(i) for i in range(lista_liter.count('0')): odpowiedz+='0' print(odpowiedz)
Title: Minimum Binary Number Time Limit: None seconds Memory Limit: None megabytes Problem Description: String can be called correct if it consists of characters "0" and "1" and there are no redundant leading zeroes. Here are some examples: "0", "10", "1001". You are given a correct string *s*. You can perform two different operations on this string: 1. swap any pair of adjacent characters (for example, "101" "110"); 1. replace "11" with "1" (for example, "110" "10"). Let *val*(*s*) be such a number that *s* is its binary representation. Correct string *a* is less than some other correct string *b* iff *val*(*a*)<=&lt;<=*val*(*b*). Your task is to find the minimum correct string that you can obtain from the given one using the operations described above. You can use these operations any number of times in any order (or even use no operations at all). Input Specification: The first line contains integer number *n* (1<=≤<=*n*<=≤<=100) — the length of string *s*. The second line contains the string *s* consisting of characters "0" and "1". It is guaranteed that the string *s* is correct. Output Specification: Print one string — the minimum correct string that you can obtain from the given one. Demo Input: ['4\n1001\n', '1\n1\n'] Demo Output: ['100\n', '1\n'] Note: In the first example you can obtain the answer by the following sequence of operations: "1001" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "1010" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "1100" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "100". In the second example you can't obtain smaller answer no matter what operations you use.
```python h=input() str=str(input()) lista_liter=[] odpowiedz='1' for i in str: lista_liter.append(i) for i in range(lista_liter.count('0')): odpowiedz+='0' print(odpowiedz) ```
0
27
E
Number With The Given Amount Of Divisors
PROGRAMMING
2,000
[ "brute force", "dp", "number theory" ]
E. Number With The Given Amount Of Divisors
2
256
Given the number *n*, find the smallest positive integer which has exactly *n* divisors. It is guaranteed that for the given *n* the answer will not exceed 1018.
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=1000).
Output the smallest positive integer with exactly *n* divisors.
[ "4\n", "6\n" ]
[ "6\n", "12\n" ]
none
2,500
[ { "input": "1", "output": "1" }, { "input": "7", "output": "64" }, { "input": "8", "output": "24" }, { "input": "9", "output": "36" }, { "input": "10", "output": "48" }, { "input": "15", "output": "144" }, { "input": "20", "output": "240" }, { "input": "47", "output": "70368744177664" }, { "input": "59", "output": "288230376151711744" }, { "input": "100", "output": "45360" }, { "input": "159", "output": "40532396646334464" }, { "input": "265", "output": "364791569817010176" }, { "input": "312", "output": "14192640" }, { "input": "473", "output": "259700248434180096" }, { "input": "637", "output": "46656000000" }, { "input": "500", "output": "62370000" }, { "input": "720", "output": "61261200" }, { "input": "902", "output": "324625310542725120" }, { "input": "940", "output": "199495389743677440" }, { "input": "1000", "output": "810810000" }, { "input": "999", "output": "757632231014400" }, { "input": "118", "output": "864691128455135232" } ]
1,626,015,356
2,147,483,647
Python 3
OK
TESTS
22
124
6,963,200
import math p = [2, 3, 5, 7, 11, 13, 17, 19, 23, 29, 31, 37, 41, 43] def solve(n, pos): ans = [1, 10 ** 18][n > 1] # si n>1 ans = 10**18 sino ans =1 dado que solo se necesita 1 divisor y solo 1 cumple tener un unico divisor for exp in range(2, n + 1): if n % exp == 0: # analizamos los posibles exponentes como se calculo matematicamente no tiene sentido pregunta por un exponente que no cumpla que (exp+1)|n ans = min(ans, p[pos] ** (exp - 1) * solve(n // exp, pos + 1)) # ans queda siendo la menor de las respuestas hasta ahora o la nueva respuesta # calculada mediante el primo que se esta analizando elevado al exponente -1 # * solve en los divisores restantes n/exp y cambiando la pos para analiar el primo siguiente return ans inp = int(input()) print(solve(inp, 0))
Title: Number With The Given Amount Of Divisors Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Given the number *n*, find the smallest positive integer which has exactly *n* divisors. It is guaranteed that for the given *n* the answer will not exceed 1018. Input Specification: The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=1000). Output Specification: Output the smallest positive integer with exactly *n* divisors. Demo Input: ['4\n', '6\n'] Demo Output: ['6\n', '12\n'] Note: none
```python import math p = [2, 3, 5, 7, 11, 13, 17, 19, 23, 29, 31, 37, 41, 43] def solve(n, pos): ans = [1, 10 ** 18][n > 1] # si n>1 ans = 10**18 sino ans =1 dado que solo se necesita 1 divisor y solo 1 cumple tener un unico divisor for exp in range(2, n + 1): if n % exp == 0: # analizamos los posibles exponentes como se calculo matematicamente no tiene sentido pregunta por un exponente que no cumpla que (exp+1)|n ans = min(ans, p[pos] ** (exp - 1) * solve(n // exp, pos + 1)) # ans queda siendo la menor de las respuestas hasta ahora o la nueva respuesta # calculada mediante el primo que se esta analizando elevado al exponente -1 # * solve en los divisores restantes n/exp y cambiando la pos para analiar el primo siguiente return ans inp = int(input()) print(solve(inp, 0)) ```
3.95603
789
B
Masha and geometric depression
PROGRAMMING
1,700
[ "brute force", "implementation", "math" ]
null
null
Masha really loves algebra. On the last lesson, her strict teacher Dvastan gave she new exercise. You are given geometric progression *b* defined by two integers *b*1 and *q*. Remind that a geometric progression is a sequence of integers *b*1,<=*b*2,<=*b*3,<=..., where for each *i*<=&gt;<=1 the respective term satisfies the condition *b**i*<==<=*b**i*<=-<=1·*q*, where *q* is called the common ratio of the progression. Progressions in Uzhlyandia are unusual: both *b*1 and *q* can equal 0. Also, Dvastan gave Masha *m* "bad" integers *a*1,<=*a*2,<=...,<=*a**m*, and an integer *l*. Masha writes all progression terms one by one onto the board (including repetitive) while condition |*b**i*|<=≤<=*l* is satisfied (|*x*| means absolute value of *x*). There is an exception: if a term equals one of the "bad" integers, Masha skips it (doesn't write onto the board) and moves forward to the next term. But the lesson is going to end soon, so Masha has to calculate how many integers will be written on the board. In order not to get into depression, Masha asked you for help: help her calculate how many numbers she will write, or print "inf" in case she needs to write infinitely many integers.
The first line of input contains four integers *b*1, *q*, *l*, *m* (-109<=≤<=*b*1,<=*q*<=≤<=109, 1<=≤<=*l*<=≤<=109, 1<=≤<=*m*<=≤<=105) — the initial term and the common ratio of progression, absolute value of maximal number that can be written on the board and the number of "bad" integers, respectively. The second line contains *m* distinct integers *a*1,<=*a*2,<=...,<=*a**m* (-109<=≤<=*a**i*<=≤<=109) — numbers that will never be written on the board.
Print the only integer, meaning the number of progression terms that will be written on the board if it is finite, or "inf" (without quotes) otherwise.
[ "3 2 30 4\n6 14 25 48\n", "123 1 2143435 4\n123 11 -5453 141245\n", "123 1 2143435 4\n54343 -13 6 124\n" ]
[ "3", "0", "inf" ]
In the first sample case, Masha will write integers 3, 12, 24. Progression term 6 will be skipped because it is a "bad" integer. Terms bigger than 24 won't be written because they exceed *l* by absolute value. In the second case, Masha won't write any number because all terms are equal 123 and this is a "bad" integer. In the third case, Masha will write infinitely integers 123.
1,000
[ { "input": "3 2 30 4\n6 14 25 48", "output": "3" }, { "input": "123 1 2143435 4\n123 11 -5453 141245", "output": "0" }, { "input": "123 1 2143435 4\n54343 -13 6 124", "output": "inf" }, { "input": "3 2 25 2\n379195692 -69874783", "output": "4" }, { "input": "3 2 30 3\n-691070108 -934106649 -220744807", "output": "4" }, { "input": "3 3 104 17\n9 -73896485 -290898562 5254410 409659728 -916522518 -435516126 94354167 262981034 -375897180 -80186684 -173062070 -288705544 -699097793 -11447747 320434295 503414250", "output": "3" }, { "input": "-1000000000 -1000000000 1 1\n232512888", "output": "0" }, { "input": "11 0 228 5\n-1 0 1 5 -11245", "output": "1" }, { "input": "11 0 228 5\n-1 -17 1 5 -11245", "output": "inf" }, { "input": "0 0 2143435 5\n-1 -153 1 5 -11245", "output": "inf" }, { "input": "123 0 2143435 4\n5433 0 123 -645", "output": "0" }, { "input": "123 -1 2143435 5\n-123 0 12 5 -11245", "output": "inf" }, { "input": "123 0 21 4\n543453 -123 6 1424", "output": "0" }, { "input": "3 2 115 16\n24 48 12 96 3 720031148 -367712651 -838596957 558177735 -963046495 -313322487 -465018432 -618984128 -607173835 144854086 178041956", "output": "1" }, { "input": "-3 0 92055 36\n-92974174 -486557474 -663622151 695596393 177960746 -563227474 -364263320 -676254242 -614140218 71456762 -764104225 705056581 -106398436 332755134 -199942822 -732751692 658942664 677739866 886535704 183687802 -784248291 -22550621 -938674499 637055091 -704750213 780395802 778342470 -999059668 -794361783 796469192 215667969 354336794 -60195289 -885080928 -290279020 201221317", "output": "inf" }, { "input": "0 -3 2143435 5\n-1 0 1 5 -11245", "output": "0" }, { "input": "123 -1 2143435 5\n-123 0 123 -5453 141245", "output": "0" }, { "input": "123 0 2143435 4\n5433 0 -123 -645", "output": "1" }, { "input": "11 0 2 5\n-1 0 1 5 -11245", "output": "0" }, { "input": "2 2 4 1\n2", "output": "1" }, { "input": "1 -2 1000000000 1\n0", "output": "30" }, { "input": "0 8 10 1\n5", "output": "inf" }, { "input": "-1000 0 10 1\n5", "output": "0" }, { "input": "0 2 2143435 4\n54343 -13 6 124", "output": "inf" }, { "input": "0 8 5 1\n9", "output": "inf" }, { "input": "-10 1 5 1\n100", "output": "0" }, { "input": "123 -1 2143435 4\n54343 -13 6 123", "output": "inf" }, { "input": "-5 -1 10 1\n-5", "output": "inf" }, { "input": "2 0 1 1\n2", "output": "0" }, { "input": "0 5 8 1\n10", "output": "inf" }, { "input": "0 5 100 2\n34 56", "output": "inf" }, { "input": "15 -1 15 4\n15 -15 1 2", "output": "0" }, { "input": "10 -1 2 1\n1", "output": "0" }, { "input": "2 0 2 1\n2", "output": "inf" }, { "input": "4 0 4 1\n0", "output": "1" }, { "input": "10 10 10 1\n123", "output": "1" }, { "input": "2 2 4 1\n3", "output": "2" }, { "input": "0 1 1 1\n0", "output": "0" }, { "input": "3 2 30 1\n3", "output": "3" }, { "input": "1000000000 100000 1000000000 4\n5433 13 6 0", "output": "1" }, { "input": "-2 0 1 1\n1", "output": "0" }, { "input": "2 -1 10 1\n2", "output": "inf" }, { "input": "1 -1 2 1\n1", "output": "inf" }, { "input": "0 10 10 1\n2", "output": "inf" }, { "input": "0 35 2 1\n3", "output": "inf" }, { "input": "3 1 3 1\n5", "output": "inf" }, { "input": "3 2 3 4\n6 14 25 48", "output": "1" }, { "input": "0 69 12 1\n1", "output": "inf" }, { "input": "100 0 100000 1\n100", "output": "inf" }, { "input": "0 4 1000 3\n5 6 7", "output": "inf" }, { "input": "0 2 100 1\n5", "output": "inf" }, { "input": "3 2 24 4\n6 14 25 48", "output": "3" }, { "input": "0 4 1 1\n2", "output": "inf" }, { "input": "1 5 10000 1\n125", "output": "5" }, { "input": "2 -1 1 1\n1", "output": "0" }, { "input": "0 3 100 1\n5", "output": "inf" }, { "input": "0 3 3 1\n1", "output": "inf" }, { "input": "0 2 5 1\n1", "output": "inf" }, { "input": "5 -1 100 1\n5", "output": "inf" }, { "input": "-20 0 10 1\n0", "output": "0" }, { "input": "3 0 1 1\n3", "output": "0" }, { "input": "2 -1 3 1\n2", "output": "inf" }, { "input": "1 1 1000000000 1\n100", "output": "inf" }, { "input": "5 -1 3 1\n0", "output": "0" }, { "input": "0 5 10 1\n2", "output": "inf" }, { "input": "123 0 125 1\n123", "output": "inf" }, { "input": "2 -1 100 1\n2", "output": "inf" }, { "input": "5 2 100 1\n5", "output": "4" }, { "input": "-5 0 1 1\n1", "output": "0" }, { "input": "-3 0 1 1\n-3", "output": "0" }, { "input": "2 -2 10 1\n1", "output": "3" }, { "input": "0 2 30 4\n6 14 25 48", "output": "inf" }, { "input": "1 -1 1 1\n1", "output": "inf" }, { "input": "2 -1 6 1\n2", "output": "inf" }, { "input": "-3 1 100 1\n-3", "output": "0" }, { "input": "1 0 2 1\n1", "output": "inf" }, { "input": "1000000000 999999998 1000000000 1\n0", "output": "1" }, { "input": "1 0 2143435 4\n1 -123 -5453 141245", "output": "inf" }, { "input": "-1000 0 100 1\n-1000", "output": "0" }, { "input": "100 10 2 1\n100", "output": "0" }, { "input": "-3 1 100 1\n3", "output": "inf" }, { "input": "123 -1 10000 1\n123", "output": "inf" }, { "input": "1 -1 2143435 4\n1 -123 -5453 141245", "output": "inf" }, { "input": "5 1 5 5\n1 2 3 4 0", "output": "inf" }, { "input": "-100 -1 1 1\n1", "output": "0" }, { "input": "10 -1 3 2\n10 8", "output": "0" }, { "input": "-10 0 5 1\n0", "output": "0" }, { "input": "3 0 3 1\n0", "output": "1" }, { "input": "2 0 2 1\n-1", "output": "inf" }, { "input": "5 0 20 1\n5", "output": "inf" }, { "input": "-4 1 1 1\n0", "output": "0" }, { "input": "11 0 1111 1\n11", "output": "inf" }, { "input": "2 0 3 1\n2", "output": "inf" }, { "input": "-1 -1 2143435 4\n-1 -123 -5453 141245", "output": "inf" }, { "input": "-100 0 50 1\n0", "output": "0" }, { "input": "5 1 2 1\n2", "output": "0" }, { "input": "3 0 3 1\n4", "output": "inf" }, { "input": "0 23 3 1\n3", "output": "inf" }, { "input": "-1000 0 100 1\n2", "output": "0" }, { "input": "1 -1 10 1\n1", "output": "inf" } ]
1,490,805,577
2,077
Python 3
WRONG_ANSWER
PRETESTS
7
78
14,745,600
b1, q, maximum, m = map(int, input().split()) A = set(map(int, input().split())) if q == 1: if b1 in A: print(0) else: print("inf") elif q == -1: if b1 in A and b1*(-1) in A: print(0) else: print("inf") elif b1 == 0 or q == 0: if 0 in A: print(0) else: print("inf") else: counter = 0 i = 0 while b1 * q**i < maximum: if b1 * q**i not in A: counter += 1 i += 1 print(counter)
Title: Masha and geometric depression Time Limit: None seconds Memory Limit: None megabytes Problem Description: Masha really loves algebra. On the last lesson, her strict teacher Dvastan gave she new exercise. You are given geometric progression *b* defined by two integers *b*1 and *q*. Remind that a geometric progression is a sequence of integers *b*1,<=*b*2,<=*b*3,<=..., where for each *i*<=&gt;<=1 the respective term satisfies the condition *b**i*<==<=*b**i*<=-<=1·*q*, where *q* is called the common ratio of the progression. Progressions in Uzhlyandia are unusual: both *b*1 and *q* can equal 0. Also, Dvastan gave Masha *m* "bad" integers *a*1,<=*a*2,<=...,<=*a**m*, and an integer *l*. Masha writes all progression terms one by one onto the board (including repetitive) while condition |*b**i*|<=≤<=*l* is satisfied (|*x*| means absolute value of *x*). There is an exception: if a term equals one of the "bad" integers, Masha skips it (doesn't write onto the board) and moves forward to the next term. But the lesson is going to end soon, so Masha has to calculate how many integers will be written on the board. In order not to get into depression, Masha asked you for help: help her calculate how many numbers she will write, or print "inf" in case she needs to write infinitely many integers. Input Specification: The first line of input contains four integers *b*1, *q*, *l*, *m* (-109<=≤<=*b*1,<=*q*<=≤<=109, 1<=≤<=*l*<=≤<=109, 1<=≤<=*m*<=≤<=105) — the initial term and the common ratio of progression, absolute value of maximal number that can be written on the board and the number of "bad" integers, respectively. The second line contains *m* distinct integers *a*1,<=*a*2,<=...,<=*a**m* (-109<=≤<=*a**i*<=≤<=109) — numbers that will never be written on the board. Output Specification: Print the only integer, meaning the number of progression terms that will be written on the board if it is finite, or "inf" (without quotes) otherwise. Demo Input: ['3 2 30 4\n6 14 25 48\n', '123 1 2143435 4\n123 11 -5453 141245\n', '123 1 2143435 4\n54343 -13 6 124\n'] Demo Output: ['3', '0', 'inf'] Note: In the first sample case, Masha will write integers 3, 12, 24. Progression term 6 will be skipped because it is a "bad" integer. Terms bigger than 24 won't be written because they exceed *l* by absolute value. In the second case, Masha won't write any number because all terms are equal 123 and this is a "bad" integer. In the third case, Masha will write infinitely integers 123.
```python b1, q, maximum, m = map(int, input().split()) A = set(map(int, input().split())) if q == 1: if b1 in A: print(0) else: print("inf") elif q == -1: if b1 in A and b1*(-1) in A: print(0) else: print("inf") elif b1 == 0 or q == 0: if 0 in A: print(0) else: print("inf") else: counter = 0 i = 0 while b1 * q**i < maximum: if b1 * q**i not in A: counter += 1 i += 1 print(counter) ```
0
727
C
Guess the Array
PROGRAMMING
1,400
[ "constructive algorithms", "interactive", "math" ]
null
null
This is an interactive problem. You should use flush operation after each printed line. For example, in C++ you should use fflush(stdout), in Java you should use System.out.flush(), and in Pascal — flush(output). In this problem you should guess an array *a* which is unknown for you. The only information you have initially is the length *n* of the array *a*. The only allowed action is to ask the sum of two elements by their indices. Formally, you can print two indices *i* and *j* (the indices should be distinct). Then your program should read the response: the single integer equals to *a**i*<=+<=*a**j*. It is easy to prove that it is always possible to guess the array using at most *n* requests. Write a program that will guess the array *a* by making at most *n* requests.
none
none
[ "5\n \n9\n \n7\n \n9\n \n11\n \n6\n " ]
[ "? 1 5\n \n? 2 3\n \n? 4 1\n \n? 5 2\n \n? 3 4\n \n! 4 6 1 5 5" ]
The format of a test to make a hack is: - The first line contains an integer number *n* (3 ≤ *n* ≤ 5000) — the length of the array.- The second line contains *n* numbers *a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">2</sub>, ..., *a*<sub class="lower-index">*n*</sub> (1 ≤ *a*<sub class="lower-index">*i*</sub> ≤ 10<sup class="upper-index">5</sup>) — the elements of the array to guess.
1,500
[ { "input": "5\n4 6 1 5 5", "output": "5 out of 5" }, { "input": "3\n1 1 1", "output": "3 out of 3" }, { "input": "4\n100 1 100 1", "output": "4 out of 4" }, { "input": "10\n9 5 10 7 4 4 8 5 10 5", "output": "10 out of 10" }, { "input": "3\n1 1 1", "output": "3 out of 3" }, { "input": "3\n100000 100000 100000", "output": "3 out of 3" }, { "input": "3\n91906 50782 19777", "output": "3 out of 3" }, { "input": "15\n5 10 10 7 7 6 4 6 8 10 8 4 10 9 4", "output": "15 out of 15" }, { "input": "30\n2 3 3 4 3 2 4 4 4 3 3 2 4 2 3 4 4 2 4 3 4 2 2 4 3 3 4 4 4 4", "output": "30 out of 30" }, { "input": "35\n4 2 2 2 4 4 3 2 4 2 2 4 2 2 3 2 3 4 4 2 3 2 2 4 3 3 3 3 4 2 3 2 2 2 3", "output": "35 out of 35" }, { "input": "40\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3", "output": "40 out of 40" }, { "input": "47\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3", "output": "47 out of 47" }, { "input": "100\n76 92 53 18 65 98 100 65 93 72 100 44 70 62 78 61 89 89 80 32 88 64 67 27 46 30 75 14 78 94 8 86 41 9 68 38 76 29 69 44 23 23 14 24 97 14 7 98 45 80 55 71 58 35 41 100 60 54 64 85 56 98 87 93 40 62 92 6 7 27 88 85 10 94 25 43 99 65 82 65 39 34 17 100 49 27 4 15 84 10 35 76 98 52 72 17 43 10 49 5", "output": "100 out of 100" } ]
1,659,702,700
2,147,483,647
PyPy 3-64
OK
TESTS
36
327
9,318,400
n = int(input()) d = [0] * n print('?', 1, 2) a = int(input()) print('?', 2, 3) b = int(input()) print('?', 1, 3) c = int(input()) x = (a+b+c)//2 d[0] = x-b d[1] = x-c d[2] = x-a for i in range(3, n): print('?', 1, i+1) x = int(input()) d[i] = x-d[0] print('!', *d)
Title: Guess the Array Time Limit: None seconds Memory Limit: None megabytes Problem Description: This is an interactive problem. You should use flush operation after each printed line. For example, in C++ you should use fflush(stdout), in Java you should use System.out.flush(), and in Pascal — flush(output). In this problem you should guess an array *a* which is unknown for you. The only information you have initially is the length *n* of the array *a*. The only allowed action is to ask the sum of two elements by their indices. Formally, you can print two indices *i* and *j* (the indices should be distinct). Then your program should read the response: the single integer equals to *a**i*<=+<=*a**j*. It is easy to prove that it is always possible to guess the array using at most *n* requests. Write a program that will guess the array *a* by making at most *n* requests. Input Specification: none Output Specification: none Demo Input: ['5\n\xa0\n9\n\xa0\n7\n\xa0\n9\n\xa0\n11\n\xa0\n6\n\xa0'] Demo Output: ['? 1 5\n\xa0\n? 2 3\n\xa0\n? 4 1\n\xa0\n? 5 2\n\xa0\n? 3 4\n\xa0\n! 4 6 1 5 5'] Note: The format of a test to make a hack is: - The first line contains an integer number *n* (3 ≤ *n* ≤ 5000) — the length of the array.- The second line contains *n* numbers *a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">2</sub>, ..., *a*<sub class="lower-index">*n*</sub> (1 ≤ *a*<sub class="lower-index">*i*</sub> ≤ 10<sup class="upper-index">5</sup>) — the elements of the array to guess.
```python n = int(input()) d = [0] * n print('?', 1, 2) a = int(input()) print('?', 2, 3) b = int(input()) print('?', 1, 3) c = int(input()) x = (a+b+c)//2 d[0] = x-b d[1] = x-c d[2] = x-a for i in range(3, n): print('?', 1, i+1) x = int(input()) d[i] = x-d[0] print('!', *d) ```
3
168
A
Wizards and Demonstration
PROGRAMMING
900
[ "implementation", "math" ]
null
null
Some country is populated by wizards. They want to organize a demonstration. There are *n* people living in the city, *x* of them are the wizards who will surely go to the demonstration. Other city people (*n*<=-<=*x* people) do not support the wizards and aren't going to go to the demonstration. We know that the city administration will react only to the demonstration involving at least *y* percent of the city people. Having considered the matter, the wizards decided to create clone puppets which can substitute the city people on the demonstration. So all in all, the demonstration will involve only the wizards and their puppets. The city administration cannot tell the difference between a puppet and a person, so, as they calculate the percentage, the administration will consider the city to be consisting of only *n* people and not containing any clone puppets. Help the wizards and find the minimum number of clones to create to that the demonstration had no less than *y* percent of the city people.
The first line contains three space-separated integers, *n*, *x*, *y* (1<=≤<=*n*,<=*x*,<=*y*<=≤<=104,<=*x*<=≤<=*n*) — the number of citizens in the city, the number of wizards and the percentage the administration needs, correspondingly. Please note that *y* can exceed 100 percent, that is, the administration wants to see on a demonstration more people that actually live in the city (<=&gt;<=*n*).
Print a single integer — the answer to the problem, the minimum number of clones to create, so that the demonstration involved no less than *y* percent of *n* (the real total city population).
[ "10 1 14\n", "20 10 50\n", "1000 352 146\n" ]
[ "1\n", "0\n", "1108\n" ]
In the first sample it is necessary that at least 14% of 10 people came to the demonstration. As the number of people should be integer, then at least two people should come. There is only one wizard living in the city and he is going to come. That isn't enough, so he needs to create one clone. In the second sample 10 people should come to the demonstration. The city has 10 wizards. They will all come to the demonstration, so nobody has to create any clones.
500
[ { "input": "10 1 14", "output": "1" }, { "input": "20 10 50", "output": "0" }, { "input": "1000 352 146", "output": "1108" }, { "input": "68 65 20", "output": "0" }, { "input": "78 28 27", "output": "0" }, { "input": "78 73 58", "output": "0" }, { "input": "70 38 66", "output": "9" }, { "input": "54 4 38", "output": "17" }, { "input": "3 1 69", "output": "2" }, { "input": "11 9 60", "output": "0" }, { "input": "71 49 65", "output": "0" }, { "input": "78 55 96", "output": "20" }, { "input": "2765 768 9020", "output": "248635" }, { "input": "3478 1728 9727", "output": "336578" }, { "input": "9678 6173 5658", "output": "541409" }, { "input": "1138 570 6666", "output": "75290" }, { "input": "7754 204 9038", "output": "700603" }, { "input": "8403 7401 4769", "output": "393339" }, { "input": "4909 2111 8860", "output": "432827" }, { "input": "6571 6449 8965", "output": "582642" }, { "input": "9178 2255 7996", "output": "731618" }, { "input": "6151 6148 3746", "output": "224269" }, { "input": "8890 5449 8734", "output": "771004" }, { "input": "7879 2590 2818", "output": "219441" }, { "input": "8484 6400 547", "output": "40008" }, { "input": "7835 6710 1639", "output": "121706" }, { "input": "2379 1436 9663", "output": "228447" }, { "input": "6487 5670 8", "output": "0" }, { "input": "4470 2543 6", "output": "0" }, { "input": "7261 5328 10", "output": "0" }, { "input": "3871 3795 7", "output": "0" }, { "input": "9620 6557 6", "output": "0" }, { "input": "4890 1112 5", "output": "0" }, { "input": "1 1 1", "output": "0" }, { "input": "1 1 10000", "output": "99" }, { "input": "10000 1 1", "output": "99" }, { "input": "10000 1 10000", "output": "999999" }, { "input": "10000 10000 1", "output": "0" }, { "input": "10000 10000 10000", "output": "990000" }, { "input": "67 1 3", "output": "2" }, { "input": "7878 4534 9159", "output": "717013" }, { "input": "1 1 1", "output": "0" }, { "input": "3271 5 50", "output": "1631" } ]
1,368,565,429
2,147,483,647
Python 3
OK
TESTS
43
93
102,400
from math import ceil n,x,y=map(int,input().split()) ans=max(0,ceil(y*n/100.0-x)) print(ans)
Title: Wizards and Demonstration Time Limit: None seconds Memory Limit: None megabytes Problem Description: Some country is populated by wizards. They want to organize a demonstration. There are *n* people living in the city, *x* of them are the wizards who will surely go to the demonstration. Other city people (*n*<=-<=*x* people) do not support the wizards and aren't going to go to the demonstration. We know that the city administration will react only to the demonstration involving at least *y* percent of the city people. Having considered the matter, the wizards decided to create clone puppets which can substitute the city people on the demonstration. So all in all, the demonstration will involve only the wizards and their puppets. The city administration cannot tell the difference between a puppet and a person, so, as they calculate the percentage, the administration will consider the city to be consisting of only *n* people and not containing any clone puppets. Help the wizards and find the minimum number of clones to create to that the demonstration had no less than *y* percent of the city people. Input Specification: The first line contains three space-separated integers, *n*, *x*, *y* (1<=≤<=*n*,<=*x*,<=*y*<=≤<=104,<=*x*<=≤<=*n*) — the number of citizens in the city, the number of wizards and the percentage the administration needs, correspondingly. Please note that *y* can exceed 100 percent, that is, the administration wants to see on a demonstration more people that actually live in the city (<=&gt;<=*n*). Output Specification: Print a single integer — the answer to the problem, the minimum number of clones to create, so that the demonstration involved no less than *y* percent of *n* (the real total city population). Demo Input: ['10 1 14\n', '20 10 50\n', '1000 352 146\n'] Demo Output: ['1\n', '0\n', '1108\n'] Note: In the first sample it is necessary that at least 14% of 10 people came to the demonstration. As the number of people should be integer, then at least two people should come. There is only one wizard living in the city and he is going to come. That isn't enough, so he needs to create one clone. In the second sample 10 people should come to the demonstration. The city has 10 wizards. They will all come to the demonstration, so nobody has to create any clones.
```python from math import ceil n,x,y=map(int,input().split()) ans=max(0,ceil(y*n/100.0-x)) print(ans) ```
3
515
A
Drazil and Date
PROGRAMMING
1,000
[ "math" ]
null
null
Someday, Drazil wanted to go on date with Varda. Drazil and Varda live on Cartesian plane. Drazil's home is located in point (0,<=0) and Varda's home is located in point (*a*,<=*b*). In each step, he can move in a unit distance in horizontal or vertical direction. In other words, from position (*x*,<=*y*) he can go to positions (*x*<=+<=1,<=*y*), (*x*<=-<=1,<=*y*), (*x*,<=*y*<=+<=1) or (*x*,<=*y*<=-<=1). Unfortunately, Drazil doesn't have sense of direction. So he randomly chooses the direction he will go to in each step. He may accidentally return back to his house during his travel. Drazil may even not notice that he has arrived to (*a*,<=*b*) and continue travelling. Luckily, Drazil arrived to the position (*a*,<=*b*) successfully. Drazil said to Varda: "It took me exactly *s* steps to travel from my house to yours". But Varda is confused about his words, she is not sure that it is possible to get from (0,<=0) to (*a*,<=*b*) in exactly *s* steps. Can you find out if it is possible for Varda?
You are given three integers *a*, *b*, and *s* (<=-<=109<=≤<=*a*,<=*b*<=≤<=109, 1<=≤<=*s*<=≤<=2·109) in a single line.
If you think Drazil made a mistake and it is impossible to take exactly *s* steps and get from his home to Varda's home, print "No" (without quotes). Otherwise, print "Yes".
[ "5 5 11\n", "10 15 25\n", "0 5 1\n", "0 0 2\n" ]
[ "No\n", "Yes\n", "No\n", "Yes\n" ]
In fourth sample case one possible route is: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/0d30660ddf6eb6c64ffd071055a4e8ddd016cde5.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
500
[ { "input": "5 5 11", "output": "No" }, { "input": "10 15 25", "output": "Yes" }, { "input": "0 5 1", "output": "No" }, { "input": "0 0 2", "output": "Yes" }, { "input": "999999999 999999999 2000000000", "output": "Yes" }, { "input": "-606037695 998320124 820674098", "output": "No" }, { "input": "948253616 -83299062 1031552680", "output": "Yes" }, { "input": "711980199 216568284 928548487", "output": "Yes" }, { "input": "-453961301 271150176 725111473", "output": "No" }, { "input": "0 0 2000000000", "output": "Yes" }, { "input": "0 0 1999999999", "output": "No" }, { "input": "1000000000 1000000000 2000000000", "output": "Yes" }, { "input": "-1000000000 1000000000 2000000000", "output": "Yes" }, { "input": "-1000000000 -1000000000 2000000000", "output": "Yes" }, { "input": "-1000000000 -1000000000 1000000000", "output": "No" }, { "input": "-1 -1 3", "output": "No" }, { "input": "919785634 216774719 129321944", "output": "No" }, { "input": "-467780354 -721273539 1369030008", "output": "No" }, { "input": "-232833910 -880680184 1774549792", "output": "Yes" }, { "input": "45535578 402686155 1011249824", "output": "No" }, { "input": "-203250176 -30379840 233630015", "output": "No" }, { "input": "-814516648 -75830576 890347222", "output": "No" }, { "input": "869184175 -511854751 1381038923", "output": "No" }, { "input": "552884998 -262338193 815223187", "output": "No" }, { "input": "-133874494 857573117 991447611", "output": "Yes" }, { "input": "169406792 786701289 956108082", "output": "No" }, { "input": "30237137 -989203246 1019440385", "output": "Yes" }, { "input": "576608216 -617624133 1194232352", "output": "No" }, { "input": "-662360368 97618995 759979367", "output": "Yes" }, { "input": "-115989290 321714461 437703756", "output": "No" }, { "input": "-1 -3 2", "output": "No" }, { "input": "-2 -2 2", "output": "No" }, { "input": "0 0 1", "output": "No" }, { "input": "0 -1 7", "output": "Yes" }, { "input": "1 2 7", "output": "Yes" }, { "input": "0 5 6", "output": "No" }, { "input": "0 -4 2", "output": "No" }, { "input": "-5 5 2", "output": "No" }, { "input": "-5 -2 7", "output": "Yes" }, { "input": "5 -5 2", "output": "No" } ]
1,596,911,854
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
8
108
6,656,000
# https://codeforces.com/contest/515/problem/A a,b,s = [int(x) for x in input().split()] if(s < a + b): print("No") else: if ((s - (a+b))%2 == 0): print("Yes") else: print("No")
Title: Drazil and Date Time Limit: None seconds Memory Limit: None megabytes Problem Description: Someday, Drazil wanted to go on date with Varda. Drazil and Varda live on Cartesian plane. Drazil's home is located in point (0,<=0) and Varda's home is located in point (*a*,<=*b*). In each step, he can move in a unit distance in horizontal or vertical direction. In other words, from position (*x*,<=*y*) he can go to positions (*x*<=+<=1,<=*y*), (*x*<=-<=1,<=*y*), (*x*,<=*y*<=+<=1) or (*x*,<=*y*<=-<=1). Unfortunately, Drazil doesn't have sense of direction. So he randomly chooses the direction he will go to in each step. He may accidentally return back to his house during his travel. Drazil may even not notice that he has arrived to (*a*,<=*b*) and continue travelling. Luckily, Drazil arrived to the position (*a*,<=*b*) successfully. Drazil said to Varda: "It took me exactly *s* steps to travel from my house to yours". But Varda is confused about his words, she is not sure that it is possible to get from (0,<=0) to (*a*,<=*b*) in exactly *s* steps. Can you find out if it is possible for Varda? Input Specification: You are given three integers *a*, *b*, and *s* (<=-<=109<=≤<=*a*,<=*b*<=≤<=109, 1<=≤<=*s*<=≤<=2·109) in a single line. Output Specification: If you think Drazil made a mistake and it is impossible to take exactly *s* steps and get from his home to Varda's home, print "No" (without quotes). Otherwise, print "Yes". Demo Input: ['5 5 11\n', '10 15 25\n', '0 5 1\n', '0 0 2\n'] Demo Output: ['No\n', 'Yes\n', 'No\n', 'Yes\n'] Note: In fourth sample case one possible route is: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/0d30660ddf6eb6c64ffd071055a4e8ddd016cde5.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
```python # https://codeforces.com/contest/515/problem/A a,b,s = [int(x) for x in input().split()] if(s < a + b): print("No") else: if ((s - (a+b))%2 == 0): print("Yes") else: print("No") ```
0
644
A
Parliament of Berland
PROGRAMMING
1,000
[ "*special", "constructive algorithms" ]
null
null
There are *n* parliamentarians in Berland. They are numbered with integers from 1 to *n*. It happened that all parliamentarians with odd indices are Democrats and all parliamentarians with even indices are Republicans. New parliament assembly hall is a rectangle consisting of *a*<=×<=*b* chairs — *a* rows of *b* chairs each. Two chairs are considered neighbouring if they share as side. For example, chair number 5 in row number 2 is neighbouring to chairs number 4 and 6 in this row and chairs with number 5 in rows 1 and 3. Thus, chairs have four neighbours in general, except for the chairs on the border of the hall We know that if two parliamentarians from one political party (that is two Democrats or two Republicans) seat nearby they spent all time discussing internal party issues. Write the program that given the number of parliamentarians and the sizes of the hall determine if there is a way to find a seat for any parliamentarian, such that no two members of the same party share neighbouring seats.
The first line of the input contains three integers *n*, *a* and *b* (1<=≤<=*n*<=≤<=10<=000, 1<=≤<=*a*,<=*b*<=≤<=100) — the number of parliamentarians, the number of rows in the assembly hall and the number of seats in each row, respectively.
If there is no way to assigns seats to parliamentarians in a proper way print -1. Otherwise print the solution in *a* lines, each containing *b* integers. The *j*-th integer of the *i*-th line should be equal to the index of parliamentarian occupying this seat, or 0 if this seat should remain empty. If there are multiple possible solution, you may print any of them.
[ "3 2 2\n", "8 4 3\n", "10 2 2\n" ]
[ "0 3\n1 2\n", "7 8 3\n0 1 4\n6 0 5\n0 2 0\n", "-1\n" ]
In the first sample there are many other possible solutions. For example, and The following assignment is incorrect, because parliamentarians 1 and 3 are both from Democrats party but will occupy neighbouring seats.
500
[ { "input": "3 2 2", "output": "1 2 \n0 3 " }, { "input": "8 4 3", "output": "1 2 3 \n4 5 6 \n7 8 0 \n0 0 0 " }, { "input": "10 2 2", "output": "-1" }, { "input": "1 1 1", "output": "1 " }, { "input": "8 3 3", "output": "1 2 3 \n4 5 6 \n7 8 0 " }, { "input": "1 1 100", "output": "1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 " }, { "input": "1 100 1", "output": "1 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 \n0 " }, { "input": "12 4 3", "output": "1 2 3 \n4 5 6 \n7 8 9 \n10 11 12 " }, { "input": "64 8 9", "output": "1 2 3 4 5 6 7 8 9 \n10 11 12 13 14 15 16 17 18 \n19 20 21 22 23 24 25 26 27 \n28 29 30 31 32 33 34 35 36 \n37 38 39 40 41 42 43 44 45 \n46 47 48 49 50 51 52 53 54 \n55 56 57 58 59 60 61 62 63 \n64 0 0 0 0 0 0 0 0 " }, { "input": "13 2 6", "output": "-1" }, { "input": "41 6 7", "output": "1 2 3 4 5 6 7 \n8 9 10 11 12 13 14 \n15 16 17 18 19 20 21 \n22 23 24 25 26 27 28 \n29 30 31 32 33 34 35 \n36 37 38 39 40 41 0 " }, { "input": "9999 100 100", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 \n102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 138 137 140 139 142 141 144 143 146 145 148 147 150 149 152 151 154 153 1..." }, { "input": "10000 100 100", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 \n102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 138 137 140 139 142 141 144 143 146 145 148 147 150 149 152 151 154 153 1..." }, { "input": "2099 70 30", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 \n32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 \n61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 \n92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 \n121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 \n152 151 1..." }, { "input": "2098 30 70", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 \n72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 138 137 140 139 \n141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "10000 1 1", "output": "-1" }, { "input": "1583 49 36", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 \n38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 \n73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 \n110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 138 137 140 139 142 141 144 143 \n145 146 147 148 149 150 151 152 153..." }, { "input": "4825 77 88", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 \n90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 138 137 140 139 142 141 144 143 146 145 148 147 150 149 152 151 154 153 1..." }, { "input": "26 1 33", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 0 0 0 0 0 0 0 " }, { "input": "274 25 77", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 \n78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 \n..." }, { "input": "694 49 22", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 \n24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 \n45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 \n68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 \n89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 \n112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 \n133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152..." }, { "input": "3585 77 62", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 \n64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 \n125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "3 1 6", "output": "1 2 3 0 0 0 " }, { "input": "352 25 59", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 \n60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 \n119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "150 53 3", "output": "1 2 3 \n4 5 6 \n7 8 9 \n10 11 12 \n13 14 15 \n16 17 18 \n19 20 21 \n22 23 24 \n25 26 27 \n28 29 30 \n31 32 33 \n34 35 36 \n37 38 39 \n40 41 42 \n43 44 45 \n46 47 48 \n49 50 51 \n52 53 54 \n55 56 57 \n58 59 60 \n61 62 63 \n64 65 66 \n67 68 69 \n70 71 72 \n73 74 75 \n76 77 78 \n79 80 81 \n82 83 84 \n85 86 87 \n88 89 90 \n91 92 93 \n94 95 96 \n97 98 99 \n100 101 102 \n103 104 105 \n106 107 108 \n109 110 111 \n112 113 114 \n115 116 117 \n118 119 120 \n121 122 123 \n124 125 126 \n127 128 129 \n130 131 132 \n133..." }, { "input": "4227 91 80", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 \n82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 138 137 140 139 142 141 144 143 146 145 148 147 150 149 152 151 154 153 1..." }, { "input": "378 19 25", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 \n26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 \n51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 \n76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 \n101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 \n126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 \n151 152..." }, { "input": "2357 43 65", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 \n66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 \n131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "232 71 9", "output": "1 2 3 4 5 6 7 8 9 \n10 11 12 13 14 15 16 17 18 \n19 20 21 22 23 24 25 26 27 \n28 29 30 31 32 33 34 35 36 \n37 38 39 40 41 42 43 44 45 \n46 47 48 49 50 51 52 53 54 \n55 56 57 58 59 60 61 62 63 \n64 65 66 67 68 69 70 71 72 \n73 74 75 76 77 78 79 80 81 \n82 83 84 85 86 87 88 89 90 \n91 92 93 94 95 96 97 98 99 \n100 101 102 103 104 105 106 107 108 \n109 110 111 112 113 114 115 116 117 \n118 119 120 121 122 123 124 125 126 \n127 128 129 130 131 132 133 134 135 \n136 137 138 139 140 141 142 143 144 \n145 146 147..." }, { "input": "2362 91 62", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 \n64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 \n125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "4601 59 78", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 \n80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 138 137 140 139 142 141 144 143 146 145 148 147 150 149 152 151 154 153 1..." }, { "input": "4439 74 60", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 \n62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 \n121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "3733 89 42", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 \n44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 \n85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 \n128 127 130 129 132 131 134 133 136 135 138 137 140 139 142 141 144 143 146 145 148 147 150 149 152 151 154 1..." }, { "input": "335 12 28", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 \n30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 \n57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 \n86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 \n113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 \n142 141 144 143 146 145 148 147 150 149 152 151 1..." }, { "input": "440 26 17", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 \n18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 \n35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 \n52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 \n69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 \n86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 \n103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 \n120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 \n137 138 139 140 141 142 143 144 145 146 147 148 149 150 151..." }, { "input": "109 37 3", "output": "1 2 3 \n4 5 6 \n7 8 9 \n10 11 12 \n13 14 15 \n16 17 18 \n19 20 21 \n22 23 24 \n25 26 27 \n28 29 30 \n31 32 33 \n34 35 36 \n37 38 39 \n40 41 42 \n43 44 45 \n46 47 48 \n49 50 51 \n52 53 54 \n55 56 57 \n58 59 60 \n61 62 63 \n64 65 66 \n67 68 69 \n70 71 72 \n73 74 75 \n76 77 78 \n79 80 81 \n82 83 84 \n85 86 87 \n88 89 90 \n91 92 93 \n94 95 96 \n97 98 99 \n100 101 102 \n103 104 105 \n106 107 108 \n109 0 0 " }, { "input": "4416 52 85", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 \n86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "5025 75 67", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 \n68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 \n135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "4983 89 56", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 \n58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 \n113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "950 17 56", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 \n58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 \n113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "1637 40 41", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 \n42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 \n83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 \n124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..." }, { "input": "1142 52 22", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 \n24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 \n45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 \n68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 \n89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 \n112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 \n133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152..." }, { "input": "907 70 13", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 \n14 15 16 17 18 19 20 21 22 23 24 25 26 \n27 28 29 30 31 32 33 34 35 36 37 38 39 \n40 41 42 43 44 45 46 47 48 49 50 51 52 \n53 54 55 56 57 58 59 60 61 62 63 64 65 \n66 67 68 69 70 71 72 73 74 75 76 77 78 \n79 80 81 82 83 84 85 86 87 88 89 90 91 \n92 93 94 95 96 97 98 99 100 101 102 103 104 \n105 106 107 108 109 110 111 112 113 114 115 116 117 \n118 119 120 121 122 123 124 125 126 127 128 129 130 \n131 132 133 134 135 136 137 138 139 140 141 142 143 \n144 145 146 147 148 149 1..." }, { "input": "7279 80 91", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 \n92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "1653 87 19", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 \n20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 \n39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 \n58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 \n77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 \n96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 \n115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 \n134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 1..." }, { "input": "15 2 8", "output": "1 2 3 4 5 6 7 8 \n10 9 12 11 14 13 0 15 " }, { "input": "1459 17 86", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 \n88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 138 137 140 139 142 141 144 143 146 145 148 147 150 149 152 151 154 153 1..." }, { "input": "3035 40 76", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 \n78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 138 137 140 139 142 141 144 143 146 145 148 147 150 149 152 151 \n153 154..." }, { "input": "3095 50 62", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 \n64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 \n125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "3055 65 47", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 \n48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 \n95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 \n142 143 144 145 146 147 148 149 150 151 152 153 1..." }, { "input": "2638 80 33", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 \n34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 \n67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 \n100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 \n133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153..." }, { "input": "29 3 11", "output": "1 2 3 4 5 6 7 8 9 10 11 \n12 13 14 15 16 17 18 19 20 21 22 \n23 24 25 26 27 28 29 0 0 0 0 " }, { "input": "16 18 1", "output": "1 \n2 \n3 \n4 \n5 \n6 \n7 \n8 \n9 \n10 \n11 \n12 \n13 \n14 \n15 \n16 \n0 \n0 " }, { "input": "2240 27 83", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 \n84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "1264 55 23", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 \n24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 \n47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 \n70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 \n93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 \n116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 \n139 140 141 142 143 144 145 146 147 148 149 150 151 152..." }, { "input": "5400 75 72", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 \n74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 138 137 140 139 142 141 144 143 \n145 146 147 148 149 150 151 152 153 154..." }, { "input": "46 3 16", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 \n18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 \n33 34 35 36 37 38 39 40 41 42 43 44 45 46 0 0 " }, { "input": "1512 27 56", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 \n58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 \n113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "4206 86 12", "output": "-1" }, { "input": "2358 14 56", "output": "-1" }, { "input": "5420 35 96", "output": "-1" }, { "input": "7758 63 41", "output": "-1" }, { "input": "9806 87 93", "output": "-1" }, { "input": "99 1 97", "output": "-1" }, { "input": "1053 25 42", "output": "-1" }, { "input": "4217 49 86", "output": "-1" }, { "input": "2312 77 30", "output": "-1" }, { "input": "74 1 71", "output": "-1" }, { "input": "1 99 100", "output": "1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "1 57 99", "output": "1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "4785 55 87", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 \n88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "4611 53 87", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 \n88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "9801 99 99", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 \n100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "8096 92 88", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 \n90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 138 137 140 139 142 141 144 143 146 145 148 147 150 149 152 151 154 153 1..." }, { "input": "5916 68 87", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 \n88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "8928 93 96", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 \n98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 138 137 140 139 142 141 144 143 146 145 148 147 150 149 152 151 154 153 1..." }, { "input": "7743 89 87", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 \n88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "3128 46 68", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 \n70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 \n137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "3800 40 95", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 \n96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "5368 61 88", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 \n90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 138 137 140 139 142 141 144 143 146 145 148 147 150 149 152 151 154 153 1..." }, { "input": "2583 41 63", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 \n64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 \n127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." }, { "input": "4056 52 78", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 \n80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 138 137 140 139 142 141 144 143 146 145 148 147 150 149 152 151 154 153 1..." }, { "input": "3822 42 91", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 \n92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "5358 57 94", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 \n96 95 98 97 100 99 102 101 104 103 106 105 108 107 110 109 112 111 114 113 116 115 118 117 120 119 122 121 124 123 126 125 128 127 130 129 132 131 134 133 136 135 138 137 140 139 142 141 144 143 146 145 148 147 150 149 152 151 154 153 1..." }, { "input": "2961 47 63", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 \n64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 \n127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..." } ]
1,625,578,088
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
78
1,228,800
from collections import deque, defaultdict, Counter from itertools import product, groupby, permutations, combinations from math import gcd, floor, inf, log2, sqrt, log10 from bisect import bisect_right, bisect_left from statistics import mode from string import ascii_uppercase n, c, r = map(int, input().split()) if n > c*r: print(-1) else: next = 1 ans = [[0] * r for i in range(c)] for i in range(c): for j in range(r): if (i+j)%2 == 0: if next <= n: ans[i][j] = next next+=1 else: break else: if next <= n: ans[i][j] = next next += 1 else: break for row in ans: print(*row)
Title: Parliament of Berland Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* parliamentarians in Berland. They are numbered with integers from 1 to *n*. It happened that all parliamentarians with odd indices are Democrats and all parliamentarians with even indices are Republicans. New parliament assembly hall is a rectangle consisting of *a*<=×<=*b* chairs — *a* rows of *b* chairs each. Two chairs are considered neighbouring if they share as side. For example, chair number 5 in row number 2 is neighbouring to chairs number 4 and 6 in this row and chairs with number 5 in rows 1 and 3. Thus, chairs have four neighbours in general, except for the chairs on the border of the hall We know that if two parliamentarians from one political party (that is two Democrats or two Republicans) seat nearby they spent all time discussing internal party issues. Write the program that given the number of parliamentarians and the sizes of the hall determine if there is a way to find a seat for any parliamentarian, such that no two members of the same party share neighbouring seats. Input Specification: The first line of the input contains three integers *n*, *a* and *b* (1<=≤<=*n*<=≤<=10<=000, 1<=≤<=*a*,<=*b*<=≤<=100) — the number of parliamentarians, the number of rows in the assembly hall and the number of seats in each row, respectively. Output Specification: If there is no way to assigns seats to parliamentarians in a proper way print -1. Otherwise print the solution in *a* lines, each containing *b* integers. The *j*-th integer of the *i*-th line should be equal to the index of parliamentarian occupying this seat, or 0 if this seat should remain empty. If there are multiple possible solution, you may print any of them. Demo Input: ['3 2 2\n', '8 4 3\n', '10 2 2\n'] Demo Output: ['0 3\n1 2\n', '7 8 3\n0 1 4\n6 0 5\n0 2 0\n', '-1\n'] Note: In the first sample there are many other possible solutions. For example, and The following assignment is incorrect, because parliamentarians 1 and 3 are both from Democrats party but will occupy neighbouring seats.
```python from collections import deque, defaultdict, Counter from itertools import product, groupby, permutations, combinations from math import gcd, floor, inf, log2, sqrt, log10 from bisect import bisect_right, bisect_left from statistics import mode from string import ascii_uppercase n, c, r = map(int, input().split()) if n > c*r: print(-1) else: next = 1 ans = [[0] * r for i in range(c)] for i in range(c): for j in range(r): if (i+j)%2 == 0: if next <= n: ans[i][j] = next next+=1 else: break else: if next <= n: ans[i][j] = next next += 1 else: break for row in ans: print(*row) ```
0
219
A
k-String
PROGRAMMING
1,000
[ "implementation", "strings" ]
null
null
A string is called a *k*-string if it can be represented as *k* concatenated copies of some string. For example, the string "aabaabaabaab" is at the same time a 1-string, a 2-string and a 4-string, but it is not a 3-string, a 5-string, or a 6-string and so on. Obviously any string is a 1-string. You are given a string *s*, consisting of lowercase English letters and a positive integer *k*. Your task is to reorder the letters in the string *s* in such a way that the resulting string is a *k*-string.
The first input line contains integer *k* (1<=≤<=*k*<=≤<=1000). The second line contains *s*, all characters in *s* are lowercase English letters. The string length *s* satisfies the inequality 1<=≤<=|*s*|<=≤<=1000, where |*s*| is the length of string *s*.
Rearrange the letters in string *s* in such a way that the result is a *k*-string. Print the result on a single output line. If there are multiple solutions, print any of them. If the solution doesn't exist, print "-1" (without quotes).
[ "2\naazz\n", "3\nabcabcabz\n" ]
[ "azaz\n", "-1\n" ]
none
500
[ { "input": "2\naazz", "output": "azaz" }, { "input": "3\nabcabcabz", "output": "-1" }, { "input": "1\na", "output": "a" }, { "input": "2\nabba", "output": "abab" }, { "input": "2\naaab", "output": "-1" }, { "input": "7\nabacaba", "output": "-1" }, { "input": "5\naaaaa", "output": "aaaaa" }, { "input": "3\naabaaaaabb", "output": "-1" }, { "input": "2\naaab", "output": "-1" }, { "input": "2\nbabac", "output": "-1" }, { "input": "3\nbbbccc", "output": "bcbcbc" }, { "input": "2\naa", "output": "aa" }, { "input": "250\ncececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececece", "output": "cececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececece" }, { "input": "15\nabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaa", "output": "aaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbc" }, { "input": "1\naaa", "output": "aaa" }, { "input": "1\naabaab", "output": "aaaabb" }, { "input": "2\naabbbbccccccdddddddd", "output": "abbcccddddabbcccdddd" }, { "input": "3\naaaaaaaaacccdddddd", "output": "aaacddaaacddaaacdd" }, { "input": "3\naaaaaaaaacccbbbbbb", "output": "aaabbcaaabbcaaabbc" }, { "input": "2\naazzzz", "output": "azzazz" }, { "input": "2\naaaa", "output": "aaaa" }, { "input": "2\naaaazz", "output": "aazaaz" }, { "input": "2\naaaabb", "output": "aabaab" }, { "input": "2\naabbbb", "output": "abbabb" }, { "input": "2\naaaazzzz", "output": "aazzaazz" }, { "input": "2\naaazz", "output": "-1" }, { "input": "2\nbbbbaa", "output": "abbabb" }, { "input": "2\naaaaaabbbb", "output": "aaabbaaabb" }, { "input": "2\naaaaaazz", "output": "aaazaaaz" }, { "input": "2\naaaabbbb", "output": "aabbaabb" }, { "input": "2\naabaab", "output": "aabaab" }, { "input": "1\naaaaa", "output": "aaaaa" }, { "input": "2\nbbaaaa", "output": "aabaab" }, { "input": "2\nacaccc", "output": "accacc" } ]
1,695,150,627
2,147,483,647
PyPy 3-64
OK
TESTS
42
124
0
k = int(input()) s = input() result = "" betuk = [0]*26 for letter in s: betuk[ord(letter)-97] += 1 for i in range(26): if betuk[i] % k != 0: result = "-1" break else: result += chr(i+97)*(betuk[i] // k) if result == "-1": print(result) else: print(result*k)
Title: k-String Time Limit: None seconds Memory Limit: None megabytes Problem Description: A string is called a *k*-string if it can be represented as *k* concatenated copies of some string. For example, the string "aabaabaabaab" is at the same time a 1-string, a 2-string and a 4-string, but it is not a 3-string, a 5-string, or a 6-string and so on. Obviously any string is a 1-string. You are given a string *s*, consisting of lowercase English letters and a positive integer *k*. Your task is to reorder the letters in the string *s* in such a way that the resulting string is a *k*-string. Input Specification: The first input line contains integer *k* (1<=≤<=*k*<=≤<=1000). The second line contains *s*, all characters in *s* are lowercase English letters. The string length *s* satisfies the inequality 1<=≤<=|*s*|<=≤<=1000, where |*s*| is the length of string *s*. Output Specification: Rearrange the letters in string *s* in such a way that the result is a *k*-string. Print the result on a single output line. If there are multiple solutions, print any of them. If the solution doesn't exist, print "-1" (without quotes). Demo Input: ['2\naazz\n', '3\nabcabcabz\n'] Demo Output: ['azaz\n', '-1\n'] Note: none
```python k = int(input()) s = input() result = "" betuk = [0]*26 for letter in s: betuk[ord(letter)-97] += 1 for i in range(26): if betuk[i] % k != 0: result = "-1" break else: result += chr(i+97)*(betuk[i] // k) if result == "-1": print(result) else: print(result*k) ```
3
58
A
Chat room
PROGRAMMING
1,000
[ "greedy", "strings" ]
A. Chat room
1
256
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
If Vasya managed to say hello, print "YES", otherwise print "NO".
[ "ahhellllloou\n", "hlelo\n" ]
[ "YES\n", "NO\n" ]
none
500
[ { "input": "ahhellllloou", "output": "YES" }, { "input": "hlelo", "output": "NO" }, { "input": "helhcludoo", "output": "YES" }, { "input": "hehwelloho", "output": "YES" }, { "input": "pnnepelqomhhheollvlo", "output": "YES" }, { "input": "tymbzjyqhymedasloqbq", "output": "NO" }, { "input": "yehluhlkwo", "output": "NO" }, { "input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello", "output": "YES" }, { "input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq", "output": "YES" }, { "input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi", "output": "YES" }, { "input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo", "output": "YES" }, { "input": "lqllcolohwflhfhlnaow", "output": "NO" }, { "input": "heheeellollvoo", "output": "YES" }, { "input": "hellooo", "output": "YES" }, { "input": "o", "output": "NO" }, { "input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv", "output": "YES" }, { "input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk", "output": "YES" }, { "input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry", "output": "NO" }, { "input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq", "output": "NO" }, { "input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi", "output": "YES" }, { "input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm", "output": "YES" }, { "input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac", "output": "NO" }, { "input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok", "output": "YES" }, { "input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz", "output": "YES" }, { "input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb", "output": "YES" }, { "input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla", "output": "YES" }, { "input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz", "output": "YES" }, { "input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti", "output": "YES" }, { "input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli", "output": "YES" }, { "input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo", "output": "YES" }, { "input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk", "output": "NO" }, { "input": "loee", "output": "NO" }, { "input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo", "output": "NO" }, { "input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi", "output": "YES" }, { "input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv", "output": "NO" }, { "input": "hello", "output": "YES" }, { "input": "oohell", "output": "NO" }, { "input": "hell", "output": "NO" }, { "input": "eloellohoelo", "output": "NO" }, { "input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo", "output": "YES" } ]
1,673,853,774
2,147,483,647
PyPy 3
RUNTIME_ERROR
TESTS
0
77
2,048,000
s=input() h='hello' j=0 c=0 for i in range(len(s)): if s[i]==h[j]: j+=1 c+=1 if c==5: print('YES') else: print('NO')
Title: Chat room Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*. Input Specification: The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters. Output Specification: If Vasya managed to say hello, print "YES", otherwise print "NO". Demo Input: ['ahhellllloou\n', 'hlelo\n'] Demo Output: ['YES\n', 'NO\n'] Note: none
```python s=input() h='hello' j=0 c=0 for i in range(len(s)): if s[i]==h[j]: j+=1 c+=1 if c==5: print('YES') else: print('NO') ```
-1
478
B
Random Teams
PROGRAMMING
1,300
[ "combinatorics", "constructive algorithms", "greedy", "math" ]
null
null
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends. Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
[ "5 1\n", "3 2\n", "6 3\n" ]
[ "10 10\n", "1 1\n", "3 6\n" ]
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends. In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one. In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
1,000
[ { "input": "5 1", "output": "10 10" }, { "input": "3 2", "output": "1 1" }, { "input": "6 3", "output": "3 6" }, { "input": "5 3", "output": "2 3" }, { "input": "10 2", "output": "20 36" }, { "input": "10 6", "output": "4 10" }, { "input": "1000000000 1", "output": "499999999500000000 499999999500000000" }, { "input": "5000000 12", "output": "1041664166668 12499942500066" }, { "input": "1833 195", "output": "7722 1342341" }, { "input": "1000000000 1000000000", "output": "0 0" }, { "input": "1000000000 1000000", "output": "499500000000 499000500499500000" }, { "input": "1000000000 32170", "output": "15541930838100 499967831017438365" }, { "input": "1000000 1000", "output": "499500000 499000999500" }, { "input": "1234 1123", "output": "111 6216" }, { "input": "599222887 298488", "output": "601178656545 179355218158217800" }, { "input": "999999999 500000000", "output": "499999999 124999999750000000" }, { "input": "1000000000 384842119", "output": "845473643 189209609585784021" }, { "input": "1000000000 384842119", "output": "845473643 189209609585784021" }, { "input": "1000000000 2", "output": "249999999500000000 499999998500000001" }, { "input": "1000000000 999999999", "output": "1 1" }, { "input": "38447 383", "output": "1910550 724453080" }, { "input": "100000000 99999799", "output": "201 20301" }, { "input": "1 1", "output": "0 0" }, { "input": "2 1", "output": "1 1" }, { "input": "2 2", "output": "0 0" }, { "input": "10 10", "output": "0 0" } ]
1,663,652,672
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
46
0
import math n, m = map(int, input().split()) max_val = (n-m+1)*(n-m)/2 if(n%m==0): x=n/m min_val=((x*(x-1))/2)*m else: x=(n/m) x = int(math.floor(x)) y = ((n-(n%m))/x) z = n%m min_val=((y*(y-1))/2)*(m-1) + (((z-1)*z/2)*1) print(int(math.floor(min_val)), int(max_val))
Title: Random Teams Time Limit: None seconds Memory Limit: None megabytes Problem Description: *n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends. Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition. Input Specification: The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively. Output Specification: The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively. Demo Input: ['5 1\n', '3 2\n', '6 3\n'] Demo Output: ['10 10\n', '1 1\n', '3 6\n'] Note: In the first sample all the participants get into one team, so there will be exactly ten pairs of friends. In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one. In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
```python import math n, m = map(int, input().split()) max_val = (n-m+1)*(n-m)/2 if(n%m==0): x=n/m min_val=((x*(x-1))/2)*m else: x=(n/m) x = int(math.floor(x)) y = ((n-(n%m))/x) z = n%m min_val=((y*(y-1))/2)*(m-1) + (((z-1)*z/2)*1) print(int(math.floor(min_val)), int(max_val)) ```
0
784
A
Numbers Joke
PROGRAMMING
1,700
[ "*special" ]
null
null
The input contains a single integer *a* (1<=≤<=*a*<=≤<=30). Output a single integer.
The input contains a single integer *a* (1<=≤<=*a*<=≤<=30).
Output a single integer.
[ "3\n" ]
[ "27\n" ]
none
0
[ { "input": "3", "output": "27" }, { "input": "1", "output": "4" }, { "input": "2", "output": "22" }, { "input": "4", "output": "58" }, { "input": "5", "output": "85" }, { "input": "6", "output": "94" }, { "input": "7", "output": "121" }, { "input": "8", "output": "166" }, { "input": "9", "output": "202" }, { "input": "10", "output": "265" }, { "input": "11", "output": "274" }, { "input": "12", "output": "319" }, { "input": "13", "output": "346" }, { "input": "14", "output": "355" }, { "input": "15", "output": "378" }, { "input": "16", "output": "382" }, { "input": "17", "output": "391" }, { "input": "18", "output": "438" }, { "input": "19", "output": "454" }, { "input": "20", "output": "483" }, { "input": "21", "output": "517" }, { "input": "22", "output": "526" }, { "input": "23", "output": "535" }, { "input": "24", "output": "562" }, { "input": "25", "output": "576" }, { "input": "26", "output": "588" }, { "input": "27", "output": "627" }, { "input": "28", "output": "634" }, { "input": "29", "output": "636" }, { "input": "30", "output": "645" } ]
1,514,993,389
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
61
5,529,600
a = int(input()) print(pow(a,a))
Title: Numbers Joke Time Limit: None seconds Memory Limit: None megabytes Problem Description: The input contains a single integer *a* (1<=≤<=*a*<=≤<=30). Output a single integer. Input Specification: The input contains a single integer *a* (1<=≤<=*a*<=≤<=30). Output Specification: Output a single integer. Demo Input: ['3\n'] Demo Output: ['27\n'] Note: none
```python a = int(input()) print(pow(a,a)) ```
0
0
none
none
none
0
[ "none" ]
null
null
Vasya the programmer lives in the middle of the Programming subway branch. He has two girlfriends: Dasha and Masha, who live at the different ends of the branch, each one is unaware of the other one's existence. When Vasya has some free time, he goes to one of his girlfriends. He descends into the subway at some time, waits the first train to come and rides on it to the end of the branch to the corresponding girl. However, the trains run with different frequencies: a train goes to Dasha's direction every *a* minutes, but a train goes to Masha's direction every *b* minutes. If two trains approach at the same time, Vasya goes toward the direction with the lower frequency of going trains, that is, to the girl, to whose directions the trains go less frequently (see the note to the third sample). We know that the trains begin to go simultaneously before Vasya appears. That is the train schedule is such that there exists a moment of time when the two trains arrive simultaneously. Help Vasya count to which girlfriend he will go more often.
The first line contains two integers *a* and *b* (*a*<=≠<=*b*,<=1<=≤<=*a*,<=*b*<=≤<=106).
Print "Dasha" if Vasya will go to Dasha more frequently, "Masha" if he will go to Masha more frequently, or "Equal" if he will go to both girlfriends with the same frequency.
[ "3 7\n", "5 3\n", "2 3\n" ]
[ "Dasha\n", "Masha\n", "Equal\n" ]
Let's take a look at the third sample. Let the trains start to go at the zero moment of time. It is clear that the moments of the trains' arrival will be periodic with period 6. That's why it is enough to show that if Vasya descends to the subway at a moment of time inside the interval (0, 6], he will go to both girls equally often. If he descends to the subway at a moment of time from 0 to 2, he leaves for Dasha on the train that arrives by the second minute. If he descends to the subway at a moment of time from 2 to 3, he leaves for Masha on the train that arrives by the third minute. If he descends to the subway at a moment of time from 3 to 4, he leaves for Dasha on the train that arrives by the fourth minute. If he descends to the subway at a moment of time from 4 to 6, he waits for both trains to arrive by the sixth minute and goes to Masha as trains go less often in Masha's direction. In sum Masha and Dasha get equal time — three minutes for each one, thus, Vasya will go to both girlfriends equally often.
0
[ { "input": "3 7", "output": "Dasha" }, { "input": "5 3", "output": "Masha" }, { "input": "2 3", "output": "Equal" }, { "input": "31 88", "output": "Dasha" }, { "input": "8 75", "output": "Dasha" }, { "input": "32 99", "output": "Dasha" }, { "input": "77 4", "output": "Masha" }, { "input": "27 1", "output": "Masha" }, { "input": "84 11", "output": "Masha" }, { "input": "4 6", "output": "Equal" }, { "input": "52 53", "output": "Equal" }, { "input": "397 568", "output": "Dasha" }, { "input": "22 332", "output": "Dasha" }, { "input": "419 430", "output": "Dasha" }, { "input": "638 619", "output": "Masha" }, { "input": "393 325", "output": "Masha" }, { "input": "876 218", "output": "Masha" }, { "input": "552 551", "output": "Equal" }, { "input": "906 912", "output": "Equal" }, { "input": "999 996", "output": "Equal" }, { "input": "652 653", "output": "Equal" }, { "input": "3647 7698", "output": "Dasha" }, { "input": "2661 8975", "output": "Dasha" }, { "input": "251 9731", "output": "Dasha" }, { "input": "9886 8671", "output": "Masha" }, { "input": "8545 7312", "output": "Masha" }, { "input": "4982 2927", "output": "Masha" }, { "input": "7660 7658", "output": "Equal" }, { "input": "9846 9844", "output": "Equal" }, { "input": "9632 9640", "output": "Equal" }, { "input": "5036 5037", "output": "Equal" }, { "input": "64854 77725", "output": "Dasha" }, { "input": "4965 85708", "output": "Dasha" }, { "input": "20393 86640", "output": "Dasha" }, { "input": "99207 30728", "output": "Masha" }, { "input": "77545 13842", "output": "Masha" }, { "input": "30362 10712", "output": "Masha" }, { "input": "51291 51292", "output": "Equal" }, { "input": "55381 55382", "output": "Equal" }, { "input": "91560 91550", "output": "Equal" }, { "input": "99087 99090", "output": "Equal" }, { "input": "983794 986389", "output": "Dasha" }, { "input": "779183 786727", "output": "Dasha" }, { "input": "450766 610961", "output": "Dasha" }, { "input": "664690 630787", "output": "Masha" }, { "input": "461363 256765", "output": "Masha" }, { "input": "638067 409048", "output": "Masha" }, { "input": "929061 929052", "output": "Equal" }, { "input": "996219 996216", "output": "Equal" }, { "input": "716249 716248", "output": "Equal" }, { "input": "782250 782252", "output": "Equal" }, { "input": "1 2", "output": "Equal" }, { "input": "2 1", "output": "Equal" }, { "input": "999999 1000000", "output": "Equal" }, { "input": "999997 1000000", "output": "Dasha" }, { "input": "1000000 999993", "output": "Masha" }, { "input": "999983 999979", "output": "Masha" } ]
1,625,062,964
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
2
624
11,468,800
import math import random from queue import Queue import time def divides(a,b): if a//b==a/b: return True return False def main(a,b): multiples=[] multiples.sort() d=0 m=0 last_multiple=0 curr_multiple=0 mult_a=a mult_b=b while curr_multiple!=(a*b): e=curr_multiple if divides(e,a) and divides(e,b): if a>b: d+=(e-last_multiple) else: m+=(e-last_multiple) elif divides(e,a): d+=(e-last_multiple) else: m+=(e-last_multiple) last_multiple=curr_multiple if mult_a<mult_b: curr_multiple=mult_a mult_a+=a else: curr_multiple=mult_b mult_b+=b if d>m: print("Dasha") elif d<m: print("Masha") else: print("Equal") return a,b=list(map(int,input().split())) main(a,b)
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya the programmer lives in the middle of the Programming subway branch. He has two girlfriends: Dasha and Masha, who live at the different ends of the branch, each one is unaware of the other one's existence. When Vasya has some free time, he goes to one of his girlfriends. He descends into the subway at some time, waits the first train to come and rides on it to the end of the branch to the corresponding girl. However, the trains run with different frequencies: a train goes to Dasha's direction every *a* minutes, but a train goes to Masha's direction every *b* minutes. If two trains approach at the same time, Vasya goes toward the direction with the lower frequency of going trains, that is, to the girl, to whose directions the trains go less frequently (see the note to the third sample). We know that the trains begin to go simultaneously before Vasya appears. That is the train schedule is such that there exists a moment of time when the two trains arrive simultaneously. Help Vasya count to which girlfriend he will go more often. Input Specification: The first line contains two integers *a* and *b* (*a*<=≠<=*b*,<=1<=≤<=*a*,<=*b*<=≤<=106). Output Specification: Print "Dasha" if Vasya will go to Dasha more frequently, "Masha" if he will go to Masha more frequently, or "Equal" if he will go to both girlfriends with the same frequency. Demo Input: ['3 7\n', '5 3\n', '2 3\n'] Demo Output: ['Dasha\n', 'Masha\n', 'Equal\n'] Note: Let's take a look at the third sample. Let the trains start to go at the zero moment of time. It is clear that the moments of the trains' arrival will be periodic with period 6. That's why it is enough to show that if Vasya descends to the subway at a moment of time inside the interval (0, 6], he will go to both girls equally often. If he descends to the subway at a moment of time from 0 to 2, he leaves for Dasha on the train that arrives by the second minute. If he descends to the subway at a moment of time from 2 to 3, he leaves for Masha on the train that arrives by the third minute. If he descends to the subway at a moment of time from 3 to 4, he leaves for Dasha on the train that arrives by the fourth minute. If he descends to the subway at a moment of time from 4 to 6, he waits for both trains to arrive by the sixth minute and goes to Masha as trains go less often in Masha's direction. In sum Masha and Dasha get equal time — three minutes for each one, thus, Vasya will go to both girlfriends equally often.
```python import math import random from queue import Queue import time def divides(a,b): if a//b==a/b: return True return False def main(a,b): multiples=[] multiples.sort() d=0 m=0 last_multiple=0 curr_multiple=0 mult_a=a mult_b=b while curr_multiple!=(a*b): e=curr_multiple if divides(e,a) and divides(e,b): if a>b: d+=(e-last_multiple) else: m+=(e-last_multiple) elif divides(e,a): d+=(e-last_multiple) else: m+=(e-last_multiple) last_multiple=curr_multiple if mult_a<mult_b: curr_multiple=mult_a mult_a+=a else: curr_multiple=mult_b mult_b+=b if d>m: print("Dasha") elif d<m: print("Masha") else: print("Equal") return a,b=list(map(int,input().split())) main(a,b) ```
0
6
A
Triangle
PROGRAMMING
900
[ "brute force", "geometry" ]
A. Triangle
2
64
Johnny has a younger sister Anne, who is very clever and smart. As she came home from the kindergarten, she told his brother about the task that her kindergartener asked her to solve. The task was just to construct a triangle out of four sticks of different colours. Naturally, one of the sticks is extra. It is not allowed to break the sticks or use their partial length. Anne has perfectly solved this task, now she is asking Johnny to do the same. The boy answered that he would cope with it without any difficulty. However, after a while he found out that different tricky things can occur. It can happen that it is impossible to construct a triangle of a positive area, but it is possible to construct a degenerate triangle. It can be so, that it is impossible to construct a degenerate triangle even. As Johnny is very lazy, he does not want to consider such a big amount of cases, he asks you to help him.
The first line of the input contains four space-separated positive integer numbers not exceeding 100 — lengthes of the sticks.
Output TRIANGLE if it is possible to construct a non-degenerate triangle. Output SEGMENT if the first case cannot take place and it is possible to construct a degenerate triangle. Output IMPOSSIBLE if it is impossible to construct any triangle. Remember that you are to use three sticks. It is not allowed to break the sticks or use their partial length.
[ "4 2 1 3\n", "7 2 2 4\n", "3 5 9 1\n" ]
[ "TRIANGLE\n", "SEGMENT\n", "IMPOSSIBLE\n" ]
none
0
[ { "input": "4 2 1 3", "output": "TRIANGLE" }, { "input": "7 2 2 4", "output": "SEGMENT" }, { "input": "3 5 9 1", "output": "IMPOSSIBLE" }, { "input": "3 1 5 1", "output": "IMPOSSIBLE" }, { "input": "10 10 10 10", "output": "TRIANGLE" }, { "input": "11 5 6 11", "output": "TRIANGLE" }, { "input": "1 1 1 1", "output": "TRIANGLE" }, { "input": "10 20 30 40", "output": "TRIANGLE" }, { "input": "45 25 5 15", "output": "IMPOSSIBLE" }, { "input": "20 5 8 13", "output": "TRIANGLE" }, { "input": "10 30 7 20", "output": "SEGMENT" }, { "input": "3 2 3 2", "output": "TRIANGLE" }, { "input": "70 10 100 30", "output": "SEGMENT" }, { "input": "4 8 16 2", "output": "IMPOSSIBLE" }, { "input": "3 3 3 10", "output": "TRIANGLE" }, { "input": "1 5 5 5", "output": "TRIANGLE" }, { "input": "13 25 12 1", "output": "SEGMENT" }, { "input": "10 100 7 3", "output": "SEGMENT" }, { "input": "50 1 50 100", "output": "TRIANGLE" }, { "input": "50 1 100 49", "output": "SEGMENT" }, { "input": "49 51 100 1", "output": "SEGMENT" }, { "input": "5 11 2 25", "output": "IMPOSSIBLE" }, { "input": "91 50 9 40", "output": "IMPOSSIBLE" }, { "input": "27 53 7 97", "output": "IMPOSSIBLE" }, { "input": "51 90 24 8", "output": "IMPOSSIBLE" }, { "input": "3 5 1 1", "output": "IMPOSSIBLE" }, { "input": "13 49 69 15", "output": "IMPOSSIBLE" }, { "input": "16 99 9 35", "output": "IMPOSSIBLE" }, { "input": "27 6 18 53", "output": "IMPOSSIBLE" }, { "input": "57 88 17 8", "output": "IMPOSSIBLE" }, { "input": "95 20 21 43", "output": "IMPOSSIBLE" }, { "input": "6 19 32 61", "output": "IMPOSSIBLE" }, { "input": "100 21 30 65", "output": "IMPOSSIBLE" }, { "input": "85 16 61 9", "output": "IMPOSSIBLE" }, { "input": "5 6 19 82", "output": "IMPOSSIBLE" }, { "input": "1 5 1 3", "output": "IMPOSSIBLE" }, { "input": "65 10 36 17", "output": "IMPOSSIBLE" }, { "input": "81 64 9 7", "output": "IMPOSSIBLE" }, { "input": "11 30 79 43", "output": "IMPOSSIBLE" }, { "input": "1 1 5 3", "output": "IMPOSSIBLE" }, { "input": "21 94 61 31", "output": "IMPOSSIBLE" }, { "input": "49 24 9 74", "output": "IMPOSSIBLE" }, { "input": "11 19 5 77", "output": "IMPOSSIBLE" }, { "input": "52 10 19 71", "output": "SEGMENT" }, { "input": "2 3 7 10", "output": "SEGMENT" }, { "input": "1 2 6 3", "output": "SEGMENT" }, { "input": "2 6 1 8", "output": "SEGMENT" }, { "input": "1 2 4 1", "output": "SEGMENT" }, { "input": "4 10 6 2", "output": "SEGMENT" }, { "input": "2 10 7 3", "output": "SEGMENT" }, { "input": "5 2 3 9", "output": "SEGMENT" }, { "input": "6 1 4 10", "output": "SEGMENT" }, { "input": "10 6 4 1", "output": "SEGMENT" }, { "input": "3 2 9 1", "output": "SEGMENT" }, { "input": "22 80 29 7", "output": "SEGMENT" }, { "input": "2 6 3 9", "output": "SEGMENT" }, { "input": "3 1 2 1", "output": "SEGMENT" }, { "input": "3 4 7 1", "output": "SEGMENT" }, { "input": "8 4 3 1", "output": "SEGMENT" }, { "input": "2 8 3 5", "output": "SEGMENT" }, { "input": "4 1 2 1", "output": "SEGMENT" }, { "input": "8 1 3 2", "output": "SEGMENT" }, { "input": "6 2 1 8", "output": "SEGMENT" }, { "input": "3 3 3 6", "output": "TRIANGLE" }, { "input": "3 6 3 3", "output": "TRIANGLE" }, { "input": "4 10 4 4", "output": "TRIANGLE" }, { "input": "1 1 2 1", "output": "TRIANGLE" }, { "input": "3 3 3 6", "output": "TRIANGLE" }, { "input": "5 4 5 5", "output": "TRIANGLE" }, { "input": "8 7 8 8", "output": "TRIANGLE" }, { "input": "3 3 3 1", "output": "TRIANGLE" }, { "input": "1 1 6 6", "output": "TRIANGLE" }, { "input": "1 9 1 9", "output": "TRIANGLE" }, { "input": "7 2 2 7", "output": "TRIANGLE" }, { "input": "7 2 3 2", "output": "TRIANGLE" }, { "input": "4 4 10 10", "output": "TRIANGLE" }, { "input": "7 7 10 7", "output": "TRIANGLE" }, { "input": "4 4 4 5", "output": "TRIANGLE" }, { "input": "1 10 9 2", "output": "TRIANGLE" }, { "input": "1 8 2 7", "output": "TRIANGLE" }, { "input": "4 3 2 8", "output": "TRIANGLE" }, { "input": "5 9 5 3", "output": "TRIANGLE" }, { "input": "4 10 3 5", "output": "TRIANGLE" } ]
1,660,553,728
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
17
92
0
n = list(map(int,input().split())) n.sort() if(n[0]+n[1]>n[2] or n[2]+n[1]>n[3]): print('TRIANGLE') elif(n[0]+n[2]+n[1]>n[3]): print('SEGMENT') else: print('IMPOSSIBLE')
Title: Triangle Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: Johnny has a younger sister Anne, who is very clever and smart. As she came home from the kindergarten, she told his brother about the task that her kindergartener asked her to solve. The task was just to construct a triangle out of four sticks of different colours. Naturally, one of the sticks is extra. It is not allowed to break the sticks or use their partial length. Anne has perfectly solved this task, now she is asking Johnny to do the same. The boy answered that he would cope with it without any difficulty. However, after a while he found out that different tricky things can occur. It can happen that it is impossible to construct a triangle of a positive area, but it is possible to construct a degenerate triangle. It can be so, that it is impossible to construct a degenerate triangle even. As Johnny is very lazy, he does not want to consider such a big amount of cases, he asks you to help him. Input Specification: The first line of the input contains four space-separated positive integer numbers not exceeding 100 — lengthes of the sticks. Output Specification: Output TRIANGLE if it is possible to construct a non-degenerate triangle. Output SEGMENT if the first case cannot take place and it is possible to construct a degenerate triangle. Output IMPOSSIBLE if it is impossible to construct any triangle. Remember that you are to use three sticks. It is not allowed to break the sticks or use their partial length. Demo Input: ['4 2 1 3\n', '7 2 2 4\n', '3 5 9 1\n'] Demo Output: ['TRIANGLE\n', 'SEGMENT\n', 'IMPOSSIBLE\n'] Note: none
```python n = list(map(int,input().split())) n.sort() if(n[0]+n[1]>n[2] or n[2]+n[1]>n[3]): print('TRIANGLE') elif(n[0]+n[2]+n[1]>n[3]): print('SEGMENT') else: print('IMPOSSIBLE') ```
0
527
A
Playing with Paper
PROGRAMMING
1,100
[ "implementation", "math" ]
null
null
One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=×<= *b* mm sheet of paper (*a*<=&gt;<=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part. After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=×<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop. Can you determine how many ships Vasya will make during the lesson?
The first line of the input contains two integers *a*, *b* (1<=≤<=*b*<=&lt;<=*a*<=≤<=1012) — the sizes of the original sheet of paper.
Print a single integer — the number of ships that Vasya will make.
[ "2 1\n", "10 7\n", "1000000000000 1\n" ]
[ "2\n", "6\n", "1000000000000\n" ]
Pictures to the first and second sample test.
500
[ { "input": "2 1", "output": "2" }, { "input": "10 7", "output": "6" }, { "input": "1000000000000 1", "output": "1000000000000" }, { "input": "3 1", "output": "3" }, { "input": "4 1", "output": "4" }, { "input": "3 2", "output": "3" }, { "input": "4 2", "output": "2" }, { "input": "1000 700", "output": "6" }, { "input": "959986566087 524054155168", "output": "90" }, { "input": "4 3", "output": "4" }, { "input": "7 6", "output": "7" }, { "input": "1000 999", "output": "1000" }, { "input": "1000 998", "output": "500" }, { "input": "1000 997", "output": "336" }, { "input": "42 1", "output": "42" }, { "input": "1000 1", "output": "1000" }, { "input": "8 5", "output": "5" }, { "input": "13 8", "output": "6" }, { "input": "987 610", "output": "15" }, { "input": "442 42", "output": "22" }, { "input": "754 466", "output": "13" }, { "input": "1000000000000 999999999999", "output": "1000000000000" }, { "input": "1000000000000 999999999998", "output": "500000000000" }, { "input": "941 14", "output": "74" }, { "input": "998 2", "output": "499" }, { "input": "1000 42", "output": "32" }, { "input": "1000 17", "output": "66" }, { "input": "5 1", "output": "5" }, { "input": "5 2", "output": "4" }, { "input": "5 3", "output": "4" }, { "input": "5 4", "output": "5" }, { "input": "293 210", "output": "17" }, { "input": "787878787878 424242424242", "output": "8" }, { "input": "956722026041 591286729879", "output": "58" }, { "input": "956722026041 365435296162", "output": "58" }, { "input": "628625247282 464807889701", "output": "102" }, { "input": "695928431619 424778620208", "output": "167" }, { "input": "1000000000000 42", "output": "23809523821" }, { "input": "987654345678 23", "output": "42941493300" }, { "input": "10000000001 2", "output": "5000000002" }, { "input": "1000000000000 2", "output": "500000000000" }, { "input": "1000000000000 3", "output": "333333333336" }, { "input": "100000000000 3", "output": "33333333336" }, { "input": "100000000000 23", "output": "4347826109" }, { "input": "999999999997 7", "output": "142857142861" }, { "input": "8589934592 4294967296", "output": "2" } ]
1,434,615,578
2,147,483,647
Python 3
OK
TESTS
46
187
3,788,800
#!/usr/bin/env python # paper.py - Codeforces 572A Paper quiz # # Copyright (C) 2015 Sergey # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. """ After making a paper ship from the square piece, Vasya looked on the remaining (a-b) mm x b mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop. Can you determine how many ships Vasya will make during the lesson? Input The first line of the input contains two integers a, b (1<=b<a<10^12) - the sizes of the original sheet of paper. Output Print a single integer - the number of ships that Vasya will make """ # Standard libraries import unittest import sys import re import random # Additional libraries ############################################################################### # Paper Class ############################################################################### class Paper: """ Paper representation """ def __init__(self, args): """ Default constructor """ self.args = args self.cur = self.args self.num = 0 def iterate(self): # Re-order with higher number first if self.cur[0] < self.cur[1]: self.cur = (self.cur[1], self.cur[0]) # calculate self.num += self.cur[0] // self.cur[1] remainder = self.cur[0] % self.cur[1] self.cur = (remainder, self.cur[1]) return 1 if remainder else 0 def calculate(self): """ Main calcualtion function of the class """ while self.iterate(): pass return self.num ############################################################################### # Executable code ############################################################################### def decode_inputs(inputs): """ Decoding input string tuple into base class args tuple """ # Decoding input into a tuple of integers ilist = [int(i) for i in inputs.split()] args = tuple(ilist) return args def calculate(inputs): """ Base class calculate method wrapper """ return Paper(decode_inputs(inputs)).calculate() def main(): """ Main function. Not called by unit tests """ # Read test input string tuple inputs = (input()) # Print the result print(calculate(inputs)) ############################################################################### # Unit Tests ############################################################################### class unitTests(unittest.TestCase): def test_decode_inputs(self): """ Input string decoding testing """ self.assertEqual(decode_inputs("2 5"), (2, 5)) def test_Paper_class__basic_functions(self): """ Paper class basic functions testing """ d = Paper((1, 2)) self.assertEqual(d.args[0], 1) # Iteration variable self.assertEqual(d.cur[0], 1) # Iterate on a square sheet, return 0 - finished d = Paper((2, 2)) self.assertEqual(d.iterate(), 0) self.assertEqual(d.num, 1) # Iterate on a rect sheet, return 1 - not finished d = Paper((10, 3)) self.assertEqual(d.iterate(), 1) self.assertEqual(d.cur, (1, 3)) self.assertEqual(d.num, 3) def test_calculate(self): """ Main calculation function """ # Sample test 1 self.assertEqual(calculate("2 2"), 1) # Sample test 2 self.assertEqual(calculate("10 3"), 6) # Other tests self.assertEqual(calculate("10 7"), 6) self.assertEqual(calculate("1000000000000 1"), 1000000000000) if __name__ == "__main__": if sys.argv[-1] == "-ut": unittest.main(argv=[" "]) main()
Title: Playing with Paper Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=×<= *b* mm sheet of paper (*a*<=&gt;<=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part. After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=×<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop. Can you determine how many ships Vasya will make during the lesson? Input Specification: The first line of the input contains two integers *a*, *b* (1<=≤<=*b*<=&lt;<=*a*<=≤<=1012) — the sizes of the original sheet of paper. Output Specification: Print a single integer — the number of ships that Vasya will make. Demo Input: ['2 1\n', '10 7\n', '1000000000000 1\n'] Demo Output: ['2\n', '6\n', '1000000000000\n'] Note: Pictures to the first and second sample test.
```python #!/usr/bin/env python # paper.py - Codeforces 572A Paper quiz # # Copyright (C) 2015 Sergey # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. """ After making a paper ship from the square piece, Vasya looked on the remaining (a-b) mm x b mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop. Can you determine how many ships Vasya will make during the lesson? Input The first line of the input contains two integers a, b (1<=b<a<10^12) - the sizes of the original sheet of paper. Output Print a single integer - the number of ships that Vasya will make """ # Standard libraries import unittest import sys import re import random # Additional libraries ############################################################################### # Paper Class ############################################################################### class Paper: """ Paper representation """ def __init__(self, args): """ Default constructor """ self.args = args self.cur = self.args self.num = 0 def iterate(self): # Re-order with higher number first if self.cur[0] < self.cur[1]: self.cur = (self.cur[1], self.cur[0]) # calculate self.num += self.cur[0] // self.cur[1] remainder = self.cur[0] % self.cur[1] self.cur = (remainder, self.cur[1]) return 1 if remainder else 0 def calculate(self): """ Main calcualtion function of the class """ while self.iterate(): pass return self.num ############################################################################### # Executable code ############################################################################### def decode_inputs(inputs): """ Decoding input string tuple into base class args tuple """ # Decoding input into a tuple of integers ilist = [int(i) for i in inputs.split()] args = tuple(ilist) return args def calculate(inputs): """ Base class calculate method wrapper """ return Paper(decode_inputs(inputs)).calculate() def main(): """ Main function. Not called by unit tests """ # Read test input string tuple inputs = (input()) # Print the result print(calculate(inputs)) ############################################################################### # Unit Tests ############################################################################### class unitTests(unittest.TestCase): def test_decode_inputs(self): """ Input string decoding testing """ self.assertEqual(decode_inputs("2 5"), (2, 5)) def test_Paper_class__basic_functions(self): """ Paper class basic functions testing """ d = Paper((1, 2)) self.assertEqual(d.args[0], 1) # Iteration variable self.assertEqual(d.cur[0], 1) # Iterate on a square sheet, return 0 - finished d = Paper((2, 2)) self.assertEqual(d.iterate(), 0) self.assertEqual(d.num, 1) # Iterate on a rect sheet, return 1 - not finished d = Paper((10, 3)) self.assertEqual(d.iterate(), 1) self.assertEqual(d.cur, (1, 3)) self.assertEqual(d.num, 3) def test_calculate(self): """ Main calculation function """ # Sample test 1 self.assertEqual(calculate("2 2"), 1) # Sample test 2 self.assertEqual(calculate("10 3"), 6) # Other tests self.assertEqual(calculate("10 7"), 6) self.assertEqual(calculate("1000000000000 1"), 1000000000000) if __name__ == "__main__": if sys.argv[-1] == "-ut": unittest.main(argv=[" "]) main() ```
3
222
A
Shooshuns and Sequence
PROGRAMMING
1,200
[ "brute force", "implementation" ]
null
null
One day shooshuns found a sequence of *n* integers, written on a blackboard. The shooshuns can perform one operation with it, the operation consists of two steps: 1. Find the number that goes *k*-th in the current sequence and add the same number to the end of the sequence; 1. Delete the first number of the current sequence. The shooshuns wonder after how many operations all numbers on the board will be the same and whether all numbers will ever be the same.
The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105) — the sequence that the shooshuns found.
Print the minimum number of operations, required for all numbers on the blackboard to become the same. If it is impossible to achieve, print -1.
[ "3 2\n3 1 1\n", "3 1\n3 1 1\n" ]
[ "1\n", "-1\n" ]
In the first test case after the first operation the blackboard will have sequence [1, 1, 1]. So, one operation is enough to make all numbers the same. Thus, the answer equals one. In the second test case the sequence will never consist of the same numbers. It will always contain at least two distinct numbers 3 and 1. Thus, the answer equals -1.
500
[ { "input": "3 2\n3 1 1", "output": "1" }, { "input": "3 1\n3 1 1", "output": "-1" }, { "input": "1 1\n1", "output": "0" }, { "input": "2 1\n1 1", "output": "0" }, { "input": "2 1\n2 1", "output": "-1" }, { "input": "4 4\n1 2 3 4", "output": "3" }, { "input": "4 3\n1 2 3 4", "output": "-1" }, { "input": "5 3\n2 1 1 1 1", "output": "1" }, { "input": "5 3\n1 1 1 1 1", "output": "0" }, { "input": "5 5\n1 1 1 1 1", "output": "0" }, { "input": "10 1\n1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "10 1\n1 2 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "10 1\n2 1 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "10 2\n2 1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "10 2\n1 2 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "10 3\n3 2 1 1 1 1 1 1 1 1", "output": "2" }, { "input": "10 1\n1 2 3 4 5 6 7 8 9 10", "output": "-1" }, { "input": "10 10\n1 2 3 4 5 6 7 8 9 10", "output": "9" }, { "input": "20 10\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "20 11\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1", "output": "10" }, { "input": "20 9\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "20 10\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "20 20\n20 1 19 2 18 3 17 4 16 5 15 6 14 7 13 8 12 9 11 10", "output": "19" } ]
1,549,711,030
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
21
278
7,680,000
n,m=map(int,input().split()) l=list(map(int,input().split())) if len(set(l[m-1:]))!=1 : print(-1) exit() k=m-1 for i in range(m-2,-1,-1) : if l[i]==l[m-1] : k-=1 print(k)
Title: Shooshuns and Sequence Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day shooshuns found a sequence of *n* integers, written on a blackboard. The shooshuns can perform one operation with it, the operation consists of two steps: 1. Find the number that goes *k*-th in the current sequence and add the same number to the end of the sequence; 1. Delete the first number of the current sequence. The shooshuns wonder after how many operations all numbers on the board will be the same and whether all numbers will ever be the same. Input Specification: The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105) — the sequence that the shooshuns found. Output Specification: Print the minimum number of operations, required for all numbers on the blackboard to become the same. If it is impossible to achieve, print -1. Demo Input: ['3 2\n3 1 1\n', '3 1\n3 1 1\n'] Demo Output: ['1\n', '-1\n'] Note: In the first test case after the first operation the blackboard will have sequence [1, 1, 1]. So, one operation is enough to make all numbers the same. Thus, the answer equals one. In the second test case the sequence will never consist of the same numbers. It will always contain at least two distinct numbers 3 and 1. Thus, the answer equals -1.
```python n,m=map(int,input().split()) l=list(map(int,input().split())) if len(set(l[m-1:]))!=1 : print(-1) exit() k=m-1 for i in range(m-2,-1,-1) : if l[i]==l[m-1] : k-=1 print(k) ```
0
39
D
Cubical Planet
PROGRAMMING
1,100
[ "math" ]
D. Cubical Planet
2
64
You can find anything whatsoever in our Galaxy! A cubical planet goes round an icosahedral star. Let us introduce a system of axes so that the edges of the cubical planet are parallel to the coordinate axes and two opposite vertices lay in the points (0,<=0,<=0) and (1,<=1,<=1). Two flies live on the planet. At the moment they are sitting on two different vertices of the cubical planet. Your task is to determine whether they see each other or not. The flies see each other when the vertices they occupy lie on the same face of the cube.
The first line contains three space-separated integers (0 or 1) — the coordinates of the first fly, the second line analogously contains the coordinates of the second fly.
Output "YES" (without quotes) if the flies see each other. Otherwise, output "NO".
[ "0 0 0\n0 1 0\n", "1 1 0\n0 1 0\n", "0 0 0\n1 1 1\n" ]
[ "YES\n", "YES\n", "NO\n" ]
none
0
[ { "input": "0 0 0\n0 1 0", "output": "YES" }, { "input": "1 1 0\n0 1 0", "output": "YES" }, { "input": "0 0 0\n1 1 1", "output": "NO" }, { "input": "0 0 0\n1 0 0", "output": "YES" }, { "input": "0 0 0\n0 1 0", "output": "YES" }, { "input": "0 0 0\n1 1 0", "output": "YES" }, { "input": "0 0 0\n0 0 1", "output": "YES" }, { "input": "0 0 0\n1 0 1", "output": "YES" }, { "input": "0 0 0\n0 1 1", "output": "YES" }, { "input": "0 0 0\n1 1 1", "output": "NO" }, { "input": "1 0 0\n0 0 0", "output": "YES" }, { "input": "1 0 0\n0 1 0", "output": "YES" }, { "input": "1 0 0\n1 1 0", "output": "YES" }, { "input": "1 0 0\n0 0 1", "output": "YES" }, { "input": "1 0 0\n1 0 1", "output": "YES" }, { "input": "1 0 0\n0 1 1", "output": "NO" }, { "input": "1 0 0\n1 1 1", "output": "YES" }, { "input": "0 1 0\n0 0 0", "output": "YES" }, { "input": "0 1 0\n1 0 0", "output": "YES" }, { "input": "0 1 0\n1 1 0", "output": "YES" }, { "input": "0 1 0\n0 0 1", "output": "YES" }, { "input": "0 1 0\n1 0 1", "output": "NO" }, { "input": "0 1 0\n0 1 1", "output": "YES" }, { "input": "0 1 0\n1 1 1", "output": "YES" }, { "input": "1 1 0\n0 0 0", "output": "YES" }, { "input": "1 1 0\n1 0 0", "output": "YES" }, { "input": "1 1 0\n0 1 0", "output": "YES" }, { "input": "1 1 0\n0 0 1", "output": "NO" }, { "input": "1 1 0\n1 0 1", "output": "YES" }, { "input": "1 1 0\n0 1 1", "output": "YES" }, { "input": "1 1 0\n1 1 1", "output": "YES" }, { "input": "0 0 1\n0 0 0", "output": "YES" }, { "input": "0 0 1\n1 0 0", "output": "YES" }, { "input": "0 0 1\n0 1 0", "output": "YES" }, { "input": "0 0 1\n1 1 0", "output": "NO" }, { "input": "0 0 1\n1 0 1", "output": "YES" }, { "input": "0 0 1\n0 1 1", "output": "YES" }, { "input": "0 0 1\n1 1 1", "output": "YES" }, { "input": "1 0 1\n0 0 0", "output": "YES" }, { "input": "1 0 1\n1 0 0", "output": "YES" }, { "input": "1 0 1\n0 1 0", "output": "NO" }, { "input": "1 0 1\n1 1 0", "output": "YES" }, { "input": "1 0 1\n0 0 1", "output": "YES" }, { "input": "1 0 1\n0 1 1", "output": "YES" }, { "input": "1 0 1\n1 1 1", "output": "YES" }, { "input": "0 1 1\n0 0 0", "output": "YES" }, { "input": "0 1 1\n1 0 0", "output": "NO" }, { "input": "0 1 1\n0 1 0", "output": "YES" }, { "input": "0 1 1\n1 1 0", "output": "YES" }, { "input": "0 1 1\n0 0 1", "output": "YES" }, { "input": "0 1 1\n1 0 1", "output": "YES" }, { "input": "0 1 1\n1 1 1", "output": "YES" }, { "input": "1 1 1\n0 0 0", "output": "NO" }, { "input": "1 1 1\n1 0 0", "output": "YES" }, { "input": "1 1 1\n0 1 0", "output": "YES" }, { "input": "1 1 1\n1 1 0", "output": "YES" }, { "input": "1 1 1\n0 0 1", "output": "YES" }, { "input": "1 1 1\n1 0 1", "output": "YES" }, { "input": "1 1 1\n0 1 1", "output": "YES" } ]
1,523,603,225
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
16
186
7,065,600
# from dust i have come dust i will be ''' if the coordinates lie in the same plane then yes ''' a,b,c=map(int,input().split()) x,y,z=map(int,input().split()) if x+y+z==3 or a+b+c==3: print('NO') exit(0) #xy plane if z==0 and c==0: print('YES') #yz plane elif x==0 and a==0: print('YES') #zx plane elif y==0 and b==0: print('YES') else: print('NO')
Title: Cubical Planet Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: You can find anything whatsoever in our Galaxy! A cubical planet goes round an icosahedral star. Let us introduce a system of axes so that the edges of the cubical planet are parallel to the coordinate axes and two opposite vertices lay in the points (0,<=0,<=0) and (1,<=1,<=1). Two flies live on the planet. At the moment they are sitting on two different vertices of the cubical planet. Your task is to determine whether they see each other or not. The flies see each other when the vertices they occupy lie on the same face of the cube. Input Specification: The first line contains three space-separated integers (0 or 1) — the coordinates of the first fly, the second line analogously contains the coordinates of the second fly. Output Specification: Output "YES" (without quotes) if the flies see each other. Otherwise, output "NO". Demo Input: ['0 0 0\n0 1 0\n', '1 1 0\n0 1 0\n', '0 0 0\n1 1 1\n'] Demo Output: ['YES\n', 'YES\n', 'NO\n'] Note: none
```python # from dust i have come dust i will be ''' if the coordinates lie in the same plane then yes ''' a,b,c=map(int,input().split()) x,y,z=map(int,input().split()) if x+y+z==3 or a+b+c==3: print('NO') exit(0) #xy plane if z==0 and c==0: print('YES') #yz plane elif x==0 and a==0: print('YES') #zx plane elif y==0 and b==0: print('YES') else: print('NO') ```
0
758
A
Holiday Of Equality
PROGRAMMING
800
[ "implementation", "math" ]
null
null
In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury. Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland). You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them.
The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen.
In the only line print the integer *S* — the minimum number of burles which are had to spend.
[ "5\n0 1 2 3 4\n", "5\n1 1 0 1 1\n", "3\n1 3 1\n", "1\n12\n" ]
[ "10", "1", "4", "0" ]
In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4. In the second example it is enough to give one burle to the third citizen. In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3. In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles.
500
[ { "input": "5\n0 1 2 3 4", "output": "10" }, { "input": "5\n1 1 0 1 1", "output": "1" }, { "input": "3\n1 3 1", "output": "4" }, { "input": "1\n12", "output": "0" }, { "input": "3\n1 2 3", "output": "3" }, { "input": "14\n52518 718438 358883 462189 853171 592966 225788 46977 814826 295697 676256 561479 56545 764281", "output": "5464380" }, { "input": "21\n842556 216391 427181 626688 775504 168309 851038 448402 880826 73697 593338 519033 135115 20128 424606 939484 846242 756907 377058 241543 29353", "output": "9535765" }, { "input": "3\n1 3 2", "output": "3" }, { "input": "3\n2 1 3", "output": "3" }, { "input": "3\n2 3 1", "output": "3" }, { "input": "3\n3 1 2", "output": "3" }, { "input": "3\n3 2 1", "output": "3" }, { "input": "1\n228503", "output": "0" }, { "input": "2\n32576 550340", "output": "517764" }, { "input": "3\n910648 542843 537125", "output": "741328" }, { "input": "4\n751720 572344 569387 893618", "output": "787403" }, { "input": "6\n433864 631347 597596 794426 713555 231193", "output": "1364575" }, { "input": "9\n31078 645168 695751 126111 375934 150495 838412 434477 993107", "output": "4647430" }, { "input": "30\n315421 772664 560686 654312 151528 356749 351486 707462 820089 226682 546700 136028 824236 842130 578079 337807 665903 764100 617900 822937 992759 591749 651310 742085 767695 695442 17967 515106 81059 186025", "output": "13488674" }, { "input": "45\n908719 394261 815134 419990 926993 383792 772842 277695 527137 655356 684956 695716 273062 550324 106247 399133 442382 33076 462920 294674 846052 817752 421365 474141 290471 358990 109812 74492 543281 169434 919692 786809 24028 197184 310029 801476 699355 429672 51343 374128 776726 850380 293868 981569 550763", "output": "21993384" }, { "input": "56\n100728 972537 13846 385421 756708 184642 259487 319707 376662 221694 675284 972837 499419 13846 38267 289898 901299 831197 954715 197515 514102 910423 127555 883934 362472 870788 538802 741008 973434 448124 391526 363321 947321 544618 68006 782313 955075 741981 815027 723297 585059 718114 700739 413489 454091 736144 308999 98065 3716 347323 9635 289003 986510 607065 60236 273351", "output": "26984185" }, { "input": "70\n644488 5444 150441 714420 602059 335330 510670 196555 546346 740011 509449 850947 692874 524857 750434 952985 223744 374727 896124 753037 367352 679050 560202 172728 569291 778616 332116 286927 843598 372698 244906 498046 900681 709791 420904 724593 864493 813094 791377 39998 296710 625656 403891 579231 706693 984045 16901 574259 562265 761104 930361 256045 124461 538980 573508 372148 988722 108592 784354 55302 232524 277205 782251 299943 436488 743389 324618 742543 266915 99642", "output": "32816391" }, { "input": "1\n0", "output": "0" }, { "input": "1\n1000000", "output": "0" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "100\n1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "99000000" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000", "output": "99000000" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "99000000" }, { "input": "3\n0 0 0", "output": "0" }, { "input": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "3\n5 0 0", "output": "10" }, { "input": "5\n2 10 0 0 0", "output": "38" } ]
1,660,149,338
2,147,483,647
Python 3
OK
TESTS
41
46
0
a = int(input()) b = [int(i) for i in input().split()] m = max(b) counter = 0 for i in b: counter += m - i print(counter)
Title: Holiday Of Equality Time Limit: None seconds Memory Limit: None megabytes Problem Description: In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury. Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland). You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them. Input Specification: The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen. Output Specification: In the only line print the integer *S* — the minimum number of burles which are had to spend. Demo Input: ['5\n0 1 2 3 4\n', '5\n1 1 0 1 1\n', '3\n1 3 1\n', '1\n12\n'] Demo Output: ['10', '1', '4', '0'] Note: In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4. In the second example it is enough to give one burle to the third citizen. In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3. In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles.
```python a = int(input()) b = [int(i) for i in input().split()] m = max(b) counter = 0 for i in b: counter += m - i print(counter) ```
3
386
A
Second-Price Auction
PROGRAMMING
800
[ "implementation" ]
null
null
In this problem we consider a special type of an auction, which is called the second-price auction. As in regular auction *n* bidders place a bid which is price a bidder ready to pay. The auction is closed, that is, each bidder secretly informs the organizer of the auction price he is willing to pay. After that, the auction winner is the participant who offered the highest price. However, he pay not the price he offers, but the highest price among the offers of other participants (hence the name: the second-price auction). Write a program that reads prices offered by bidders and finds the winner and the price he will pay. Consider that all of the offered prices are different.
The first line of the input contains *n* (2<=≤<=*n*<=≤<=1000) — number of bidders. The second line contains *n* distinct integer numbers *p*1,<=*p*2,<=... *p**n*, separated by single spaces (1<=≤<=*p**i*<=≤<=10000), where *p**i* stands for the price offered by the *i*-th bidder.
The single output line should contain two integers: index of the winner and the price he will pay. Indices are 1-based.
[ "2\n5 7\n", "3\n10 2 8\n", "6\n3 8 2 9 4 14\n" ]
[ "2 5\n", "1 8\n", "6 9\n" ]
none
500
[ { "input": "2\n5 7", "output": "2 5" }, { "input": "3\n10 2 8", "output": "1 8" }, { "input": "6\n3 8 2 9 4 14", "output": "6 9" }, { "input": "4\n4707 7586 4221 5842", "output": "2 5842" }, { "input": "5\n3304 4227 4869 6937 6002", "output": "4 6002" }, { "input": "6\n5083 3289 7708 5362 9031 7458", "output": "5 7708" }, { "input": "7\n9038 6222 3392 1706 3778 1807 2657", "output": "1 6222" }, { "input": "8\n7062 2194 4481 3864 7470 1814 8091 733", "output": "7 7470" }, { "input": "9\n2678 5659 9199 2628 7906 7496 4524 2663 3408", "output": "3 7906" }, { "input": "2\n3458 1504", "output": "1 1504" }, { "input": "50\n9237 3904 407 9052 6657 9229 9752 3888 7732 2512 4614 1055 2355 7108 6506 6849 2529 8862 159 8630 7906 7941 960 8470 333 8659 54 9475 3163 5625 6393 6814 2656 3388 169 7918 4881 8468 9983 6281 6340 280 5108 2996 101 7617 3313 8172 326 1991", "output": "39 9752" }, { "input": "100\n2515 3324 7975 6171 4240 1217 4829 5203 8603 6900 3031 4699 4732 6070 4221 3228 6497 7359 9130 4346 4619 1109 3945 5442 3271 16 9711 2045 6410 2301 3406 8125 6003 1892 1260 9661 3940 6692 4708 7027 4930 6925 1979 5361 4263 3144 867 8639 6230 5562 9714 3676 4231 3347 4733 4920 4881 3431 1059 7313 8912 3038 9308 72 9583 7009 3034 7425 2398 6141 3245 2495 2933 6710 8289 9806 1226 8393 7349 6462 1618 9613 3546 6012 2964 9995 1578 210 2123 4874 1252 8625 348 8020 803 7244 9080 5088 706 2602", "output": "86 9806" }, { "input": "2\n2 1", "output": "1 1" }, { "input": "2\n1 2", "output": "2 1" }, { "input": "3\n10 20 30", "output": "3 20" }, { "input": "3\n10 30 20", "output": "2 20" }, { "input": "3\n20 10 30", "output": "3 20" }, { "input": "3\n20 30 10", "output": "2 20" }, { "input": "3\n30 10 20", "output": "1 20" }, { "input": "3\n30 20 10", "output": "1 20" }, { "input": "2\n1 10000", "output": "2 1" }, { "input": "2\n10000 999", "output": "1 999" }, { "input": "3\n3 4 1", "output": "2 3" }, { "input": "6\n1 2 24 6 5 7", "output": "3 7" } ]
1,622,832,395
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
78
0
n = int(input()) a = list(map(int, input().split())) q = max(a) for i in range(len(a)): if q == a[i]: q = 1 a = sorted(a) a[-1] = 0 print(q, max(a))
Title: Second-Price Auction Time Limit: None seconds Memory Limit: None megabytes Problem Description: In this problem we consider a special type of an auction, which is called the second-price auction. As in regular auction *n* bidders place a bid which is price a bidder ready to pay. The auction is closed, that is, each bidder secretly informs the organizer of the auction price he is willing to pay. After that, the auction winner is the participant who offered the highest price. However, he pay not the price he offers, but the highest price among the offers of other participants (hence the name: the second-price auction). Write a program that reads prices offered by bidders and finds the winner and the price he will pay. Consider that all of the offered prices are different. Input Specification: The first line of the input contains *n* (2<=≤<=*n*<=≤<=1000) — number of bidders. The second line contains *n* distinct integer numbers *p*1,<=*p*2,<=... *p**n*, separated by single spaces (1<=≤<=*p**i*<=≤<=10000), where *p**i* stands for the price offered by the *i*-th bidder. Output Specification: The single output line should contain two integers: index of the winner and the price he will pay. Indices are 1-based. Demo Input: ['2\n5 7\n', '3\n10 2 8\n', '6\n3 8 2 9 4 14\n'] Demo Output: ['2 5\n', '1 8\n', '6 9\n'] Note: none
```python n = int(input()) a = list(map(int, input().split())) q = max(a) for i in range(len(a)): if q == a[i]: q = 1 a = sorted(a) a[-1] = 0 print(q, max(a)) ```
0
851
B
Arpa and an exam about geometry
PROGRAMMING
1,400
[ "geometry", "math" ]
null
null
Arpa is taking a geometry exam. Here is the last problem of the exam. You are given three points *a*,<=*b*,<=*c*. Find a point and an angle such that if we rotate the page around the point by the angle, the new position of *a* is the same as the old position of *b*, and the new position of *b* is the same as the old position of *c*. Arpa is doubting if the problem has a solution or not (i.e. if there exists a point and an angle satisfying the condition). Help Arpa determine if the question has a solution or not.
The only line contains six integers *a**x*,<=*a**y*,<=*b**x*,<=*b**y*,<=*c**x*,<=*c**y* (|*a**x*|,<=|*a**y*|,<=|*b**x*|,<=|*b**y*|,<=|*c**x*|,<=|*c**y*|<=≤<=109). It's guaranteed that the points are distinct.
Print "Yes" if the problem has a solution, "No" otherwise. You can print each letter in any case (upper or lower).
[ "0 1 1 1 1 0\n", "1 1 0 0 1000 1000\n" ]
[ "Yes\n", "No\n" ]
In the first sample test, rotate the page around (0.5, 0.5) by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9d845923f4d356a48d8ede337db0303821311f0c.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second sample test, you can't find any solution.
1,000
[ { "input": "0 1 1 1 1 0", "output": "Yes" }, { "input": "1 1 0 0 1000 1000", "output": "No" }, { "input": "1 0 2 0 3 0", "output": "No" }, { "input": "3 4 0 0 4 3", "output": "Yes" }, { "input": "-1000000000 1 0 0 1000000000 1", "output": "Yes" }, { "input": "49152 0 0 0 0 81920", "output": "No" }, { "input": "1 -1 4 4 2 -3", "output": "No" }, { "input": "-2 -2 1 4 -2 0", "output": "No" }, { "input": "5 0 4 -2 0 1", "output": "No" }, { "input": "-4 -3 2 -1 -3 4", "output": "No" }, { "input": "-3 -3 5 2 3 -1", "output": "No" }, { "input": "-1000000000 -1000000000 0 0 1000000000 999999999", "output": "No" }, { "input": "-1000000000 -1000000000 0 0 1000000000 1000000000", "output": "No" }, { "input": "-357531221 381512519 -761132895 -224448284 328888775 -237692564", "output": "No" }, { "input": "264193194 -448876521 736684426 -633906160 -328597212 -47935734", "output": "No" }, { "input": "419578772 -125025887 169314071 89851312 961404059 21419450", "output": "No" }, { "input": "-607353321 -620687860 248029390 477864359 728255275 -264646027", "output": "No" }, { "input": "299948862 -648908808 338174789 841279400 -850322448 350263551", "output": "No" }, { "input": "48517753 416240699 7672672 272460100 -917845051 199790781", "output": "No" }, { "input": "-947393823 -495674431 211535284 -877153626 -522763219 -778236665", "output": "No" }, { "input": "-685673792 -488079395 909733355 385950193 -705890324 256550506", "output": "No" }, { "input": "-326038504 547872194 49630307 713863100 303770000 -556852524", "output": "No" }, { "input": "-706921242 -758563024 -588592101 -443440080 858751713 238854303", "output": "No" }, { "input": "-1000000000 -1000000000 0 1000000000 1000000000 -1000000000", "output": "Yes" }, { "input": "1000000000 1000000000 0 -1000000000 -1000000000 1000000000", "output": "Yes" }, { "input": "-999999999 -1000000000 0 0 1000000000 999999999", "output": "Yes" }, { "input": "-1000000000 -999999999 0 0 1000000000 999999999", "output": "No" }, { "input": "-1 -1000000000 0 1000000000 1 -1000000000", "output": "Yes" }, { "input": "0 1000000000 1 0 0 -1000000000", "output": "Yes" }, { "input": "0 1000000000 0 0 0 -1000000000", "output": "No" }, { "input": "0 1 1 2 2 3", "output": "No" }, { "input": "999999999 1000000000 0 0 -1000000000 -999999999", "output": "Yes" }, { "input": "0 0 1 1 2 0", "output": "Yes" }, { "input": "0 0 1 1 2 2", "output": "No" }, { "input": "1 1 2 2 3 3", "output": "No" }, { "input": "0 2 0 3 0 4", "output": "No" }, { "input": "1 1 1 2 1 3", "output": "No" }, { "input": "0 0 3 4 3 9", "output": "Yes" }, { "input": "589824 196608 262144 196608 0 0", "output": "Yes" }, { "input": "0 0 1000000000 1 1000000000 -999999999", "output": "No" }, { "input": "0 0 2 45 0 90", "output": "Yes" }, { "input": "0 0 0 2 0 1", "output": "No" }, { "input": "0 2 4 5 4 0", "output": "Yes" }, { "input": "0 0 2 0 4 0", "output": "No" }, { "input": "1 1 3 3 5 5", "output": "No" }, { "input": "1 1 2 2 3 1", "output": "Yes" } ]
1,648,535,586
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
39
46
0
from math import sqrt ax, ay, bx, by, cx, cy = map(int, input().split()) z1 =sqrt((cx-bx)**2+(cy-by)**2) z2 = sqrt((ax-bx)**2+(ay-by)**2) if z1!=z2: print('NO') elif ((bx-ax)*(cy-ay)-(cx-ax)*(by-ay))==0: print('NO') else: print('YES')
Title: Arpa and an exam about geometry Time Limit: None seconds Memory Limit: None megabytes Problem Description: Arpa is taking a geometry exam. Here is the last problem of the exam. You are given three points *a*,<=*b*,<=*c*. Find a point and an angle such that if we rotate the page around the point by the angle, the new position of *a* is the same as the old position of *b*, and the new position of *b* is the same as the old position of *c*. Arpa is doubting if the problem has a solution or not (i.e. if there exists a point and an angle satisfying the condition). Help Arpa determine if the question has a solution or not. Input Specification: The only line contains six integers *a**x*,<=*a**y*,<=*b**x*,<=*b**y*,<=*c**x*,<=*c**y* (|*a**x*|,<=|*a**y*|,<=|*b**x*|,<=|*b**y*|,<=|*c**x*|,<=|*c**y*|<=≤<=109). It's guaranteed that the points are distinct. Output Specification: Print "Yes" if the problem has a solution, "No" otherwise. You can print each letter in any case (upper or lower). Demo Input: ['0 1 1 1 1 0\n', '1 1 0 0 1000 1000\n'] Demo Output: ['Yes\n', 'No\n'] Note: In the first sample test, rotate the page around (0.5, 0.5) by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9d845923f4d356a48d8ede337db0303821311f0c.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second sample test, you can't find any solution.
```python from math import sqrt ax, ay, bx, by, cx, cy = map(int, input().split()) z1 =sqrt((cx-bx)**2+(cy-by)**2) z2 = sqrt((ax-bx)**2+(ay-by)**2) if z1!=z2: print('NO') elif ((bx-ax)*(cy-ay)-(cx-ax)*(by-ay))==0: print('NO') else: print('YES') ```
0
50
B
Choosing Symbol Pairs
PROGRAMMING
1,500
[ "strings" ]
B. Choosing Symbol Pairs
2
256
There is a given string *S* consisting of *N* symbols. Your task is to find the number of ordered pairs of integers *i* and *j* such that 1. 1<=≤<=*i*,<=*j*<=≤<=*N* 2. *S*[*i*]<==<=*S*[*j*], that is the *i*-th symbol of string *S* is equal to the *j*-th.
The single input line contains *S*, consisting of lowercase Latin letters and digits. It is guaranteed that string *S* in not empty and its length does not exceed 105.
Print a single number which represents the number of pairs *i* and *j* with the needed property. Pairs (*x*,<=*y*) and (*y*,<=*x*) should be considered different, i.e. the ordered pairs count.
[ "great10\n", "aaaaaaaaaa\n" ]
[ "7\n", "100\n" ]
none
1,000
[ { "input": "great10", "output": "7" }, { "input": "aaaaaaaaaa", "output": "100" }, { "input": "great10", "output": "7" }, { "input": "aaaaaaaaaa", "output": "100" }, { "input": "aabb", "output": "8" }, { "input": "w", "output": "1" }, { "input": "129a", "output": "4" }, { "input": "233444", "output": "14" }, { "input": "abacaba", "output": "21" }, { "input": "abcdefghijklmnopqrstuvwxyz0987654321abcdefghijklmnopqrstuvwxyz0987654321abcdefghijklmnopqrstuvwxyz0987654321", "output": "324" }, { "input": "zazaeeeeeeeq34443333444tttttt", "output": "155" }, { "input": "00000000000000000000000", "output": "529" }, { "input": "999000888775646453342311", "output": "62" } ]
1,615,548,932
2,147,483,647
Python 3
OK
TESTS
30
154
307,200
S=input() cnt={} for each in S: cnt[each]=cnt.get(each,0)+1 ls=cnt.values() s=0 for i in ls: s+=int(i)**2 print(s)
Title: Choosing Symbol Pairs Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: There is a given string *S* consisting of *N* symbols. Your task is to find the number of ordered pairs of integers *i* and *j* such that 1. 1<=≤<=*i*,<=*j*<=≤<=*N* 2. *S*[*i*]<==<=*S*[*j*], that is the *i*-th symbol of string *S* is equal to the *j*-th. Input Specification: The single input line contains *S*, consisting of lowercase Latin letters and digits. It is guaranteed that string *S* in not empty and its length does not exceed 105. Output Specification: Print a single number which represents the number of pairs *i* and *j* with the needed property. Pairs (*x*,<=*y*) and (*y*,<=*x*) should be considered different, i.e. the ordered pairs count. Demo Input: ['great10\n', 'aaaaaaaaaa\n'] Demo Output: ['7\n', '100\n'] Note: none
```python S=input() cnt={} for each in S: cnt[each]=cnt.get(each,0)+1 ls=cnt.values() s=0 for i in ls: s+=int(i)**2 print(s) ```
3.960928
705
A
Hulk
PROGRAMMING
800
[ "implementation" ]
null
null
Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings. Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on... For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on. Please help Dr. Banner.
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate.
Print Dr.Banner's feeling in one line.
[ "1\n", "2\n", "3\n" ]
[ "I hate it\n", "I hate that I love it\n", "I hate that I love that I hate it\n" ]
none
500
[ { "input": "1", "output": "I hate it" }, { "input": "2", "output": "I hate that I love it" }, { "input": "3", "output": "I hate that I love that I hate it" }, { "input": "4", "output": "I hate that I love that I hate that I love it" }, { "input": "5", "output": "I hate that I love that I hate that I love that I hate it" }, { "input": "10", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it" }, { "input": "18", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it" }, { "input": "19", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it" }, { "input": "76", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "77", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "81", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "82", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "85", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "86", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "100", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "99", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "98", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "33", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it" }, { "input": "34", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it" }, { "input": "57", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "100", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." } ]
1,695,622,853
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
46
0
a = int(input()) sent = [] def hulk(n): while n > 1: if n % 2 == 0: sent.append('that I love') n -= 1 return hulk(n - 1) elif n % 2 == 1: sent.append('that I hate') return hulk(n - 1) hulk(a) print('I hate', end=' ') for i in range(len(sent)): print(sent[i], end=' ') print('it', end='')
Title: Hulk Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings. Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on... For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on. Please help Dr. Banner. Input Specification: The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate. Output Specification: Print Dr.Banner's feeling in one line. Demo Input: ['1\n', '2\n', '3\n'] Demo Output: ['I hate it\n', 'I hate that I love it\n', 'I hate that I love that I hate it\n'] Note: none
```python a = int(input()) sent = [] def hulk(n): while n > 1: if n % 2 == 0: sent.append('that I love') n -= 1 return hulk(n - 1) elif n % 2 == 1: sent.append('that I hate') return hulk(n - 1) hulk(a) print('I hate', end=' ') for i in range(len(sent)): print(sent[i], end=' ') print('it', end='') ```
0