contestId
int64
0
1.01k
index
stringclasses
57 values
name
stringlengths
2
58
type
stringclasses
2 values
rating
int64
0
3.5k
tags
listlengths
0
11
title
stringclasses
522 values
time-limit
stringclasses
8 values
memory-limit
stringclasses
8 values
problem-description
stringlengths
0
7.15k
input-specification
stringlengths
0
2.05k
output-specification
stringlengths
0
1.5k
demo-input
listlengths
0
7
demo-output
listlengths
0
7
note
stringlengths
0
5.24k
points
float64
0
425k
test_cases
listlengths
0
402
creationTimeSeconds
int64
1.37B
1.7B
relativeTimeSeconds
int64
8
2.15B
programmingLanguage
stringclasses
3 values
verdict
stringclasses
14 values
testset
stringclasses
12 values
passedTestCount
int64
0
1k
timeConsumedMillis
int64
0
15k
memoryConsumedBytes
int64
0
805M
code
stringlengths
3
65.5k
prompt
stringlengths
262
8.2k
response
stringlengths
17
65.5k
score
float64
-1
3.99
828
B
Black Square
PROGRAMMING
1,300
[ "implementation" ]
null
null
Polycarp has a checkered sheet of paper of size *n*<=×<=*m*. Polycarp painted some of cells with black, the others remained white. Inspired by Malevich's "Black Square", Polycarp wants to paint minimum possible number of white cells with black so that all black cells form a square. You are to determine the minimum possible number of cells needed to be painted black so that the black cells form a black square with sides parallel to the painting's sides. All the cells that do not belong to the square should be white. The square's side should have positive length.
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the sizes of the sheet. The next *n* lines contain *m* letters 'B' or 'W' each — the description of initial cells' colors. If a letter is 'B', then the corresponding cell is painted black, otherwise it is painted white.
Print the minimum number of cells needed to be painted black so that the black cells form a black square with sides parallel to the painting's sides. All the cells that do not belong to the square should be white. If it is impossible, print -1.
[ "5 4\nWWWW\nWWWB\nWWWB\nWWBB\nWWWW\n", "1 2\nBB\n", "3 3\nWWW\nWWW\nWWW\n" ]
[ "5\n", "-1\n", "1\n" ]
In the first example it is needed to paint 5 cells — (2, 2), (2, 3), (3, 2), (3, 3) and (4, 2). Then there will be a square with side equal to three, and the upper left corner in (2, 2). In the second example all the cells are painted black and form a rectangle, so it's impossible to get a square. In the third example all cells are colored white, so it's sufficient to color any cell black.
750
[ { "input": "5 4\nWWWW\nWWWB\nWWWB\nWWBB\nWWWW", "output": "5" }, { "input": "1 2\nBB", "output": "-1" }, { "input": "3 3\nWWW\nWWW\nWWW", "output": "1" }, { "input": "100 1\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nB\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nB", "output": "-1" }, { "input": "1 1\nW", "output": "1" }, { "input": "2 4\nWWWW\nWBWW", "output": "0" }, { "input": "4 5\nWWWWW\nBBWWW\nBBWWW\nWWWWW", "output": "0" }, { "input": "5 4\nWWWW\nWWWW\nWWWB\nWWWW\nWWWW", "output": "0" }, { "input": "10 5\nWWWWB\nWWWWW\nWWWBB\nWWBWW\nWWWWW\nWWWWW\nWWWWW\nWWWWW\nWWWWW\nWWWWW", "output": "12" }, { "input": "5 10\nWWWWWWWWWW\nWWWWBWBBWW\nWWWWWWWWWW\nWWWWBWWWWW\nWWWWWWBWWW", "output": "11" }, { "input": "20 10\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWBBWBWWWW\nWWBWWBWWWW\nWWWWBWWWWW\nWWWWBWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW", "output": "9" }, { "input": "10 20\nWWWWWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWWWWWWBW\nWWWWWWWWWWWWWWWWWBWW\nWWWWWWWWWWWWWWWWWWWW", "output": "2" }, { "input": "1 1\nW", "output": "1" }, { "input": "1 1\nB", "output": "0" }, { "input": "2 2\nWW\nWW", "output": "1" }, { "input": "2 2\nWW\nWB", "output": "0" }, { "input": "2 2\nWW\nBW", "output": "0" }, { "input": "2 2\nWW\nBB", "output": "2" }, { "input": "2 2\nWB\nWW", "output": "0" }, { "input": "2 2\nWB\nWB", "output": "2" }, { "input": "2 2\nWB\nBW", "output": "2" }, { "input": "2 2\nWB\nBB", "output": "1" }, { "input": "2 2\nBW\nWW", "output": "0" }, { "input": "2 2\nBW\nWB", "output": "2" }, { "input": "2 2\nBW\nBW", "output": "2" }, { "input": "2 2\nBW\nBB", "output": "1" }, { "input": "2 2\nBB\nWW", "output": "2" }, { "input": "2 2\nBB\nWB", "output": "1" }, { "input": "2 2\nBB\nBW", "output": "1" }, { "input": "2 2\nBB\nBB", "output": "0" }, { "input": "1 2\nWW", "output": "1" }, { "input": "1 2\nWB", "output": "0" }, { "input": "1 2\nBW", "output": "0" }, { "input": "2 1\nW\nW", "output": "1" }, { "input": "2 1\nW\nB", "output": "0" }, { "input": "2 1\nB\nW", "output": "0" }, { "input": "2 1\nB\nB", "output": "-1" }, { "input": "20 10\nWWBWWWBBWW\nWWWWWBWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWBBBWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWBWWWWWBWW\nWBWWBWWWBW\nWWBWBWWWWW\nWWWBWWBBWW\nWWBBWBWBWW\nBBWWWWWBWW\nWWBWWBBBWW\nWWWBWBBWWW\nWWWBBWBWWW\nWWWWWWWWWW\nWWWBWWWWWW\nWWWWWWWWWW", "output": "-1" }, { "input": "10 20\nWWWWWWWBWWWWWWWBWWWB\nWWWBWWWBWWWWWWWWWWWW\nBWWWWWWWWWWWWWWWWWBB\nWWWWWWBWWBWWBWWWBWWW\nWWWWWWWWBWWBWWWBWWWW\nWBWWWWWWWBWWWWWWWWWW\nWWWBWBWWBWWWWWBBWWWB\nWWBBWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWBWWWWBW\nWWWWWWWWWWWWBWWBWWWB", "output": "-1" }, { "input": "1 100\nBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW", "output": "0" }, { "input": "1 100\nWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWB", "output": "0" }, { "input": "1 100\nWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW", "output": "0" }, { "input": "1 100\nBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW", "output": "-1" }, { "input": "1 100\nWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWB", "output": "-1" }, { "input": "100 1\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nB", "output": "0" }, { "input": "100 1\nB\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW", "output": "0" }, { "input": "100 1\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nB\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW", "output": "0" }, { "input": "100 1\nB\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nB\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW", "output": "-1" }, { "input": "1 5\nWBBWW", "output": "-1" }, { "input": "20 1\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nB\nB\nB", "output": "-1" }, { "input": "3 3\nWBW\nWBB\nWWW", "output": "1" }, { "input": "4 6\nWWWWWW\nWWWBWW\nWWWWWB\nWWWWWW", "output": "7" }, { "input": "5 5\nWBWBW\nWWWWW\nWWWWW\nWWWWW\nWWWWW", "output": "7" }, { "input": "3 3\nBBB\nBBB\nBBB", "output": "0" }, { "input": "5 5\nWWBWW\nWWWWW\nWWWWW\nWWWWW\nWWBWW", "output": "23" }, { "input": "5 4\nWWBW\nBWWB\nWWWW\nWWWW\nWWWW", "output": "13" }, { "input": "5 4\nWWWW\nWWWB\nWWWB\nWWWW\nWBBW", "output": "12" }, { "input": "6 6\nWWBWWW\nWWWWWW\nWWWWWW\nWWWWWW\nWWWWWW\nWWWBWW", "output": "34" }, { "input": "3 3\nBBW\nWWW\nBWW", "output": "6" }, { "input": "3 3\nBWB\nWWW\nBWW", "output": "6" }, { "input": "6 6\nWBWWWW\nBWWWBW\nWWWWWW\nWWBWWW\nWWWWWW\nWWWWWW", "output": "21" }, { "input": "3 3\nWWW\nWBW\nWWW", "output": "0" }, { "input": "3 3\nBBB\nWWW\nWWW", "output": "6" }, { "input": "5 5\nWWBWW\nWWBWW\nWBBBW\nWWBWW\nWWBWW", "output": "18" }, { "input": "5 2\nWB\nWB\nWB\nWW\nWW", "output": "-1" }, { "input": "4 7\nBBBBBWW\nWWWWWWW\nWWWWWWW\nWWWWWWW", "output": "-1" }, { "input": "5 4\nWWWW\nWWWB\nWWWW\nWWBB\nWWWW", "output": "6" }, { "input": "4 4\nWWWW\nWBWW\nWWWW\nWWWW", "output": "0" }, { "input": "2 5\nWWWWW\nBBBWW", "output": "-1" }, { "input": "6 6\nWWBWWW\nWWWWWW\nWWWWBW\nWWWWWW\nWWWWWW\nWWBWWW", "output": "33" }, { "input": "3 3\nWBW\nWBW\nWBW", "output": "6" }, { "input": "3 5\nWWBBB\nBWBBB\nWWBBB", "output": "-1" }, { "input": "5 5\nWWWWB\nBWWWW\nWWWWB\nWWWWW\nWWWWW", "output": "22" }, { "input": "5 5\nBWWWB\nWWWWW\nWWWWW\nWWWWW\nBWWWW", "output": "22" }, { "input": "4 5\nWWWWW\nBWWWW\nBBBWW\nWWWWW", "output": "5" }, { "input": "4 4\nBBBB\nWWWW\nWWWW\nWWWW", "output": "12" }, { "input": "4 6\nWWWWWW\nBWWWWW\nBWWWWW\nBBBBBB", "output": "-1" }, { "input": "3 6\nWWWWWW\nBBBWWW\nWWWWWW", "output": "6" }, { "input": "5 2\nWW\nBW\nBW\nBB\nWW", "output": "-1" }, { "input": "5 5\nWWWWW\nWWWWW\nBBBBB\nWWWWW\nWWWWW", "output": "20" }, { "input": "5 5\nWWWWW\nWWWWW\nWWWWB\nWBWWW\nWWWWW", "output": "14" }, { "input": "1 5\nWWBWW", "output": "0" }, { "input": "1 3\nBBB", "output": "-1" }, { "input": "2 4\nWWBW\nBWBW", "output": "-1" }, { "input": "6 6\nBBBBBB\nWWWWWW\nWWWWWW\nWWWWWW\nWWWWWW\nWWWWWW", "output": "30" }, { "input": "4 4\nWWWW\nWWWW\nWWWW\nWWWW", "output": "1" }, { "input": "3 3\nWWW\nWWW\nWWB", "output": "0" }, { "input": "5 1\nB\nB\nW\nW\nW", "output": "-1" }, { "input": "2 3\nWBW\nWBW", "output": "2" }, { "input": "5 2\nWW\nWB\nWB\nWB\nWW", "output": "-1" }, { "input": "5 5\nWWWWW\nBWWWW\nWWWWB\nWWWWW\nWWWWW", "output": "23" } ]
1,568,378,560
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
9
124
1,740,800
def transpose(a,n,m): c = [] for i in range(max(n,m)): k = [] for j in range(max(n,m)): try: k.append(a[j][i]) except: pass c.append(k) return c n,m = map(int,input().split()) c = [] for i in range(n): c.append(list(input())) p = transpose(c,n,m) lu = 1000000000 ld = 0 ll = 1000000000 lr = 0 for i in range(len(c)): try: q = c[i].index('B') ll = min(ll,q) except: pass for i in range(len(p)): try: q = p[i].index('B') lu = min(lu,q) except: pass for i in range(len(c)): try: c[i].reverse() q = c[i].index('B') lr = max(ll,m-q-1) c[i].reverse() except: pass for i in range(len(c)): try: p[i].reverse() q = p[i].index('B') ld = max(ll,n-q-1) p[i].reverse() except: pass if lr == 0 and ll == 1000000000 and lu == 1000000000 and ld == 0: print(1) else: side1 = lr-ll+1 side2 = ld-lu+1 p = max(side1,side2) if p==side1: lu = ld-p+1 else: ll = lr-p+1 if lu<0 or ll<0: print(-1) else: k = 0 for i in range(lu,ld+1): for j in range(ll,lr+1): if c[i][j]!='B': k+=1 print(k)
Title: Black Square Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp has a checkered sheet of paper of size *n*<=×<=*m*. Polycarp painted some of cells with black, the others remained white. Inspired by Malevich's "Black Square", Polycarp wants to paint minimum possible number of white cells with black so that all black cells form a square. You are to determine the minimum possible number of cells needed to be painted black so that the black cells form a black square with sides parallel to the painting's sides. All the cells that do not belong to the square should be white. The square's side should have positive length. Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the sizes of the sheet. The next *n* lines contain *m* letters 'B' or 'W' each — the description of initial cells' colors. If a letter is 'B', then the corresponding cell is painted black, otherwise it is painted white. Output Specification: Print the minimum number of cells needed to be painted black so that the black cells form a black square with sides parallel to the painting's sides. All the cells that do not belong to the square should be white. If it is impossible, print -1. Demo Input: ['5 4\nWWWW\nWWWB\nWWWB\nWWBB\nWWWW\n', '1 2\nBB\n', '3 3\nWWW\nWWW\nWWW\n'] Demo Output: ['5\n', '-1\n', '1\n'] Note: In the first example it is needed to paint 5 cells — (2, 2), (2, 3), (3, 2), (3, 3) and (4, 2). Then there will be a square with side equal to three, and the upper left corner in (2, 2). In the second example all the cells are painted black and form a rectangle, so it's impossible to get a square. In the third example all cells are colored white, so it's sufficient to color any cell black.
```python def transpose(a,n,m): c = [] for i in range(max(n,m)): k = [] for j in range(max(n,m)): try: k.append(a[j][i]) except: pass c.append(k) return c n,m = map(int,input().split()) c = [] for i in range(n): c.append(list(input())) p = transpose(c,n,m) lu = 1000000000 ld = 0 ll = 1000000000 lr = 0 for i in range(len(c)): try: q = c[i].index('B') ll = min(ll,q) except: pass for i in range(len(p)): try: q = p[i].index('B') lu = min(lu,q) except: pass for i in range(len(c)): try: c[i].reverse() q = c[i].index('B') lr = max(ll,m-q-1) c[i].reverse() except: pass for i in range(len(c)): try: p[i].reverse() q = p[i].index('B') ld = max(ll,n-q-1) p[i].reverse() except: pass if lr == 0 and ll == 1000000000 and lu == 1000000000 and ld == 0: print(1) else: side1 = lr-ll+1 side2 = ld-lu+1 p = max(side1,side2) if p==side1: lu = ld-p+1 else: ll = lr-p+1 if lu<0 or ll<0: print(-1) else: k = 0 for i in range(lu,ld+1): for j in range(ll,lr+1): if c[i][j]!='B': k+=1 print(k) ```
0
598
A
Tricky Sum
PROGRAMMING
900
[ "math" ]
null
null
In this problem you are to calculate the sum of all integers from 1 to *n*, but you should take all powers of two with minus in the sum. For example, for *n*<==<=4 the sum is equal to <=-<=1<=-<=2<=+<=3<=-<=4<==<=<=-<=4, because 1, 2 and 4 are 20, 21 and 22 respectively. Calculate the answer for *t* values of *n*.
The first line of the input contains a single integer *t* (1<=≤<=*t*<=≤<=100) — the number of values of *n* to be processed. Each of next *t* lines contains a single integer *n* (1<=≤<=*n*<=≤<=109).
Print the requested sum for each of *t* integers *n* given in the input.
[ "2\n4\n1000000000\n" ]
[ "-4\n499999998352516354\n" ]
The answer for the first sample is explained in the statement.
0
[ { "input": "2\n4\n1000000000", "output": "-4\n499999998352516354" }, { "input": "10\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10", "output": "-1\n-3\n0\n-4\n1\n7\n14\n6\n15\n25" }, { "input": "10\n10\n9\n47\n33\n99\n83\n62\n1\n100\n53", "output": "25\n15\n1002\n435\n4696\n3232\n1827\n-1\n4796\n1305" }, { "input": "100\n901\n712\n3\n677\n652\n757\n963\n134\n205\n888\n847\n283\n591\n984\n1\n61\n540\n986\n950\n729\n104\n244\n500\n461\n251\n685\n631\n803\n526\n600\n1000\n899\n411\n219\n597\n342\n771\n348\n507\n775\n454\n102\n486\n333\n580\n431\n537\n355\n624\n23\n429\n276\n84\n704\n96\n536\n855\n653\n72\n718\n776\n658\n802\n777\n995\n285\n328\n405\n184\n555\n956\n410\n846\n853\n525\n983\n65\n549\n839\n929\n620\n725\n635\n303\n201\n878\n580\n139\n182\n69\n400\n788\n985\n792\n103\n248\n570\n839\n253\n417", "output": "404305\n251782\n0\n227457\n210832\n284857\n462120\n8535\n20605\n392670\n357082\n39164\n172890\n482574\n-1\n1765\n144024\n484545\n449679\n264039\n5206\n29380\n124228\n105469\n31116\n232909\n197350\n320760\n136555\n178254\n498454\n402504\n83644\n23580\n176457\n57631\n295560\n59704\n127756\n298654\n102263\n4999\n117319\n54589\n166444\n92074\n142407\n62168\n192954\n214\n91213\n37204\n3316\n246114\n4402\n141870\n363894\n211485\n2374\n256075\n299430\n214765\n319957\n300207\n493464\n39733\n52934\n81193\n16510\n15..." }, { "input": "1\n16", "output": "74" }, { "input": "60\n536870912\n536870911\n536870913\n1000000000\n999999999\n1\n2\n3\n4\n268435456\n268435455\n268435457\n536870912\n536870911\n536870913\n1000000000\n999999999\n1\n2\n3\n4\n268435456\n268435455\n268435457\n536870912\n536870911\n536870913\n1000000000\n999999999\n1\n2\n3\n4\n268435456\n268435455\n268435457\n536870912\n536870911\n536870913\n1000000000\n999999999\n1\n2\n3\n4\n268435456\n268435455\n268435457\n536870912\n536870911\n536870913\n1000000000\n999999999\n1\n2\n3\n4\n268435456\n268435455\n268435457", "output": "144115186196807682\n144115186733678594\n144115186733678595\n499999998352516354\n499999997352516354\n-1\n-3\n0\n-4\n36028796079439874\n36028796347875330\n36028796347875331\n144115186196807682\n144115186733678594\n144115186733678595\n499999998352516354\n499999997352516354\n-1\n-3\n0\n-4\n36028796079439874\n36028796347875330\n36028796347875331\n144115186196807682\n144115186733678594\n144115186733678595\n499999998352516354\n499999997352516354\n-1\n-3\n0\n-4\n36028796079439874\n36028796347875330\n36028796347875..." }, { "input": "13\n1\n19\n31\n19\n19\n92\n74\n69\n32\n32\n91\n42\n73", "output": "-1\n128\n434\n128\n128\n4024\n2521\n2161\n402\n402\n3932\n777\n2447" }, { "input": "1\n16383", "output": "134176770" }, { "input": "16\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100\n100100", "output": "5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908\n5009792908" }, { "input": "1\n414234", "output": "85794061921" }, { "input": "1\n414232", "output": "85793233454" }, { "input": "3\n414231\n414231\n414231", "output": "85792819222\n85792819222\n85792819222" }, { "input": "1\n121", "output": "7127" } ]
1,693,395,431
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
30
0
t = int(input()) for i in range(t): n = int(input()) i = 0 s = [] while 2**i <= n: s.append(2**i) i += 1 if n % 2 == 0: sm = (1 + n) * (n // 2) else: sm = (1 + n) * (n // 2) - (n + 1) // 2 sm = sm - 2 * sum(s) print(sm) #1 4 #4 #5 4 3 2 #2 1 3 2 #3
Title: Tricky Sum Time Limit: None seconds Memory Limit: None megabytes Problem Description: In this problem you are to calculate the sum of all integers from 1 to *n*, but you should take all powers of two with minus in the sum. For example, for *n*<==<=4 the sum is equal to <=-<=1<=-<=2<=+<=3<=-<=4<==<=<=-<=4, because 1, 2 and 4 are 20, 21 and 22 respectively. Calculate the answer for *t* values of *n*. Input Specification: The first line of the input contains a single integer *t* (1<=≤<=*t*<=≤<=100) — the number of values of *n* to be processed. Each of next *t* lines contains a single integer *n* (1<=≤<=*n*<=≤<=109). Output Specification: Print the requested sum for each of *t* integers *n* given in the input. Demo Input: ['2\n4\n1000000000\n'] Demo Output: ['-4\n499999998352516354\n'] Note: The answer for the first sample is explained in the statement.
```python t = int(input()) for i in range(t): n = int(input()) i = 0 s = [] while 2**i <= n: s.append(2**i) i += 1 if n % 2 == 0: sm = (1 + n) * (n // 2) else: sm = (1 + n) * (n // 2) - (n + 1) // 2 sm = sm - 2 * sum(s) print(sm) #1 4 #4 #5 4 3 2 #2 1 3 2 #3 ```
0
315
A
Sereja and Bottles
PROGRAMMING
1,400
[ "brute force" ]
null
null
Sereja and his friends went to a picnic. The guys had *n* soda bottles just for it. Sereja forgot the bottle opener as usual, so the guys had to come up with another way to open bottles. Sereja knows that the *i*-th bottle is from brand *a**i*, besides, you can use it to open other bottles of brand *b**i*. You can use one bottle to open multiple other bottles. Sereja can open bottle with opened bottle or closed bottle. Knowing this, Sereja wants to find out the number of bottles they've got that they won't be able to open in any way. Help him and find this number.
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of bottles. The next *n* lines contain the bottles' description. The *i*-th line contains two integers *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the description of the *i*-th bottle.
In a single line print a single integer — the answer to the problem.
[ "4\n1 1\n2 2\n3 3\n4 4\n", "4\n1 2\n2 3\n3 4\n4 1\n" ]
[ "4\n", "0\n" ]
none
500
[ { "input": "4\n1 1\n2 2\n3 3\n4 4", "output": "4" }, { "input": "4\n1 2\n2 3\n3 4\n4 1", "output": "0" }, { "input": "3\n2 828\n4 392\n4 903", "output": "3" }, { "input": "4\n2 3\n1 772\n3 870\n3 668", "output": "2" }, { "input": "5\n1 4\n6 6\n4 3\n3 4\n4 758", "output": "2" }, { "input": "6\n4 843\n2 107\n10 943\n9 649\n7 806\n6 730", "output": "6" }, { "input": "7\n351 955\n7 841\n102 377\n394 102\n549 440\n630 324\n624 624", "output": "6" }, { "input": "8\n83 978\n930 674\n542 22\n834 116\n116 271\n640 930\n659 930\n705 987", "output": "6" }, { "input": "9\n162 942\n637 967\n356 108\n768 53\n656 656\n575 32\n32 575\n53 53\n351 222", "output": "6" }, { "input": "10\n423 360\n947 538\n507 484\n31 947\n414 351\n169 901\n901 21\n592 22\n763 200\n656 485", "output": "8" }, { "input": "1\n1000 1000", "output": "1" }, { "input": "1\n500 1000", "output": "1" }, { "input": "11\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11", "output": "11" }, { "input": "49\n1 758\n5 3\n5 3\n4 2\n4 36\n3 843\n5 107\n1 943\n1 649\n2 806\n3 730\n2 351\n2 102\n1 4\n3 4\n3 955\n2 841\n2 377\n5 2\n3 440\n4 324\n3 3\n3 83\n2 2\n2 1\n4 1\n1 931\n3 4\n2 5\n2 5\n4 73\n5 830\n3 4\n3 5\n5 291\n1 2\n5 3\n4 4\n2 3\n3 151\n4 2\n4 431\n5 1\n2 5\n2 4\n4 2\n4 4\n3 1\n5 2", "output": "0" }, { "input": "50\n507 31\n31 250\n414 763\n169 304\n901 9\n592 610\n763 414\n656 789\n411 422\n360 468\n625 504\n538 201\n549 619\n484 797\n596 282\n42 310\n603 656\n351 623\n292 293\n837 180\n375 658\n21 192\n597 729\n22 512\n349 635\n200 56\n669 647\n485 887\n282 939\n735 808\n54 417\n1000 310\n419 652\n939 617\n901 669\n789 390\n128 549\n468 511\n729 837\n894 729\n649 894\n484 22\n808 586\n422 286\n311 427\n618 656\n814 933\n515 901\n310 894\n617 330", "output": "30" }, { "input": "2\n7 7\n5 359", "output": "2" }, { "input": "2\n465 706\n706 706", "output": "1" }, { "input": "2\n1 1\n1 1", "output": "0" }, { "input": "3\n1 1\n1 1\n2 2", "output": "1" }, { "input": "5\n1 1\n1 2\n2 3\n3 4\n4 3", "output": "1" }, { "input": "3\n1 2\n1 2\n1 1", "output": "1" } ]
1,370,811,966
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
62
0
n = int (input()) a = [0]*n m = 0 for i in range(n): b = input() b=b.split(' ') c = int(b[1]) b=int(b[0]) if a[b-1] == 0: m +=1 a[b-1]=1 print (m)
Title: Sereja and Bottles Time Limit: None seconds Memory Limit: None megabytes Problem Description: Sereja and his friends went to a picnic. The guys had *n* soda bottles just for it. Sereja forgot the bottle opener as usual, so the guys had to come up with another way to open bottles. Sereja knows that the *i*-th bottle is from brand *a**i*, besides, you can use it to open other bottles of brand *b**i*. You can use one bottle to open multiple other bottles. Sereja can open bottle with opened bottle or closed bottle. Knowing this, Sereja wants to find out the number of bottles they've got that they won't be able to open in any way. Help him and find this number. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of bottles. The next *n* lines contain the bottles' description. The *i*-th line contains two integers *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the description of the *i*-th bottle. Output Specification: In a single line print a single integer — the answer to the problem. Demo Input: ['4\n1 1\n2 2\n3 3\n4 4\n', '4\n1 2\n2 3\n3 4\n4 1\n'] Demo Output: ['4\n', '0\n'] Note: none
```python n = int (input()) a = [0]*n m = 0 for i in range(n): b = input() b=b.split(' ') c = int(b[1]) b=int(b[0]) if a[b-1] == 0: m +=1 a[b-1]=1 print (m) ```
0
2
A
Winner
PROGRAMMING
1,500
[ "hashing", "implementation" ]
A. Winner
1
64
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
Print the name of the winner.
[ "3\nmike 3\nandrew 5\nmike 2\n", "3\nandrew 3\nandrew 2\nmike 5\n" ]
[ "andrew\n", "andrew\n" ]
none
0
[ { "input": "3\nmike 3\nandrew 5\nmike 2", "output": "andrew" }, { "input": "3\nandrew 3\nandrew 2\nmike 5", "output": "andrew" }, { "input": "5\nkaxqybeultn -352\nmgochgrmeyieyskhuourfg -910\nkaxqybeultn 691\nmgochgrmeyieyskhuourfg -76\nkaxqybeultn -303", "output": "kaxqybeultn" }, { "input": "7\nksjuuerbnlklcfdjeyq 312\ndthjlkrvvbyahttifpdewvyslsh -983\nksjuuerbnlklcfdjeyq 268\ndthjlkrvvbyahttifpdewvyslsh 788\nksjuuerbnlklcfdjeyq -79\nksjuuerbnlklcfdjeyq -593\nksjuuerbnlklcfdjeyq 734", "output": "ksjuuerbnlklcfdjeyq" }, { "input": "12\natrtthfpcvishmqbakprquvnejr 185\natrtthfpcvishmqbakprquvnejr -699\natrtthfpcvishmqbakprquvnejr -911\natrtthfpcvishmqbakprquvnejr -220\nfcgslzkicjrpbqaifgweyzreajjfdo 132\nfcgslzkicjrpbqaifgweyzreajjfdo -242\nm 177\nm -549\natrtthfpcvishmqbakprquvnejr -242\nm 38\natrtthfpcvishmqbakprquvnejr -761\nfcgslzkicjrpbqaifgweyzreajjfdo 879", "output": "fcgslzkicjrpbqaifgweyzreajjfdo" }, { "input": "15\naawtvezfntstrcpgbzjbf 681\nzhahpvqiptvksnbjkdvmknb -74\naawtvezfntstrcpgbzjbf 661\njpdwmyke 474\naawtvezfntstrcpgbzjbf -547\naawtvezfntstrcpgbzjbf 600\nzhahpvqiptvksnbjkdvmknb -11\njpdwmyke 711\nbjmj 652\naawtvezfntstrcpgbzjbf -1000\naawtvezfntstrcpgbzjbf -171\nbjmj -302\naawtvezfntstrcpgbzjbf 961\nzhahpvqiptvksnbjkdvmknb 848\nbjmj -735", "output": "aawtvezfntstrcpgbzjbf" }, { "input": "17\nqdplghhx -649\nivhgbxiv 424\nivhgbxiv -72\nivhgbxiv 479\nugowfouebkelargxylsxn 83\nugowfouebkelargxylsxn -840\nivhgbxiv 382\nqdplghhx -904\nivhgbxiv -710\nugowfouebkelargxylsxn -838\nqdplghhx -974\nqdplghhx 571\nivhgbxiv -145\nugowfouebkelargxylsxn -788\nivhgbxiv 209\nivhgbxiv 420\nqdplghhx -158", "output": "ivhgbxiv" } ]
1,688,085,969
2,147,483,647
PyPy 3-64
OK
TESTS
20
184
1,945,600
scores, jugadas = {}, [] for i in range(int(input())): # print("Hola") data = input().split(" ") name, score = data[0], int(data[1]) scores[name] = scores.get(name, 0)+score jugadas += [(name, scores[name])] # Puntaje acumulado maximo = max(scores.values()) for name, score in jugadas: if scores[name] == maximo and score >= maximo: print(name) break
Title: Winner Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points. Input Specification: The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive. Output Specification: Print the name of the winner. Demo Input: ['3\nmike 3\nandrew 5\nmike 2\n', '3\nandrew 3\nandrew 2\nmike 5\n'] Demo Output: ['andrew\n', 'andrew\n'] Note: none
```python scores, jugadas = {}, [] for i in range(int(input())): # print("Hola") data = input().split(" ") name, score = data[0], int(data[1]) scores[name] = scores.get(name, 0)+score jugadas += [(name, scores[name])] # Puntaje acumulado maximo = max(scores.values()) for name, score in jugadas: if scores[name] == maximo and score >= maximo: print(name) break ```
3.893504
268
A
Games
PROGRAMMING
800
[ "brute force" ]
null
null
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
In a single line print the number of games where the host team is going to play in the guest uniform.
[ "3\n1 2\n2 4\n3 4\n", "4\n100 42\n42 100\n5 42\n100 5\n", "2\n1 2\n1 2\n" ]
[ "1\n", "5\n", "0\n" ]
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
500
[ { "input": "3\n1 2\n2 4\n3 4", "output": "1" }, { "input": "4\n100 42\n42 100\n5 42\n100 5", "output": "5" }, { "input": "2\n1 2\n1 2", "output": "0" }, { "input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52", "output": "6" }, { "input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28", "output": "1" }, { "input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77", "output": "6" }, { "input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35", "output": "4" }, { "input": "2\n46 6\n6 46", "output": "2" }, { "input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11", "output": "10" }, { "input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33", "output": "6" }, { "input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73", "output": "0" }, { "input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2", "output": "1" }, { "input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100", "output": "8" }, { "input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "450" }, { "input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3", "output": "0" }, { "input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5", "output": "20" }, { "input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2", "output": "108" }, { "input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2", "output": "312" }, { "input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6", "output": "96" }, { "input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97", "output": "210" }, { "input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78", "output": "73" }, { "input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80", "output": "277" }, { "input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21", "output": "154" }, { "input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17", "output": "418" }, { "input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80", "output": "74" }, { "input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9", "output": "59" }, { "input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67", "output": "100" }, { "input": "4\n8 7\n8 7\n7 8\n7 8", "output": "8" }, { "input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1", "output": "10" }, { "input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "72" }, { "input": "4\n1 2\n1 2\n2 1\n2 1", "output": "8" } ]
1,698,519,567
2,147,483,647
Python 3
OK
TESTS
31
92
0
n = int(input()) score = 0 homeColors = [] awayColors = [] for i in range(n): home, away = input().split() homeColors.append(home) awayColors.append(away) for i in range(n): for j in range(n): if i!=j and homeColors[i] == awayColors[j]: score+=1 print(score)
Title: Games Time Limit: None seconds Memory Limit: None megabytes Problem Description: Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question. Input Specification: The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively. Output Specification: In a single line print the number of games where the host team is going to play in the guest uniform. Demo Input: ['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n'] Demo Output: ['1\n', '5\n', '0\n'] Note: In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
```python n = int(input()) score = 0 homeColors = [] awayColors = [] for i in range(n): home, away = input().split() homeColors.append(home) awayColors.append(away) for i in range(n): for j in range(n): if i!=j and homeColors[i] == awayColors[j]: score+=1 print(score) ```
3
43
A
Football
PROGRAMMING
1,000
[ "strings" ]
A. Football
2
256
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
[ "1\nABC\n", "5\nA\nABA\nABA\nA\nA\n" ]
[ "ABC\n", "A\n" ]
none
500
[ { "input": "1\nABC", "output": "ABC" }, { "input": "5\nA\nABA\nABA\nA\nA", "output": "A" }, { "input": "2\nXTSJEP\nXTSJEP", "output": "XTSJEP" }, { "input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ", "output": "XZYDJAEDZ" }, { "input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD", "output": "QCCYXL" }, { "input": "3\nAZID\nEERWBC\nEERWBC", "output": "EERWBC" }, { "input": "3\nHNCGYL\nHNCGYL\nHNCGYL", "output": "HNCGYL" }, { "input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG", "output": "ZZWZTG" }, { "input": "4\nA\nA\nKUDLJMXCSE\nA", "output": "A" }, { "input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW", "output": "PHBTW" }, { "input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN", "output": "PKUZYTFYWN" }, { "input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH", "output": "HH" }, { "input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW", "output": "W" }, { "input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP", "output": "XBCP" }, { "input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS", "output": "PYPAS" }, { "input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC", "output": "NC" }, { "input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI", "output": "VOCI" }, { "input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA", "output": "HA" }, { "input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS", "output": "G" }, { "input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL", "output": "WL" } ]
1,662,535,123
2,147,483,647
PyPy 3-64
OK
TESTS
34
154
0
n=int(input()) l=[] l2=[] c1=0 c2=0 for _ in range(n): team=input() l2.append(team) if team not in l: l.append(team) for i in range(n): if l2[i]==l[0]: c1+=1 elif l2[i]==l[1]: c2+=1 if c1>c2: print(l[0]) elif c2>c1: print(l[1])
Title: Football Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams. Output Specification: Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner. Demo Input: ['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n'] Demo Output: ['ABC\n', 'A\n'] Note: none
```python n=int(input()) l=[] l2=[] c1=0 c2=0 for _ in range(n): team=input() l2.append(team) if team not in l: l.append(team) for i in range(n): if l2[i]==l[0]: c1+=1 elif l2[i]==l[1]: c2+=1 if c1>c2: print(l[0]) elif c2>c1: print(l[1]) ```
3.9615
749
A
Bachgold Problem
PROGRAMMING
800
[ "greedy", "implementation", "math", "number theory" ]
null
null
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1. Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*.
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000).
The first line of the output contains a single integer *k* — maximum possible number of primes in representation. The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
[ "5\n", "6\n" ]
[ "2\n2 3\n", "3\n2 2 2\n" ]
none
500
[ { "input": "5", "output": "2\n2 3" }, { "input": "6", "output": "3\n2 2 2" }, { "input": "2", "output": "1\n2" }, { "input": "3", "output": "1\n3" }, { "input": "99999", "output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "100000", "output": "50000\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "7", "output": "3\n2 2 3" }, { "input": "4", "output": "2\n2 2" }, { "input": "8", "output": "4\n2 2 2 2" }, { "input": "9", "output": "4\n2 2 2 3" }, { "input": "99995", "output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "99996", "output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "10", "output": "5\n2 2 2 2 2" }, { "input": "11", "output": "5\n2 2 2 2 3" }, { "input": "99997", "output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "99998", "output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "12", "output": "6\n2 2 2 2 2 2" }, { "input": "13", "output": "6\n2 2 2 2 2 3" }, { "input": "99993", "output": "49996\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "99994", "output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "14", "output": "7\n2 2 2 2 2 2 2" }, { "input": "15", "output": "7\n2 2 2 2 2 2 3" }, { "input": "53", "output": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3" }, { "input": "57", "output": "28\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3" }, { "input": "61", "output": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3" }, { "input": "774", "output": "387\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "202", "output": "101\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2" }, { "input": "530", "output": "265\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "7166", "output": "3583\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "9294", "output": "4647\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "2422", "output": "1211\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "15326", "output": "7663\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "11454", "output": "5727\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "14878", "output": "7439\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "90672", "output": "45336\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "99544", "output": "49772\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "90472", "output": "45236\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "23", "output": "11\n2 2 2 2 2 2 2 2 2 2 3" }, { "input": "93", "output": "46\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3" }, { "input": "19", "output": "9\n2 2 2 2 2 2 2 2 3" }, { "input": "11110", "output": "5555\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." } ]
1,663,578,035
2,147,483,647
Python 3
OK
TESTS
41
61
0
a=int(input()); print(a//2,"\n","2 "*(a//2-1),2+a%2)
Title: Bachgold Problem Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1. Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*. Input Specification: The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000). Output Specification: The first line of the output contains a single integer *k* — maximum possible number of primes in representation. The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them. Demo Input: ['5\n', '6\n'] Demo Output: ['2\n2 3\n', '3\n2 2 2\n'] Note: none
```python a=int(input()); print(a//2,"\n","2 "*(a//2-1),2+a%2) ```
3
494
A
Treasure
PROGRAMMING
1,500
[ "greedy" ]
null
null
Malek has recently found a treasure map. While he was looking for a treasure he found a locked door. There was a string *s* written on the door consisting of characters '(', ')' and '#'. Below there was a manual on how to open the door. After spending a long time Malek managed to decode the manual and found out that the goal is to replace each '#' with one or more ')' characters so that the final string becomes beautiful. Below there was also written that a string is called beautiful if for each *i* (1<=≤<=*i*<=≤<=|*s*|) there are no more ')' characters than '(' characters among the first *i* characters of *s* and also the total number of '(' characters is equal to the total number of ')' characters. Help Malek open the door by telling him for each '#' character how many ')' characters he must replace it with.
The first line of the input contains a string *s* (1<=≤<=|*s*|<=≤<=105). Each character of this string is one of the characters '(', ')' or '#'. It is guaranteed that *s* contains at least one '#' character.
If there is no way of replacing '#' characters which leads to a beautiful string print <=-<=1. Otherwise for each character '#' print a separate line containing a positive integer, the number of ')' characters this character must be replaced with. If there are several possible answers, you may output any of them.
[ "(((#)((#)\n", "()((#((#(#()\n", "#\n", "(#)\n" ]
[ "1\n2\n", "2\n2\n1", "-1\n", "-1\n" ]
|*s*| denotes the length of the string *s*.
500
[ { "input": "(((#)((#)", "output": "1\n2" }, { "input": "()((#((#(#()", "output": "1\n1\n3" }, { "input": "#", "output": "-1" }, { "input": "(#)", "output": "-1" }, { "input": "(((((#(#(#(#()", "output": "1\n1\n1\n5" }, { "input": "#))))", "output": "-1" }, { "input": "((#(()#(##", "output": "1\n1\n1\n1" }, { "input": "##((((((()", "output": "-1" }, { "input": "(((((((((((((((((((###################", "output": "1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1" }, { "input": "((#)(", "output": "-1" }, { "input": "((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((##", "output": "1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1" }, { "input": ")((##((###", "output": "-1" }, { "input": "(#))(#(#)((((#(##((#(#((((#(##((((((#((()(()(())((()#((((#((()((((#(((((#(##)(##()((((()())(((((#(((", "output": "-1" }, { "input": "#(#(#((##((()))(((#)(#()#(((()()(()#(##(((()(((()))#(((((()(((((((()#((#((()(#(((()(()##(()(((()((#(", "output": "-1" }, { "input": "((#(", "output": "-1" }, { "input": "()#(#())()()#)(#)()##)#((()#)((#)()#())((#((((((((#)()()(()()(((((#)#(#((((#((##()(##(((#(()(#((#))#", "output": "-1" }, { "input": "(())((((#)", "output": "3" }, { "input": "(#(", "output": "-1" }, { "input": "((#)(", "output": "-1" }, { "input": "(((()#(#)(", "output": "-1" }, { "input": "#((#", "output": "-1" }, { "input": "(#((((()", "output": "-1" }, { "input": "(#((", "output": "-1" }, { "input": ")(((())#", "output": "-1" } ]
1,448,612,477
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
5
77
204,800
# coding=utf-8 def main(): s = input() if s.count(')') >= s.count('('): print(-1) return count = 0 i = 0 while i < len(s) - 1: if s[i] == '(': count += 1 elif s[i] == ')': count -= 1 elif s[i] == '#': while i + 1 < len(s): if s[i + 1] == ')': count -= 1 i += 1 else: break print(count) count = 0 i += 1 if __name__ == '__main__': main()
Title: Treasure Time Limit: None seconds Memory Limit: None megabytes Problem Description: Malek has recently found a treasure map. While he was looking for a treasure he found a locked door. There was a string *s* written on the door consisting of characters '(', ')' and '#'. Below there was a manual on how to open the door. After spending a long time Malek managed to decode the manual and found out that the goal is to replace each '#' with one or more ')' characters so that the final string becomes beautiful. Below there was also written that a string is called beautiful if for each *i* (1<=≤<=*i*<=≤<=|*s*|) there are no more ')' characters than '(' characters among the first *i* characters of *s* and also the total number of '(' characters is equal to the total number of ')' characters. Help Malek open the door by telling him for each '#' character how many ')' characters he must replace it with. Input Specification: The first line of the input contains a string *s* (1<=≤<=|*s*|<=≤<=105). Each character of this string is one of the characters '(', ')' or '#'. It is guaranteed that *s* contains at least one '#' character. Output Specification: If there is no way of replacing '#' characters which leads to a beautiful string print <=-<=1. Otherwise for each character '#' print a separate line containing a positive integer, the number of ')' characters this character must be replaced with. If there are several possible answers, you may output any of them. Demo Input: ['(((#)((#)\n', '()((#((#(#()\n', '#\n', '(#)\n'] Demo Output: ['1\n2\n', '2\n2\n1', '-1\n', '-1\n'] Note: |*s*| denotes the length of the string *s*.
```python # coding=utf-8 def main(): s = input() if s.count(')') >= s.count('('): print(-1) return count = 0 i = 0 while i < len(s) - 1: if s[i] == '(': count += 1 elif s[i] == ')': count -= 1 elif s[i] == '#': while i + 1 < len(s): if s[i + 1] == ')': count -= 1 i += 1 else: break print(count) count = 0 i += 1 if __name__ == '__main__': main() ```
0
510
A
Fox And Snake
PROGRAMMING
800
[ "implementation" ]
null
null
Fox Ciel starts to learn programming. The first task is drawing a fox! However, that turns out to be too hard for a beginner, so she decides to draw a snake instead. A snake is a pattern on a *n* by *m* table. Denote *c*-th cell of *r*-th row as (*r*,<=*c*). The tail of the snake is located at (1,<=1), then it's body extends to (1,<=*m*), then goes down 2 rows to (3,<=*m*), then goes left to (3,<=1) and so on. Your task is to draw this snake for Fox Ciel: the empty cells should be represented as dot characters ('.') and the snake cells should be filled with number signs ('#'). Consider sample tests in order to understand the snake pattern.
The only line contains two integers: *n* and *m* (3<=≤<=*n*,<=*m*<=≤<=50). *n* is an odd number.
Output *n* lines. Each line should contain a string consisting of *m* characters. Do not output spaces.
[ "3 3\n", "3 4\n", "5 3\n", "9 9\n" ]
[ "###\n..#\n###\n", "####\n...#\n####\n", "###\n..#\n###\n#..\n###\n", "#########\n........#\n#########\n#........\n#########\n........#\n#########\n#........\n#########\n" ]
none
500
[ { "input": "3 3", "output": "###\n..#\n###" }, { "input": "3 4", "output": "####\n...#\n####" }, { "input": "5 3", "output": "###\n..#\n###\n#..\n###" }, { "input": "9 9", "output": "#########\n........#\n#########\n#........\n#########\n........#\n#########\n#........\n#########" }, { "input": "3 5", "output": "#####\n....#\n#####" }, { "input": "3 6", "output": "######\n.....#\n######" }, { "input": "7 3", "output": "###\n..#\n###\n#..\n###\n..#\n###" }, { "input": "7 4", "output": "####\n...#\n####\n#...\n####\n...#\n####" }, { "input": "49 50", "output": "##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.............................................." }, { "input": "43 50", "output": "##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.............................................." }, { "input": "43 27", "output": "###########################\n..........................#\n###########################\n#..........................\n###########################\n..........................#\n###########################\n#..........................\n###########################\n..........................#\n###########################\n#..........................\n###########################\n..........................#\n###########################\n#..........................\n###########################\n....................." }, { "input": "11 15", "output": "###############\n..............#\n###############\n#..............\n###############\n..............#\n###############\n#..............\n###############\n..............#\n###############" }, { "input": "11 3", "output": "###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###" }, { "input": "19 3", "output": "###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###" }, { "input": "23 50", "output": "##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.............................................." }, { "input": "49 49", "output": "#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#..." }, { "input": "33 43", "output": "###########################################\n..........................................#\n###########################################\n#..........................................\n###########################################\n..........................................#\n###########################################\n#..........................................\n###########################################\n..........................................#\n###########################################\n#.................." }, { "input": "33 44", "output": "############################################\n...........................................#\n############################################\n#...........................................\n############################################\n...........................................#\n############################################\n#...........................................\n############################################\n...........................................#\n############################################\n#......." }, { "input": "45 45", "output": "#############################################\n............................................#\n#############################################\n#............................................\n#############################################\n............................................#\n#############################################\n#............................................\n#############################################\n............................................#\n#########################################..." }, { "input": "45 49", "output": "#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#..." }, { "input": "45 3", "output": "###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###" }, { "input": "45 4", "output": "####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####" }, { "input": "5 4", "output": "####\n...#\n####\n#...\n####" }, { "input": "5 5", "output": "#####\n....#\n#####\n#....\n#####" }, { "input": "5 6", "output": "######\n.....#\n######\n#.....\n######" }, { "input": "7 5", "output": "#####\n....#\n#####\n#....\n#####\n....#\n#####" }, { "input": "7 6", "output": "######\n.....#\n######\n#.....\n######\n.....#\n######" }, { "input": "7 7", "output": "#######\n......#\n#######\n#......\n#######\n......#\n#######" } ]
1,687,697,047
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
31
0
n,m=map(int,input().split()) for i in range(n): for j in range(m): if i==0 or i==n-1 or (i%2)==0: print("#",end='') else: if (j==n-1 and i%10 in [1,5,9]) or (j==0 and i%10 in[3,7]): print("#",end='') else: print("-",end='') print()
Title: Fox And Snake Time Limit: None seconds Memory Limit: None megabytes Problem Description: Fox Ciel starts to learn programming. The first task is drawing a fox! However, that turns out to be too hard for a beginner, so she decides to draw a snake instead. A snake is a pattern on a *n* by *m* table. Denote *c*-th cell of *r*-th row as (*r*,<=*c*). The tail of the snake is located at (1,<=1), then it's body extends to (1,<=*m*), then goes down 2 rows to (3,<=*m*), then goes left to (3,<=1) and so on. Your task is to draw this snake for Fox Ciel: the empty cells should be represented as dot characters ('.') and the snake cells should be filled with number signs ('#'). Consider sample tests in order to understand the snake pattern. Input Specification: The only line contains two integers: *n* and *m* (3<=≤<=*n*,<=*m*<=≤<=50). *n* is an odd number. Output Specification: Output *n* lines. Each line should contain a string consisting of *m* characters. Do not output spaces. Demo Input: ['3 3\n', '3 4\n', '5 3\n', '9 9\n'] Demo Output: ['###\n..#\n###\n', '####\n...#\n####\n', '###\n..#\n###\n#..\n###\n', '#########\n........#\n#########\n#........\n#########\n........#\n#########\n#........\n#########\n'] Note: none
```python n,m=map(int,input().split()) for i in range(n): for j in range(m): if i==0 or i==n-1 or (i%2)==0: print("#",end='') else: if (j==n-1 and i%10 in [1,5,9]) or (j==0 and i%10 in[3,7]): print("#",end='') else: print("-",end='') print() ```
0
579
A
Raising Bacteria
PROGRAMMING
1,000
[ "bitmasks" ]
null
null
You are a lover of bacteria. You want to raise some bacteria in a box. Initially, the box is empty. Each morning, you can put any number of bacteria into the box. And each night, every bacterium in the box will split into two bacteria. You hope to see exactly *x* bacteria in the box at some moment. What is the minimum number of bacteria you need to put into the box across those days?
The only line containing one integer *x* (1<=≤<=*x*<=≤<=109).
The only line containing one integer: the answer.
[ "5\n", "8\n" ]
[ "2\n", "1\n" ]
For the first sample, we can add one bacterium in the box in the first day morning and at the third morning there will be 4 bacteria in the box. Now we put one more resulting 5 in the box. We added 2 bacteria in the process so the answer is 2. For the second sample, we can put one in the first morning and in the 4-th morning there will be 8 in the box. So the answer is 1.
250
[ { "input": "5", "output": "2" }, { "input": "8", "output": "1" }, { "input": "536870911", "output": "29" }, { "input": "1", "output": "1" }, { "input": "343000816", "output": "14" }, { "input": "559980448", "output": "12" }, { "input": "697681824", "output": "14" }, { "input": "41313494", "output": "14" }, { "input": "673935585", "output": "13" }, { "input": "117422204", "output": "19" }, { "input": "954746654", "output": "15" }, { "input": "536838144", "output": "14" }, { "input": "1000000000", "output": "13" }, { "input": "2", "output": "1" }, { "input": "3", "output": "2" }, { "input": "4", "output": "1" }, { "input": "6", "output": "2" }, { "input": "7", "output": "3" }, { "input": "9", "output": "2" }, { "input": "10", "output": "2" }, { "input": "999999999", "output": "21" }, { "input": "999999998", "output": "20" }, { "input": "999999997", "output": "20" }, { "input": "999999996", "output": "19" }, { "input": "999999995", "output": "20" }, { "input": "999999994", "output": "19" }, { "input": "999999993", "output": "19" }, { "input": "999999992", "output": "18" }, { "input": "999999991", "output": "20" }, { "input": "999999990", "output": "19" }, { "input": "536870910", "output": "28" }, { "input": "536870912", "output": "1" }, { "input": "536870913", "output": "2" }, { "input": "536870914", "output": "2" }, { "input": "22", "output": "3" }, { "input": "14", "output": "3" } ]
1,685,214,639
2,147,483,647
Python 3
OK
TESTS
36
46
0
x = int(input()) a = 1 while 1 < x: if x % 2 > 0: a = a + 1 x = x // 2 print(a)
Title: Raising Bacteria Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are a lover of bacteria. You want to raise some bacteria in a box. Initially, the box is empty. Each morning, you can put any number of bacteria into the box. And each night, every bacterium in the box will split into two bacteria. You hope to see exactly *x* bacteria in the box at some moment. What is the minimum number of bacteria you need to put into the box across those days? Input Specification: The only line containing one integer *x* (1<=≤<=*x*<=≤<=109). Output Specification: The only line containing one integer: the answer. Demo Input: ['5\n', '8\n'] Demo Output: ['2\n', '1\n'] Note: For the first sample, we can add one bacterium in the box in the first day morning and at the third morning there will be 4 bacteria in the box. Now we put one more resulting 5 in the box. We added 2 bacteria in the process so the answer is 2. For the second sample, we can put one in the first morning and in the 4-th morning there will be 8 in the box. So the answer is 1.
```python x = int(input()) a = 1 while 1 < x: if x % 2 > 0: a = a + 1 x = x // 2 print(a) ```
3
579
A
Raising Bacteria
PROGRAMMING
1,000
[ "bitmasks" ]
null
null
You are a lover of bacteria. You want to raise some bacteria in a box. Initially, the box is empty. Each morning, you can put any number of bacteria into the box. And each night, every bacterium in the box will split into two bacteria. You hope to see exactly *x* bacteria in the box at some moment. What is the minimum number of bacteria you need to put into the box across those days?
The only line containing one integer *x* (1<=≤<=*x*<=≤<=109).
The only line containing one integer: the answer.
[ "5\n", "8\n" ]
[ "2\n", "1\n" ]
For the first sample, we can add one bacterium in the box in the first day morning and at the third morning there will be 4 bacteria in the box. Now we put one more resulting 5 in the box. We added 2 bacteria in the process so the answer is 2. For the second sample, we can put one in the first morning and in the 4-th morning there will be 8 in the box. So the answer is 1.
250
[ { "input": "5", "output": "2" }, { "input": "8", "output": "1" }, { "input": "536870911", "output": "29" }, { "input": "1", "output": "1" }, { "input": "343000816", "output": "14" }, { "input": "559980448", "output": "12" }, { "input": "697681824", "output": "14" }, { "input": "41313494", "output": "14" }, { "input": "673935585", "output": "13" }, { "input": "117422204", "output": "19" }, { "input": "954746654", "output": "15" }, { "input": "536838144", "output": "14" }, { "input": "1000000000", "output": "13" }, { "input": "2", "output": "1" }, { "input": "3", "output": "2" }, { "input": "4", "output": "1" }, { "input": "6", "output": "2" }, { "input": "7", "output": "3" }, { "input": "9", "output": "2" }, { "input": "10", "output": "2" }, { "input": "999999999", "output": "21" }, { "input": "999999998", "output": "20" }, { "input": "999999997", "output": "20" }, { "input": "999999996", "output": "19" }, { "input": "999999995", "output": "20" }, { "input": "999999994", "output": "19" }, { "input": "999999993", "output": "19" }, { "input": "999999992", "output": "18" }, { "input": "999999991", "output": "20" }, { "input": "999999990", "output": "19" }, { "input": "536870910", "output": "28" }, { "input": "536870912", "output": "1" }, { "input": "536870913", "output": "2" }, { "input": "536870914", "output": "2" }, { "input": "22", "output": "3" }, { "input": "14", "output": "3" } ]
1,684,760,744
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
0
1,000
0
x=int(input()) s=0 while x>0: if x%2==1: s+=1 x//2 print(s)
Title: Raising Bacteria Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are a lover of bacteria. You want to raise some bacteria in a box. Initially, the box is empty. Each morning, you can put any number of bacteria into the box. And each night, every bacterium in the box will split into two bacteria. You hope to see exactly *x* bacteria in the box at some moment. What is the minimum number of bacteria you need to put into the box across those days? Input Specification: The only line containing one integer *x* (1<=≤<=*x*<=≤<=109). Output Specification: The only line containing one integer: the answer. Demo Input: ['5\n', '8\n'] Demo Output: ['2\n', '1\n'] Note: For the first sample, we can add one bacterium in the box in the first day morning and at the third morning there will be 4 bacteria in the box. Now we put one more resulting 5 in the box. We added 2 bacteria in the process so the answer is 2. For the second sample, we can put one in the first morning and in the 4-th morning there will be 8 in the box. So the answer is 1.
```python x=int(input()) s=0 while x>0: if x%2==1: s+=1 x//2 print(s) ```
0
839
A
Arya and Bran
PROGRAMMING
900
[ "implementation" ]
null
null
Bran and his older sister Arya are from the same house. Bran like candies so much, so Arya is going to give him some Candies. At first, Arya and Bran have 0 Candies. There are *n* days, at the *i*-th day, Arya finds *a**i* candies in a box, that is given by the Many-Faced God. Every day she can give Bran at most 8 of her candies. If she don't give him the candies at the same day, they are saved for her and she can give them to him later. Your task is to find the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day. Formally, you need to output the minimum day index to the end of which *k* candies will be given out (the days are indexed from 1 to *n*). Print -1 if she can't give him *k* candies during *n* given days.
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=10000). The second line contains *n* integers *a*1,<=*a*2,<=*a*3,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100).
If it is impossible for Arya to give Bran *k* candies within *n* days, print -1. Otherwise print a single integer — the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day.
[ "2 3\n1 2\n", "3 17\n10 10 10\n", "1 9\n10\n" ]
[ "2", "3", "-1" ]
In the first sample, Arya can give Bran 3 candies in 2 days. In the second sample, Arya can give Bran 17 candies in 3 days, because she can give him at most 8 candies per day. In the third sample, Arya can't give Bran 9 candies, because she can give him at most 8 candies per day and she must give him the candies within 1 day.
500
[ { "input": "2 3\n1 2", "output": "2" }, { "input": "3 17\n10 10 10", "output": "3" }, { "input": "1 9\n10", "output": "-1" }, { "input": "10 70\n6 5 2 3 3 2 1 4 3 2", "output": "-1" }, { "input": "20 140\n40 4 81 40 10 54 34 50 84 60 16 1 90 78 38 93 99 60 81 99", "output": "18" }, { "input": "30 133\n3 2 3 4 3 7 4 5 5 6 7 2 1 3 4 6 7 4 6 4 7 5 7 1 3 4 1 6 8 5", "output": "30" }, { "input": "40 320\n70 79 21 64 95 36 63 29 66 89 30 34 100 76 42 12 4 56 80 78 83 1 39 9 34 45 6 71 27 31 55 52 72 71 38 21 43 83 48 47", "output": "40" }, { "input": "50 300\n5 3 11 8 7 4 9 5 5 1 6 3 5 7 4 2 2 10 8 1 7 10 4 4 11 5 2 4 9 1 5 4 11 9 11 2 7 4 4 8 10 9 1 11 10 2 4 11 6 9", "output": "-1" }, { "input": "37 30\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "30" }, { "input": "100 456\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "57" }, { "input": "90 298\n94 90 98 94 93 90 99 98 90 96 93 96 92 92 97 98 94 94 96 100 93 96 95 98 94 91 95 95 94 90 93 96 93 100 99 98 94 95 98 91 91 98 97 100 98 93 92 93 91 100 92 97 95 95 97 94 98 97 99 100 90 96 93 100 95 99 92 100 99 91 97 99 98 93 90 93 97 95 94 96 90 100 94 93 91 92 97 97 97 100", "output": "38" }, { "input": "7 43\n4 3 7 9 3 8 10", "output": "-1" }, { "input": "99 585\n8 2 3 3 10 7 9 4 7 4 6 8 7 11 5 8 7 4 7 7 6 7 11 8 1 7 3 2 10 1 6 10 10 5 10 2 5 5 11 6 4 1 5 10 5 8 1 3 7 10 6 1 1 3 8 11 5 8 2 2 5 4 7 6 7 5 8 7 10 9 6 11 4 8 2 7 1 7 1 4 11 1 9 6 1 10 6 10 1 5 6 5 2 5 11 5 1 10 8", "output": "-1" }, { "input": "30 177\n8 7 5 8 3 7 2 4 3 8 11 3 9 11 2 4 1 4 5 6 11 5 8 3 6 3 11 2 11 8", "output": "-1" }, { "input": "19 129\n3 3 10 11 4 7 3 8 10 2 11 6 11 9 4 2 11 10 5", "output": "-1" }, { "input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "100" }, { "input": "13 104\n94 55 20 96 86 76 13 71 13 1 32 76 69", "output": "13" }, { "input": "85 680\n61 44 55 6 30 74 27 26 17 45 73 1 67 71 39 32 13 25 79 66 4 59 49 28 29 22 10 17 98 80 36 99 52 24 59 44 27 79 29 46 29 12 47 72 82 25 6 30 81 72 95 65 30 71 72 45 39 16 16 89 48 42 59 71 50 58 31 65 91 70 48 56 28 34 53 89 94 98 49 55 94 65 91 11 53", "output": "85" }, { "input": "100 458\n3 6 4 1 8 4 1 5 4 4 5 8 4 4 6 6 5 1 2 2 2 1 7 1 1 2 6 5 7 8 3 3 8 3 7 5 7 6 6 2 4 2 2 1 1 8 6 1 5 3 3 4 1 4 6 8 5 4 8 5 4 5 5 1 3 1 6 7 6 2 7 3 4 8 1 8 6 7 1 2 4 6 7 4 8 8 8 4 8 7 5 2 8 4 2 5 6 8 8 5", "output": "100" }, { "input": "98 430\n4 7 6 3 4 1 7 1 1 6 6 1 5 4 6 1 5 4 6 6 1 5 1 1 8 1 6 6 2 6 8 4 4 6 6 8 8 7 4 1 2 4 1 5 4 3 7 3 2 5 7 7 7 2 2 2 7 2 8 7 3 4 5 7 8 3 7 6 7 3 2 4 7 1 4 4 7 1 1 8 4 5 8 3 1 5 3 5 2 1 3 3 8 1 3 5 8 6", "output": "98" }, { "input": "90 80\n6 1 7 1 1 8 6 6 6 1 5 4 2 2 8 4 8 7 7 2 5 7 7 8 5 5 6 3 3 8 3 5 6 3 4 2 6 5 5 3 3 3 8 6 6 1 8 3 6 5 4 8 5 4 3 7 1 3 2 3 3 7 7 7 3 5 2 6 2 3 6 4 6 5 5 3 2 1 1 7 3 3 4 3 4 2 1 2 3 1", "output": "18" }, { "input": "89 99\n7 7 3 5 2 7 8 8 1 1 5 7 7 4 1 5 3 4 4 8 8 3 3 2 6 3 8 2 7 5 8 1 3 5 3 6 4 3 6 2 3 3 4 5 1 6 1 7 7 7 6 7 7 7 8 8 8 2 1 7 5 8 6 7 7 4 7 5 7 8 1 3 5 8 7 1 4 2 5 8 3 4 4 5 5 6 2 4 2", "output": "21" }, { "input": "50 700\n4 3 2 8 8 5 5 3 3 4 7 2 6 6 3 3 8 4 2 4 8 6 5 4 5 4 5 8 6 5 4 7 2 4 1 6 2 6 8 6 2 5 8 1 3 8 3 8 4 1", "output": "-1" }, { "input": "82 359\n95 98 95 90 90 96 91 94 93 99 100 100 92 99 96 94 99 90 94 96 91 91 90 93 97 96 90 94 97 99 93 90 99 98 96 100 93 97 100 91 100 92 93 100 92 90 90 94 99 95 100 98 99 96 94 96 96 99 99 91 97 100 95 100 99 91 94 91 98 98 100 97 93 93 96 97 94 94 92 100 91 91", "output": "45" }, { "input": "60 500\n93 93 100 99 91 92 95 93 95 99 93 91 97 98 90 91 98 100 95 100 94 93 92 91 91 98 98 90 93 91 90 96 92 93 92 94 94 91 96 94 98 100 97 96 96 97 91 99 97 95 96 94 91 92 99 95 97 92 98 90", "output": "-1" }, { "input": "98 776\n48 63 26 3 88 81 27 33 37 10 2 89 41 84 98 93 25 44 42 90 41 65 97 1 28 69 42 14 86 18 96 28 28 94 78 8 44 31 96 45 26 52 93 25 48 39 3 75 94 93 63 59 67 86 18 74 27 38 68 7 31 60 69 67 20 11 19 34 47 43 86 96 3 49 56 60 35 49 89 28 92 69 48 15 17 73 99 69 2 73 27 35 28 53 11 1 96 50", "output": "97" }, { "input": "100 189\n15 14 32 65 28 96 33 93 48 28 57 20 32 20 90 42 57 53 18 58 94 21 27 29 37 22 94 45 67 60 83 23 20 23 35 93 3 42 6 46 68 46 34 25 17 16 50 5 49 91 23 76 69 100 58 68 81 32 88 41 64 29 37 13 95 25 6 59 74 58 31 35 16 80 13 80 10 59 85 18 16 70 51 40 44 28 8 76 8 87 53 86 28 100 2 73 14 100 52 9", "output": "24" }, { "input": "99 167\n72 4 79 73 49 58 15 13 92 92 42 36 35 21 13 10 51 94 64 35 86 50 6 80 93 77 59 71 2 88 22 10 27 30 87 12 77 6 34 56 31 67 78 84 36 27 15 15 12 56 80 7 56 14 10 9 14 59 15 20 34 81 8 49 51 72 4 58 38 77 31 86 18 61 27 86 95 36 46 36 39 18 78 39 48 37 71 12 51 92 65 48 39 22 16 87 4 5 42", "output": "21" }, { "input": "90 4\n48 4 4 78 39 3 85 29 69 52 70 39 11 98 42 56 65 98 77 24 61 31 6 59 60 62 84 46 67 59 15 44 99 23 12 74 2 48 84 60 51 28 17 90 10 82 3 43 50 100 45 57 57 95 53 71 20 74 52 46 64 59 72 33 74 16 44 44 80 71 83 1 70 59 61 6 82 69 81 45 88 28 17 24 22 25 53 97 1 100", "output": "1" }, { "input": "30 102\n55 94 3 96 3 47 92 85 25 78 27 70 97 83 40 2 55 12 74 84 91 37 31 85 7 40 33 54 72 5", "output": "13" }, { "input": "81 108\n61 59 40 100 8 75 5 74 87 12 6 23 98 26 59 68 27 4 98 79 14 44 4 11 89 77 29 90 33 3 43 1 87 91 28 24 4 84 75 7 37 46 15 46 8 87 68 66 5 21 36 62 77 74 91 95 88 28 12 48 18 93 14 51 33 5 99 62 99 38 49 15 56 87 52 64 69 46 41 12 92", "output": "14" }, { "input": "2 16\n10 6", "output": "2" }, { "input": "2 8\n7 8", "output": "2" }, { "input": "2 9\n4 8", "output": "2" }, { "input": "3 19\n9 9 1", "output": "3" }, { "input": "4 32\n9 9 9 5", "output": "4" }, { "input": "2 15\n14 1", "output": "2" }, { "input": "2 3\n3 3", "output": "1" }, { "input": "3 10\n10 1 1", "output": "2" }, { "input": "12 20\n3 16 19 10 1 6 17 8 6 20 1 4", "output": "4" }, { "input": "4 15\n14 3 3 3", "output": "2" }, { "input": "5 40\n10 10 10 10 1", "output": "5" }, { "input": "4 31\n9 9 8 5", "output": "4" }, { "input": "4 31\n20 7 1 1", "output": "-1" }, { "input": "2 10\n9 1", "output": "2" }, { "input": "10 50\n100 10 1 1 1 1 1 1 1 1", "output": "7" }, { "input": "2 11\n10 2", "output": "2" }, { "input": "3 21\n10 10 1", "output": "3" }, { "input": "2 2\n1 2", "output": "2" }, { "input": "3 2\n1 8 8", "output": "2" }, { "input": "2 11\n10 1", "output": "2" }, { "input": "2 16\n12 4", "output": "2" }, { "input": "3 11\n9 2 2", "output": "2" }, { "input": "3 11\n4 3 4", "output": "3" }, { "input": "2 13\n7 6", "output": "2" }, { "input": "3 24\n14 3 4", "output": "-1" }, { "input": "2 13\n10 3", "output": "2" }, { "input": "3 11\n9 2 1", "output": "2" }, { "input": "2 15\n12 3", "output": "2" }, { "input": "2 14\n11 4", "output": "2" } ]
1,597,972,714
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
93
0
n, k = map(int, input().split()) ni = map(int, input().split()) # for i in range(n+1): # candies = 0 if k/n < 8: print(n) else: print(-1)
Title: Arya and Bran Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bran and his older sister Arya are from the same house. Bran like candies so much, so Arya is going to give him some Candies. At first, Arya and Bran have 0 Candies. There are *n* days, at the *i*-th day, Arya finds *a**i* candies in a box, that is given by the Many-Faced God. Every day she can give Bran at most 8 of her candies. If she don't give him the candies at the same day, they are saved for her and she can give them to him later. Your task is to find the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day. Formally, you need to output the minimum day index to the end of which *k* candies will be given out (the days are indexed from 1 to *n*). Print -1 if she can't give him *k* candies during *n* given days. Input Specification: The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=10000). The second line contains *n* integers *a*1,<=*a*2,<=*a*3,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100). Output Specification: If it is impossible for Arya to give Bran *k* candies within *n* days, print -1. Otherwise print a single integer — the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day. Demo Input: ['2 3\n1 2\n', '3 17\n10 10 10\n', '1 9\n10\n'] Demo Output: ['2', '3', '-1'] Note: In the first sample, Arya can give Bran 3 candies in 2 days. In the second sample, Arya can give Bran 17 candies in 3 days, because she can give him at most 8 candies per day. In the third sample, Arya can't give Bran 9 candies, because she can give him at most 8 candies per day and she must give him the candies within 1 day.
```python n, k = map(int, input().split()) ni = map(int, input().split()) # for i in range(n+1): # candies = 0 if k/n < 8: print(n) else: print(-1) ```
0
638
B
Making Genome in Berland
PROGRAMMING
1,500
[ "*special", "dfs and similar", "strings" ]
null
null
Berland scientists face a very important task - given the parts of short DNA fragments, restore the dinosaur DNA! The genome of a berland dinosaur has noting in common with the genome that we've used to: it can have 26 distinct nucleotide types, a nucleotide of each type can occur at most once. If we assign distinct English letters to all nucleotides, then the genome of a Berland dinosaur will represent a non-empty string consisting of small English letters, such that each letter occurs in it at most once. Scientists have *n* genome fragments that are represented as substrings (non-empty sequences of consecutive nucleotides) of the sought genome. You face the following problem: help scientists restore the dinosaur genome. It is guaranteed that the input is not contradictory and at least one suitable line always exists. When the scientists found out that you are a strong programmer, they asked you in addition to choose the one with the minimum length. If there are multiple such strings, choose any string.
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of genome fragments. Each of the next lines contains one descriptions of a fragment. Each fragment is a non-empty string consisting of distinct small letters of the English alphabet. It is not guaranteed that the given fragments are distinct. Fragments could arbitrarily overlap and one fragment could be a substring of another one. It is guaranteed that there is such string of distinct letters that contains all the given fragments as substrings.
In the single line of the output print the genome of the minimum length that contains all the given parts. All the nucleotides in the genome must be distinct. If there are multiple suitable strings, print the string of the minimum length. If there also are multiple suitable strings, you can print any of them.
[ "3\nbcd\nab\ncdef\n", "4\nx\ny\nz\nw\n" ]
[ "abcdef\n", "xyzw\n" ]
none
1,000
[ { "input": "3\nbcd\nab\ncdef", "output": "abcdef" }, { "input": "4\nx\ny\nz\nw", "output": "xyzw" }, { "input": "25\nef\nfg\ngh\nhi\nij\njk\nkl\nlm\nmn\nno\nab\nbc\ncd\nde\nop\npq\nqr\nrs\nst\ntu\nuv\nvw\nwx\nxy\nyz", "output": "abcdefghijklmnopqrstuvwxyz" }, { "input": "1\nf", "output": "f" }, { "input": "1\nqwertyuiopzxcvbnmasdfghjkl", "output": "qwertyuiopzxcvbnmasdfghjkl" }, { "input": "3\ndfghj\nghjkl\nasdfg", "output": "asdfghjkl" }, { "input": "4\nab\nab\nab\nabc", "output": "abc" }, { "input": "3\nf\nn\nux", "output": "uxfn" }, { "input": "2\nfgs\nfgs", "output": "fgs" }, { "input": "96\nc\ndhf\no\nq\nry\nh\nr\nf\nji\nek\ndhf\np\nk\no\nf\nw\nc\nc\nfgw\nbps\nhfg\np\ni\nji\nto\nc\nou\ny\nfg\na\ne\nu\nc\ny\nhf\nqn\nu\nj\np\ns\no\nmr\na\nqn\nb\nlb\nn\nji\nji\na\no\nat\ns\nf\nb\ndh\nk\nl\nl\nvq\nt\nb\nc\nv\nc\nh\nh\ny\nh\nq\ne\nx\nd\no\nq\nm\num\nmr\nfg\ni\nl\na\nh\nt\num\nr\no\nn\nk\ne\nji\na\nc\nh\ne\nm", "output": "atoumrydhfgwekjilbpsvqncx" }, { "input": "3\npbi\nopbi\ngh", "output": "ghopbi" }, { "input": "4\ng\np\no\nop", "output": "opg" }, { "input": "5\np\nf\nu\nf\np", "output": "pfu" }, { "input": "4\nr\nko\nuz\nko", "output": "kouzr" }, { "input": "5\nzt\nted\nlzt\nted\ndyv", "output": "lztedyv" }, { "input": "6\ngul\ng\njrb\nul\nd\njr", "output": "guljrbd" }, { "input": "5\nlkyh\naim\nkyh\nm\nkyhai", "output": "lkyhaim" }, { "input": "4\nzrncsywd\nsywdx\ngqzrn\nqzrncsy", "output": "gqzrncsywdx" }, { "input": "5\ntbxzc\njrdtb\njrdtb\nflnj\nrdtbx", "output": "flnjrdtbxzc" }, { "input": "10\ng\nkagijn\nzxt\nhmkag\nhm\njnc\nxtqupw\npwhmk\ng\nagi", "output": "zxtqupwhmkagijnc" }, { "input": "20\nf\nf\nv\nbn\ne\nmr\ne\ne\nn\nj\nqfv\ne\ndpb\nj\nlc\nr\ndp\nf\na\nrt", "output": "dpbnlcmrtqfveja" }, { "input": "30\nxlo\nwx\ne\nf\nyt\nw\ne\nl\nxl\nojg\njg\niy\ngkz\ne\nw\nloj\ng\nfw\nl\nlo\nbe\ne\ngk\niyt\no\nb\nqv\nz\nb\nzq", "output": "befwxlojgkzqviyt" }, { "input": "50\nmd\nei\nhy\naz\nzr\nmd\nv\nz\nke\ny\nuk\nf\nhy\njm\nke\njm\ncn\nwf\nzr\nqj\ng\nzr\ndv\ni\ndv\nuk\nj\nwf\njm\nn\na\nqj\nei\nf\nzr\naz\naz\nke\na\nr\ndv\nei\nzr\ndv\nq\ncn\nyg\nqj\nnh\nhy", "output": "azrcnhygqjmdvukeiwf" }, { "input": "80\ni\nioh\nquc\nexioh\niohb\nex\nrwky\nz\nquc\nrw\nplnt\nq\nhbrwk\nexioh\ntv\nxioh\nlnt\nxi\nn\npln\niohbr\nwky\nhbr\nw\nyq\nrwky\nbrw\nplnt\nv\nkyq\nrwkyq\nt\nhb\ngplnt\np\nkyqu\nhbr\nrwkyq\nhbr\nve\nhbrwk\nkyq\nkyquc\ngpln\ni\nbr\ntvex\nwkyqu\nz\nlnt\ngp\nky\ngplnt\ne\nhbrwk\nbrw\nve\no\nplnt\nn\nntve\ny\nln\npln\ntvexi\nr\nzgp\nxiohb\nl\nn\nt\nplnt\nlntv\nexi\nexi\ngpl\nioh\nk\nwk\ni", "output": "zgplntvexiohbrwkyquc" }, { "input": "70\njp\nz\nz\nd\ndy\nk\nsn\nrg\nz\nsn\nh\nj\ns\nkx\npu\nkx\nm\njp\nbo\nm\ntk\ndy\no\nm\nsn\nv\nrg\nv\nn\no\ngh\np\no\nx\nq\nzv\nr\nbo\ng\noz\nu\nub\nnd\nh\ny\njp\no\nq\nbo\nhq\nhq\nkx\nx\ndy\nn\nb\nub\nsn\np\nub\ntk\nu\nnd\nvw\nt\nub\nbo\nyr\nyr\nub", "output": "jpubozvwsndyrghqtkxm" }, { "input": "100\nm\nj\nj\nf\nk\nq\ni\nu\ni\nl\nt\nt\no\nv\nk\nw\nr\nj\nh\nx\nc\nv\nu\nf\nh\nj\nb\ne\ni\nr\ng\nb\nl\nb\ng\nb\nf\nq\nv\na\nu\nn\ni\nl\nk\nc\nx\nu\nr\ne\ni\na\nc\no\nc\na\nx\nd\nf\nx\no\nx\nm\nl\nr\nc\nr\nc\nv\nj\ng\nu\nn\nn\nd\nl\nl\nc\ng\nu\nr\nu\nh\nl\na\nl\nr\nt\nm\nf\nm\nc\nh\nl\nd\na\nr\nh\nn\nc", "output": "mjfkqiultovwrhxcbegand" }, { "input": "99\nia\nz\nsb\ne\nnm\nd\nknm\nt\nm\np\nqvu\ne\nq\nq\ns\nmd\nz\nfh\ne\nwi\nn\nsb\nq\nw\ni\ng\nr\ndf\nwi\nl\np\nm\nb\ni\natj\nb\nwia\nx\nnm\nlk\nx\nfh\nh\np\nf\nzr\nz\nr\nsbz\nlkn\nsbz\nz\na\nwia\ntjx\nk\nj\nx\nl\nqvu\nzr\nfh\nbzrg\nz\nplk\nfhe\nn\njxqv\nrgp\ne\ndf\nz\ns\natj\ndf\nat\ngp\nw\new\nt\np\np\nfhe\nq\nxq\nt\nzr\nat\ndfh\nj\ns\nu\npl\np\nrg\nlk\nq\nwia\ng", "output": "sbzrgplknmdfhewiatjxqvu" }, { "input": "95\np\nk\nd\nr\nn\nz\nn\nb\np\nw\ni\nn\ny\ni\nn\nn\ne\nr\nu\nr\nb\ni\ne\np\nk\nc\nc\nh\np\nk\nh\ns\ne\ny\nq\nq\nx\nw\nh\ng\nt\nt\na\nt\nh\ni\nb\ne\np\nr\nu\nn\nn\nr\nq\nn\nu\ng\nw\nt\np\nt\nk\nd\nz\nh\nf\nd\ni\na\na\nf\ne\na\np\ns\nk\nt\ng\nf\ni\ng\ng\nt\nn\nn\nt\nt\nr\nx\na\nz\nc\nn\nk", "output": "pkdrnzbwiyeuchsqxgtaf" }, { "input": "3\nh\nx\np", "output": "hxp" }, { "input": "4\nrz\nvu\nxy\npg", "output": "pgrzvuxy" }, { "input": "5\ndrw\nu\nzq\npd\naip", "output": "aipdrwzqu" }, { "input": "70\ne\no\ng\ns\nsz\nyl\ns\nn\no\nq\np\nl\noa\ndq\ny\np\nn\nio\ng\nb\nk\nv\ny\nje\nc\ncb\nfx\ncbv\nfxp\nkt\nhm\nz\nrcb\np\nt\nu\nzh\ne\nb\na\nyl\nd\nv\nl\nrc\nq\nt\nt\nj\nl\nr\ny\nlg\np\nt\nd\nq\nje\nqwu\ng\nz\ngi\ndqw\nz\nvyl\nk\nt\nc\nb\nrc", "output": "dqwufxpjektrcbvylgioaszhmn" }, { "input": "3\ne\nw\nox", "output": "oxew" }, { "input": "100\npr\nfz\nru\ntk\nld\nvq\nef\ngj\ncp\nbm\nsn\nld\nua\nzl\ndw\nef\nua\nbm\nxb\nvq\nav\ncp\nko\nwc\nru\ni\ne\nav\nbm\nav\nxb\nog\ng\nme\ntk\nog\nxb\nef\ntk\nhx\nqt\nvq\ndw\nv\nxb\ndw\nko\nd\nbm\nua\nvq\nis\nwc\ntk\ntk\ngj\ng\ngj\nef\nqt\nvq\nbm\nog\nvq\ngj\nvq\nzl\ngj\nji\nvq\nhx\ng\nbm\nji\nqt\nef\nav\ntk\nxb\nru\nko\nny\nis\ncp\nxb\nog\nru\nhx\nwc\nko\nu\nfz\ndw\nji\nzl\nvq\nqt\nko\ngj\nis", "output": "hxbmefzldwcpruavqtkogjisny" }, { "input": "23\nw\nz\nk\nc\ne\np\nt\na\nx\nc\nq\nx\na\nf\np\nw\nh\nx\nf\nw\np\nw\nq", "output": "wzkceptaxqfh" }, { "input": "12\nu\na\nhw\na\ngh\nog\nr\nd\nw\nk\nl\ny", "output": "oghwuardkly" }, { "input": "2\ny\nd", "output": "yd" }, { "input": "1\nd", "output": "d" }, { "input": "100\nwm\nq\nhf\nwm\niz\ndl\nmiz\np\nzoa\nbk\nw\nxv\nfj\nd\nxvsg\nr\nx\nt\nyd\nbke\ny\neq\nx\nn\nry\nt\nc\nuh\nn\npw\nuhf\neq\nr\nw\nk\nt\nsg\njb\nd\nke\ne\nx\nh\ntuh\nan\nn\noa\nw\nq\nz\nk\noan\nbk\nj\nzoan\nyd\npwmi\nyd\nc\nry\nfj\nlx\nqr\nke\nizo\nm\nz\noan\nwmi\nl\nyd\nz\ns\nke\nw\nfjbk\nqry\nlxv\nhf\ns\nnc\nq\nlxv\nzoa\nn\nfj\np\nhf\nmiz\npwm\ntu\noan\ng\nd\nqr\na\nan\nxvs\ny\ntuhf", "output": "pwmizoanctuhfjbkeqrydlxvsg" }, { "input": "94\ncw\nm\nuhbk\ntfy\nsd\nu\ntf\ntfym\nfy\nbk\nx\nx\nxl\npu\noq\nkt\ny\nb\nj\nqxl\no\noqx\nr\nr\njr\nk\ne\nw\nsd\na\nljre\nhbk\nym\nxl\np\nreg\nktf\nre\nw\nhbk\nxlj\nzn\ne\nm\nms\nsdv\nr\nr\no\naoq\nzna\nymsd\nqx\nr\no\nlj\nm\nk\nu\nkt\nms\ne\nx\nh\ni\nz\nm\nc\nb\no\nm\nvcw\ndvc\nq\na\nb\nfyms\nv\nxl\nxl\ntfym\nx\nfy\np\nyms\nms\nb\nt\nu\nn\nq\nnaoqx\no\ne", "output": "puhbktfymsdvcwznaoqxljregi" }, { "input": "13\ngku\nzw\nstvqc\najy\njystvq\nfilden\nstvq\nfild\nqcporh\najys\nqcpor\nqcpor\ncporhm", "output": "ajystvqcporhmfildengkuzw" }, { "input": "2\not\nqu", "output": "otqu" }, { "input": "100\nv\nh\nj\nf\nr\ni\ns\nw\nv\nd\nv\np\nd\nu\ny\nd\nu\nx\nr\nu\ng\nm\ns\nf\nv\nx\na\ng\ng\ni\ny\ny\nv\nd\ni\nq\nq\nu\nx\nj\nv\nj\ne\no\nr\nh\nu\ne\nd\nv\nb\nv\nq\nk\ni\nr\ne\nm\na\nj\na\nu\nq\nx\nq\ny\ns\nw\nk\ni\ns\nr\np\ni\np\ns\nd\nj\nw\no\nm\ns\nr\nd\nf\ns\nw\nv\ne\ny\no\nx\na\np\nk\nr\ng\ng\nb\nq", "output": "vhjfriswdpuyxgmaqeobk" }, { "input": "99\ntnq\nep\nuk\nk\nx\nvhy\nepj\nx\nj\nhy\nukg\nsep\nquk\nr\nw\no\nxrwm\ndl\nh\no\nad\ng\ng\nhy\nxr\nad\nhyx\nkg\nvh\nb\nlovh\nuk\nl\ntn\nkg\ny\nu\nxr\nse\nyx\nmt\nlo\nm\nu\nukg\ngse\na\nuk\nn\nr\nlov\nep\nh\nadl\nyx\nt\nukg\nz\nepj\nz\nm\nx\nov\nyx\nxr\nep\nw\ny\nmtn\nsep\nep\nmt\nrwmt\nuk\nlo\nz\nnq\nj\ntn\nj\nkgs\ny\nb\nmtn\nsep\nr\ns\no\nr\nepjb\nadl\nrwmt\nyxrw\npj\nvhy\nk\ns\nx\nt", "output": "adlovhyxrwmtnqukgsepjbz" }, { "input": "95\nx\np\nk\nu\ny\nz\nt\na\ni\nj\nc\nh\nk\nn\nk\ns\nr\ny\nn\nv\nf\nb\nr\no\no\nu\nb\nj\no\nd\np\ns\nb\nt\nd\nq\nq\na\nm\ny\nq\nj\nz\nk\ne\nt\nv\nj\np\np\ns\nz\no\nk\nt\na\na\nc\np\nb\np\nx\nc\ny\nv\nj\na\np\nc\nd\nj\nt\nj\nt\nf\no\no\nn\nx\nq\nc\nk\np\nk\nq\na\ns\nl\na\nq\na\nb\ne\nj\nl", "output": "xpkuyztaijchnsrvfbodqmel" }, { "input": "96\not\njo\nvpr\nwi\ngx\nay\nzqf\nzq\npr\nigx\ntsb\nv\nr\ngxc\nigx\ngx\nvpr\nxc\nylk\nigx\nlkh\nvp\nuvp\nz\nbuv\njo\nvpr\npr\nprn\nwi\nqfw\nbuv\nd\npr\ndmj\nvpr\ng\nylk\nsbu\nhz\nk\nzqf\nylk\nxc\nwi\nvpr\nbuv\nzq\nmjo\nkh\nuv\nuvp\nts\nt\nylk\nnay\nbuv\nhzq\nts\njo\nsbu\nqfw\ngxc\ntsb\np\nhzq\nbuv\nsbu\nfwi\nkh\nmjo\nwig\nhzq\ndmj\ntsb\ntsb\nts\nylk\nyl\ngxc\not\nots\nuvp\nay\nay\nuvp\not\ny\np\nm\ngx\nkhz\ngxc\nkhz\ntsb\nrn", "output": "dmjotsbuvprnaylkhzqfwigxc" }, { "input": "3\nm\nu\nm", "output": "mu" }, { "input": "4\np\na\nz\nq", "output": "pazq" }, { "input": "5\ngtb\nnlu\nzjp\nk\nazj", "output": "azjpgtbnluk" }, { "input": "70\nxv\nlu\ntb\njx\nseh\nc\nm\ntbr\ntb\ndl\ne\nd\nt\np\nn\nse\nna\neh\nw\np\nzkj\nr\nk\nrw\nqf\ndl\ndl\ns\nat\nkjx\na\nz\nmig\nu\nse\npse\nd\ng\nc\nxv\nv\ngo\nps\ncd\nyqf\nyqf\nwzk\nxv\nat\nw\no\nl\nxvm\nfpse\nz\nk\nna\nv\nseh\nk\nl\nz\nd\nz\nn\nm\np\ng\nse\nat", "output": "cdlunatbrwzkjxvmigoyqfpseh" }, { "input": "3\nbmg\nwjah\nil", "output": "bmgilwjah" }, { "input": "100\ne\nbr\nls\nfb\nyx\nva\njm\nwn\nak\nhv\noq\nyx\nl\nm\nak\nce\nug\nqz\nug\ndf\nty\nhv\nmo\nxp\nyx\nkt\nak\nmo\niu\nxp\nce\nnd\noq\nbr\nty\nva\nce\nwn\nx\nsj\nel\npi\noq\ndf\niu\nc\nhv\npi\nsj\nhv\nmo\nbr\nxp\nce\nfb\nwn\nnd\nfb\npi\noq\nhv\nty\ngw\noq\nel\nw\nhv\nce\noq\nsj\nsj\nl\nwn\nqz\nty\nbr\nz\nel\nug\nce\nnd\nj\ndf\npi\niu\nnd\nls\niu\nrc\nbr\nug\nrc\nnd\nak\njm\njm\no\nls\nq\nfb", "output": "hvaktyxpiugwndfbrcelsjmoqz" }, { "input": "23\nq\ni\nj\nx\nz\nm\nt\ns\nu\ng\nc\nk\nh\nb\nx\nh\nt\no\ny\nh\nb\nn\na", "output": "qijxzmtsugckhboyna" }, { "input": "12\nkx\ng\nfo\nnt\nmf\nzv\nir\nds\nbz\nf\nlw\nx", "output": "bzvdsirkxlwmfontg" }, { "input": "2\na\nt", "output": "at" }, { "input": "1\ndm", "output": "dm" }, { "input": "100\nj\numj\ninc\nu\nsd\ntin\nw\nlf\nhs\nepk\nyg\nqhs\nh\nti\nf\nsd\ngepk\nu\nfw\nu\nsd\nvumj\num\ndt\nb\ng\nozl\nabvu\noz\nn\nw\nab\nge\nqh\nfwy\nsdti\ng\nyge\nepk\nabvu\nz\nlfw\nbv\nab\nyge\nqhs\nge\nhsdt\num\nl\np\na\nab\nd\nfw\ngep\nfwy\nbvu\nvumj\nzlfw\nk\nepk\ntin\npkab\nzl\nvum\nr\nf\nd\nsdt\nhs\nxoz\nlfwy\nfw\num\nep\nincx\na\nt\num\nh\nsdt\ngep\nlfw\nkab\ng\nmjr\nj\noz\ns\nwy\nnc\nlfw\nyg\nygep\nti\nyg\npk\nkab\nwyg", "output": "qhsdtincxozlfwygepkabvumjr" }, { "input": "94\nkmwbq\nmw\nwbq\ns\nlx\nf\npf\nl\nkmwb\na\nfoynt\nnt\nx\npf\npf\nep\nqs\nwbqse\nrl\nfoynt\nntzjd\nlxc\npfoy\nlx\nr\nagikm\nr\ntzjd\nep\nyntz\nu\nmw\nyntz\nfoynt\ntzjd\njdrlx\nwbqse\nr\nkmw\nwbq\nlx\nfoyn\nkm\nsepfo\nikmw\nf\nrlxch\nzjdrl\nyn\nhv\nynt\nbqs\nvu\nik\nqse\nxchvu\nmwbqs\ny\nlx\nx\nntzjd\nbq\nxchv\nwbqse\nkm\nse\nmwb\nxchvu\nwbq\nc\ngikm\nbq\nwb\nmwbq\nikmw\nag\ny\nchvu\nbqsep\nbqs\nrlx\ntzjd\nmwb\na\ndrlxc\ntzjd\nt\nsepf\nwbqse\nd\nbqs\nyn\nh\nepfo", "output": "agikmwbqsepfoyntzjdrlxchvu" }, { "input": "13\ndaq\nvcnexi\nlkp\nztvcne\naqozt\nztvcne\nprdaqo\ncnex\nnexijm\nztvcne\nfysh\nxijmb\naq", "output": "fyshlkprdaqoztvcnexijmb" }, { "input": "2\nnxqdblgac\nzpjou", "output": "nxqdblgaczpjou" }, { "input": "7\nfjr\ngk\nigkf\nret\nvx\nvxa\ncv", "output": "cvxaigkfjret" }, { "input": "7\nwer\nqwe\nw\nq\nert\ntyu\nrty", "output": "qwertyu" }, { "input": "4\na\nb\nab\nabc", "output": "abc" }, { "input": "4\nt\nwef\nqwe\nh", "output": "qwefth" }, { "input": "5\nabcd\nbc\ndef\nde\ncd", "output": "abcdef" } ]
1,632,506,157
2,147,483,647
Python 3
OK
TESTS
67
77
6,963,200
a = {} dic = {} l = [] b = int(input()) for c in range(b): d = input() l.append(d[0]) for c in range(len(d) - 1): if d[c] not in a: a[d[c]] = d[c + 1] if d[c + 1] not in dic: dic[d[c + 1]] = d[c] viz = [] def ds(no): viz.append(no) global ai if no in dic: ai = dic[no][0] + ai ds(dic[no][0]) def fs(no): global ai viz.append(no) if no in a: ai += a[no][0] fs(a[no][0]) jk = "" for c in range(len(l)): if l[c] not in viz: ai = "" ds(l[c]) ai += l[c] fs(l[c]) jk += ai print(jk)
Title: Making Genome in Berland Time Limit: None seconds Memory Limit: None megabytes Problem Description: Berland scientists face a very important task - given the parts of short DNA fragments, restore the dinosaur DNA! The genome of a berland dinosaur has noting in common with the genome that we've used to: it can have 26 distinct nucleotide types, a nucleotide of each type can occur at most once. If we assign distinct English letters to all nucleotides, then the genome of a Berland dinosaur will represent a non-empty string consisting of small English letters, such that each letter occurs in it at most once. Scientists have *n* genome fragments that are represented as substrings (non-empty sequences of consecutive nucleotides) of the sought genome. You face the following problem: help scientists restore the dinosaur genome. It is guaranteed that the input is not contradictory and at least one suitable line always exists. When the scientists found out that you are a strong programmer, they asked you in addition to choose the one with the minimum length. If there are multiple such strings, choose any string. Input Specification: The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of genome fragments. Each of the next lines contains one descriptions of a fragment. Each fragment is a non-empty string consisting of distinct small letters of the English alphabet. It is not guaranteed that the given fragments are distinct. Fragments could arbitrarily overlap and one fragment could be a substring of another one. It is guaranteed that there is such string of distinct letters that contains all the given fragments as substrings. Output Specification: In the single line of the output print the genome of the minimum length that contains all the given parts. All the nucleotides in the genome must be distinct. If there are multiple suitable strings, print the string of the minimum length. If there also are multiple suitable strings, you can print any of them. Demo Input: ['3\nbcd\nab\ncdef\n', '4\nx\ny\nz\nw\n'] Demo Output: ['abcdef\n', 'xyzw\n'] Note: none
```python a = {} dic = {} l = [] b = int(input()) for c in range(b): d = input() l.append(d[0]) for c in range(len(d) - 1): if d[c] not in a: a[d[c]] = d[c + 1] if d[c + 1] not in dic: dic[d[c + 1]] = d[c] viz = [] def ds(no): viz.append(no) global ai if no in dic: ai = dic[no][0] + ai ds(dic[no][0]) def fs(no): global ai viz.append(no) if no in a: ai += a[no][0] fs(a[no][0]) jk = "" for c in range(len(l)): if l[c] not in viz: ai = "" ds(l[c]) ai += l[c] fs(l[c]) jk += ai print(jk) ```
3
915
C
Permute Digits
PROGRAMMING
1,700
[ "dp", "greedy" ]
null
null
You are given two positive integer numbers *a* and *b*. Permute (change order) of the digits of *a* to construct maximal number not exceeding *b*. No number in input and/or output can start with the digit 0. It is allowed to leave *a* as it is.
The first line contains integer *a* (1<=≤<=*a*<=≤<=1018). The second line contains integer *b* (1<=≤<=*b*<=≤<=1018). Numbers don't have leading zeroes. It is guaranteed that answer exists.
Print the maximum possible number that is a permutation of digits of *a* and is not greater than *b*. The answer can't have any leading zeroes. It is guaranteed that the answer exists. The number in the output should have exactly the same length as number *a*. It should be a permutation of digits of *a*.
[ "123\n222\n", "3921\n10000\n", "4940\n5000\n" ]
[ "213\n", "9321\n", "4940\n" ]
none
0
[ { "input": "123\n222", "output": "213" }, { "input": "3921\n10000", "output": "9321" }, { "input": "4940\n5000", "output": "4940" }, { "input": "23923472834\n23589234723", "output": "23498743322" }, { "input": "102391019\n491010301", "output": "399211100" }, { "input": "123456789123456789\n276193619183618162", "output": "276193618987554432" }, { "input": "1000000000000000000\n1000000000000000000", "output": "1000000000000000000" }, { "input": "1\n1000000000000000000", "output": "1" }, { "input": "999999999999999999\n1000000000000000000", "output": "999999999999999999" }, { "input": "2475345634895\n3455834583479", "output": "3455834579642" }, { "input": "15778899\n98715689", "output": "98598771" }, { "input": "4555\n5454", "output": "4555" }, { "input": "122112\n221112", "output": "221112" }, { "input": "199999999999991\n191000000000000", "output": "119999999999999" }, { "input": "13\n31", "output": "31" }, { "input": "212\n211", "output": "122" }, { "input": "222234\n322223", "output": "243222" }, { "input": "123456789\n987654311", "output": "987654231" }, { "input": "20123\n21022", "output": "20321" }, { "input": "10101\n11000", "output": "10110" }, { "input": "592\n924", "output": "592" }, { "input": "5654456\n5634565", "output": "5566544" }, { "input": "655432\n421631", "output": "365542" }, { "input": "200\n200", "output": "200" }, { "input": "123456789987654321\n121111111111111111", "output": "119988776655443322" }, { "input": "12345\n21344", "output": "15432" }, { "input": "120\n200", "output": "120" }, { "input": "123\n212", "output": "132" }, { "input": "2184645\n5213118", "output": "5186442" }, { "input": "9912346\n9912345", "output": "9694321" }, { "input": "5003\n5000", "output": "3500" }, { "input": "12345\n31234", "output": "25431" }, { "input": "5001\n5000", "output": "1500" }, { "input": "53436\n53425", "output": "53364" }, { "input": "9329\n3268", "output": "2993" }, { "input": "1234567890\n9000000001", "output": "8976543210" }, { "input": "321\n212", "output": "132" }, { "input": "109823464\n901234467", "output": "896443210" }, { "input": "6543\n6542", "output": "6534" }, { "input": "555441\n555100", "output": "554541" }, { "input": "472389479\n327489423", "output": "327487994" }, { "input": "45645643756464352\n53465475637456247", "output": "53465475636654442" }, { "input": "254\n599", "output": "542" }, { "input": "5232222345652321\n5000000000000000", "output": "4655533322222221" }, { "input": "201\n200", "output": "120" }, { "input": "14362799391220361\n45160821596433661", "output": "43999766332221110" }, { "input": "3453\n5304", "output": "4533" }, { "input": "989\n998", "output": "998" }, { "input": "5200000000234\n5200000000311", "output": "5200000000243" }, { "input": "5555132\n1325442", "output": "1255553" }, { "input": "123\n211", "output": "132" }, { "input": "65689\n66123", "output": "65986" }, { "input": "123451234567890\n123456789012345", "output": "123456789012345" }, { "input": "22115\n22015", "output": "21521" }, { "input": "123\n311", "output": "231" }, { "input": "12222\n21111", "output": "12222" }, { "input": "765\n567", "output": "567" }, { "input": "9087645\n9087640", "output": "9087564" }, { "input": "1111111122222333\n2220000000000000", "output": "2213332221111111" }, { "input": "7901\n7108", "output": "7091" }, { "input": "215489\n215488", "output": "214985" }, { "input": "102\n200", "output": "120" }, { "input": "19260817\n20011213", "output": "19876210" }, { "input": "12345\n53200", "output": "53142" }, { "input": "1040003001\n1040003000", "output": "1040001300" }, { "input": "295\n924", "output": "592" }, { "input": "20000000000000001\n20000000000000000", "output": "12000000000000000" }, { "input": "99988877\n99887766", "output": "99879887" }, { "input": "12\n12", "output": "12" }, { "input": "199999999999999999\n900000000000000000", "output": "199999999999999999" }, { "input": "1234\n4310", "output": "4231" }, { "input": "100011\n100100", "output": "100011" }, { "input": "328899\n328811", "output": "299883" }, { "input": "646722972346\n397619201220", "output": "397476664222" }, { "input": "1203\n1200", "output": "1032" }, { "input": "1\n2", "output": "1" }, { "input": "1112\n2110", "output": "1211" }, { "input": "4545\n5540", "output": "5454" }, { "input": "3053\n5004", "output": "3530" }, { "input": "3503\n5004", "output": "3530" }, { "input": "351731653766064847\n501550303749042658", "output": "501548777666643331" }, { "input": "10123456789013451\n26666666666666666", "output": "26598754433111100" }, { "input": "1110111\n1100000", "output": "1011111" }, { "input": "30478\n32265", "output": "30874" }, { "input": "456546546549874615\n441554543131214545", "output": "441554498766665554" }, { "input": "214\n213", "output": "142" }, { "input": "415335582799619283\n133117803602859310", "output": "132999887655543321" }, { "input": "787\n887", "output": "877" }, { "input": "3333222288889999\n3333222288881111", "output": "3332999988883222" }, { "input": "495779862481416791\n836241745208800994", "output": "829998777665444111" }, { "input": "139\n193", "output": "193" }, { "input": "9568\n6500", "output": "5986" }, { "input": "3208899\n3228811", "output": "3209988" }, { "input": "27778\n28710", "output": "27877" }, { "input": "62345\n46415", "output": "46352" }, { "input": "405739873179209\n596793907108871", "output": "594998777332100" }, { "input": "365\n690", "output": "653" }, { "input": "8388731334391\n4710766672578", "output": "4398887333311" }, { "input": "1230\n1200", "output": "1032" }, { "input": "1025\n5000", "output": "2510" }, { "input": "4207799\n4027711", "output": "2997740" }, { "input": "4444222277779999\n4444222277771111", "output": "4442999977774222" }, { "input": "7430\n3047", "output": "3047" }, { "input": "649675735\n540577056", "output": "539776654" }, { "input": "26\n82", "output": "62" }, { "input": "241285\n207420", "output": "185422" }, { "input": "3\n3", "output": "3" }, { "input": "12\n21", "output": "21" }, { "input": "481287\n826607", "output": "824871" }, { "input": "40572351\n59676984", "output": "57543210" }, { "input": "268135787269\n561193454469", "output": "539887766221" }, { "input": "4\n9", "output": "4" }, { "input": "5\n6", "output": "5" }, { "input": "60579839\n33370073", "output": "30998765" }, { "input": "49939\n39200", "output": "34999" }, { "input": "2224\n4220", "output": "2422" }, { "input": "427799\n427711", "output": "299774" }, { "input": "49\n90", "output": "49" }, { "input": "93875\n82210", "output": "79853" }, { "input": "78831\n7319682", "output": "88731" }, { "input": "937177\n7143444", "output": "977731" }, { "input": "499380628\n391990337", "output": "390988642" }, { "input": "2090909\n2900000", "output": "2099900" }, { "input": "112233445566778890\n987654321987654320", "output": "987654321876543210" }, { "input": "48257086\n80903384", "output": "80876542" }, { "input": "112233445566778890\n900654321987654320", "output": "898776655443322110" }, { "input": "112233445566778890\n123456789123456788", "output": "123456789123456780" }, { "input": "5207799\n5027711", "output": "2997750" }, { "input": "200000000000000001\n200000000000000000", "output": "120000000000000000" }, { "input": "597402457\n797455420", "output": "797455420" }, { "input": "90\n94", "output": "90" }, { "input": "86888\n88683", "output": "86888" }, { "input": "419155888\n588151913", "output": "588151894" }, { "input": "408919130\n191830070", "output": "191830049" }, { "input": "524975\n554924", "output": "554792" }, { "input": "53029\n30524", "output": "30295" }, { "input": "5549\n5542", "output": "5495" }, { "input": "6\n9", "output": "6" }, { "input": "87\n810", "output": "87" }, { "input": "920491855\n281495062", "output": "281495059" }, { "input": "6691\n6910", "output": "6691" }, { "input": "533\n335", "output": "335" }, { "input": "999999999999999998\n999999999999999997", "output": "999999999999999989" }, { "input": "21111111111111111\n21111111111111110", "output": "12111111111111111" }, { "input": "2\n12", "output": "2" }, { "input": "76544\n45744", "output": "45674" }, { "input": "2000000000000001\n2000000000000000", "output": "1200000000000000" }, { "input": "740867\n467701", "output": "467087" }, { "input": "2\n6", "output": "2" }, { "input": "103\n130", "output": "130" }, { "input": "2423712\n8466235", "output": "7432221" }, { "input": "84\n48", "output": "48" }, { "input": "1210\n12113", "output": "2110" }, { "input": "2430\n20786", "output": "4320" }, { "input": "100\n999", "output": "100" }, { "input": "19325\n21903", "output": "21593" }, { "input": "1969\n23251", "output": "9961" } ]
1,516,989,315
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
46
5,632,000
a = list(map(int, list(input()))) q = len(a) b = list(map(int, list(input()))) new = "" a.sort() a.reverse() if len(b) > q: a = list(map(str, a)) new = "".join(a) print(new) else: i = 0 while True: if int("".join(map(str, a))) < int("".join(map(str, b))): break else: a[i], a[i + 1] = a[i+ 1], a[i] i += 1 if i == q-1: i = 0 print("".join(map(str, a)))
Title: Permute Digits Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given two positive integer numbers *a* and *b*. Permute (change order) of the digits of *a* to construct maximal number not exceeding *b*. No number in input and/or output can start with the digit 0. It is allowed to leave *a* as it is. Input Specification: The first line contains integer *a* (1<=≤<=*a*<=≤<=1018). The second line contains integer *b* (1<=≤<=*b*<=≤<=1018). Numbers don't have leading zeroes. It is guaranteed that answer exists. Output Specification: Print the maximum possible number that is a permutation of digits of *a* and is not greater than *b*. The answer can't have any leading zeroes. It is guaranteed that the answer exists. The number in the output should have exactly the same length as number *a*. It should be a permutation of digits of *a*. Demo Input: ['123\n222\n', '3921\n10000\n', '4940\n5000\n'] Demo Output: ['213\n', '9321\n', '4940\n'] Note: none
```python a = list(map(int, list(input()))) q = len(a) b = list(map(int, list(input()))) new = "" a.sort() a.reverse() if len(b) > q: a = list(map(str, a)) new = "".join(a) print(new) else: i = 0 while True: if int("".join(map(str, a))) < int("".join(map(str, b))): break else: a[i], a[i + 1] = a[i+ 1], a[i] i += 1 if i == q-1: i = 0 print("".join(map(str, a))) ```
0
4
A
Watermelon
PROGRAMMING
800
[ "brute force", "math" ]
A. Watermelon
1
64
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem. Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
[ "8\n" ]
[ "YES\n" ]
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
0
[ { "input": "8", "output": "YES" }, { "input": "5", "output": "NO" }, { "input": "4", "output": "YES" }, { "input": "3", "output": "NO" }, { "input": "2", "output": "NO" }, { "input": "1", "output": "NO" }, { "input": "7", "output": "NO" }, { "input": "6", "output": "YES" }, { "input": "10", "output": "YES" }, { "input": "9", "output": "NO" }, { "input": "53", "output": "NO" }, { "input": "77", "output": "NO" }, { "input": "32", "output": "YES" }, { "input": "44", "output": "YES" }, { "input": "98", "output": "YES" }, { "input": "99", "output": "NO" }, { "input": "90", "output": "YES" }, { "input": "67", "output": "NO" }, { "input": "100", "output": "YES" }, { "input": "88", "output": "YES" } ]
1,696,785,531
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
30
0
n=int(input('ENTER THE WEIGHT OF THE WATERMELON:')) if 1<=n<=100: if n%2==0: print("yes") else: print("NO") else: print('ENTER VALID WEIGHT')
Title: Watermelon Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem. Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight. Input Specification: The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys. Output Specification: Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case. Demo Input: ['8\n'] Demo Output: ['YES\n'] Note: For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
```python n=int(input('ENTER THE WEIGHT OF THE WATERMELON:')) if 1<=n<=100: if n%2==0: print("yes") else: print("NO") else: print('ENTER VALID WEIGHT') ```
0
787
A
The Monster
PROGRAMMING
1,200
[ "brute force", "math", "number theory" ]
null
null
A monster is chasing after Rick and Morty on another planet. They're so frightened that sometimes they scream. More accurately, Rick screams at times *b*,<=*b*<=+<=*a*,<=*b*<=+<=2*a*,<=*b*<=+<=3*a*,<=... and Morty screams at times *d*,<=*d*<=+<=*c*,<=*d*<=+<=2*c*,<=*d*<=+<=3*c*,<=.... The Monster will catch them if at any point they scream at the same time, so it wants to know when it will catch them (the first time they scream at the same time) or that they will never scream at the same time.
The first line of input contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100). The second line contains two integers *c* and *d* (1<=≤<=*c*,<=*d*<=≤<=100).
Print the first time Rick and Morty will scream at the same time, or <=-<=1 if they will never scream at the same time.
[ "20 2\n9 19\n", "2 1\n16 12\n" ]
[ "82\n", "-1\n" ]
In the first sample testcase, Rick's 5th scream and Morty's 8th time are at time 82. In the second sample testcase, all Rick's screams will be at odd times and Morty's will be at even times, so they will never scream at the same time.
500
[ { "input": "20 2\n9 19", "output": "82" }, { "input": "2 1\n16 12", "output": "-1" }, { "input": "39 52\n88 78", "output": "1222" }, { "input": "59 96\n34 48", "output": "1748" }, { "input": "87 37\n91 29", "output": "211" }, { "input": "11 81\n49 7", "output": "301" }, { "input": "39 21\n95 89", "output": "3414" }, { "input": "59 70\n48 54", "output": "1014" }, { "input": "87 22\n98 32", "output": "718" }, { "input": "15 63\n51 13", "output": "-1" }, { "input": "39 7\n97 91", "output": "1255" }, { "input": "18 18\n71 71", "output": "1278" }, { "input": "46 71\n16 49", "output": "209" }, { "input": "70 11\n74 27", "output": "2321" }, { "input": "94 55\n20 96", "output": "-1" }, { "input": "18 4\n77 78", "output": "1156" }, { "input": "46 44\n23 55", "output": "-1" }, { "input": "74 88\n77 37", "output": "1346" }, { "input": "94 37\n34 7", "output": "789" }, { "input": "22 81\n80 88", "output": "-1" }, { "input": "46 30\n34 62", "output": "674" }, { "input": "40 4\n81 40", "output": "364" }, { "input": "69 48\n39 9", "output": "48" }, { "input": "89 93\n84 87", "output": "5967" }, { "input": "17 45\n42 65", "output": "317" }, { "input": "41 85\n95 46", "output": "331" }, { "input": "69 30\n41 16", "output": "1410" }, { "input": "93 74\n99 93", "output": "-1" }, { "input": "17 19\n44 75", "output": "427" }, { "input": "45 63\n98 53", "output": "3483" }, { "input": "69 11\n48 34", "output": "-1" }, { "input": "55 94\n3 96", "output": "204" }, { "input": "100 100\n100 100", "output": "100" }, { "input": "1 1\n1 1", "output": "1" }, { "input": "1 1\n1 100", "output": "100" }, { "input": "1 100\n100 1", "output": "101" }, { "input": "98 1\n99 100", "output": "9703" }, { "input": "98 1\n99 2", "output": "9605" }, { "input": "97 2\n99 100", "output": "4852" }, { "input": "3 3\n3 1", "output": "-1" }, { "input": "3 2\n7 2", "output": "2" }, { "input": "2 3\n2 5", "output": "5" }, { "input": "2 3\n2 3", "output": "3" }, { "input": "100 3\n100 5", "output": "-1" }, { "input": "6 10\n12 14", "output": "-1" }, { "input": "4 2\n4 4", "output": "-1" }, { "input": "2 3\n2 2", "output": "-1" }, { "input": "2 3\n4 99", "output": "99" }, { "input": "1 5\n1 5", "output": "5" }, { "input": "1 100\n3 1", "output": "100" }, { "input": "2 2\n2 1", "output": "-1" }, { "input": "2 10\n6 20", "output": "20" }, { "input": "2 2\n2 10", "output": "10" }, { "input": "3 7\n3 6", "output": "-1" }, { "input": "1 100\n1 100", "output": "100" }, { "input": "7 25\n39 85", "output": "319" }, { "input": "84 82\n38 6", "output": "82" }, { "input": "7 7\n7 14", "output": "14" } ]
1,680,293,379
2,147,483,647
Python 3
OK
TESTS
58
46
0
a, b = [int(x) for x in input().split()] c, d = [int(x) for x in input().split()] i = 0 ans = -1 while b + a * i < 101*101: s = b + a * i if s >= d and (s-d) % c == 0: ans = s break i += 1 print(ans)
Title: The Monster Time Limit: None seconds Memory Limit: None megabytes Problem Description: A monster is chasing after Rick and Morty on another planet. They're so frightened that sometimes they scream. More accurately, Rick screams at times *b*,<=*b*<=+<=*a*,<=*b*<=+<=2*a*,<=*b*<=+<=3*a*,<=... and Morty screams at times *d*,<=*d*<=+<=*c*,<=*d*<=+<=2*c*,<=*d*<=+<=3*c*,<=.... The Monster will catch them if at any point they scream at the same time, so it wants to know when it will catch them (the first time they scream at the same time) or that they will never scream at the same time. Input Specification: The first line of input contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100). The second line contains two integers *c* and *d* (1<=≤<=*c*,<=*d*<=≤<=100). Output Specification: Print the first time Rick and Morty will scream at the same time, or <=-<=1 if they will never scream at the same time. Demo Input: ['20 2\n9 19\n', '2 1\n16 12\n'] Demo Output: ['82\n', '-1\n'] Note: In the first sample testcase, Rick's 5th scream and Morty's 8th time are at time 82. In the second sample testcase, all Rick's screams will be at odd times and Morty's will be at even times, so they will never scream at the same time.
```python a, b = [int(x) for x in input().split()] c, d = [int(x) for x in input().split()] i = 0 ans = -1 while b + a * i < 101*101: s = b + a * i if s >= d and (s-d) % c == 0: ans = s break i += 1 print(ans) ```
3
767
A
Snacktower
PROGRAMMING
1,100
[ "data structures", "implementation" ]
null
null
According to an old legeng, a long time ago Ankh-Morpork residents did something wrong to miss Fortune, and she cursed them. She said that at some time *n* snacks of distinct sizes will fall on the city, and the residents should build a Snacktower of them by placing snacks one on another. Of course, big snacks should be at the bottom of the tower, while small snacks should be at the top. Years passed, and once different snacks started to fall onto the city, and the residents began to build the Snacktower. However, they faced some troubles. Each day exactly one snack fell onto the city, but their order was strange. So, at some days the residents weren't able to put the new stack on the top of the Snacktower: they had to wait until all the bigger snacks fell. Of course, in order to not to anger miss Fortune again, the residents placed each snack on the top of the tower immediately as they could do it. Write a program that models the behavior of Ankh-Morpork residents.
The first line contains single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the total number of snacks. The second line contains *n* integers, the *i*-th of them equals the size of the snack which fell on the *i*-th day. Sizes are distinct integers from 1 to *n*.
Print *n* lines. On the *i*-th of them print the sizes of the snacks which the residents placed on the top of the Snacktower on the *i*-th day in the order they will do that. If no snack is placed on some day, leave the corresponding line empty.
[ "3\n3 1 2\n", "5\n4 5 1 2 3\n" ]
[ "3\n \n2 1", "5 4\n \n \n3 2 1\n" ]
In the example a snack of size 3 fell on the first day, and the residents immediately placed it. On the second day a snack of size 1 fell, and the residents weren't able to place it because they were missing the snack of size 2. On the third day a snack of size 2 fell, and the residents immediately placed it. Right after that they placed the snack of size 1 which had fallen before.
500
[ { "input": "3\n3 1 2", "output": "3 \n\n2 1 " }, { "input": "5\n4 5 1 2 3", "output": "5 4 \n\n\n3 2 1 " }, { "input": "1\n1", "output": "1 " }, { "input": "2\n1 2", "output": "2 1 " }, { "input": "10\n5 1 6 2 8 3 4 10 9 7", "output": "10 \n9 8 \n7 6 5 4 3 2 1 " }, { "input": "30\n16 10 4 29 5 28 12 21 11 30 18 6 14 3 17 22 20 15 9 1 27 19 24 26 13 25 2 23 8 7", "output": "30 29 28 \n\n\n\n\n\n\n\n\n\n\n27 \n\n\n26 \n\n25 24 \n\n23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 \n8 \n7 6 5 4 3 2 1 " }, { "input": "100\n98 52 63 2 18 96 31 58 84 40 41 45 66 100 46 71 26 48 81 20 73 91 68 76 13 93 17 29 64 95 79 21 55 75 19 85 54 51 89 78 15 87 43 59 36 1 90 35 65 56 62 28 86 5 82 49 3 99 33 9 92 32 74 69 27 22 77 16 44 94 34 6 57 70 23 12 61 25 8 11 67 47 83 88 10 14 30 7 97 60 42 37 24 38 53 50 4 80 72 39", "output": "100 \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n99 98 \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 \n\n\n\n\n\n\n\n\n80 79 78 77 76 75 74 73 \n72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 \n39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 " }, { "input": "2\n2 1", "output": "2 \n1 " } ]
1,604,042,598
2,147,483,647
PyPy 3
OK
TESTS
25
390
11,776,000
n = int(input()) stone = list(map(int,input().split())) h = set() for i in stone: h.add(i) while n in h and n > 0: print(n, end=" ") n -= 1 print()
Title: Snacktower Time Limit: None seconds Memory Limit: None megabytes Problem Description: According to an old legeng, a long time ago Ankh-Morpork residents did something wrong to miss Fortune, and she cursed them. She said that at some time *n* snacks of distinct sizes will fall on the city, and the residents should build a Snacktower of them by placing snacks one on another. Of course, big snacks should be at the bottom of the tower, while small snacks should be at the top. Years passed, and once different snacks started to fall onto the city, and the residents began to build the Snacktower. However, they faced some troubles. Each day exactly one snack fell onto the city, but their order was strange. So, at some days the residents weren't able to put the new stack on the top of the Snacktower: they had to wait until all the bigger snacks fell. Of course, in order to not to anger miss Fortune again, the residents placed each snack on the top of the tower immediately as they could do it. Write a program that models the behavior of Ankh-Morpork residents. Input Specification: The first line contains single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the total number of snacks. The second line contains *n* integers, the *i*-th of them equals the size of the snack which fell on the *i*-th day. Sizes are distinct integers from 1 to *n*. Output Specification: Print *n* lines. On the *i*-th of them print the sizes of the snacks which the residents placed on the top of the Snacktower on the *i*-th day in the order they will do that. If no snack is placed on some day, leave the corresponding line empty. Demo Input: ['3\n3 1 2\n', '5\n4 5 1 2 3\n'] Demo Output: ['3\n\xa0\n2 1', '5 4\n\xa0\n\xa0\n3 2 1\n'] Note: In the example a snack of size 3 fell on the first day, and the residents immediately placed it. On the second day a snack of size 1 fell, and the residents weren't able to place it because they were missing the snack of size 2. On the third day a snack of size 2 fell, and the residents immediately placed it. Right after that they placed the snack of size 1 which had fallen before.
```python n = int(input()) stone = list(map(int,input().split())) h = set() for i in stone: h.add(i) while n in h and n > 0: print(n, end=" ") n -= 1 print() ```
3
0
none
none
none
0
[ "none" ]
null
null
Gennady is one of the best child dentists in Berland. Today *n* children got an appointment with him, they lined up in front of his office. All children love to cry loudly at the reception at the dentist. We enumerate the children with integers from 1 to *n* in the order they go in the line. Every child is associated with the value of his cofidence *p**i*. The children take turns one after another to come into the office; each time the child that is the first in the line goes to the doctor. While Gennady treats the teeth of the *i*-th child, the child is crying with the volume of *v**i*. At that the confidence of the first child in the line is reduced by the amount of *v**i*, the second one — by value *v**i*<=-<=1, and so on. The children in the queue after the *v**i*-th child almost do not hear the crying, so their confidence remains unchanged. If at any point in time the confidence of the *j*-th child is less than zero, he begins to cry with the volume of *d**j* and leaves the line, running towards the exit, without going to the doctor's office. At this the confidence of all the children after the *j*-th one in the line is reduced by the amount of *d**j*. All these events occur immediately one after the other in some order. Some cries may lead to other cries, causing a chain reaction. Once in the hallway it is quiet, the child, who is first in the line, goes into the doctor's office. Help Gennady the Dentist to determine the numbers of kids, whose teeth he will cure. Print their numbers in the chronological order.
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=4000) — the number of kids in the line. Next *n* lines contain three integers each *v**i*,<=*d**i*,<=*p**i* (1<=≤<=*v**i*,<=*d**i*,<=*p**i*<=≤<=106) — the volume of the cry in the doctor's office, the volume of the cry in the hall and the confidence of the *i*-th child.
In the first line print number *k* — the number of children whose teeth Gennady will cure. In the second line print *k* integers — the numbers of the children who will make it to the end of the line in the increasing order.
[ "5\n4 2 2\n4 1 2\n5 2 4\n3 3 5\n5 1 2\n", "5\n4 5 1\n5 3 9\n4 1 2\n2 1 8\n4 1 9\n" ]
[ "2\n1 3 ", "4\n1 2 4 5 " ]
In the first example, Gennady first treats the teeth of the first child who will cry with volume 4. The confidences of the remaining children will get equal to  - 2, 1, 3, 1, respectively. Thus, the second child also cries at the volume of 1 and run to the exit. The confidence of the remaining children will be equal to 0, 2, 0. Then the third child will go to the office, and cry with volume 5. The other children won't bear this, and with a loud cry they will run to the exit. In the second sample, first the first child goes into the office, he will cry with volume 4. The confidence of the remaining children will be equal to 5,  - 1, 6, 8. Thus, the third child will cry with the volume of 1 and run to the exit. The confidence of the remaining children will be equal to 5, 5, 7. After that, the second child goes to the office and cry with the volume of 5. The confidences of the remaining children will be equal to 0, 3. Then the fourth child will go into the office and cry with the volume of 2. Because of this the confidence of the fifth child will be 1, and he will go into the office last.
0
[ { "input": "5\n4 2 2\n4 1 2\n5 2 4\n3 3 5\n5 1 2", "output": "2\n1 3 " }, { "input": "5\n4 5 1\n5 3 9\n4 1 2\n2 1 8\n4 1 9", "output": "4\n1 2 4 5 " }, { "input": "10\n10 7 10\n3 6 11\n8 4 10\n10 1 11\n7 3 13\n7 2 13\n7 6 14\n3 4 17\n9 4 20\n5 2 24", "output": "3\n1 2 5 " }, { "input": "10\n5 6 3\n7 4 10\n9 1 17\n2 8 23\n9 10 24\n6 8 18\n3 2 35\n7 6 6\n1 3 12\n9 9 5", "output": "6\n1 2 3 4 5 7 " }, { "input": "10\n4 9 1\n8 2 14\n7 10 20\n6 9 18\n5 3 19\n2 9 7\n6 8 30\n8 7 38\n6 5 5\n6 9 37", "output": "8\n1 2 3 4 5 7 8 10 " }, { "input": "10\n10 3 3\n8 6 17\n9 5 26\n10 7 17\n3 10 29\n3 1 27\n3 3 7\n8 10 28\n1 3 23\n3 4 6", "output": "5\n1 2 3 5 8 " }, { "input": "10\n5 6 1\n9 2 6\n4 1 5\n4 10 5\n1 8 23\n9 4 21\n3 9 6\n7 8 34\n7 4 24\n8 9 21", "output": "5\n1 2 5 6 8 " }, { "input": "4\n2 10 1\n1 2 2\n2 1 1\n5 5 1", "output": "3\n1 2 4 " }, { "input": "1\n1 1 1", "output": "1\n1 " }, { "input": "2\n5 1 1\n1 1 5", "output": "2\n1 2 " }, { "input": "2\n5 1 1\n1 1 4", "output": "1\n1 " }, { "input": "2\n5 1 1\n1 1 6", "output": "2\n1 2 " }, { "input": "3\n5 1 1\n1 1 4\n1 1 4", "output": "1\n1 " }, { "input": "3\n5 1 1\n1 1 4\n1 1 5", "output": "2\n1 3 " }, { "input": "3\n5 1 1\n1 1 5\n1 1 3", "output": "2\n1 2 " }, { "input": "3\n5 1 1\n10 1 5\n1000 1000 14", "output": "3\n1 2 3 " }, { "input": "10\n9 8 8\n2 9 33\n10 7 42\n7 2 18\n3 5 82\n9 9 25\n3 2 86\n3 5 49\n5 3 72\n4 4 71", "output": "10\n1 2 3 4 5 6 7 8 9 10 " }, { "input": "10\n9 8 8\n2 9 8\n10 7 16\n7 2 9\n3 5 23\n9 9 25\n3 2 35\n3 5 36\n5 3 40\n4 4 42", "output": "1\n1 " } ]
1,444,643,450
2,450
Python 3
TIME_LIMIT_EXCEEDED
TESTS
31
1,000
307,200
# import sys # sys.stdin = open('cf586c.in') n = int(input()) v, d, p = [], [], [] for _ in range(n): vi, di, pi = [int(v) for v in input().split()] v.append(vi) d.append(di) p.append(pi) kids = list(range(n)) ans = [] while kids: curr = kids[0] ans.append(curr) del kids[0] for i in range(min(len(kids), v[curr])): p[kids[i]] -= (v[curr] - i) i = 0 while i < len(kids): # print("i = %d, Remaining certainty: %r" % (i, p)) if p[kids[i]] < 0: for j in range(i + 1, len(kids)): p[kids[j]] -= d[kids[i]] del kids[i] else: i += 1 print(len(ans)) print(' '.join(str(v + 1) for v in ans))
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Gennady is one of the best child dentists in Berland. Today *n* children got an appointment with him, they lined up in front of his office. All children love to cry loudly at the reception at the dentist. We enumerate the children with integers from 1 to *n* in the order they go in the line. Every child is associated with the value of his cofidence *p**i*. The children take turns one after another to come into the office; each time the child that is the first in the line goes to the doctor. While Gennady treats the teeth of the *i*-th child, the child is crying with the volume of *v**i*. At that the confidence of the first child in the line is reduced by the amount of *v**i*, the second one — by value *v**i*<=-<=1, and so on. The children in the queue after the *v**i*-th child almost do not hear the crying, so their confidence remains unchanged. If at any point in time the confidence of the *j*-th child is less than zero, he begins to cry with the volume of *d**j* and leaves the line, running towards the exit, without going to the doctor's office. At this the confidence of all the children after the *j*-th one in the line is reduced by the amount of *d**j*. All these events occur immediately one after the other in some order. Some cries may lead to other cries, causing a chain reaction. Once in the hallway it is quiet, the child, who is first in the line, goes into the doctor's office. Help Gennady the Dentist to determine the numbers of kids, whose teeth he will cure. Print their numbers in the chronological order. Input Specification: The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=4000) — the number of kids in the line. Next *n* lines contain three integers each *v**i*,<=*d**i*,<=*p**i* (1<=≤<=*v**i*,<=*d**i*,<=*p**i*<=≤<=106) — the volume of the cry in the doctor's office, the volume of the cry in the hall and the confidence of the *i*-th child. Output Specification: In the first line print number *k* — the number of children whose teeth Gennady will cure. In the second line print *k* integers — the numbers of the children who will make it to the end of the line in the increasing order. Demo Input: ['5\n4 2 2\n4 1 2\n5 2 4\n3 3 5\n5 1 2\n', '5\n4 5 1\n5 3 9\n4 1 2\n2 1 8\n4 1 9\n'] Demo Output: ['2\n1 3 ', '4\n1 2 4 5 '] Note: In the first example, Gennady first treats the teeth of the first child who will cry with volume 4. The confidences of the remaining children will get equal to  - 2, 1, 3, 1, respectively. Thus, the second child also cries at the volume of 1 and run to the exit. The confidence of the remaining children will be equal to 0, 2, 0. Then the third child will go to the office, and cry with volume 5. The other children won't bear this, and with a loud cry they will run to the exit. In the second sample, first the first child goes into the office, he will cry with volume 4. The confidence of the remaining children will be equal to 5,  - 1, 6, 8. Thus, the third child will cry with the volume of 1 and run to the exit. The confidence of the remaining children will be equal to 5, 5, 7. After that, the second child goes to the office and cry with the volume of 5. The confidences of the remaining children will be equal to 0, 3. Then the fourth child will go into the office and cry with the volume of 2. Because of this the confidence of the fifth child will be 1, and he will go into the office last.
```python # import sys # sys.stdin = open('cf586c.in') n = int(input()) v, d, p = [], [], [] for _ in range(n): vi, di, pi = [int(v) for v in input().split()] v.append(vi) d.append(di) p.append(pi) kids = list(range(n)) ans = [] while kids: curr = kids[0] ans.append(curr) del kids[0] for i in range(min(len(kids), v[curr])): p[kids[i]] -= (v[curr] - i) i = 0 while i < len(kids): # print("i = %d, Remaining certainty: %r" % (i, p)) if p[kids[i]] < 0: for j in range(i + 1, len(kids)): p[kids[j]] -= d[kids[i]] del kids[i] else: i += 1 print(len(ans)) print(' '.join(str(v + 1) for v in ans)) ```
0
227
B
Effective Approach
PROGRAMMING
1,100
[ "implementation" ]
null
null
Once at a team training Vasya, Petya and Sasha got a problem on implementing linear search in an array. According to the boys, linear search works as follows. The array elements in a pre-selected order are in turn compared with the number that you need to find. Once you find the array element that is equal to the required one, the search ends. The efficiency of the algorithm is the number of performed comparisons. The fewer comparisons the linear search has made, the more effective it is. Vasya believes that a linear search would work better if it sequentially iterates through the elements, starting with the 1-st one (in this problem we consider the elements of the array indexed from 1 to *n*) and ending with the *n*-th one. And Petya says that Vasya is wrong: the search will need less comparisons if it sequentially iterates the elements starting from the *n*-th and ending with the 1-st one. Sasha argues that the two approaches are equivalent. To finally begin the task, the teammates decided to settle the debate and compare the two approaches on an example. For this, they took an array that is a permutation of integers from 1 to *n*, and generated *m* queries of the form: find element with value *b**i* in the array. They want to calculate for both approaches how many comparisons in total the linear search will need to respond to all queries. If the first search needs fewer comparisons, then the winner of the dispute is Vasya. If the second one does, then the winner is Petya. If both approaches make the same number of comparisons, then Sasha's got the upper hand. But the problem is, linear search is too slow. That's why the boys aren't going to find out who is right before the end of the training, unless you come in here. Help them to determine who will win the dispute.
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of elements in the array. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the elements of array. The third line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. The last line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*) — the search queries. Note that the queries can repeat.
Print two integers, showing how many comparisons Vasya's approach needs and how many comparisons Petya's approach needs. Separate the numbers by spaces. Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier.
[ "2\n1 2\n1\n1\n", "2\n2 1\n1\n1\n", "3\n3 1 2\n3\n1 2 3\n" ]
[ "1 2\n", "2 1\n", "6 6\n" ]
In the first sample Vasya's approach will make one comparison (it starts with the 1-st element and immediately finds the required number), and Petya's approach makes two comparisons (first he compares with the 2-nd array element, doesn't find the search item and compares with the 1-st element). In the second sample, on the contrary, Vasya's approach will need two comparisons (first with 1-st element, and then with the 2-nd), and Petya's approach will find the required value in one comparison (the first comparison with the 2-nd element).
1,000
[ { "input": "2\n1 2\n1\n1", "output": "1 2" }, { "input": "2\n2 1\n1\n1", "output": "2 1" }, { "input": "3\n3 1 2\n3\n1 2 3", "output": "6 6" }, { "input": "9\n2 9 3 1 6 4 7 8 5\n9\n5 1 5 2 8 4 4 4 5", "output": "58 32" }, { "input": "10\n3 10 9 2 7 6 5 8 4 1\n1\n4", "output": "9 2" }, { "input": "10\n5 2 10 8 3 1 9 7 6 4\n9\n2 5 9 2 3 2 5 9 8", "output": "31 68" }, { "input": "9\n3 8 4 7 1 2 5 6 9\n3\n2 7 1", "output": "15 15" }, { "input": "9\n5 3 8 4 2 6 1 7 9\n4\n6 1 9 2", "output": "27 13" }, { "input": "4\n1 3 2 4\n4\n3 1 2 3", "output": "8 12" }, { "input": "3\n1 2 3\n8\n3 2 1 1 2 3 1 2", "output": "15 17" } ]
1,692,884,246
2,147,483,647
Python 3
OK
TESTS
34
436
27,136,000
n = int(input()) arr = [(int(x) , i) for i , x in enumerate(input().split())] arr.sort() m = int(input()) querries = [int(x) for x in input().split()] one = 0 for e in querries: one += arr[e - 1][1] print(one + m , m * n - one)
Title: Effective Approach Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once at a team training Vasya, Petya and Sasha got a problem on implementing linear search in an array. According to the boys, linear search works as follows. The array elements in a pre-selected order are in turn compared with the number that you need to find. Once you find the array element that is equal to the required one, the search ends. The efficiency of the algorithm is the number of performed comparisons. The fewer comparisons the linear search has made, the more effective it is. Vasya believes that a linear search would work better if it sequentially iterates through the elements, starting with the 1-st one (in this problem we consider the elements of the array indexed from 1 to *n*) and ending with the *n*-th one. And Petya says that Vasya is wrong: the search will need less comparisons if it sequentially iterates the elements starting from the *n*-th and ending with the 1-st one. Sasha argues that the two approaches are equivalent. To finally begin the task, the teammates decided to settle the debate and compare the two approaches on an example. For this, they took an array that is a permutation of integers from 1 to *n*, and generated *m* queries of the form: find element with value *b**i* in the array. They want to calculate for both approaches how many comparisons in total the linear search will need to respond to all queries. If the first search needs fewer comparisons, then the winner of the dispute is Vasya. If the second one does, then the winner is Petya. If both approaches make the same number of comparisons, then Sasha's got the upper hand. But the problem is, linear search is too slow. That's why the boys aren't going to find out who is right before the end of the training, unless you come in here. Help them to determine who will win the dispute. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of elements in the array. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the elements of array. The third line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. The last line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*) — the search queries. Note that the queries can repeat. Output Specification: Print two integers, showing how many comparisons Vasya's approach needs and how many comparisons Petya's approach needs. Separate the numbers by spaces. Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier. Demo Input: ['2\n1 2\n1\n1\n', '2\n2 1\n1\n1\n', '3\n3 1 2\n3\n1 2 3\n'] Demo Output: ['1 2\n', '2 1\n', '6 6\n'] Note: In the first sample Vasya's approach will make one comparison (it starts with the 1-st element and immediately finds the required number), and Petya's approach makes two comparisons (first he compares with the 2-nd array element, doesn't find the search item and compares with the 1-st element). In the second sample, on the contrary, Vasya's approach will need two comparisons (first with 1-st element, and then with the 2-nd), and Petya's approach will find the required value in one comparison (the first comparison with the 2-nd element).
```python n = int(input()) arr = [(int(x) , i) for i , x in enumerate(input().split())] arr.sort() m = int(input()) querries = [int(x) for x in input().split()] one = 0 for e in querries: one += arr[e - 1][1] print(one + m , m * n - one) ```
3
432
A
Choosing Teams
PROGRAMMING
800
[ "greedy", "implementation", "sortings" ]
null
null
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times. The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
Print a single number — the answer to the problem.
[ "5 2\n0 4 5 1 0\n", "6 4\n0 1 2 3 4 5\n", "6 5\n0 0 0 0 0 0\n" ]
[ "1\n", "0\n", "2\n" ]
In the first sample only one team could be made: the first, the fourth and the fifth participants. In the second sample no teams could be created. In the third sample two teams could be created. Any partition into two teams fits.
500
[ { "input": "5 2\n0 4 5 1 0", "output": "1" }, { "input": "6 4\n0 1 2 3 4 5", "output": "0" }, { "input": "6 5\n0 0 0 0 0 0", "output": "2" }, { "input": "3 4\n0 1 0", "output": "1" }, { "input": "3 4\n0 2 0", "output": "0" }, { "input": "6 5\n0 0 0 0 0 0", "output": "2" }, { "input": "12 2\n0 1 2 3 4 0 1 2 3 4 0 1", "output": "3" }, { "input": "15 2\n0 1 2 3 4 0 1 2 3 4 0 1 2 3 4", "output": "4" }, { "input": "13 1\n5 0 5 0 1 5 0 4 1 1 1 4 1", "output": "3" }, { "input": "20 1\n5 0 4 2 2 3 2 1 2 4 1 3 5 5 5 4 4 1 3 0", "output": "5" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "6 3\n4 4 4 4 4 4", "output": "0" }, { "input": "1 4\n1", "output": "0" }, { "input": "1 1\n0", "output": "0" }, { "input": "2 3\n0 0", "output": "0" } ]
1,693,986,000
2,147,483,647
Python 3
OK
TESTS
35
46
0
n, k = map(int, input().split()) ps = list(map(int, input().split())) teams = 0 for count in ps: if 5 - count >= k: teams += 1 ms = teams // 3 print(ms)
Title: Choosing Teams Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times. The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times? Input Specification: The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship. Output Specification: Print a single number — the answer to the problem. Demo Input: ['5 2\n0 4 5 1 0\n', '6 4\n0 1 2 3 4 5\n', '6 5\n0 0 0 0 0 0\n'] Demo Output: ['1\n', '0\n', '2\n'] Note: In the first sample only one team could be made: the first, the fourth and the fifth participants. In the second sample no teams could be created. In the third sample two teams could be created. Any partition into two teams fits.
```python n, k = map(int, input().split()) ps = list(map(int, input().split())) teams = 0 for count in ps: if 5 - count >= k: teams += 1 ms = teams // 3 print(ms) ```
3
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,613,245,758
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
1
218
0
# INPUT: # HoUse # OUTPUT: # house word= input() l=0 u=0 for i in word: if i>='a' : l+=1 else: u+=1 if l>u: print(word.lower()) elif l==u: print(word.upper())
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python # INPUT: # HoUse # OUTPUT: # house word= input() l=0 u=0 for i in word: if i>='a' : l+=1 else: u+=1 if l>u: print(word.lower()) elif l==u: print(word.upper()) ```
0
69
A
Young Physicist
PROGRAMMING
1,000
[ "implementation", "math" ]
A. Young Physicist
2
256
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
[ "3\n4 1 7\n-2 4 -1\n1 -5 -3\n", "3\n3 -1 7\n-5 2 -4\n2 -1 -3\n" ]
[ "NO", "YES" ]
none
500
[ { "input": "3\n4 1 7\n-2 4 -1\n1 -5 -3", "output": "NO" }, { "input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3", "output": "YES" }, { "input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41", "output": "NO" }, { "input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33", "output": "NO" }, { "input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7", "output": "NO" }, { "input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38", "output": "NO" }, { "input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6", "output": "YES" }, { "input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0", "output": "YES" }, { "input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0", "output": "YES" }, { "input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0", "output": "YES" }, { "input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0", "output": "YES" }, { "input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0", "output": "YES" }, { "input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87", "output": "YES" }, { "input": "3\n1 2 3\n3 2 1\n0 0 0", "output": "NO" }, { "input": "2\n5 -23 12\n0 0 0", "output": "NO" }, { "input": "1\n0 0 0", "output": "YES" }, { "input": "1\n1 -2 0", "output": "NO" }, { "input": "2\n-23 77 -86\n23 -77 86", "output": "YES" }, { "input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82", "output": "YES" }, { "input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0", "output": "YES" }, { "input": "3\n96 49 -12\n2 -66 28\n-98 17 -16", "output": "YES" }, { "input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0", "output": "YES" }, { "input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53", "output": "YES" }, { "input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1", "output": "YES" }, { "input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0", "output": "YES" }, { "input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0", "output": "YES" }, { "input": "3\n0 2 -2\n1 -1 3\n-3 0 0", "output": "NO" } ]
1,546,745,837
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
156
0
#We take the number of points in the space and store it as ninputs and convert it into integer because input() take inputs as strings ninputs = int(input()) #Now we declare three variables xsum, ysum, zsum which store thesum of x, y , z coordinates. Can also be declared in the same line xsum = 0 ysum = 0 zsum = 0 #We take the ordinate values using a while loop while ninputs > 0: #We take the inputs for the first point in space xordinate, yordinate, zordinate = int(input()), int(input()), int(input()) #Adding the ordinate values xsum += xordinate ysum += yordinate zsum += zordinate #Decrementing the value of ninputs to prevent an infinite loop ninputs -= 1 #Checking for the main test condition if xsum == 0 and ysum == 0 and zsum == 0: print("YES") else: print("NO")
Title: Young Physicist Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. Input Specification: The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). Output Specification: Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. Demo Input: ['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n'] Demo Output: ['NO', 'YES'] Note: none
```python #We take the number of points in the space and store it as ninputs and convert it into integer because input() take inputs as strings ninputs = int(input()) #Now we declare three variables xsum, ysum, zsum which store thesum of x, y , z coordinates. Can also be declared in the same line xsum = 0 ysum = 0 zsum = 0 #We take the ordinate values using a while loop while ninputs > 0: #We take the inputs for the first point in space xordinate, yordinate, zordinate = int(input()), int(input()), int(input()) #Adding the ordinate values xsum += xordinate ysum += yordinate zsum += zordinate #Decrementing the value of ninputs to prevent an infinite loop ninputs -= 1 #Checking for the main test condition if xsum == 0 and ysum == 0 and zsum == 0: print("YES") else: print("NO") ```
-1
535
B
Tavas and SaDDas
PROGRAMMING
1,100
[ "bitmasks", "brute force", "combinatorics", "implementation" ]
null
null
Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you." The problem is: You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. If we sort all lucky numbers in increasing order, what's the 1-based index of *n*? Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back.
The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109).
Print the index of *n* among all lucky numbers.
[ "4\n", "7\n", "77\n" ]
[ "1\n", "2\n", "6\n" ]
none
1,000
[ { "input": "4", "output": "1" }, { "input": "7", "output": "2" }, { "input": "77", "output": "6" }, { "input": "4", "output": "1" }, { "input": "474744", "output": "83" }, { "input": "777774", "output": "125" }, { "input": "447", "output": "8" }, { "input": "774", "output": "13" }, { "input": "4", "output": "1" }, { "input": "4447747", "output": "140" }, { "input": "7747474", "output": "233" }, { "input": "4444", "output": "15" }, { "input": "4447", "output": "16" }, { "input": "7", "output": "2" }, { "input": "4", "output": "1" }, { "input": "4447744", "output": "139" }, { "input": "77474", "output": "57" }, { "input": "7747", "output": "28" }, { "input": "444", "output": "7" }, { "input": "7", "output": "2" }, { "input": "7774477", "output": "242" }, { "input": "4477774", "output": "157" }, { "input": "7444", "output": "23" }, { "input": "7474747", "output": "212" }, { "input": "77", "output": "6" }, { "input": "774477", "output": "114" }, { "input": "7", "output": "2" }, { "input": "47", "output": "4" }, { "input": "747777", "output": "110" }, { "input": "444444444", "output": "511" }, { "input": "777777777", "output": "1022" }, { "input": "477477447", "output": "728" }, { "input": "777744747", "output": "996" } ]
1,597,848,195
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
93
0
num = stdin.readline().split() # num = '74' n = len(num) # ans = 1 # for x in n: # ans = 2 * ans + (1 if x == '7' else 0) # print(ans) start = 0 end = n-1 ans = (1 << n)-2 while end >= 0: if num[end] == '7': ans += (1 << start) end -= 1 start += 1 print(ans+1)
Title: Tavas and SaDDas Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you." The problem is: You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. If we sort all lucky numbers in increasing order, what's the 1-based index of *n*? Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back. Input Specification: The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109). Output Specification: Print the index of *n* among all lucky numbers. Demo Input: ['4\n', '7\n', '77\n'] Demo Output: ['1\n', '2\n', '6\n'] Note: none
```python num = stdin.readline().split() # num = '74' n = len(num) # ans = 1 # for x in n: # ans = 2 * ans + (1 if x == '7' else 0) # print(ans) start = 0 end = n-1 ans = (1 << n)-2 while end >= 0: if num[end] == '7': ans += (1 << start) end -= 1 start += 1 print(ans+1) ```
-1
609
A
USB Flash Drives
PROGRAMMING
800
[ "greedy", "implementation", "sortings" ]
null
null
Sean is trying to save a large file to a USB flash drive. He has *n* USB flash drives with capacities equal to *a*1,<=*a*2,<=...,<=*a**n* megabytes. The file size is equal to *m* megabytes. Find the minimum number of USB flash drives needed to write Sean's file, if he can split the file between drives.
The first line contains positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of USB flash drives. The second line contains positive integer *m* (1<=≤<=*m*<=≤<=105) — the size of Sean's file. Each of the next *n* lines contains positive integer *a**i* (1<=≤<=*a**i*<=≤<=1000) — the sizes of USB flash drives in megabytes. It is guaranteed that the answer exists, i. e. the sum of all *a**i* is not less than *m*.
Print the minimum number of USB flash drives to write Sean's file, if he can split the file between drives.
[ "3\n5\n2\n1\n3\n", "3\n6\n2\n3\n2\n", "2\n5\n5\n10\n" ]
[ "2\n", "3\n", "1\n" ]
In the first example Sean needs only two USB flash drives — the first and the third. In the second example Sean needs all three USB flash drives. In the third example Sean needs only one USB flash drive and he can use any available USB flash drive — the first or the second.
0
[ { "input": "3\n5\n2\n1\n3", "output": "2" }, { "input": "3\n6\n2\n3\n2", "output": "3" }, { "input": "2\n5\n5\n10", "output": "1" }, { "input": "5\n16\n8\n1\n3\n4\n9", "output": "2" }, { "input": "10\n121\n10\n37\n74\n56\n42\n39\n6\n68\n8\n100", "output": "2" }, { "input": "12\n4773\n325\n377\n192\n780\n881\n816\n839\n223\n215\n125\n952\n8", "output": "7" }, { "input": "15\n7758\n182\n272\n763\n910\n24\n359\n583\n890\n735\n819\n66\n992\n440\n496\n227", "output": "15" }, { "input": "30\n70\n6\n2\n10\n4\n7\n10\n5\n1\n8\n10\n4\n3\n5\n9\n3\n6\n6\n4\n2\n6\n5\n10\n1\n9\n7\n2\n1\n10\n7\n5", "output": "8" }, { "input": "40\n15705\n702\n722\n105\n873\n417\n477\n794\n300\n869\n496\n572\n232\n456\n298\n473\n584\n486\n713\n934\n121\n303\n956\n934\n840\n358\n201\n861\n497\n131\n312\n957\n96\n914\n509\n60\n300\n722\n658\n820\n103", "output": "21" }, { "input": "50\n18239\n300\n151\n770\n9\n200\n52\n247\n753\n523\n263\n744\n463\n540\n244\n608\n569\n771\n32\n425\n777\n624\n761\n628\n124\n405\n396\n726\n626\n679\n237\n229\n49\n512\n18\n671\n290\n768\n632\n739\n18\n136\n413\n117\n83\n413\n452\n767\n664\n203\n404", "output": "31" }, { "input": "70\n149\n5\n3\n3\n4\n6\n1\n2\n9\n8\n3\n1\n8\n4\n4\n3\n6\n10\n7\n1\n10\n8\n4\n9\n3\n8\n3\n2\n5\n1\n8\n6\n9\n10\n4\n8\n6\n9\n9\n9\n3\n4\n2\n2\n5\n8\n9\n1\n10\n3\n4\n3\n1\n9\n3\n5\n1\n3\n7\n6\n9\n8\n9\n1\n7\n4\n4\n2\n3\n5\n7", "output": "17" }, { "input": "70\n2731\n26\n75\n86\n94\n37\n25\n32\n35\n92\n1\n51\n73\n53\n66\n16\n80\n15\n81\n100\n87\n55\n48\n30\n71\n39\n87\n77\n25\n70\n22\n75\n23\n97\n16\n75\n95\n61\n61\n28\n10\n78\n54\n80\n51\n25\n24\n90\n58\n4\n77\n40\n54\n53\n47\n62\n30\n38\n71\n97\n71\n60\n58\n1\n21\n15\n55\n99\n34\n88\n99", "output": "35" }, { "input": "70\n28625\n34\n132\n181\n232\n593\n413\n862\n887\n808\n18\n35\n89\n356\n640\n339\n280\n975\n82\n345\n398\n948\n372\n91\n755\n75\n153\n948\n603\n35\n694\n722\n293\n363\n884\n264\n813\n175\n169\n646\n138\n449\n488\n828\n417\n134\n84\n763\n288\n845\n801\n556\n972\n332\n564\n934\n699\n842\n942\n644\n203\n406\n140\n37\n9\n423\n546\n675\n491\n113\n587", "output": "45" }, { "input": "80\n248\n3\n9\n4\n5\n10\n7\n2\n6\n2\n2\n8\n2\n1\n3\n7\n9\n2\n8\n4\n4\n8\n5\n4\n4\n10\n2\n1\n4\n8\n4\n10\n1\n2\n10\n2\n3\n3\n1\n1\n8\n9\n5\n10\n2\n8\n10\n5\n3\n6\n1\n7\n8\n9\n10\n5\n10\n10\n2\n10\n1\n2\n4\n1\n9\n4\n7\n10\n8\n5\n8\n1\n4\n2\n2\n3\n9\n9\n9\n10\n6", "output": "27" }, { "input": "80\n2993\n18\n14\n73\n38\n14\n73\n77\n18\n81\n6\n96\n65\n77\n86\n76\n8\n16\n81\n83\n83\n34\n69\n58\n15\n19\n1\n16\n57\n95\n35\n5\n49\n8\n15\n47\n84\n99\n94\n93\n55\n43\n47\n51\n61\n57\n13\n7\n92\n14\n4\n83\n100\n60\n75\n41\n95\n74\n40\n1\n4\n95\n68\n59\n65\n15\n15\n75\n85\n46\n77\n26\n30\n51\n64\n75\n40\n22\n88\n68\n24", "output": "38" }, { "input": "80\n37947\n117\n569\n702\n272\n573\n629\n90\n337\n673\n589\n576\n205\n11\n284\n645\n719\n777\n271\n567\n466\n251\n402\n3\n97\n288\n699\n208\n173\n530\n782\n266\n395\n957\n159\n463\n43\n316\n603\n197\n386\n132\n799\n778\n905\n784\n71\n851\n963\n883\n705\n454\n275\n425\n727\n223\n4\n870\n833\n431\n463\n85\n505\n800\n41\n954\n981\n242\n578\n336\n48\n858\n702\n349\n929\n646\n528\n993\n506\n274\n227", "output": "70" }, { "input": "90\n413\n5\n8\n10\n7\n5\n7\n5\n7\n1\n7\n8\n4\n3\n9\n4\n1\n10\n3\n1\n10\n9\n3\n1\n8\n4\n7\n5\n2\n9\n3\n10\n10\n3\n6\n3\n3\n10\n7\n5\n1\n1\n2\n4\n8\n2\n5\n5\n3\n9\n5\n5\n3\n10\n2\n3\n8\n5\n9\n1\n3\n6\n5\n9\n2\n3\n7\n10\n3\n4\n4\n1\n5\n9\n2\n6\n9\n1\n1\n9\n9\n7\n7\n7\n8\n4\n5\n3\n4\n6\n9", "output": "59" }, { "input": "90\n4226\n33\n43\n83\n46\n75\n14\n88\n36\n8\n25\n47\n4\n96\n19\n33\n49\n65\n17\n59\n72\n1\n55\n94\n92\n27\n33\n39\n14\n62\n79\n12\n89\n22\n86\n13\n19\n77\n53\n96\n74\n24\n25\n17\n64\n71\n81\n87\n52\n72\n55\n49\n74\n36\n65\n86\n91\n33\n61\n97\n38\n87\n61\n14\n73\n95\n43\n67\n42\n67\n22\n12\n62\n32\n96\n24\n49\n82\n46\n89\n36\n75\n91\n11\n10\n9\n33\n86\n28\n75\n39", "output": "64" }, { "input": "90\n40579\n448\n977\n607\n745\n268\n826\n479\n59\n330\n609\n43\n301\n970\n726\n172\n632\n600\n181\n712\n195\n491\n312\n849\n722\n679\n682\n780\n131\n404\n293\n387\n567\n660\n54\n339\n111\n833\n612\n911\n869\n356\n884\n635\n126\n639\n712\n473\n663\n773\n435\n32\n973\n484\n662\n464\n699\n274\n919\n95\n904\n253\n589\n543\n454\n250\n349\n237\n829\n511\n536\n36\n45\n152\n626\n384\n199\n877\n941\n84\n781\n115\n20\n52\n726\n751\n920\n291\n571\n6\n199", "output": "64" }, { "input": "100\n66\n7\n9\n10\n5\n2\n8\n6\n5\n4\n10\n10\n6\n5\n2\n2\n1\n1\n5\n8\n7\n8\n10\n5\n6\n6\n5\n9\n9\n6\n3\n8\n7\n10\n5\n9\n6\n7\n3\n5\n8\n6\n8\n9\n1\n1\n1\n2\n4\n5\n5\n1\n1\n2\n6\n7\n1\n5\n8\n7\n2\n1\n7\n10\n9\n10\n2\n4\n10\n4\n10\n10\n5\n3\n9\n1\n2\n1\n10\n5\n1\n7\n4\n4\n5\n7\n6\n10\n4\n7\n3\n4\n3\n6\n2\n5\n2\n4\n9\n5\n3", "output": "7" }, { "input": "100\n4862\n20\n47\n85\n47\n76\n38\n48\n93\n91\n81\n31\n51\n23\n60\n59\n3\n73\n72\n57\n67\n54\n9\n42\n5\n32\n46\n72\n79\n95\n61\n79\n88\n33\n52\n97\n10\n3\n20\n79\n82\n93\n90\n38\n80\n18\n21\n43\n60\n73\n34\n75\n65\n10\n84\n100\n29\n94\n56\n22\n59\n95\n46\n22\n57\n69\n67\n90\n11\n10\n61\n27\n2\n48\n69\n86\n91\n69\n76\n36\n71\n18\n54\n90\n74\n69\n50\n46\n8\n5\n41\n96\n5\n14\n55\n85\n39\n6\n79\n75\n87", "output": "70" }, { "input": "100\n45570\n14\n881\n678\n687\n993\n413\n760\n451\n426\n787\n503\n343\n234\n530\n294\n725\n941\n524\n574\n441\n798\n399\n360\n609\n376\n525\n229\n995\n478\n347\n47\n23\n468\n525\n749\n601\n235\n89\n995\n489\n1\n239\n415\n122\n671\n128\n357\n886\n401\n964\n212\n968\n210\n130\n871\n360\n661\n844\n414\n187\n21\n824\n266\n713\n126\n496\n916\n37\n193\n755\n894\n641\n300\n170\n176\n383\n488\n627\n61\n897\n33\n242\n419\n881\n698\n107\n391\n418\n774\n905\n87\n5\n896\n835\n318\n373\n916\n393\n91\n460", "output": "78" }, { "input": "100\n522\n1\n5\n2\n4\n2\n6\n3\n4\n2\n10\n10\n6\n7\n9\n7\n1\n7\n2\n5\n3\n1\n5\n2\n3\n5\n1\n7\n10\n10\n4\n4\n10\n9\n10\n6\n2\n8\n2\n6\n10\n9\n2\n7\n5\n9\n4\n6\n10\n7\n3\n1\n1\n9\n5\n10\n9\n2\n8\n3\n7\n5\n4\n7\n5\n9\n10\n6\n2\n9\n2\n5\n10\n1\n7\n7\n10\n5\n6\n2\n9\n4\n7\n10\n10\n8\n3\n4\n9\n3\n6\n9\n10\n2\n9\n9\n3\n4\n1\n10\n2", "output": "74" }, { "input": "100\n32294\n414\n116\n131\n649\n130\n476\n630\n605\n213\n117\n757\n42\n109\n85\n127\n635\n629\n994\n410\n764\n204\n161\n231\n577\n116\n936\n537\n565\n571\n317\n722\n819\n229\n284\n487\n649\n304\n628\n727\n816\n854\n91\n111\n549\n87\n374\n417\n3\n868\n882\n168\n743\n77\n534\n781\n75\n956\n910\n734\n507\n568\n802\n946\n891\n659\n116\n678\n375\n380\n430\n627\n873\n350\n930\n285\n6\n183\n96\n517\n81\n794\n235\n360\n551\n6\n28\n799\n226\n996\n894\n981\n551\n60\n40\n460\n479\n161\n318\n952\n433", "output": "42" }, { "input": "100\n178\n71\n23\n84\n98\n8\n14\n4\n42\n56\n83\n87\n28\n22\n32\n50\n5\n96\n90\n1\n59\n74\n56\n96\n77\n88\n71\n38\n62\n36\n85\n1\n97\n98\n98\n32\n99\n42\n6\n81\n20\n49\n57\n71\n66\n9\n45\n41\n29\n28\n32\n68\n38\n29\n35\n29\n19\n27\n76\n85\n68\n68\n41\n32\n78\n72\n38\n19\n55\n83\n83\n25\n46\n62\n48\n26\n53\n14\n39\n31\n94\n84\n22\n39\n34\n96\n63\n37\n42\n6\n78\n76\n64\n16\n26\n6\n79\n53\n24\n29\n63", "output": "2" }, { "input": "100\n885\n226\n266\n321\n72\n719\n29\n121\n533\n85\n672\n225\n830\n783\n822\n30\n791\n618\n166\n487\n922\n434\n814\n473\n5\n741\n947\n910\n305\n998\n49\n945\n588\n868\n809\n803\n168\n280\n614\n434\n634\n538\n591\n437\n540\n445\n313\n177\n171\n799\n778\n55\n617\n554\n583\n611\n12\n94\n599\n182\n765\n556\n965\n542\n35\n460\n177\n313\n485\n744\n384\n21\n52\n879\n792\n411\n614\n811\n565\n695\n428\n587\n631\n794\n461\n258\n193\n696\n936\n646\n756\n267\n55\n690\n730\n742\n734\n988\n235\n762\n440", "output": "1" }, { "input": "100\n29\n9\n2\n10\n8\n6\n7\n7\n3\n3\n10\n4\n5\n2\n5\n1\n6\n3\n2\n5\n10\n10\n9\n1\n4\n5\n2\n2\n3\n1\n2\n2\n9\n6\n9\n7\n8\n8\n1\n5\n5\n3\n1\n5\n6\n1\n9\n2\n3\n8\n10\n8\n3\n2\n7\n1\n2\n1\n2\n8\n10\n5\n2\n3\n1\n10\n7\n1\n7\n4\n9\n6\n6\n4\n7\n1\n2\n7\n7\n9\n9\n7\n10\n4\n10\n8\n2\n1\n5\n5\n10\n5\n8\n1\n5\n6\n5\n1\n5\n6\n8", "output": "3" }, { "input": "100\n644\n94\n69\n43\n36\n54\n93\n30\n74\n56\n95\n70\n49\n11\n36\n57\n30\n59\n3\n52\n59\n90\n82\n39\n67\n32\n8\n80\n64\n8\n65\n51\n48\n89\n90\n35\n4\n54\n66\n96\n68\n90\n30\n4\n13\n97\n41\n90\n85\n17\n45\n94\n31\n58\n4\n39\n76\n95\n92\n59\n67\n46\n96\n55\n82\n64\n20\n20\n83\n46\n37\n15\n60\n37\n79\n45\n47\n63\n73\n76\n31\n52\n36\n32\n49\n26\n61\n91\n31\n25\n62\n90\n65\n65\n5\n94\n7\n15\n97\n88\n68", "output": "7" }, { "input": "100\n1756\n98\n229\n158\n281\n16\n169\n149\n239\n235\n182\n147\n215\n49\n270\n194\n242\n295\n289\n249\n19\n12\n144\n157\n92\n270\n122\n212\n97\n152\n14\n42\n12\n198\n98\n295\n154\n229\n191\n294\n5\n156\n43\n185\n184\n20\n125\n23\n10\n257\n244\n264\n79\n46\n277\n13\n22\n97\n212\n77\n293\n20\n51\n17\n109\n37\n68\n117\n51\n248\n10\n149\n179\n192\n239\n161\n13\n173\n297\n73\n43\n109\n288\n198\n81\n70\n254\n187\n277\n1\n295\n113\n95\n291\n293\n119\n205\n191\n37\n34\n116", "output": "6" }, { "input": "100\n20562\n721\n452\n11\n703\n376\n183\n197\n203\n406\n642\n346\n446\n256\n760\n201\n360\n702\n707\n388\n779\n653\n610\n497\n768\n670\n134\n780\n306\n661\n180\n259\n256\n362\n6\n121\n415\n747\n170\n67\n439\n728\n193\n622\n481\n38\n225\n343\n303\n253\n436\n305\n68\n794\n247\n291\n600\n750\n188\n199\n757\n28\n776\n749\n253\n351\n53\n629\n129\n578\n209\n89\n651\n262\n638\n353\n469\n31\n144\n460\n176\n535\n562\n366\n639\n234\n577\n364\n761\n617\n303\n450\n778\n311\n289\n221\n274\n239\n626\n194\n36", "output": "30" }, { "input": "100\n32630\n548\n21\n756\n138\n56\n719\n97\n86\n599\n531\n464\n137\n737\n239\n626\n179\n170\n271\n335\n178\n298\n597\n616\n104\n190\n216\n333\n606\n621\n310\n70\n286\n593\n655\n472\n556\n77\n625\n744\n395\n487\n762\n316\n469\n258\n475\n596\n651\n180\n737\n101\n511\n708\n163\n713\n475\n557\n649\n705\n583\n97\n447\n119\n91\n372\n194\n394\n667\n384\n635\n611\n746\n758\n613\n54\n508\n405\n188\n570\n254\n28\n599\n767\n115\n737\n194\n148\n686\n705\n236\n762\n613\n770\n633\n401\n773\n448\n274\n141\n718", "output": "52" }, { "input": "1\n1\n1", "output": "1" } ]
1,615,988,207
2,147,483,647
Python 3
OK
TESTS
34
77
0
if __name__ == '__main__': n = int(input()) m = int(input()) aa = [] for _ in range(n): aa.append(int(input())) for key, val in enumerate(sorted(aa, reverse=True)): m -= val if m <= 0: print(key + 1) break
Title: USB Flash Drives Time Limit: None seconds Memory Limit: None megabytes Problem Description: Sean is trying to save a large file to a USB flash drive. He has *n* USB flash drives with capacities equal to *a*1,<=*a*2,<=...,<=*a**n* megabytes. The file size is equal to *m* megabytes. Find the minimum number of USB flash drives needed to write Sean's file, if he can split the file between drives. Input Specification: The first line contains positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of USB flash drives. The second line contains positive integer *m* (1<=≤<=*m*<=≤<=105) — the size of Sean's file. Each of the next *n* lines contains positive integer *a**i* (1<=≤<=*a**i*<=≤<=1000) — the sizes of USB flash drives in megabytes. It is guaranteed that the answer exists, i. e. the sum of all *a**i* is not less than *m*. Output Specification: Print the minimum number of USB flash drives to write Sean's file, if he can split the file between drives. Demo Input: ['3\n5\n2\n1\n3\n', '3\n6\n2\n3\n2\n', '2\n5\n5\n10\n'] Demo Output: ['2\n', '3\n', '1\n'] Note: In the first example Sean needs only two USB flash drives — the first and the third. In the second example Sean needs all three USB flash drives. In the third example Sean needs only one USB flash drive and he can use any available USB flash drive — the first or the second.
```python if __name__ == '__main__': n = int(input()) m = int(input()) aa = [] for _ in range(n): aa.append(int(input())) for key, val in enumerate(sorted(aa, reverse=True)): m -= val if m <= 0: print(key + 1) break ```
3
318
A
Even Odds
PROGRAMMING
900
[ "math" ]
null
null
Being a nonconformist, Volodya is displeased with the current state of things, particularly with the order of natural numbers (natural number is positive integer number). He is determined to rearrange them. But there are too many natural numbers, so Volodya decided to start with the first *n*. He writes down the following sequence of numbers: firstly all odd integers from 1 to *n* (in ascending order), then all even integers from 1 to *n* (also in ascending order). Help our hero to find out which number will stand at the position number *k*.
The only line of input contains integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1012). Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
Print the number that will stand at the position number *k* after Volodya's manipulations.
[ "10 3\n", "7 7\n" ]
[ "5", "6" ]
In the first sample Volodya's sequence will look like this: {1, 3, 5, 7, 9, 2, 4, 6, 8, 10}. The third place in the sequence is therefore occupied by the number 5.
500
[ { "input": "10 3", "output": "5" }, { "input": "7 7", "output": "6" }, { "input": "7 1", "output": "1" }, { "input": "7 2", "output": "3" }, { "input": "8 5", "output": "2" }, { "input": "8 3", "output": "5" }, { "input": "8 4", "output": "7" }, { "input": "1000000000000 500000000001", "output": "2" }, { "input": "999999999997 499999999999", "output": "999999999997" }, { "input": "999999999999 999999999999", "output": "999999999998" }, { "input": "1000000000000 1", "output": "1" }, { "input": "999999999999 1", "output": "1" }, { "input": "1 1", "output": "1" }, { "input": "1000000000000 1000000000000", "output": "1000000000000" }, { "input": "1000000000000 500000000000", "output": "999999999999" }, { "input": "1000000000000 499999999999", "output": "999999999997" }, { "input": "999999999997 499999999998", "output": "999999999995" }, { "input": "619234238 556154835", "output": "493075432" }, { "input": "38151981 36650624", "output": "35149266" }, { "input": "680402465 442571217", "output": "204739968" }, { "input": "109135284 9408714", "output": "18817427" }, { "input": "603701841 56038951", "output": "112077901" }, { "input": "356764822 321510177", "output": "286255532" }, { "input": "284911189 142190783", "output": "284381565" }, { "input": "91028405 61435545", "output": "31842684" } ]
1,697,400,615
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
4
62
0
input_str = input() n,k = map(int,input_str.split()) if (n%2 == 1): num_odd = (n+1)//2 num_even = n - num_odd else: num_even= (n)/2 num_odd = n - num_even if (k>num_odd): print(2*(k-num_odd)) else: print((2*k)-1)
Title: Even Odds Time Limit: None seconds Memory Limit: None megabytes Problem Description: Being a nonconformist, Volodya is displeased with the current state of things, particularly with the order of natural numbers (natural number is positive integer number). He is determined to rearrange them. But there are too many natural numbers, so Volodya decided to start with the first *n*. He writes down the following sequence of numbers: firstly all odd integers from 1 to *n* (in ascending order), then all even integers from 1 to *n* (also in ascending order). Help our hero to find out which number will stand at the position number *k*. Input Specification: The only line of input contains integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1012). Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier. Output Specification: Print the number that will stand at the position number *k* after Volodya's manipulations. Demo Input: ['10 3\n', '7 7\n'] Demo Output: ['5', '6'] Note: In the first sample Volodya's sequence will look like this: {1, 3, 5, 7, 9, 2, 4, 6, 8, 10}. The third place in the sequence is therefore occupied by the number 5.
```python input_str = input() n,k = map(int,input_str.split()) if (n%2 == 1): num_odd = (n+1)//2 num_even = n - num_odd else: num_even= (n)/2 num_odd = n - num_even if (k>num_odd): print(2*(k-num_odd)) else: print((2*k)-1) ```
0
876
A
Trip For Meal
PROGRAMMING
900
[ "math" ]
null
null
Winnie-the-Pooh likes honey very much! That is why he decided to visit his friends. Winnie has got three best friends: Rabbit, Owl and Eeyore, each of them lives in his own house. There are winding paths between each pair of houses. The length of a path between Rabbit's and Owl's houses is *a* meters, between Rabbit's and Eeyore's house is *b* meters, between Owl's and Eeyore's house is *c* meters. For enjoying his life and singing merry songs Winnie-the-Pooh should have a meal *n* times a day. Now he is in the Rabbit's house and has a meal for the first time. Each time when in the friend's house where Winnie is now the supply of honey is about to end, Winnie leaves that house. If Winnie has not had a meal the required amount of times, he comes out from the house and goes to someone else of his two friends. For this he chooses one of two adjacent paths, arrives to the house on the other end and visits his friend. You may assume that when Winnie is eating in one of his friend's house, the supply of honey in other friend's houses recover (most probably, they go to the supply store). Winnie-the-Pooh does not like physical activity. He wants to have a meal *n* times, traveling minimum possible distance. Help him to find this distance.
First line contains an integer *n* (1<=≤<=*n*<=≤<=100) — number of visits. Second line contains an integer *a* (1<=≤<=*a*<=≤<=100) — distance between Rabbit's and Owl's houses. Third line contains an integer *b* (1<=≤<=*b*<=≤<=100) — distance between Rabbit's and Eeyore's houses. Fourth line contains an integer *c* (1<=≤<=*c*<=≤<=100) — distance between Owl's and Eeyore's houses.
Output one number — minimum distance in meters Winnie must go through to have a meal *n* times.
[ "3\n2\n3\n1\n", "1\n2\n3\n5\n" ]
[ "3\n", "0\n" ]
In the first test case the optimal path for Winnie is the following: first have a meal in Rabbit's house, then in Owl's house, then in Eeyore's house. Thus he will pass the distance 2 + 1 = 3. In the second test case Winnie has a meal in Rabbit's house and that is for him. So he doesn't have to walk anywhere at all.
500
[ { "input": "3\n2\n3\n1", "output": "3" }, { "input": "1\n2\n3\n5", "output": "0" }, { "input": "10\n1\n8\n3", "output": "9" }, { "input": "7\n10\n5\n6", "output": "30" }, { "input": "9\n9\n7\n5", "output": "42" }, { "input": "9\n37\n85\n76", "output": "296" }, { "input": "76\n46\n77\n11", "output": "860" }, { "input": "80\n42\n1\n37", "output": "79" }, { "input": "8\n80\n55\n1", "output": "61" }, { "input": "10\n13\n72\n17", "output": "117" }, { "input": "9\n24\n1\n63", "output": "8" }, { "input": "65\n5\n8\n7", "output": "320" }, { "input": "56\n8\n9\n3", "output": "170" }, { "input": "59\n8\n1\n2", "output": "58" }, { "input": "75\n50\n50\n5", "output": "415" }, { "input": "75\n54\n76\n66", "output": "3996" }, { "input": "73\n71\n69\n66", "output": "4755" }, { "input": "83\n58\n88\n16", "output": "1354" }, { "input": "74\n31\n11\n79", "output": "803" }, { "input": "62\n27\n16\n72", "output": "976" }, { "input": "72\n95\n27\n9", "output": "657" }, { "input": "1\n2\n2\n1", "output": "0" }, { "input": "1\n1\n1\n1", "output": "0" }, { "input": "1\n1\n1\n99", "output": "0" }, { "input": "100\n100\n100\n100", "output": "9900" }, { "input": "2\n1\n1\n3", "output": "1" }, { "input": "1\n3\n2\n1", "output": "0" }, { "input": "1\n5\n6\n1", "output": "0" }, { "input": "1\n2\n6\n1", "output": "0" }, { "input": "1\n30\n20\n1", "output": "0" }, { "input": "1\n15\n13\n11", "output": "0" }, { "input": "1\n100\n50\n1", "output": "0" }, { "input": "1\n2\n3\n1", "output": "0" }, { "input": "5\n5\n5\n5", "output": "20" }, { "input": "1\n100\n50\n5", "output": "0" }, { "input": "1\n5\n7\n3", "output": "0" }, { "input": "1\n3\n4\n2", "output": "0" }, { "input": "3\n3\n3\n3", "output": "6" }, { "input": "1\n99\n98\n1", "output": "0" }, { "input": "5\n3\n3\n1", "output": "6" }, { "input": "2\n1\n1\n1", "output": "1" }, { "input": "2\n1\n7\n8", "output": "1" }, { "input": "2\n2\n2\n1", "output": "2" }, { "input": "2\n2\n3\n1", "output": "2" }, { "input": "1\n5\n6\n2", "output": "0" }, { "input": "100\n1\n1\n100", "output": "99" }, { "input": "2\n3\n2\n1", "output": "2" }, { "input": "1\n99\n98\n97", "output": "0" } ]
1,550,513,399
2,147,483,647
Python 3
OK
TESTS
48
109
0
def food(n, a, b, c): if n == 1: return 0 result = 0 n -= 1 if a > b: result += b n -= 1 if b > c and n > 0: result += n * c else: result += n * b else: result += a n -= 1 if a > c and n > 0: result += n * c else: result += n * a return result N = int(input()) A = int(input()) B = int(input()) C = int(input()) print(food(N, A, B, C))
Title: Trip For Meal Time Limit: None seconds Memory Limit: None megabytes Problem Description: Winnie-the-Pooh likes honey very much! That is why he decided to visit his friends. Winnie has got three best friends: Rabbit, Owl and Eeyore, each of them lives in his own house. There are winding paths between each pair of houses. The length of a path between Rabbit's and Owl's houses is *a* meters, between Rabbit's and Eeyore's house is *b* meters, between Owl's and Eeyore's house is *c* meters. For enjoying his life and singing merry songs Winnie-the-Pooh should have a meal *n* times a day. Now he is in the Rabbit's house and has a meal for the first time. Each time when in the friend's house where Winnie is now the supply of honey is about to end, Winnie leaves that house. If Winnie has not had a meal the required amount of times, he comes out from the house and goes to someone else of his two friends. For this he chooses one of two adjacent paths, arrives to the house on the other end and visits his friend. You may assume that when Winnie is eating in one of his friend's house, the supply of honey in other friend's houses recover (most probably, they go to the supply store). Winnie-the-Pooh does not like physical activity. He wants to have a meal *n* times, traveling minimum possible distance. Help him to find this distance. Input Specification: First line contains an integer *n* (1<=≤<=*n*<=≤<=100) — number of visits. Second line contains an integer *a* (1<=≤<=*a*<=≤<=100) — distance between Rabbit's and Owl's houses. Third line contains an integer *b* (1<=≤<=*b*<=≤<=100) — distance between Rabbit's and Eeyore's houses. Fourth line contains an integer *c* (1<=≤<=*c*<=≤<=100) — distance between Owl's and Eeyore's houses. Output Specification: Output one number — minimum distance in meters Winnie must go through to have a meal *n* times. Demo Input: ['3\n2\n3\n1\n', '1\n2\n3\n5\n'] Demo Output: ['3\n', '0\n'] Note: In the first test case the optimal path for Winnie is the following: first have a meal in Rabbit's house, then in Owl's house, then in Eeyore's house. Thus he will pass the distance 2 + 1 = 3. In the second test case Winnie has a meal in Rabbit's house and that is for him. So he doesn't have to walk anywhere at all.
```python def food(n, a, b, c): if n == 1: return 0 result = 0 n -= 1 if a > b: result += b n -= 1 if b > c and n > 0: result += n * c else: result += n * b else: result += a n -= 1 if a > c and n > 0: result += n * c else: result += n * a return result N = int(input()) A = int(input()) B = int(input()) C = int(input()) print(food(N, A, B, C)) ```
3
157
B
Trace
PROGRAMMING
1,000
[ "geometry", "sortings" ]
null
null
One day, as Sherlock Holmes was tracking down one very important criminal, he found a wonderful painting on the wall. This wall could be represented as a plane. The painting had several concentric circles that divided the wall into several parts. Some parts were painted red and all the other were painted blue. Besides, any two neighboring parts were painted different colors, that is, the red and the blue color were alternating, i. e. followed one after the other. The outer area of the wall (the area that lied outside all circles) was painted blue. Help Sherlock Holmes determine the total area of red parts of the wall. Let us remind you that two circles are called concentric if their centers coincide. Several circles are called concentric if any two of them are concentric.
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=100). The second line contains *n* space-separated integers *r**i* (1<=≤<=*r**i*<=≤<=1000) — the circles' radii. It is guaranteed that all circles are different.
Print the single real number — total area of the part of the wall that is painted red. The answer is accepted if absolute or relative error doesn't exceed 10<=-<=4.
[ "1\n1\n", "3\n1 4 2\n" ]
[ "3.1415926536\n", "40.8407044967\n" ]
In the first sample the picture is just one circle of radius 1. Inner part of the circle is painted red. The area of the red part equals π × 1<sup class="upper-index">2</sup> = π. In the second sample there are three circles of radii 1, 4 and 2. Outside part of the second circle is painted blue. Part between the second and the third circles is painted red. Part between the first and the third is painted blue. And, finally, the inner part of the first circle is painted red. Overall there are two red parts: the ring between the second and the third circles and the inner part of the first circle. Total area of the red parts is equal (π × 4<sup class="upper-index">2</sup> - π × 2<sup class="upper-index">2</sup>) + π × 1<sup class="upper-index">2</sup> = π × 12 + π = 13π
1,000
[ { "input": "1\n1", "output": "3.1415926536" }, { "input": "3\n1 4 2", "output": "40.8407044967" }, { "input": "4\n4 1 3 2", "output": "31.4159265359" }, { "input": "4\n100 10 2 1", "output": "31111.1920484997" }, { "input": "10\n10 9 8 7 6 5 4 3 2 1", "output": "172.7875959474" }, { "input": "1\n1000", "output": "3141592.6535897931" }, { "input": "8\n8 1 7 2 6 3 5 4", "output": "113.0973355292" }, { "input": "100\n1000 999 998 997 996 995 994 993 992 991 990 989 988 987 986 985 984 983 982 981 980 979 978 977 976 975 974 973 972 971 970 969 968 967 966 965 964 963 962 961 960 959 958 957 956 955 954 953 952 951 950 949 948 947 946 945 944 943 942 941 940 939 938 937 936 935 934 933 932 931 930 929 928 927 926 925 924 923 922 921 920 919 918 917 916 915 914 913 912 911 910 909 908 907 906 905 904 903 902 901", "output": "298608.3817237098" }, { "input": "6\n109 683 214 392 678 10", "output": "397266.9574170437" }, { "input": "2\n151 400", "output": "431023.3704798660" }, { "input": "6\n258 877 696 425 663 934", "output": "823521.3902487604" }, { "input": "9\n635 707 108 234 52 180 910 203 782", "output": "1100144.9065826489" }, { "input": "8\n885 879 891 428 522 176 135 983", "output": "895488.9947571954" }, { "input": "3\n269 918 721", "output": "1241695.6467754442" }, { "input": "7\n920 570 681 428 866 935 795", "output": "1469640.1849419588" }, { "input": "2\n517 331", "output": "495517.1260654109" }, { "input": "2\n457 898", "output": "1877274.3981158488" }, { "input": "8\n872 704 973 612 183 274 739 253", "output": "1780774.0965755312" }, { "input": "74\n652 446 173 457 760 847 670 25 196 775 998 279 656 809 883 148 969 884 792 502 641 800 663 938 362 339 545 608 107 184 834 666 149 458 864 72 199 658 618 987 126 723 806 643 689 958 626 904 944 415 427 498 628 331 636 261 281 276 478 220 513 595 510 384 354 561 469 462 799 449 747 109 903 456", "output": "1510006.5089479341" }, { "input": "76\n986 504 673 158 87 332 124 218 714 235 212 122 878 370 938 81 686 323 386 348 410 468 875 107 50 960 82 834 234 663 651 422 794 633 294 771 945 607 146 913 950 858 297 88 882 725 247 872 645 749 799 987 115 394 380 382 971 429 593 426 652 353 351 233 868 598 889 116 71 376 916 464 414 976 138 903", "output": "1528494.7817143100" }, { "input": "70\n12 347 748 962 514 686 192 159 990 4 10 788 602 542 946 215 523 727 799 717 955 796 529 465 897 103 181 515 495 153 710 179 747 145 16 585 943 998 923 708 156 399 770 547 775 285 9 68 713 722 570 143 913 416 663 624 925 218 64 237 797 138 942 213 188 818 780 840 480 758", "output": "1741821.4892636713" }, { "input": "26\n656 508 45 189 561 366 96 486 547 386 703 570 780 689 264 26 11 74 466 76 421 48 982 886 215 650", "output": "1818821.9252031571" }, { "input": "52\n270 658 808 249 293 707 700 78 791 167 92 772 807 502 830 991 945 102 968 376 556 578 326 980 688 368 280 853 646 256 666 638 424 737 321 996 925 405 199 680 953 541 716 481 727 143 577 919 892 355 346 298", "output": "1272941.9273080483" }, { "input": "77\n482 532 200 748 692 697 171 863 586 547 301 149 326 812 147 698 303 691 527 805 681 387 619 947 598 453 167 799 840 508 893 688 643 974 998 341 804 230 538 669 271 404 477 759 943 596 949 235 880 160 151 660 832 82 969 539 708 889 258 81 224 655 790 144 462 582 646 256 445 52 456 920 67 819 631 484 534", "output": "2045673.1891262225" }, { "input": "27\n167 464 924 575 775 97 944 390 297 315 668 296 533 829 851 406 702 366 848 512 71 197 321 900 544 529 116", "output": "1573959.9105970615" }, { "input": "38\n488 830 887 566 720 267 583 102 65 200 884 220 263 858 510 481 316 804 754 568 412 166 374 869 356 977 145 421 500 58 664 252 745 70 381 927 670 772", "output": "1479184.3434235646" }, { "input": "64\n591 387 732 260 840 397 563 136 571 876 831 953 799 493 579 13 559 872 53 678 256 232 969 993 847 14 837 365 547 997 604 199 834 529 306 443 739 49 19 276 343 835 904 588 900 870 439 576 975 955 518 117 131 347 800 83 432 882 869 709 32 950 314 450", "output": "1258248.6984672088" }, { "input": "37\n280 281 169 68 249 389 977 101 360 43 448 447 368 496 125 507 747 392 338 270 916 150 929 428 118 266 589 470 774 852 263 644 187 817 808 58 637", "output": "1495219.0323274869" }, { "input": "97\n768 569 306 968 437 779 227 561 412 60 44 807 234 645 169 858 580 396 343 145 842 723 416 80 456 247 81 150 297 116 760 964 312 558 101 850 549 650 299 868 121 435 579 705 118 424 302 812 970 397 659 565 916 183 933 459 6 593 518 717 326 305 744 470 75 981 824 221 294 324 194 293 251 446 481 215 338 861 528 829 921 945 540 89 450 178 24 460 990 392 148 219 934 615 932 340 937", "output": "1577239.7333274092" }, { "input": "94\n145 703 874 425 277 652 239 496 458 658 339 842 564 699 893 352 625 980 432 121 798 872 499 859 850 721 414 825 543 843 304 111 342 45 219 311 50 748 465 902 781 822 504 985 919 656 280 310 917 438 464 527 491 713 906 329 635 777 223 810 501 535 156 252 806 112 971 719 103 443 165 98 579 554 244 996 221 560 301 51 977 422 314 858 528 772 448 626 185 194 536 66 577 677", "output": "1624269.3753516484" }, { "input": "97\n976 166 649 81 611 927 480 231 998 711 874 91 969 521 531 414 993 790 317 981 9 261 437 332 173 573 904 777 882 990 658 878 965 64 870 896 271 732 431 53 761 943 418 602 708 949 930 130 512 240 363 458 673 319 131 784 224 48 919 126 208 212 911 59 677 535 450 273 479 423 79 807 336 18 72 290 724 28 123 605 287 228 350 897 250 392 885 655 746 417 643 114 813 378 355 635 905", "output": "1615601.7212203942" }, { "input": "91\n493 996 842 9 748 178 1 807 841 519 796 998 84 670 778 143 707 208 165 893 154 943 336 150 761 881 434 112 833 55 412 682 552 945 758 189 209 600 354 325 440 844 410 20 136 665 88 791 688 17 539 821 133 236 94 606 483 446 429 60 960 476 915 134 137 852 754 908 276 482 117 252 297 903 981 203 829 811 471 135 188 667 710 393 370 302 874 872 551 457 692", "output": "1806742.5014501044" }, { "input": "95\n936 736 17 967 229 607 589 291 242 244 29 698 800 566 630 667 90 416 11 94 812 838 668 520 678 111 490 823 199 973 681 676 683 721 262 896 682 713 402 691 874 44 95 704 56 322 822 887 639 433 406 35 988 61 176 496 501 947 440 384 372 959 577 370 754 802 1 945 427 116 746 408 308 391 397 730 493 183 203 871 831 862 461 565 310 344 504 378 785 137 279 123 475 138 415", "output": "1611115.5269110680" }, { "input": "90\n643 197 42 218 582 27 66 704 195 445 641 675 285 639 503 686 242 327 57 955 848 287 819 992 756 749 363 48 648 736 580 117 752 921 923 372 114 313 202 337 64 497 399 25 883 331 24 871 917 8 517 486 323 529 325 92 891 406 864 402 263 773 931 253 625 31 17 271 140 131 232 586 893 525 846 54 294 562 600 801 214 55 768 683 389 738 314 284 328 804", "output": "1569819.2914796301" }, { "input": "98\n29 211 984 75 333 96 840 21 352 168 332 433 130 944 215 210 620 442 363 877 91 491 513 955 53 82 351 19 998 706 702 738 770 453 344 117 893 590 723 662 757 16 87 546 312 669 568 931 224 374 927 225 751 962 651 587 361 250 256 240 282 600 95 64 384 589 813 783 39 918 412 648 506 283 886 926 443 173 946 241 310 33 622 565 261 360 547 339 943 367 354 25 479 743 385 485 896 741", "output": "2042921.1539616778" }, { "input": "93\n957 395 826 67 185 4 455 880 683 654 463 84 258 878 553 592 124 585 9 133 20 609 43 452 725 125 801 537 700 685 771 155 566 376 19 690 383 352 174 208 177 416 304 1000 533 481 87 509 358 233 681 22 507 659 36 859 952 259 138 271 594 779 576 782 119 69 608 758 283 616 640 523 710 751 34 106 774 92 874 568 864 660 998 992 474 679 180 409 15 297 990 689 501", "output": "1310703.8710041976" }, { "input": "97\n70 611 20 30 904 636 583 262 255 501 604 660 212 128 199 138 545 576 506 528 12 410 77 888 783 972 431 188 338 485 148 793 907 678 281 922 976 680 252 724 253 920 177 361 721 798 960 572 99 622 712 466 608 49 612 345 266 751 63 594 40 695 532 789 520 930 825 929 48 59 405 135 109 735 508 186 495 772 375 587 201 324 447 610 230 947 855 318 856 956 313 810 931 175 668 183 688", "output": "1686117.9099228707" }, { "input": "96\n292 235 391 180 840 172 218 997 166 287 329 20 886 325 400 471 182 356 448 337 417 319 58 106 366 764 393 614 90 831 924 314 667 532 64 874 3 434 350 352 733 795 78 640 967 63 47 879 635 272 145 569 468 792 153 761 770 878 281 467 209 208 298 37 700 18 334 93 5 750 412 779 523 517 360 649 447 328 311 653 57 578 767 460 647 663 50 670 151 13 511 580 625 907 227 89", "output": "1419726.5608617242" }, { "input": "100\n469 399 735 925 62 153 707 723 819 529 200 624 57 708 245 384 889 11 639 638 260 419 8 142 403 298 204 169 887 388 241 983 885 267 643 943 417 237 452 562 6 839 149 742 832 896 100 831 712 754 679 743 135 222 445 680 210 955 220 63 960 487 514 824 481 584 441 997 795 290 10 45 510 678 844 503 407 945 850 84 858 934 500 320 936 663 736 592 161 670 606 465 864 969 293 863 868 393 899 744", "output": "1556458.0979239127" }, { "input": "100\n321 200 758 415 190 710 920 992 873 898 814 259 359 66 971 210 838 545 663 652 684 277 36 756 963 459 335 484 462 982 532 423 131 703 307 229 391 938 253 847 542 975 635 928 220 980 222 567 557 181 366 824 900 180 107 979 112 564 525 413 300 422 876 615 737 343 902 8 654 628 469 913 967 785 893 314 909 215 912 262 20 709 363 915 997 954 986 454 596 124 74 159 660 550 787 418 895 786 293 50", "output": "1775109.8050211088" }, { "input": "100\n859 113 290 762 701 63 188 431 810 485 671 673 99 658 194 227 511 435 941 212 551 124 89 222 42 321 657 815 898 171 216 482 707 567 724 491 414 942 820 351 48 653 685 312 586 24 20 627 602 498 533 173 463 262 621 466 119 299 580 964 510 987 40 698 521 998 847 651 746 215 808 563 785 837 631 772 404 923 682 244 232 214 390 350 968 771 517 900 70 543 934 554 681 368 642 575 891 728 478 317", "output": "1447969.4788174964" }, { "input": "100\n941 283 349 457 52 837 299 284 796 305 893 624 101 972 738 204 121 70 17 704 836 791 95 111 162 952 472 724 733 580 878 177 705 804 11 211 463 417 288 409 410 485 896 755 921 267 164 656 505 765 539 439 535 19 991 689 220 474 114 944 884 144 926 849 486 566 117 35 749 499 797 303 362 905 690 890 976 66 590 183 234 683 39 297 769 787 376 541 571 759 495 200 261 352 73 493 831 442 273 339", "output": "1597889.4218394549" }, { "input": "100\n110 868 147 888 291 282 916 542 917 337 235 595 498 621 814 249 261 713 445 666 142 275 319 49 900 543 333 606 487 670 620 769 852 258 230 867 603 491 714 839 879 37 21 74 590 190 397 506 499 967 152 862 200 107 145 23 614 167 857 475 79 598 270 906 626 116 89 59 651 846 723 201 50 699 522 408 634 132 226 414 824 764 513 586 526 238 556 162 667 173 684 415 527 743 10 442 552 274 350 822", "output": "1567230.6191330721" }, { "input": "100\n901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000", "output": "298608.3817237098" } ]
1,662,458,163
2,147,483,647
PyPy 3
OK
TESTS
44
154
0
n = int(input()) l = sorted(list(map(int, input().split())), reverse=True) ans = 0 i = 0 pi = 3.1415926536 while i<n: if i%2 == 0: ans += pi*l[i]*l[i] else: ans -= pi*l[i]*l[i] i += 1 print(ans)
Title: Trace Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day, as Sherlock Holmes was tracking down one very important criminal, he found a wonderful painting on the wall. This wall could be represented as a plane. The painting had several concentric circles that divided the wall into several parts. Some parts were painted red and all the other were painted blue. Besides, any two neighboring parts were painted different colors, that is, the red and the blue color were alternating, i. e. followed one after the other. The outer area of the wall (the area that lied outside all circles) was painted blue. Help Sherlock Holmes determine the total area of red parts of the wall. Let us remind you that two circles are called concentric if their centers coincide. Several circles are called concentric if any two of them are concentric. Input Specification: The first line contains the single integer *n* (1<=≤<=*n*<=≤<=100). The second line contains *n* space-separated integers *r**i* (1<=≤<=*r**i*<=≤<=1000) — the circles' radii. It is guaranteed that all circles are different. Output Specification: Print the single real number — total area of the part of the wall that is painted red. The answer is accepted if absolute or relative error doesn't exceed 10<=-<=4. Demo Input: ['1\n1\n', '3\n1 4 2\n'] Demo Output: ['3.1415926536\n', '40.8407044967\n'] Note: In the first sample the picture is just one circle of radius 1. Inner part of the circle is painted red. The area of the red part equals π × 1<sup class="upper-index">2</sup> = π. In the second sample there are three circles of radii 1, 4 and 2. Outside part of the second circle is painted blue. Part between the second and the third circles is painted red. Part between the first and the third is painted blue. And, finally, the inner part of the first circle is painted red. Overall there are two red parts: the ring between the second and the third circles and the inner part of the first circle. Total area of the red parts is equal (π × 4<sup class="upper-index">2</sup> - π × 2<sup class="upper-index">2</sup>) + π × 1<sup class="upper-index">2</sup> = π × 12 + π = 13π
```python n = int(input()) l = sorted(list(map(int, input().split())), reverse=True) ans = 0 i = 0 pi = 3.1415926536 while i<n: if i%2 == 0: ans += pi*l[i]*l[i] else: ans -= pi*l[i]*l[i] i += 1 print(ans) ```
3
493
C
Vasya and Basketball
PROGRAMMING
1,600
[ "binary search", "brute force", "data structures", "implementation", "sortings", "two pointers" ]
null
null
Vasya follows a basketball game and marks the distances from which each team makes a throw. He knows that each successful throw has value of either 2 or 3 points. A throw is worth 2 points if the distance it was made from doesn't exceed some value of *d* meters, and a throw is worth 3 points if the distance is larger than *d* meters, where *d* is some non-negative integer. Vasya would like the advantage of the points scored by the first team (the points of the first team minus the points of the second team) to be maximum. For that he can mentally choose the value of *d*. Help him to do that.
The first line contains integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of throws of the first team. Then follow *n* integer numbers — the distances of throws *a**i* (1<=≤<=*a**i*<=≤<=2·109). Then follows number *m* (1<=≤<=*m*<=≤<=2·105) — the number of the throws of the second team. Then follow *m* integer numbers — the distances of throws of *b**i* (1<=≤<=*b**i*<=≤<=2·109).
Print two numbers in the format a:b — the score that is possible considering the problem conditions where the result of subtraction *a*<=-<=*b* is maximum. If there are several such scores, find the one in which number *a* is maximum.
[ "3\n1 2 3\n2\n5 6\n", "5\n6 7 8 9 10\n5\n1 2 3 4 5\n" ]
[ "9:6\n", "15:10\n" ]
none
2,000
[ { "input": "3\n1 2 3\n2\n5 6", "output": "9:6" }, { "input": "5\n6 7 8 9 10\n5\n1 2 3 4 5", "output": "15:10" }, { "input": "5\n1 2 3 4 5\n5\n6 7 8 9 10", "output": "15:15" }, { "input": "3\n1 2 3\n3\n6 4 5", "output": "9:9" }, { "input": "10\n1 2 3 4 5 6 7 8 9 10\n1\n11", "output": "30:3" }, { "input": "10\n1 2 3 4 5 6 7 8 9 11\n1\n10", "output": "30:3" }, { "input": "3\n1 2 3\n3\n1 2 3", "output": "9:9" }, { "input": "3\n1 2 3\n3\n3 4 5", "output": "9:9" }, { "input": "4\n2 5 3 2\n4\n1 5 6 2", "output": "12:11" }, { "input": "2\n3 3\n3\n1 3 3", "output": "6:8" }, { "input": "3\n1 1 1\n4\n1 3 1 1", "output": "6:8" }, { "input": "4\n4 2 1 1\n4\n3 2 2 2", "output": "9:8" }, { "input": "3\n3 9 4\n2\n10 1", "output": "9:5" }, { "input": "14\n4336 24047 24846 25681 28597 30057 32421 34446 48670 67750 68185 69661 85721 89013\n30\n8751 10576 14401 22336 22689 35505 38649 43073 43176 44359 44777 50210 50408 51361 53181 60095 65554 68201 68285 68801 72501 75881 80251 80509 83306 93167 95365 95545 97201 97731", "output": "28:60" }, { "input": "1\n1\n2\n1 2", "output": "2:4" }, { "input": "18\n450 3726 12063 27630 29689 30626 33937 35015 45951 46217 53004 59541 75551 75836 78996 81297 93876 96211\n47\n3393 5779 6596 7935 9549 10330 11145 13121 14801 15578 24104 24125 25871 31280 35036 38969 40077 41342 42708 46033 47491 48451 49152 51905 55002 55689 56565 57901 59481 60017 66075 67081 68397 71122 74961 78501 84098 87083 87893 89281 89739 90321 92046 95821 96717 96921 96951", "output": "36:94" }, { "input": "3\n3 3 4\n6\n2 2 3 3 3 3", "output": "7:12" }, { "input": "3\n2 2 2\n3\n1 1 1", "output": "9:6" }, { "input": "2\n2 2\n2\n2 2", "output": "6:6" }, { "input": "1\n7\n6\n6 7 8 9 10 11", "output": "2:12" }, { "input": "1\n1\n2\n1 1", "output": "2:4" }, { "input": "3\n1 2 3\n1\n1", "output": "9:3" }, { "input": "3\n3 3 4\n6\n3 2 2 2 3 2", "output": "9:14" }, { "input": "1\n3\n1\n3", "output": "3:3" }, { "input": "1\n1\n5\n1 1 1 1 1", "output": "2:10" }, { "input": "2\n1 999999999\n2\n2 4", "output": "5:4" } ]
1,562,695,009
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
93
204,800
import bisect def distNums(team): scores = {} for i in team: if i not in scores.keys(): scores[i] = 1 else: scores[i] += 1 team = [] for i in scores.keys(): team.append(i) team.sort() dp = [] for i in team: if not dp: dp.append(scores[i]) else: dp.append(dp[-1]+scores[i]) return team,dp def main(): n = int(input()) team1 = list(map(int,input().split())) m = int(input()) team2,dp = distNums(list(map(int,input().split()))) team1.sort() max_diff = 3*(n-m) a = 3*n b = 3*m for i in range(len(team2)): throw2 = team2[i] total = dp[i] score2 = (3*(dp[-1]-dp[i]))+(2*total) index = bisect.bisect(team1,throw2) score1 = 2*index+(3*(n-index)) diff = score1-score2 #print(diff,score1,score2,index) if diff > max_diff: max_diff = diff a = score1 b = score2 elif diff == max_diff: if score1 > a: a = score1 b = score2 print(a,b) main()
Title: Vasya and Basketball Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya follows a basketball game and marks the distances from which each team makes a throw. He knows that each successful throw has value of either 2 or 3 points. A throw is worth 2 points if the distance it was made from doesn't exceed some value of *d* meters, and a throw is worth 3 points if the distance is larger than *d* meters, where *d* is some non-negative integer. Vasya would like the advantage of the points scored by the first team (the points of the first team minus the points of the second team) to be maximum. For that he can mentally choose the value of *d*. Help him to do that. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of throws of the first team. Then follow *n* integer numbers — the distances of throws *a**i* (1<=≤<=*a**i*<=≤<=2·109). Then follows number *m* (1<=≤<=*m*<=≤<=2·105) — the number of the throws of the second team. Then follow *m* integer numbers — the distances of throws of *b**i* (1<=≤<=*b**i*<=≤<=2·109). Output Specification: Print two numbers in the format a:b — the score that is possible considering the problem conditions where the result of subtraction *a*<=-<=*b* is maximum. If there are several such scores, find the one in which number *a* is maximum. Demo Input: ['3\n1 2 3\n2\n5 6\n', '5\n6 7 8 9 10\n5\n1 2 3 4 5\n'] Demo Output: ['9:6\n', '15:10\n'] Note: none
```python import bisect def distNums(team): scores = {} for i in team: if i not in scores.keys(): scores[i] = 1 else: scores[i] += 1 team = [] for i in scores.keys(): team.append(i) team.sort() dp = [] for i in team: if not dp: dp.append(scores[i]) else: dp.append(dp[-1]+scores[i]) return team,dp def main(): n = int(input()) team1 = list(map(int,input().split())) m = int(input()) team2,dp = distNums(list(map(int,input().split()))) team1.sort() max_diff = 3*(n-m) a = 3*n b = 3*m for i in range(len(team2)): throw2 = team2[i] total = dp[i] score2 = (3*(dp[-1]-dp[i]))+(2*total) index = bisect.bisect(team1,throw2) score1 = 2*index+(3*(n-index)) diff = score1-score2 #print(diff,score1,score2,index) if diff > max_diff: max_diff = diff a = score1 b = score2 elif diff == max_diff: if score1 > a: a = score1 b = score2 print(a,b) main() ```
0
61
A
Ultra-Fast Mathematician
PROGRAMMING
800
[ "implementation" ]
A. Ultra-Fast Mathematician
2
256
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Write one line — the corresponding answer. Do not omit the leading 0s.
[ "1010100\n0100101\n", "000\n111\n", "1110\n1010\n", "01110\n01100\n" ]
[ "1110001\n", "111\n", "0100\n", "00010\n" ]
none
500
[ { "input": "1010100\n0100101", "output": "1110001" }, { "input": "000\n111", "output": "111" }, { "input": "1110\n1010", "output": "0100" }, { "input": "01110\n01100", "output": "00010" }, { "input": "011101\n000001", "output": "011100" }, { "input": "10\n01", "output": "11" }, { "input": "00111111\n11011101", "output": "11100010" }, { "input": "011001100\n101001010", "output": "110000110" }, { "input": "1100100001\n0110101100", "output": "1010001101" }, { "input": "00011101010\n10010100101", "output": "10001001111" }, { "input": "100000101101\n111010100011", "output": "011010001110" }, { "input": "1000001111010\n1101100110001", "output": "0101101001011" }, { "input": "01011111010111\n10001110111010", "output": "11010001101101" }, { "input": "110010000111100\n001100101011010", "output": "111110101100110" }, { "input": "0010010111110000\n0000000011010110", "output": "0010010100100110" }, { "input": "00111110111110000\n01111100001100000", "output": "01000010110010000" }, { "input": "101010101111010001\n001001111101111101", "output": "100011010010101100" }, { "input": "0110010101111100000\n0011000101000000110", "output": "0101010000111100110" }, { "input": "11110100011101010111\n00001000011011000000", "output": "11111100000110010111" }, { "input": "101010101111101101001\n111010010010000011111", "output": "010000111101101110110" }, { "input": "0000111111100011000010\n1110110110110000001010", "output": "1110001001010011001000" }, { "input": "10010010101000110111000\n00101110100110111000111", "output": "10111100001110001111111" }, { "input": "010010010010111100000111\n100100111111100011001110", "output": "110110101101011111001001" }, { "input": "0101110100100111011010010\n0101100011010111001010001", "output": "0000010111110000010000011" }, { "input": "10010010100011110111111011\n10000110101100000001000100", "output": "00010100001111110110111111" }, { "input": "000001111000000100001000000\n011100111101111001110110001", "output": "011101000101111101111110001" }, { "input": "0011110010001001011001011100\n0000101101000011101011001010", "output": "0011011111001010110010010110" }, { "input": "11111000000000010011001101111\n11101110011001010100010000000", "output": "00010110011001000111011101111" }, { "input": "011001110000110100001100101100\n001010000011110000001000101001", "output": "010011110011000100000100000101" }, { "input": "1011111010001100011010110101111\n1011001110010000000101100010101", "output": "0000110100011100011111010111010" }, { "input": "10111000100001000001010110000001\n10111000001100101011011001011000", "output": "00000000101101101010001111011001" }, { "input": "000001010000100001000000011011100\n111111111001010100100001100000111", "output": "111110101001110101100001111011011" }, { "input": "1101000000000010011011101100000110\n1110000001100010011010000011011110", "output": "0011000001100000000001101111011000" }, { "input": "01011011000010100001100100011110001\n01011010111000001010010100001110000", "output": "00000001111010101011110000010000001" }, { "input": "000011111000011001000110111100000100\n011011000110000111101011100111000111", "output": "011000111110011110101101011011000011" }, { "input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000", "output": "1011001001111001001011101010101000010" }, { "input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011", "output": "10001110000010101110000111000011111110" }, { "input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100", "output": "000100001011110000011101110111010001110" }, { "input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001", "output": "1101110101010110000011000000101011110011" }, { "input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100", "output": "11001011110010010000010111001100001001110" }, { "input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110", "output": "001100101000011111111101111011101010111001" }, { "input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001", "output": "0111010010100110110101100010000100010100000" }, { "input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100", "output": "11111110000000100101000100110111001100011001" }, { "input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011", "output": "101011011100100010100011011001101010100100010" }, { "input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001", "output": "1101001100111011010111110110101111001011110111" }, { "input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001", "output": "10010101000101000000011010011110011110011110001" }, { "input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100", "output": "011011011100000000010101110010000000101000111101" }, { "input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100", "output": "0101010111101001011011110110011101010101010100011" }, { "input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011", "output": "11001011010010111000010110011101100100001110111111" }, { "input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011", "output": "111011101010011100001111101001101011110010010110001" }, { "input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001", "output": "0100111110110011111110010010010000110111100101101101" }, { "input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100", "output": "01011001110111010111001100010011010100010000111011000" }, { "input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111", "output": "100011101001001000011011011001111000100000010100100100" }, { "input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110", "output": "1100110010000101101010111111101001001001110101110010110" }, { "input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110", "output": "01000111100111001011110010100011111111110010101100001101" }, { "input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010", "output": "110001010001000011000101110101000100001011111001011001001" }, { "input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111", "output": "1110100010111000101001001011101110011111100111000011011011" }, { "input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110", "output": "01110110101110100100110011010000001000101100101111000111011" }, { "input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011", "output": "111100101000000011101011011001110010101111000110010010000000" }, { "input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111", "output": "0100100010111110010011101010000011111110001110010110010111001" }, { "input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111", "output": "00110100000011001101101100100010110010001100000001100110011101" }, { "input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011", "output": "000000011000111011110011101000010000010100101000000011010110010" }, { "input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010", "output": "0010100110110100111100100100101101010100100111011010001001010101" }, { "input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111", "output": "11010110111100101111101001100001110100010110010110110111100110100" }, { "input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111", "output": "111111010011011100101110100110111111111001111110011010111111110000" }, { "input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110", "output": "1010101010100010001001001001100000111000010010010100010011000100000" }, { "input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000", "output": "00011111011111001000011100010011100011010100101011011000001001111110" }, { "input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111", "output": "001111000011001110100111010101111111011100110011001010010010000111011" }, { "input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101", "output": "0110001100110100010000110111000010011010011000011001010011010100010100" }, { "input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010", "output": "00010000000110110101000011001000000100100110111010011111101010001010000" }, { "input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001", "output": "000100100000000110011100100001010110101001100101110010010011111001110111" }, { "input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000", "output": "1000111100010011010110011101000000101010101100011111100001101111001010010" }, { "input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011", "output": "01000010011110111001011011110000001011000111101101101010010110001010100100" }, { "input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101", "output": "101101110110110010011100001011111100100001110000101100110000100011011100110" }, { "input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001", "output": "1110111111110010111000001100101010101011010100101010100101100011001001111111" }, { "input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111", "output": "10111011000111000101110100101000100111011011100011110110000101010001111010111" }, { "input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110", "output": "110100100110000101010010011010011001100110000111010000010100001011110111111101" }, { "input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111", "output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111" }, { "input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001", "output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001" }, { "input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110", "output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011" }, { "input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111", "output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101" }, { "input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010", "output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101" }, { "input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000", "output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001" }, { "input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011", "output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110" }, { "input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011", "output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011" }, { "input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011", "output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011" }, { "input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010", "output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011" }, { "input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001", "output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110" }, { "input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111", "output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010" }, { "input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011", "output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011" }, { "input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100", "output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000" }, { "input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001", "output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101" }, { "input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110", "output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101" }, { "input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011", "output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110" }, { "input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111", "output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110" }, { "input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000", "output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001" }, { "input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010", "output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101" }, { "input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101", "output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011" }, { "input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011", "output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010" }, { "input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010", "output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011" }, { "input": "0\n0", "output": "0" }, { "input": "0\n1", "output": "1" } ]
1,557,222,992
2,147,483,647
Python 3
OK
TESTS
102
124
0
aa = input() a = int(aa, 2) b = int(input(), 2) r = a ^ b res = format(r, '#0{}b'.format(len(aa)))[2:] dif = len(aa) - len(res) res = "{}{}".format(''.join('0' for i in range(dif)), res) print(res)
Title: Ultra-Fast Mathematician Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate. Input Specification: There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. Output Specification: Write one line — the corresponding answer. Do not omit the leading 0s. Demo Input: ['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n'] Demo Output: ['1110001\n', '111\n', '0100\n', '00010\n'] Note: none
```python aa = input() a = int(aa, 2) b = int(input(), 2) r = a ^ b res = format(r, '#0{}b'.format(len(aa)))[2:] dif = len(aa) - len(res) res = "{}{}".format(''.join('0' for i in range(dif)), res) print(res) ```
3.969
918
A
Eleven
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
Eleven wants to choose a new name for herself. As a bunch of geeks, her friends suggested an algorithm to choose a name for her. Eleven wants her name to have exactly *n* characters. Her friend suggested that her name should only consist of uppercase and lowercase letters 'O'. More precisely, they suggested that the *i*-th letter of her name should be 'O' (uppercase) if *i* is a member of Fibonacci sequence, and 'o' (lowercase) otherwise. The letters in the name are numbered from 1 to *n*. Fibonacci sequence is the sequence *f* where - *f*1<==<=1, - *f*2<==<=1, - *f**n*<==<=*f**n*<=-<=2<=+<=*f**n*<=-<=1 (*n*<=&gt;<=2). As her friends are too young to know what Fibonacci sequence is, they asked you to help Eleven determine her new name.
The first and only line of input contains an integer *n* (1<=≤<=*n*<=≤<=1000).
Print Eleven's new name on the first and only line of output.
[ "8\n", "15\n" ]
[ "OOOoOooO\n", "OOOoOooOooooOoo\n" ]
none
500
[ { "input": "8", "output": "OOOoOooO" }, { "input": "15", "output": "OOOoOooOooooOoo" }, { "input": "85", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooo" }, { "input": "381", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooo" }, { "input": "805", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..." }, { "input": "1000", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..." }, { "input": "1", "output": "O" }, { "input": "2", "output": "OO" }, { "input": "3", "output": "OOO" }, { "input": "5", "output": "OOOoO" }, { "input": "17", "output": "OOOoOooOooooOoooo" }, { "input": "49", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooo" }, { "input": "256", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooo" }, { "input": "512", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..." }, { "input": "933", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..." }, { "input": "61", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooo" }, { "input": "781", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..." }, { "input": "999", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..." } ]
1,528,810,901
2,147,483,647
Python 3
OK
TESTS
18
92
0
l = [1, 1, 2, 3, 5, 8, 13, 21, 34, 55, 89, 144, 233, 377, 610, 987, 1597] n = int(input()) for i in range(1,n+1) : if i in l : print('O',end = '') else : print('o',end = '')
Title: Eleven Time Limit: None seconds Memory Limit: None megabytes Problem Description: Eleven wants to choose a new name for herself. As a bunch of geeks, her friends suggested an algorithm to choose a name for her. Eleven wants her name to have exactly *n* characters. Her friend suggested that her name should only consist of uppercase and lowercase letters 'O'. More precisely, they suggested that the *i*-th letter of her name should be 'O' (uppercase) if *i* is a member of Fibonacci sequence, and 'o' (lowercase) otherwise. The letters in the name are numbered from 1 to *n*. Fibonacci sequence is the sequence *f* where - *f*1<==<=1, - *f*2<==<=1, - *f**n*<==<=*f**n*<=-<=2<=+<=*f**n*<=-<=1 (*n*<=&gt;<=2). As her friends are too young to know what Fibonacci sequence is, they asked you to help Eleven determine her new name. Input Specification: The first and only line of input contains an integer *n* (1<=≤<=*n*<=≤<=1000). Output Specification: Print Eleven's new name on the first and only line of output. Demo Input: ['8\n', '15\n'] Demo Output: ['OOOoOooO\n', 'OOOoOooOooooOoo\n'] Note: none
```python l = [1, 1, 2, 3, 5, 8, 13, 21, 34, 55, 89, 144, 233, 377, 610, 987, 1597] n = int(input()) for i in range(1,n+1) : if i in l : print('O',end = '') else : print('o',end = '') ```
3
365
A
Good Number
PROGRAMMING
1,100
[ "implementation" ]
null
null
Let's call a number *k*-good if it contains all digits not exceeding *k* (0,<=...,<=*k*). You've got a number *k* and an array *a* containing *n* numbers. Find out how many *k*-good numbers are in *a* (count each number every time it occurs in array *a*).
The first line contains integers *n* and *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=9). The *i*-th of the following *n* lines contains integer *a**i* without leading zeroes (1<=≤<=*a**i*<=≤<=109).
Print a single integer — the number of *k*-good numbers in *a*.
[ "10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n", "2 1\n1\n10\n" ]
[ "10\n", "1\n" ]
none
500
[ { "input": "10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560", "output": "10" }, { "input": "2 1\n1\n10", "output": "1" }, { "input": "1 0\n1000000000", "output": "1" }, { "input": "1 1\n1000000000", "output": "1" }, { "input": "6 0\n10\n102\n120\n1032\n1212103\n1999999", "output": "5" }, { "input": "1 3\n1000000000", "output": "0" }, { "input": "1 9\n1000000000", "output": "0" }, { "input": "1 0\n1", "output": "0" }, { "input": "1 1\n1", "output": "0" }, { "input": "1 3\n1", "output": "0" }, { "input": "1 9\n1", "output": "0" }, { "input": "2 8\n123456780\n123", "output": "1" }, { "input": "2 8\n12345678\n1230", "output": "0" }, { "input": "6 1\n10\n102\n120\n1032\n1212103\n1999999", "output": "5" }, { "input": "6 2\n10\n102\n120\n1032\n1212103\n1999999", "output": "4" }, { "input": "6 3\n10\n102\n120\n1032\n1212103\n1999999", "output": "2" }, { "input": "6 9\n10\n102\n120\n1032\n1212103\n1999999", "output": "0" }, { "input": "1 2\n2220", "output": "0" } ]
1,697,175,869
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
2
62
0
n, k = map(int, input().split()) cnt = 0 for _ in range(n): x = int(input()) y = 0 if '0' in str(x): y = 1 while x > 0: y |= 1 << (x % 10) x //= 10 if y == (1 << (k+1)) - 1: cnt += 1 print(cnt)
Title: Good Number Time Limit: None seconds Memory Limit: None megabytes Problem Description: Let's call a number *k*-good if it contains all digits not exceeding *k* (0,<=...,<=*k*). You've got a number *k* and an array *a* containing *n* numbers. Find out how many *k*-good numbers are in *a* (count each number every time it occurs in array *a*). Input Specification: The first line contains integers *n* and *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=9). The *i*-th of the following *n* lines contains integer *a**i* without leading zeroes (1<=≤<=*a**i*<=≤<=109). Output Specification: Print a single integer — the number of *k*-good numbers in *a*. Demo Input: ['10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n', '2 1\n1\n10\n'] Demo Output: ['10\n', '1\n'] Note: none
```python n, k = map(int, input().split()) cnt = 0 for _ in range(n): x = int(input()) y = 0 if '0' in str(x): y = 1 while x > 0: y |= 1 << (x % 10) x //= 10 if y == (1 << (k+1)) - 1: cnt += 1 print(cnt) ```
0
624
A
Save Luke
PROGRAMMING
800
[ "math" ]
null
null
Luke Skywalker got locked up in a rubbish shredder between two presses. R2D2 is already working on his rescue, but Luke needs to stay alive as long as possible. For simplicity we will assume that everything happens on a straight line, the presses are initially at coordinates 0 and *L*, and they move towards each other with speed *v*1 and *v*2, respectively. Luke has width *d* and is able to choose any position between the presses. Luke dies as soon as the distance between the presses is less than his width. Your task is to determine for how long Luke can stay alive.
The first line of the input contains four integers *d*, *L*, *v*1, *v*2 (1<=≤<=*d*,<=*L*,<=*v*1,<=*v*2<=≤<=10<=000,<=*d*<=&lt;<=*L*) — Luke's width, the initial position of the second press and the speed of the first and second presses, respectively.
Print a single real value — the maximum period of time Luke can stay alive for. Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6. Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
[ "2 6 2 2\n", "1 9 1 2\n" ]
[ "1.00000000000000000000\n", "2.66666666666666650000\n" ]
In the first sample Luke should stay exactly in the middle of the segment, that is at coordinates [2;4], as the presses move with the same speed. In the second sample he needs to occupy the position <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/71395c777960eaded59a9fdc428a9625f152605b.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In this case both presses move to his edges at the same time.
500
[ { "input": "2 6 2 2", "output": "1.00000000000000000000" }, { "input": "1 9 1 2", "output": "2.66666666666666650000" }, { "input": "1 10000 1 1", "output": "4999.50000000000000000000" }, { "input": "9999 10000 10000 10000", "output": "0.00005000000000000000" }, { "input": "1023 2340 1029 3021", "output": "0.32518518518518519000" }, { "input": "2173 2176 10000 9989", "output": "0.00015008254539996998" }, { "input": "1 2 123 1", "output": "0.00806451612903225780" }, { "input": "123 1242 12 312", "output": "3.45370370370370370000" }, { "input": "2 9997 3 12", "output": "666.33333333333337000000" }, { "input": "1 10000 10000 10000", "output": "0.49995000000000001000" }, { "input": "3274 4728 888 4578", "output": "0.26600804976216613000" }, { "input": "4600 9696 5634 8248", "output": "0.36709407866301685000" }, { "input": "2255 7902 8891 429", "output": "0.60590128755364803000" }, { "input": "6745 9881 2149 9907", "output": "0.26011944260119441000" }, { "input": "4400 8021 6895 2089", "output": "0.40304986642920748000" }, { "input": "5726 9082 7448 3054", "output": "0.31955817939440107000" }, { "input": "3381 9769 4898 2532", "output": "0.85975773889636609000" }, { "input": "1036 6259 5451 4713", "output": "0.51387249114521838000" }, { "input": "5526 6455 197 4191", "output": "0.21171376481312670000" }, { "input": "1196 4082 4071 9971", "output": "0.20552627830793335000" }, { "input": "8850 9921 8816 9449", "output": "0.05863673692855187600" }, { "input": "3341 7299 2074 8927", "output": "0.35978547404781386000" }, { "input": "7831 8609 6820 2596", "output": "0.08262531860662701600" }, { "input": "2322 7212 77 4778", "output": "1.00720906282183310000" }, { "input": "9976 9996 4823 4255", "output": "0.00220312844238819110" }, { "input": "7631 9769 5377 6437", "output": "0.18097172845776197000" }, { "input": "8957 9525 8634 107", "output": "0.06498112344125385500" }, { "input": "6612 9565 3380 2288", "output": "0.52099505998588569000" }, { "input": "1103 6256 3934 9062", "output": "0.39650661742074483000" }, { "input": "1854 3280 1481 2140", "output": "0.39381386357359843000" } ]
1,644,507,560
2,147,483,647
Python 3
OK
TESTS
30
46
0
n = input().split() a = int(n[0]) b = int(n[1]) c = int(n[2]) d = int(n[3]) sub = (b-a) add = (c+d) print(sub/add)
Title: Save Luke Time Limit: None seconds Memory Limit: None megabytes Problem Description: Luke Skywalker got locked up in a rubbish shredder between two presses. R2D2 is already working on his rescue, but Luke needs to stay alive as long as possible. For simplicity we will assume that everything happens on a straight line, the presses are initially at coordinates 0 and *L*, and they move towards each other with speed *v*1 and *v*2, respectively. Luke has width *d* and is able to choose any position between the presses. Luke dies as soon as the distance between the presses is less than his width. Your task is to determine for how long Luke can stay alive. Input Specification: The first line of the input contains four integers *d*, *L*, *v*1, *v*2 (1<=≤<=*d*,<=*L*,<=*v*1,<=*v*2<=≤<=10<=000,<=*d*<=&lt;<=*L*) — Luke's width, the initial position of the second press and the speed of the first and second presses, respectively. Output Specification: Print a single real value — the maximum period of time Luke can stay alive for. Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6. Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if . Demo Input: ['2 6 2 2\n', '1 9 1 2\n'] Demo Output: ['1.00000000000000000000\n', '2.66666666666666650000\n'] Note: In the first sample Luke should stay exactly in the middle of the segment, that is at coordinates [2;4], as the presses move with the same speed. In the second sample he needs to occupy the position <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/71395c777960eaded59a9fdc428a9625f152605b.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In this case both presses move to his edges at the same time.
```python n = input().split() a = int(n[0]) b = int(n[1]) c = int(n[2]) d = int(n[3]) sub = (b-a) add = (c+d) print(sub/add) ```
3
0
none
none
none
0
[ "none" ]
null
null
You are given two integers $a$ and $b$. Moreover, you are given a sequence $s_0, s_1, \dots, s_{n}$. All values in $s$ are integers $1$ or $-1$. It's known that sequence is $k$-periodic and $k$ divides $n+1$. In other words, for each $k \leq i \leq n$ it's satisfied that $s_{i} = s_{i - k}$. Find out the non-negative remainder of division of $\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i}$ by $10^{9} + 9$. Note that the modulo is unusual!
The first line contains four integers $n, a, b$ and $k$ $(1 \leq n \leq 10^{9}, 1 \leq a, b \leq 10^{9}, 1 \leq k \leq 10^{5})$. The second line contains a sequence of length $k$ consisting of characters '+' and '-'. If the $i$-th character (0-indexed) is '+', then $s_{i} = 1$, otherwise $s_{i} = -1$. Note that only the first $k$ members of the sequence are given, the rest can be obtained using the periodicity property.
Output a single integer — value of given expression modulo $10^{9} + 9$.
[ "2 2 3 3\n+-+\n", "4 1 5 1\n-\n" ]
[ "7\n", "999999228\n" ]
In the first example: $(\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i})$ = $2^{2} 3^{0} - 2^{1} 3^{1} + 2^{0} 3^{2}$ = 7 In the second example: $(\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i}) = -1^{4} 5^{0} - 1^{3} 5^{1} - 1^{2} 5^{2} - 1^{1} 5^{3} - 1^{0} 5^{4} = -781 \equiv 999999228 \pmod{10^{9} + 9}$.
0
[ { "input": "2 2 3 3\n+-+", "output": "7" }, { "input": "4 1 5 1\n-", "output": "999999228" }, { "input": "1 1 4 2\n-+", "output": "3" }, { "input": "3 1 4 4\n+--+", "output": "45" }, { "input": "5 1 1 6\n++---+", "output": "0" }, { "input": "5 2 2 6\n+--++-", "output": "0" }, { "input": "686653196 115381398 884618610 3\n+-+", "output": "542231211" }, { "input": "608663287 430477711 172252358 8\n-+--+-+-", "output": "594681696" }, { "input": "904132655 827386249 118827660 334\n+++-+++++--+++----+-+-+-+-+--+-+---++--++--++--+-+-+++-+++--+-+-+----+-+-++++-----+--++++------+++-+-+-++-++++++++-+-++-+++--+--++------+--+-+++--++--+---++-++-+-+-++---++-++--+-+-++-+------+-+----+++-+++--+-+-+--+--+--+------+--+---+--+-++--+++---+-+-++--------+-++--++-+-+-+-+-+-+--+-++++-+++--+--++----+--+-++-++--+--+-+-++-+-++++-", "output": "188208979" }, { "input": "234179195 430477711 115381398 12\n++++-+-+-+++", "output": "549793323" }, { "input": "75952547 967294208 907708706 252\n++--++--+++-+-+--++--++++++---+++-++-+-----++++--++-+-++------+-+-+-++-+-+-++++------++---+-++++---+-+-++++--++++++--+-+++-++--+--+---++++---+-+++-+++--+-+--+++++---+--++-++++--++++-+-++-+++-++-----+-+++++----++--+++-+-+++++-+--++-++-+--+-++++--+-+-+-+", "output": "605712499" }, { "input": "74709071 801809249 753674746 18\n++++++-+-+---+-+--", "output": "13414893" }, { "input": "743329 973758 92942 82\n++----+-++++----+--+++---+--++++-+-+---+++++--+--+++++++--++-+++----+--+++++-+--+-", "output": "299311566" }, { "input": "18111 291387 518587 2\n++", "output": "724471355" }, { "input": "996144 218286 837447 1\n-", "output": "549104837" }, { "input": "179358 828426 548710 67\n++++---+--++----+-+-++++----+--+---+------++-+-++++--+----+---+-+--", "output": "759716474" }, { "input": "397521 174985 279760 1\n+", "output": "25679493" }, { "input": "613632 812232 482342 1\n-", "output": "891965141" }, { "input": "936810 183454 647048 1\n+", "output": "523548992" }, { "input": "231531 250371 921383 28\n++-+------+--+--++++--+-+++-", "output": "134450934" }, { "input": "947301 87242 360762 97\n--+++--+++-++--++-++--++--+++---+++--++++--+++++--+-++-++-----+-++-+--++-----+-++-+--++-++-+-----", "output": "405016159" }, { "input": "425583346 814209084 570987274 1\n+", "output": "63271171" }, { "input": "354062556 688076879 786825319 1\n+", "output": "545304776" }, { "input": "206671954 13571766 192250278 1\n+", "output": "717117421" }, { "input": "23047921 621656196 160244047 1\n-", "output": "101533009" }, { "input": "806038018 740585177 987616107 293\n-+++++--++++---++-+--+-+---+-++++--+--+++--++---++++++++--+++++-+-++-+--+----+--+++-+-++-+++-+-+-+----------++-+-+++++++-+-+-+-++---+++-+-+-------+-+-++--++-++-++-++-+---+--++-++--+++--+++-+-+----++--+-+-++-+---+---+-+-+++------+-+++-+---++-+--+++----+++++---++-++--+----+++-+--+++-+------+-++", "output": "441468166" }, { "input": "262060935 184120408 148332034 148\n+--+-------+-+-+--++-+++--++-+-++++++--++-+++-+++--+-------+-+--+++-+-+-+---++-++-+-++---+--+-+-+--+------+++--+--+-+-+---+---+-+-++++---+++--+++---", "output": "700325386" }, { "input": "919350941 654611542 217223605 186\n++-++-+++++-+++--+---+++++++-++-+----+-++--+-++--++--+++-+++---+--+--++-+-+++-+-+++-++---+--+++-+-+++--+-+-------+-++------++---+-+---++-++-++---+-+--+-+--+++++---+--+--++++-++-++--+--++", "output": "116291420" }, { "input": "289455627 906207104 512692624 154\n-------++--+++---++-++------++----------+--+++-+-+++---+---+++--++++++--+-+-+--+---+-+-++-++--+-++--++++---+-+---+-----+--+-+---------+++-++---++-+-+-----", "output": "48198216" }, { "input": "258833760 515657142 791267045 1\n-", "output": "935800888" }, { "input": "691617927 66917103 843055237 8\n--+++---", "output": "147768186" }, { "input": "379582849 362892355 986900829 50\n++-++---+-+++++--++++--+--++--++-----+------++--+-", "output": "927469713" }, { "input": "176799169 363368399 841293419 1\n+", "output": "746494802" }, { "input": "144808247 203038656 166324035 4\n-+-+", "output": "909066471" }, { "input": "477607531 177367565 20080950 2\n++", "output": "928662830" }, { "input": "682074525 289438443 917164266 1\n+", "output": "28048785" }, { "input": "938449224 59852396 219719125 1\n-", "output": "648647459" }, { "input": "395171426 872478622 193568600 147\n+---++---+-+--+++++--+---+-++++-+-++---++++--+--+-+-++-+-++--------++---+++-+---++---+---+-+--+-++++-+++-+-+-++-+--+++-++-+-+-+-++++++-+---+---++--", "output": "460881399" }, { "input": "403493428 317461491 556701240 1\n-", "output": "936516261" }, { "input": "917751169 330191895 532837377 70\n-+-+++++++--++---++-+++++-+++-----+-+++---+--+-+-++-++-+-+-++-++-+----", "output": "908035409" }, { "input": "252089413 552678586 938424519 1\n-", "output": "627032736" }, { "input": "649316142 320010793 200197645 1\n-", "output": "323650777" }, { "input": "116399299 784781190 299072480 5\n++++-", "output": "754650814" } ]
1,523,979,754
5,854
Python 3
WRONG_ANSWER
PRETESTS
6
93
7,065,600
MOD = 1000000009 n, a, b, k = map(int, input().split()) s = input() sign = 0 res1 = 0 for i in range(k): sign = 1 if s[i] == '+' else -1 res1 += sign * pow(a, n - i, MOD) * pow(b, i, MOD); if (res1 > 0): res1 %= MOD else: res1 = res1 % MOD - MOD if (a == b): res = res1 * (n + 1) // k; else: res = (res1 * (pow((b / a), (n + 1) // k) - 1)) / (b / a - 1) res %= MOD print(round(res))
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given two integers $a$ and $b$. Moreover, you are given a sequence $s_0, s_1, \dots, s_{n}$. All values in $s$ are integers $1$ or $-1$. It's known that sequence is $k$-periodic and $k$ divides $n+1$. In other words, for each $k \leq i \leq n$ it's satisfied that $s_{i} = s_{i - k}$. Find out the non-negative remainder of division of $\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i}$ by $10^{9} + 9$. Note that the modulo is unusual! Input Specification: The first line contains four integers $n, a, b$ and $k$ $(1 \leq n \leq 10^{9}, 1 \leq a, b \leq 10^{9}, 1 \leq k \leq 10^{5})$. The second line contains a sequence of length $k$ consisting of characters '+' and '-'. If the $i$-th character (0-indexed) is '+', then $s_{i} = 1$, otherwise $s_{i} = -1$. Note that only the first $k$ members of the sequence are given, the rest can be obtained using the periodicity property. Output Specification: Output a single integer — value of given expression modulo $10^{9} + 9$. Demo Input: ['2 2 3 3\n+-+\n', '4 1 5 1\n-\n'] Demo Output: ['7\n', '999999228\n'] Note: In the first example: $(\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i})$ = $2^{2} 3^{0} - 2^{1} 3^{1} + 2^{0} 3^{2}$ = 7 In the second example: $(\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i}) = -1^{4} 5^{0} - 1^{3} 5^{1} - 1^{2} 5^{2} - 1^{1} 5^{3} - 1^{0} 5^{4} = -781 \equiv 999999228 \pmod{10^{9} + 9}$.
```python MOD = 1000000009 n, a, b, k = map(int, input().split()) s = input() sign = 0 res1 = 0 for i in range(k): sign = 1 if s[i] == '+' else -1 res1 += sign * pow(a, n - i, MOD) * pow(b, i, MOD); if (res1 > 0): res1 %= MOD else: res1 = res1 % MOD - MOD if (a == b): res = res1 * (n + 1) // k; else: res = (res1 * (pow((b / a), (n + 1) // k) - 1)) / (b / a - 1) res %= MOD print(round(res)) ```
0
509
A
Maximum in Table
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
An *n*<=×<=*n* table *a* is defined as follows: - The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1. These conditions define all the values in the table. You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
Print a single line containing a positive integer *m* — the maximum value in the table.
[ "1\n", "5\n" ]
[ "1", "70" ]
In the second test the rows of the table look as follows:
0
[ { "input": "1", "output": "1" }, { "input": "5", "output": "70" }, { "input": "2", "output": "2" }, { "input": "3", "output": "6" }, { "input": "4", "output": "20" }, { "input": "6", "output": "252" }, { "input": "7", "output": "924" }, { "input": "9", "output": "12870" }, { "input": "10", "output": "48620" }, { "input": "8", "output": "3432" } ]
1,637,336,073
2,147,483,647
Python 3
OK
TESTS
10
46
0
import math n=int(input()) n-=1 ans=math.factorial(2*n)/math.factorial(n)**2 print(int(ans))
Title: Maximum in Table Time Limit: None seconds Memory Limit: None megabytes Problem Description: An *n*<=×<=*n* table *a* is defined as follows: - The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1. These conditions define all the values in the table. You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above. Input Specification: The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table. Output Specification: Print a single line containing a positive integer *m* — the maximum value in the table. Demo Input: ['1\n', '5\n'] Demo Output: ['1', '70'] Note: In the second test the rows of the table look as follows:
```python import math n=int(input()) n-=1 ans=math.factorial(2*n)/math.factorial(n)**2 print(int(ans)) ```
3
466
C
Number of Ways
PROGRAMMING
1,700
[ "binary search", "brute force", "data structures", "dp", "two pointers" ]
null
null
You've got array *a*[1],<=*a*[2],<=...,<=*a*[*n*], consisting of *n* integers. Count the number of ways to split all the elements of the array into three contiguous parts so that the sum of elements in each part is the same. More formally, you need to find the number of such pairs of indices *i*,<=*j* (2<=≤<=*i*<=≤<=*j*<=≤<=*n*<=-<=1), that .
The first line contains integer *n* (1<=≤<=*n*<=≤<=5·105), showing how many numbers are in the array. The second line contains *n* integers *a*[1], *a*[2], ..., *a*[*n*] (|*a*[*i*]|<=≤<=<=109) — the elements of array *a*.
Print a single integer — the number of ways to split the array into three parts with the same sum.
[ "5\n1 2 3 0 3\n", "4\n0 1 -1 0\n", "2\n4 1\n" ]
[ "2\n", "1\n", "0\n" ]
none
1,500
[ { "input": "5\n1 2 3 0 3", "output": "2" }, { "input": "4\n0 1 -1 0", "output": "1" }, { "input": "2\n4 1", "output": "0" }, { "input": "9\n0 0 0 0 0 0 0 0 0", "output": "28" }, { "input": "10\n2 5 -2 2 -3 -2 3 5 -5 -2", "output": "0" }, { "input": "1\n1", "output": "0" }, { "input": "3\n1 2 3", "output": "0" }, { "input": "100\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1", "output": "2030" }, { "input": "6\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000", "output": "1" }, { "input": "10\n1 0 0 0 1 1 1 0 1 1", "output": "2" }, { "input": "10\n-2 2 -2 0 -2 -1 1 -1 2 0", "output": "0" }, { "input": "4\n0 2 -1 2", "output": "0" }, { "input": "5\n3 3 -3 3 3", "output": "3" }, { "input": "5\n1 1 1 1 1", "output": "0" }, { "input": "8\n-1 -1 -1 -1 -1 -1 -1 -1", "output": "0" }, { "input": "2\n0 0", "output": "0" }, { "input": "4\n1 -1 0 0", "output": "1" }, { "input": "3\n6 -3 6", "output": "0" } ]
1,683,722,739
2,147,483,647
PyPy 3-64
TIME_LIMIT_EXCEEDED
TESTS
5
2,000
13,004,800
input() nums = list(map(int,input().split())) value = sum(nums)%3 if value!=0: print(0) else: first_target = sum(nums)//3 second_target = first_target*2 third_target = first_target*3 # prefix_sum = for i in range(1,len(nums)): nums[i] = nums[i-1] + nums[i] first=[] second=[] third=[] for i in range(len(nums)): if nums[i]==first_target: first.append(i) if nums[i]==second_target: second.append(i) if nums[i]==third_target: third.append(i) ans=0 for one in first: for two in second: for three in third: if one<two<three: ans=ans+1 break # print(first) # print(second) # print(third) print(ans)
Title: Number of Ways Time Limit: None seconds Memory Limit: None megabytes Problem Description: You've got array *a*[1],<=*a*[2],<=...,<=*a*[*n*], consisting of *n* integers. Count the number of ways to split all the elements of the array into three contiguous parts so that the sum of elements in each part is the same. More formally, you need to find the number of such pairs of indices *i*,<=*j* (2<=≤<=*i*<=≤<=*j*<=≤<=*n*<=-<=1), that . Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=5·105), showing how many numbers are in the array. The second line contains *n* integers *a*[1], *a*[2], ..., *a*[*n*] (|*a*[*i*]|<=≤<=<=109) — the elements of array *a*. Output Specification: Print a single integer — the number of ways to split the array into three parts with the same sum. Demo Input: ['5\n1 2 3 0 3\n', '4\n0 1 -1 0\n', '2\n4 1\n'] Demo Output: ['2\n', '1\n', '0\n'] Note: none
```python input() nums = list(map(int,input().split())) value = sum(nums)%3 if value!=0: print(0) else: first_target = sum(nums)//3 second_target = first_target*2 third_target = first_target*3 # prefix_sum = for i in range(1,len(nums)): nums[i] = nums[i-1] + nums[i] first=[] second=[] third=[] for i in range(len(nums)): if nums[i]==first_target: first.append(i) if nums[i]==second_target: second.append(i) if nums[i]==third_target: third.append(i) ans=0 for one in first: for two in second: for three in third: if one<two<three: ans=ans+1 break # print(first) # print(second) # print(third) print(ans) ```
0
369
A
Valera and Plates
PROGRAMMING
900
[ "greedy", "implementation" ]
null
null
Valera is a lazy student. He has *m* clean bowls and *k* clean plates. Valera has made an eating plan for the next *n* days. As Valera is lazy, he will eat exactly one dish per day. At that, in order to eat a dish, he needs exactly one clean plate or bowl. We know that Valera can cook only two types of dishes. He can eat dishes of the first type from bowls and dishes of the second type from either bowls or plates. When Valera finishes eating, he leaves a dirty plate/bowl behind. His life philosophy doesn't let him eat from dirty kitchenware. So sometimes he needs to wash his plate/bowl before eating. Find the minimum number of times Valera will need to wash a plate/bowl, if he acts optimally.
The first line of the input contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=1000) — the number of the planned days, the number of clean bowls and the number of clean plates. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2). If *a**i* equals one, then on day *i* Valera will eat a first type dish. If *a**i* equals two, then on day *i* Valera will eat a second type dish.
Print a single integer — the minimum number of times Valera will need to wash a plate/bowl.
[ "3 1 1\n1 2 1\n", "4 3 1\n1 1 1 1\n", "3 1 2\n2 2 2\n", "8 2 2\n1 2 1 2 1 2 1 2\n" ]
[ "1\n", "1\n", "0\n", "4\n" ]
In the first sample Valera will wash a bowl only on the third day, so the answer is one. In the second sample, Valera will have the first type of the dish during all four days, and since there are only three bowls, he will wash a bowl exactly once. In the third sample, Valera will have the second type of dish for all three days, and as they can be eaten from either a plate or a bowl, he will never need to wash a plate/bowl.
500
[ { "input": "3 1 1\n1 2 1", "output": "1" }, { "input": "4 3 1\n1 1 1 1", "output": "1" }, { "input": "3 1 2\n2 2 2", "output": "0" }, { "input": "8 2 2\n1 2 1 2 1 2 1 2", "output": "4" }, { "input": "2 100 100\n2 2", "output": "0" }, { "input": "1 1 1\n2", "output": "0" }, { "input": "233 100 1\n2 2 1 1 1 2 2 2 2 1 1 2 2 2 1 2 2 1 1 1 2 2 1 1 1 1 2 1 2 2 1 1 2 2 1 2 2 1 2 1 2 1 2 2 2 1 1 1 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 2 2 2 1 1 2 2 1 1 1 1 2 1 1 2 1 2 2 2 1 1 1 2 2 2 1 1 1 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 1 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 1 2 2 1 1 1 2 2 1 1 2 2 1 1 2 1 1 2 2 1 2 2 2 2 2 2 1 2 2 2 2 2 1 1 2 2 2 2 2 2 1 1 1 2 1 2 2 2 2 2 2 2 2 1 1 2 1 2 1 2 2", "output": "132" }, { "input": "123 100 1\n2 2 2 1 1 2 2 2 2 1 1 2 2 2 1 2 2 2 2 1 2 2 2 1 1 1 2 2 2 2 1 2 2 2 2 2 2 1 2 1 2 1 2 2 2 1 2 1 2 2 1 2 2 1 2 2 1 2 2 1 2 2 2 1 1 1 1 1 1 1 1 1 2 2 2 2 2 1 1 2 2 1 1 1 1 2 1 2 2 1 2 2 2 1 1 1 2 2 2 1 2 2 2 2 1 2 2 2 2 1 2 2 2 1 1 2 1 2 1 2 1 1 1", "output": "22" }, { "input": "188 100 1\n2 2 1 1 1 2 2 2 2 1 1 2 2 2 1 2 2 1 1 1 2 2 1 1 1 1 2 1 2 2 1 1 2 2 1 2 2 1 2 1 2 1 2 2 2 1 1 1 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 2 2 2 1 1 2 2 1 1 1 1 2 1 1 2 1 2 2 2 1 1 1 2 2 2 1 1 1 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 1 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 1 2 2 1 1 1 2 2 1 1 2 2 1 1 2 1", "output": "87" }, { "input": "3 1 2\n1 1 1", "output": "2" }, { "input": "3 2 2\n1 1 1", "output": "1" }, { "input": "3 2 1\n1 1 1", "output": "1" }, { "input": "3 1 1\n1 1 1", "output": "2" }, { "input": "5 1 2\n2 2 2 2 2", "output": "2" }, { "input": "5 2 2\n2 2 2 2 2", "output": "1" }, { "input": "5 2 1\n2 2 2 2 2", "output": "2" }, { "input": "5 1 1\n2 2 2 2 2", "output": "3" }, { "input": "1 1 2\n2", "output": "0" }, { "input": "1 2 2\n2", "output": "0" }, { "input": "1 2 1\n2", "output": "0" }, { "input": "1 1 1\n2", "output": "0" }, { "input": "6 3 1\n1 1 2 2 2 2", "output": "2" }, { "input": "100 40 20\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "40" }, { "input": "7 5 2\n2 2 1 1 1 1 1", "output": "0" }, { "input": "10 4 4\n2 2 2 2 2 2 1 1 1 1", "output": "2" }, { "input": "3 2 1\n2 1 1", "output": "0" }, { "input": "7 6 1\n2 1 1 1 1 1 1", "output": "0" }, { "input": "7 5 1\n1 1 1 2 2 2 2", "output": "1" }, { "input": "5 3 1\n1 1 2 2 2", "output": "1" }, { "input": "3 1 1\n2 2 2", "output": "1" }, { "input": "5 2 2\n2 2 2 2 2", "output": "1" }, { "input": "3 1 3\n1 1 1", "output": "2" }, { "input": "5 2 1\n1 1 2 2 2", "output": "2" }, { "input": "4 3 2\n2 1 1 1", "output": "0" }, { "input": "4 2 1\n1 2 2 2", "output": "1" }, { "input": "14 4 7\n1 1 1 2 2 2 2 2 2 2 2 2 2 2", "output": "3" }, { "input": "12 10 4\n2 2 2 2 2 2 1 1 1 1 1 1", "output": "0" }, { "input": "5 3 2\n2 2 1 1 1", "output": "0" } ]
1,675,609,840
2,147,483,647
Python 3
OK
TESTS
63
46
0
# LUOGU_RID: 101541410 n, m, k, *a = map(int, open(0).read().split()) print(max(0, n - a.count(2) - min(0, k - a.count(2)) - m))
Title: Valera and Plates Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera is a lazy student. He has *m* clean bowls and *k* clean plates. Valera has made an eating plan for the next *n* days. As Valera is lazy, he will eat exactly one dish per day. At that, in order to eat a dish, he needs exactly one clean plate or bowl. We know that Valera can cook only two types of dishes. He can eat dishes of the first type from bowls and dishes of the second type from either bowls or plates. When Valera finishes eating, he leaves a dirty plate/bowl behind. His life philosophy doesn't let him eat from dirty kitchenware. So sometimes he needs to wash his plate/bowl before eating. Find the minimum number of times Valera will need to wash a plate/bowl, if he acts optimally. Input Specification: The first line of the input contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=1000) — the number of the planned days, the number of clean bowls and the number of clean plates. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2). If *a**i* equals one, then on day *i* Valera will eat a first type dish. If *a**i* equals two, then on day *i* Valera will eat a second type dish. Output Specification: Print a single integer — the minimum number of times Valera will need to wash a plate/bowl. Demo Input: ['3 1 1\n1 2 1\n', '4 3 1\n1 1 1 1\n', '3 1 2\n2 2 2\n', '8 2 2\n1 2 1 2 1 2 1 2\n'] Demo Output: ['1\n', '1\n', '0\n', '4\n'] Note: In the first sample Valera will wash a bowl only on the third day, so the answer is one. In the second sample, Valera will have the first type of the dish during all four days, and since there are only three bowls, he will wash a bowl exactly once. In the third sample, Valera will have the second type of dish for all three days, and as they can be eaten from either a plate or a bowl, he will never need to wash a plate/bowl.
```python # LUOGU_RID: 101541410 n, m, k, *a = map(int, open(0).read().split()) print(max(0, n - a.count(2) - min(0, k - a.count(2)) - m)) ```
3
275
A
Lights Out
PROGRAMMING
900
[ "implementation" ]
null
null
Lenny is playing a game on a 3<=×<=3 grid of lights. In the beginning of the game all lights are switched on. Pressing any of the lights will toggle it and all side-adjacent lights. The goal of the game is to switch all the lights off. We consider the toggling as follows: if the light was switched on then it will be switched off, if it was switched off then it will be switched on. Lenny has spent some time playing with the grid and by now he has pressed each light a certain number of times. Given the number of times each light is pressed, you have to print the current state of each light.
The input consists of three rows. Each row contains three integers each between 0 to 100 inclusive. The *j*-th number in the *i*-th row is the number of times the *j*-th light of the *i*-th row of the grid is pressed.
Print three lines, each containing three characters. The *j*-th character of the *i*-th line is "1" if and only if the corresponding light is switched on, otherwise it's "0".
[ "1 0 0\n0 0 0\n0 0 1\n", "1 0 1\n8 8 8\n2 0 3\n" ]
[ "001\n010\n100\n", "010\n011\n100\n" ]
none
500
[ { "input": "1 0 0\n0 0 0\n0 0 1", "output": "001\n010\n100" }, { "input": "1 0 1\n8 8 8\n2 0 3", "output": "010\n011\n100" }, { "input": "13 85 77\n25 50 45\n65 79 9", "output": "000\n010\n000" }, { "input": "96 95 5\n8 84 74\n67 31 61", "output": "011\n011\n101" }, { "input": "24 54 37\n60 63 6\n1 84 26", "output": "110\n101\n011" }, { "input": "23 10 40\n15 6 40\n92 80 77", "output": "101\n100\n000" }, { "input": "62 74 80\n95 74 93\n2 47 95", "output": "010\n001\n110" }, { "input": "80 83 48\n26 0 66\n47 76 37", "output": "000\n000\n010" }, { "input": "32 15 65\n7 54 36\n5 51 3", "output": "111\n101\n001" }, { "input": "22 97 12\n71 8 24\n100 21 64", "output": "100\n001\n100" }, { "input": "46 37 13\n87 0 50\n90 8 55", "output": "111\n011\n000" }, { "input": "57 43 58\n20 82 83\n66 16 52", "output": "111\n010\n110" }, { "input": "45 56 93\n47 51 59\n18 51 63", "output": "101\n011\n100" }, { "input": "47 66 67\n14 1 37\n27 81 69", "output": "001\n001\n110" }, { "input": "26 69 69\n85 18 23\n14 22 74", "output": "110\n001\n010" }, { "input": "10 70 65\n94 27 25\n74 66 30", "output": "111\n010\n100" }, { "input": "97 1 74\n15 99 1\n88 68 86", "output": "001\n011\n000" }, { "input": "36 48 42\n45 41 66\n26 64 1", "output": "001\n111\n010" }, { "input": "52 81 97\n29 77 71\n66 11 2", "output": "100\n100\n111" }, { "input": "18 66 33\n19 49 49\n48 46 26", "output": "011\n100\n000" }, { "input": "68 79 52\n51 39 100\n29 14 26", "output": "110\n000\n111" }, { "input": "91 69 77\n91 26 64\n91 88 57", "output": "001\n011\n110" }, { "input": "16 69 64\n48 21 80\n81 51 51", "output": "010\n101\n111" }, { "input": "96 14 2\n100 18 12\n65 34 89", "output": "111\n010\n010" }, { "input": "93 95 90\n8 59 42\n53 13 19", "output": "100\n001\n111" }, { "input": "71 84 18\n100 19 67\n9 76 15", "output": "010\n010\n001" }, { "input": "38 93 85\n21 88 64\n4 96 25", "output": "111\n011\n000" }, { "input": "75 20 20\n60 5 78\n77 4 69", "output": "011\n001\n000" }, { "input": "65 70 96\n19 6 83\n33 37 82", "output": "100\n000\n011" }, { "input": "11 13 60\n17 13 46\n42 21 39", "output": "000\n011\n101" }, { "input": "0 0 0\n0 0 0\n0 0 0", "output": "111\n111\n111" }, { "input": "0 0 0\n0 1 0\n0 0 0", "output": "101\n000\n101" }, { "input": "0 0 0\n0 0 0\n0 0 1", "output": "111\n110\n100" } ]
1,591,868,069
2,147,483,647
PyPy 3
OK
TESTS
33
155
0
a=[[1,1,1],[1,1,1],[1,1,1]] c=[] for i in range(3): b=list(map(int,input().split()))[:3] c.append(b) for i in range(3): for j in range(3): if c[i][j]%2==1: if a[i][j]==0: a[i][j]=1 else: a[i][j]=0 if i-1>=0: if a[i-1][j]==0: a[i-1][j]=1 else: a[i-1][j]=0 if i+1<3: if a[i+1][j]==0: a[i+1][j]=1 else: a[i+1][j]=0 if j+1<3: if a[i][j+1]==0: a[i][j+1]=1 else: a[i][j+1]=0 if j-1>=0: if a[i][j-1]==0: a[i][j-1]=1 else: a[i][j-1]=0 for i in range(3): for j in range(3): print(a[i][j],end='') print()
Title: Lights Out Time Limit: None seconds Memory Limit: None megabytes Problem Description: Lenny is playing a game on a 3<=×<=3 grid of lights. In the beginning of the game all lights are switched on. Pressing any of the lights will toggle it and all side-adjacent lights. The goal of the game is to switch all the lights off. We consider the toggling as follows: if the light was switched on then it will be switched off, if it was switched off then it will be switched on. Lenny has spent some time playing with the grid and by now he has pressed each light a certain number of times. Given the number of times each light is pressed, you have to print the current state of each light. Input Specification: The input consists of three rows. Each row contains three integers each between 0 to 100 inclusive. The *j*-th number in the *i*-th row is the number of times the *j*-th light of the *i*-th row of the grid is pressed. Output Specification: Print three lines, each containing three characters. The *j*-th character of the *i*-th line is "1" if and only if the corresponding light is switched on, otherwise it's "0". Demo Input: ['1 0 0\n0 0 0\n0 0 1\n', '1 0 1\n8 8 8\n2 0 3\n'] Demo Output: ['001\n010\n100\n', '010\n011\n100\n'] Note: none
```python a=[[1,1,1],[1,1,1],[1,1,1]] c=[] for i in range(3): b=list(map(int,input().split()))[:3] c.append(b) for i in range(3): for j in range(3): if c[i][j]%2==1: if a[i][j]==0: a[i][j]=1 else: a[i][j]=0 if i-1>=0: if a[i-1][j]==0: a[i-1][j]=1 else: a[i-1][j]=0 if i+1<3: if a[i+1][j]==0: a[i+1][j]=1 else: a[i+1][j]=0 if j+1<3: if a[i][j+1]==0: a[i][j+1]=1 else: a[i][j+1]=0 if j-1>=0: if a[i][j-1]==0: a[i][j-1]=1 else: a[i][j-1]=0 for i in range(3): for j in range(3): print(a[i][j],end='') print() ```
3
946
B
Weird Subtraction Process
PROGRAMMING
1,100
[ "math", "number theory" ]
null
null
You have two variables *a* and *b*. Consider the following sequence of actions performed with these variables: 1. If *a*<==<=0 or *b*<==<=0, end the process. Otherwise, go to step 2;1. If *a*<=≥<=2·*b*, then set the value of *a* to *a*<=-<=2·*b*, and repeat step 1. Otherwise, go to step 3;1. If *b*<=≥<=2·*a*, then set the value of *b* to *b*<=-<=2·*a*, and repeat step 1. Otherwise, end the process. Initially the values of *a* and *b* are positive integers, and so the process will be finite. You have to determine the values of *a* and *b* after the process ends.
The only line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1018). *n* is the initial value of variable *a*, and *m* is the initial value of variable *b*.
Print two integers — the values of *a* and *b* after the end of the process.
[ "12 5\n", "31 12\n" ]
[ "0 1\n", "7 12\n" ]
Explanations to the samples: 1. *a* = 12, *b* = 5 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 2, *b* = 5 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 2, *b* = 1 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 0, *b* = 1;1. *a* = 31, *b* = 12 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 7, *b* = 12.
0
[ { "input": "12 5", "output": "0 1" }, { "input": "31 12", "output": "7 12" }, { "input": "1000000000000000000 7", "output": "8 7" }, { "input": "31960284556200 8515664064180", "output": "14928956427840 8515664064180" }, { "input": "1000000000000000000 1000000000000000000", "output": "1000000000000000000 1000000000000000000" }, { "input": "1 1000", "output": "1 0" }, { "input": "1 1000000", "output": "1 0" }, { "input": "1 1000000000000000", "output": "1 0" }, { "input": "1 99999999999999999", "output": "1 1" }, { "input": "1 4", "output": "1 0" }, { "input": "1000000000000001 500000000000000", "output": "1 0" }, { "input": "1 1000000000000000000", "output": "1 0" }, { "input": "2 4", "output": "2 0" }, { "input": "2 1", "output": "0 1" }, { "input": "6 19", "output": "6 7" }, { "input": "22 5", "output": "0 1" }, { "input": "10000000000000000 100000000000000001", "output": "0 1" }, { "input": "1 1000000000000", "output": "1 0" }, { "input": "2 1000000000000000", "output": "2 0" }, { "input": "2 10", "output": "2 2" }, { "input": "51 100", "output": "51 100" }, { "input": "3 1000000000000000000", "output": "3 4" }, { "input": "1000000000000000000 3", "output": "4 3" }, { "input": "1 10000000000000000", "output": "1 0" }, { "input": "8796203 7556", "output": "1019 1442" }, { "input": "5 22", "output": "1 0" }, { "input": "1000000000000000000 1", "output": "0 1" }, { "input": "1 100000000000", "output": "1 0" }, { "input": "2 1000000000000", "output": "2 0" }, { "input": "5 4567865432345678", "output": "5 8" }, { "input": "576460752303423487 288230376151711743", "output": "1 1" }, { "input": "499999999999999999 1000000000000000000", "output": "3 2" }, { "input": "1 9999999999999", "output": "1 1" }, { "input": "103 1000000000000000000", "output": "103 196" }, { "input": "7 1", "output": "1 1" }, { "input": "100000000000000001 10000000000000000", "output": "1 0" }, { "input": "5 10", "output": "5 0" }, { "input": "7 11", "output": "7 11" }, { "input": "1 123456789123456", "output": "1 0" }, { "input": "5000000000000 100000000000001", "output": "0 1" }, { "input": "1000000000000000 1", "output": "0 1" }, { "input": "1000000000000000000 499999999999999999", "output": "2 3" }, { "input": "10 5", "output": "0 5" }, { "input": "9 18917827189272", "output": "9 0" }, { "input": "179 100000000000497000", "output": "179 270" }, { "input": "5 100000000000001", "output": "1 1" }, { "input": "5 20", "output": "5 0" }, { "input": "100000001 50000000", "output": "1 0" }, { "input": "345869461223138161 835002744095575440", "output": "1 0" }, { "input": "8589934592 4294967296", "output": "0 4294967296" }, { "input": "4 8", "output": "4 0" }, { "input": "1 100000000000000000", "output": "1 0" }, { "input": "1000000000000000000 333333333333333", "output": "1000 1333" }, { "input": "25 12", "output": "1 0" }, { "input": "24 54", "output": "0 6" }, { "input": "6 12", "output": "6 0" }, { "input": "129200000000305 547300000001292", "output": "1 0" }, { "input": "1000000000000000000 49999999999999999", "output": "20 39" }, { "input": "1 2", "output": "1 0" }, { "input": "1 123456789876", "output": "1 0" }, { "input": "2 3", "output": "2 3" }, { "input": "1 3", "output": "1 1" }, { "input": "1 1", "output": "1 1" }, { "input": "19 46", "output": "3 2" }, { "input": "3 6", "output": "3 0" }, { "input": "129 1000000000000000000", "output": "1 0" }, { "input": "12 29", "output": "0 1" }, { "input": "8589934592 2147483648", "output": "0 2147483648" }, { "input": "2147483648 8589934592", "output": "2147483648 0" }, { "input": "5 6", "output": "5 6" }, { "input": "1000000000000000000 2", "output": "0 2" }, { "input": "2 7", "output": "2 3" }, { "input": "17174219820754872 61797504734333370", "output": "17174219820754872 27449065092823626" }, { "input": "49 100", "output": "1 0" }, { "input": "7 17", "output": "1 1" }, { "input": "1000000000000000000 10000001", "output": "0 1" }, { "input": "49999999999999999 2", "output": "3 2" }, { "input": "49999999999999999 1", "output": "1 1" }, { "input": "576460752303423487 2", "output": "3 2" }, { "input": "19395 19395", "output": "19395 19395" }, { "input": "19394 19394", "output": "19394 19394" } ]
1,567,925,685
2,147,483,647
Python 3
OK
TESTS
81
124
0
n,m = map(int,input().split()) while True: if n == 0 or m == 0: break if n>=2*m: n = n%(2*m) elif m>=2*n: m = m%(2*n) else: break print(n,m)
Title: Weird Subtraction Process Time Limit: None seconds Memory Limit: None megabytes Problem Description: You have two variables *a* and *b*. Consider the following sequence of actions performed with these variables: 1. If *a*<==<=0 or *b*<==<=0, end the process. Otherwise, go to step 2;1. If *a*<=≥<=2·*b*, then set the value of *a* to *a*<=-<=2·*b*, and repeat step 1. Otherwise, go to step 3;1. If *b*<=≥<=2·*a*, then set the value of *b* to *b*<=-<=2·*a*, and repeat step 1. Otherwise, end the process. Initially the values of *a* and *b* are positive integers, and so the process will be finite. You have to determine the values of *a* and *b* after the process ends. Input Specification: The only line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1018). *n* is the initial value of variable *a*, and *m* is the initial value of variable *b*. Output Specification: Print two integers — the values of *a* and *b* after the end of the process. Demo Input: ['12 5\n', '31 12\n'] Demo Output: ['0 1\n', '7 12\n'] Note: Explanations to the samples: 1. *a* = 12, *b* = 5 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 2, *b* = 5 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 2, *b* = 1 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 0, *b* = 1;1. *a* = 31, *b* = 12 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 7, *b* = 12.
```python n,m = map(int,input().split()) while True: if n == 0 or m == 0: break if n>=2*m: n = n%(2*m) elif m>=2*n: m = m%(2*n) else: break print(n,m) ```
3
474
B
Worms
PROGRAMMING
1,200
[ "binary search", "implementation" ]
null
null
It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch. Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding. Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained. Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile. The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot. The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms.
Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is.
[ "5\n2 7 3 4 9\n3\n1 25 11\n" ]
[ "1\n5\n3\n" ]
For the sample input: - The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
1,000
[ { "input": "5\n2 7 3 4 9\n3\n1 25 11", "output": "1\n5\n3" } ]
1,682,098,541
2,147,483,647
Python 3
OK
TESTS
38
716
13,312,000
''' Online Python Compiler. Code, Compile, Run and Debug python program online. Write your code in this editor and press "Run" button to execute it. ''' n=int(input()) l=list(map(int,input().split())) m=int(input()) temp=list(map(int,input().split())) newtemp=[] for i in range(m): newtemp.append([temp[i],i]) ans=[-1 for _ in range(m)] newtemp.sort() for i in range(1,n): l[i]=l[i]+l[i-1] ptr=0 for i in range(m): sno,idx=newtemp[i] while ptr<n and l[ptr]<sno:ptr+=1 ans[idx]=ptr for ele in ans: print(ele+1)
Title: Worms Time Limit: None seconds Memory Limit: None megabytes Problem Description: It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch. Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding. Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained. Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile. The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot. The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms. Output Specification: Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is. Demo Input: ['5\n2 7 3 4 9\n3\n1 25 11\n'] Demo Output: ['1\n5\n3\n'] Note: For the sample input: - The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
```python ''' Online Python Compiler. Code, Compile, Run and Debug python program online. Write your code in this editor and press "Run" button to execute it. ''' n=int(input()) l=list(map(int,input().split())) m=int(input()) temp=list(map(int,input().split())) newtemp=[] for i in range(m): newtemp.append([temp[i],i]) ans=[-1 for _ in range(m)] newtemp.sort() for i in range(1,n): l[i]=l[i]+l[i-1] ptr=0 for i in range(m): sno,idx=newtemp[i] while ptr<n and l[ptr]<sno:ptr+=1 ans[idx]=ptr for ele in ans: print(ele+1) ```
3
988
C
Equal Sums
PROGRAMMING
1,400
[ "implementation", "sortings" ]
null
null
You are given $k$ sequences of integers. The length of the $i$-th sequence equals to $n_i$. You have to choose exactly two sequences $i$ and $j$ ($i \ne j$) such that you can remove exactly one element in each of them in such a way that the sum of the changed sequence $i$ (its length will be equal to $n_i - 1$) equals to the sum of the changed sequence $j$ (its length will be equal to $n_j - 1$). Note that it's required to remove exactly one element in each of the two chosen sequences. Assume that the sum of the empty (of the length equals $0$) sequence is $0$.
The first line contains an integer $k$ ($2 \le k \le 2 \cdot 10^5$) — the number of sequences. Then $k$ pairs of lines follow, each pair containing a sequence. The first line in the $i$-th pair contains one integer $n_i$ ($1 \le n_i &lt; 2 \cdot 10^5$) — the length of the $i$-th sequence. The second line of the $i$-th pair contains a sequence of $n_i$ integers $a_{i, 1}, a_{i, 2}, \dots, a_{i, n_i}$. The elements of sequences are integer numbers from $-10^4$ to $10^4$. The sum of lengths of all given sequences don't exceed $2 \cdot 10^5$, i.e. $n_1 + n_2 + \dots + n_k \le 2 \cdot 10^5$.
If it is impossible to choose two sequences such that they satisfy given conditions, print "NO" (without quotes). Otherwise in the first line print "YES" (without quotes), in the second line — two integers $i$, $x$ ($1 \le i \le k, 1 \le x \le n_i$), in the third line — two integers $j$, $y$ ($1 \le j \le k, 1 \le y \le n_j$). It means that the sum of the elements of the $i$-th sequence without the element with index $x$ equals to the sum of the elements of the $j$-th sequence without the element with index $y$. Two chosen sequences must be distinct, i.e. $i \ne j$. You can print them in any order. If there are multiple possible answers, print any of them.
[ "2\n5\n2 3 1 3 2\n6\n1 1 2 2 2 1\n", "3\n1\n5\n5\n1 1 1 1 1\n2\n2 3\n", "4\n6\n2 2 2 2 2 2\n5\n2 2 2 2 2\n3\n2 2 2\n5\n2 2 2 2 2\n" ]
[ "YES\n2 6\n1 2\n", "NO\n", "YES\n2 2\n4 1\n" ]
In the first example there are two sequences $[2, 3, 1, 3, 2]$ and $[1, 1, 2, 2, 2, 1]$. You can remove the second element from the first sequence to get $[2, 1, 3, 2]$ and you can remove the sixth element from the second sequence to get $[1, 1, 2, 2, 2]$. The sums of the both resulting sequences equal to $8$, i.e. the sums are equal.
0
[ { "input": "2\n5\n2 3 1 3 2\n6\n1 1 2 2 2 1", "output": "YES\n2 1\n1 4" }, { "input": "3\n1\n5\n5\n1 1 1 1 1\n2\n2 3", "output": "NO" }, { "input": "4\n6\n2 2 2 2 2 2\n5\n2 2 2 2 2\n3\n2 2 2\n5\n2 2 2 2 2", "output": "YES\n4 1\n2 5" }, { "input": "2\n2\n0 -10000\n2\n10000 0", "output": "YES\n2 1\n1 2" } ]
1,697,670,364
2,147,483,647
PyPy 3-64
TIME_LIMIT_EXCEEDED
TESTS
5
2,000
52,019,200
class Solution: def processSequence(self, i, sequence): # triplet = (reachable value, sequence index, removed element index) n = len(sequence) total = sum(sequence) for j in range(n): value = total - sequence[j] triplet = (value, i, j) self.triplets.append(triplet) def compatibleTriplets(self, a, b): (value_a, i, x) = a (value_b, j, y) = b if i == j: return False if value_a == value_b: self.ans.append((i, x)) self.ans.append((j, y)) return True return False def printAnswer(self): if not self.ans: print("NO") return (i, x) = self.ans[0] (j, y) = self.ans[1] print("YES") print(f"{i+1} {x+1}") print(f"{j+1} {y+1}") def solve(self, k, sequences): self.triplets = [] for i in range(k): self.processSequence(i, sequences[i]) self.triplets.sort() n = len(self.triplets) self.ans = [] for i in range(n-1): a = self.triplets[i] b = self.triplets[i+1] if self.compatibleTriplets(a, b): break self.printAnswer() if __name__ == "__main__": solver = Solution() k = int(input()) sequences = [] for i in range(k): input() nums = [int(x) for x in input().split(" ")] sequences.append(nums) solver.solve(k, sequences)
Title: Equal Sums Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given $k$ sequences of integers. The length of the $i$-th sequence equals to $n_i$. You have to choose exactly two sequences $i$ and $j$ ($i \ne j$) such that you can remove exactly one element in each of them in such a way that the sum of the changed sequence $i$ (its length will be equal to $n_i - 1$) equals to the sum of the changed sequence $j$ (its length will be equal to $n_j - 1$). Note that it's required to remove exactly one element in each of the two chosen sequences. Assume that the sum of the empty (of the length equals $0$) sequence is $0$. Input Specification: The first line contains an integer $k$ ($2 \le k \le 2 \cdot 10^5$) — the number of sequences. Then $k$ pairs of lines follow, each pair containing a sequence. The first line in the $i$-th pair contains one integer $n_i$ ($1 \le n_i &lt; 2 \cdot 10^5$) — the length of the $i$-th sequence. The second line of the $i$-th pair contains a sequence of $n_i$ integers $a_{i, 1}, a_{i, 2}, \dots, a_{i, n_i}$. The elements of sequences are integer numbers from $-10^4$ to $10^4$. The sum of lengths of all given sequences don't exceed $2 \cdot 10^5$, i.e. $n_1 + n_2 + \dots + n_k \le 2 \cdot 10^5$. Output Specification: If it is impossible to choose two sequences such that they satisfy given conditions, print "NO" (without quotes). Otherwise in the first line print "YES" (without quotes), in the second line — two integers $i$, $x$ ($1 \le i \le k, 1 \le x \le n_i$), in the third line — two integers $j$, $y$ ($1 \le j \le k, 1 \le y \le n_j$). It means that the sum of the elements of the $i$-th sequence without the element with index $x$ equals to the sum of the elements of the $j$-th sequence without the element with index $y$. Two chosen sequences must be distinct, i.e. $i \ne j$. You can print them in any order. If there are multiple possible answers, print any of them. Demo Input: ['2\n5\n2 3 1 3 2\n6\n1 1 2 2 2 1\n', '3\n1\n5\n5\n1 1 1 1 1\n2\n2 3\n', '4\n6\n2 2 2 2 2 2\n5\n2 2 2 2 2\n3\n2 2 2\n5\n2 2 2 2 2\n'] Demo Output: ['YES\n2 6\n1 2\n', 'NO\n', 'YES\n2 2\n4 1\n'] Note: In the first example there are two sequences $[2, 3, 1, 3, 2]$ and $[1, 1, 2, 2, 2, 1]$. You can remove the second element from the first sequence to get $[2, 1, 3, 2]$ and you can remove the sixth element from the second sequence to get $[1, 1, 2, 2, 2]$. The sums of the both resulting sequences equal to $8$, i.e. the sums are equal.
```python class Solution: def processSequence(self, i, sequence): # triplet = (reachable value, sequence index, removed element index) n = len(sequence) total = sum(sequence) for j in range(n): value = total - sequence[j] triplet = (value, i, j) self.triplets.append(triplet) def compatibleTriplets(self, a, b): (value_a, i, x) = a (value_b, j, y) = b if i == j: return False if value_a == value_b: self.ans.append((i, x)) self.ans.append((j, y)) return True return False def printAnswer(self): if not self.ans: print("NO") return (i, x) = self.ans[0] (j, y) = self.ans[1] print("YES") print(f"{i+1} {x+1}") print(f"{j+1} {y+1}") def solve(self, k, sequences): self.triplets = [] for i in range(k): self.processSequence(i, sequences[i]) self.triplets.sort() n = len(self.triplets) self.ans = [] for i in range(n-1): a = self.triplets[i] b = self.triplets[i+1] if self.compatibleTriplets(a, b): break self.printAnswer() if __name__ == "__main__": solver = Solution() k = int(input()) sequences = [] for i in range(k): input() nums = [int(x) for x in input().split(" ")] sequences.append(nums) solver.solve(k, sequences) ```
0
450
B
Jzzhu and Sequences
PROGRAMMING
1,300
[ "implementation", "math" ]
null
null
Jzzhu has invented a kind of sequences, they meet the following property: You are given *x* and *y*, please calculate *f**n* modulo 1000000007 (109<=+<=7).
The first line contains two integers *x* and *y* (|*x*|,<=|*y*|<=≤<=109). The second line contains a single integer *n* (1<=≤<=*n*<=≤<=2·109).
Output a single integer representing *f**n* modulo 1000000007 (109<=+<=7).
[ "2 3\n3\n", "0 -1\n2\n" ]
[ "1\n", "1000000006\n" ]
In the first sample, *f*<sub class="lower-index">2</sub> = *f*<sub class="lower-index">1</sub> + *f*<sub class="lower-index">3</sub>, 3 = 2 + *f*<sub class="lower-index">3</sub>, *f*<sub class="lower-index">3</sub> = 1. In the second sample, *f*<sub class="lower-index">2</sub> =  - 1;  - 1 modulo (10<sup class="upper-index">9</sup> + 7) equals (10<sup class="upper-index">9</sup> + 6).
1,000
[ { "input": "2 3\n3", "output": "1" }, { "input": "0 -1\n2", "output": "1000000006" }, { "input": "-9 -11\n12345", "output": "1000000005" }, { "input": "0 0\n1000000000", "output": "0" }, { "input": "-1000000000 1000000000\n2000000000", "output": "1000000000" }, { "input": "-12345678 12345678\n1912345678", "output": "12345678" }, { "input": "728374857 678374857\n1928374839", "output": "950000007" }, { "input": "278374837 992837483\n1000000000", "output": "721625170" }, { "input": "-693849384 502938493\n982838498", "output": "502938493" }, { "input": "-783928374 983738273\n992837483", "output": "16261734" }, { "input": "-872837483 -682738473\n999999999", "output": "190099010" }, { "input": "-892837483 -998273847\n999283948", "output": "892837483" }, { "input": "-283938494 738473848\n1999999999", "output": "716061513" }, { "input": "-278374857 819283838\n1", "output": "721625150" }, { "input": "-1000000000 123456789\n1", "output": "7" }, { "input": "-529529529 -524524524\n2", "output": "475475483" }, { "input": "1 2\n2000000000", "output": "2" }, { "input": "-1 -2\n2000000000", "output": "1000000005" }, { "input": "1 2\n1999999999", "output": "1" }, { "input": "1 2\n1999999998", "output": "1000000006" }, { "input": "1 2\n1999999997", "output": "1000000005" }, { "input": "1 2\n1999999996", "output": "1000000006" }, { "input": "69975122 366233206\n1189460676", "output": "703741923" }, { "input": "812229413 904420051\n806905621", "output": "812229413" }, { "input": "872099024 962697902\n1505821695", "output": "90598878" }, { "input": "887387283 909670917\n754835014", "output": "112612724" }, { "input": "37759824 131342932\n854621399", "output": "868657075" }, { "input": "-246822123 800496170\n626323615", "output": "753177884" }, { "input": "-861439463 974126967\n349411083", "output": "835566423" }, { "input": "-69811049 258093841\n1412447", "output": "741906166" }, { "input": "844509330 -887335829\n123329059", "output": "844509330" }, { "input": "83712471 -876177148\n1213284777", "output": "40110388" }, { "input": "598730524 -718984219\n1282749880", "output": "401269483" }, { "input": "-474244697 -745885656\n1517883612", "output": "271640959" }, { "input": "-502583588 -894906953\n1154189557", "output": "497416419" }, { "input": "-636523651 -873305815\n154879215", "output": "763217843" }, { "input": "721765550 594845720\n78862386", "output": "126919830" }, { "input": "364141461 158854993\n1337196589", "output": "364141461" }, { "input": "878985260 677031952\n394707801", "output": "798046699" }, { "input": "439527072 -24854079\n1129147002", "output": "464381151" }, { "input": "840435009 -612103127\n565968986", "output": "387896880" }, { "input": "875035447 -826471373\n561914518", "output": "124964560" }, { "input": "-342526698 305357084\n70776744", "output": "352116225" }, { "input": "-903244186 899202229\n1527859274", "output": "899202229" }, { "input": "-839482546 815166320\n1127472130", "output": "839482546" }, { "input": "-976992569 -958313041\n1686580818", "output": "981320479" }, { "input": "-497338894 -51069176\n737081851", "output": "502661113" }, { "input": "-697962643 -143148799\n1287886520", "output": "856851208" }, { "input": "-982572938 -482658433\n1259858332", "output": "982572938" }, { "input": "123123 78817\n2000000000", "output": "78817" }, { "input": "1000000000 -1000000000\n3", "output": "14" }, { "input": "-1000000000 1000000000\n6", "output": "14" }, { "input": "2 3\n6", "output": "1000000006" }, { "input": "0 -1\n6", "output": "1" }, { "input": "500000000 -1000000000\n600000003", "output": "500000014" }, { "input": "-1000000000 1000000000\n3", "output": "999999993" }, { "input": "1 3\n6", "output": "1000000005" }, { "input": "1 2\n12", "output": "1000000006" }, { "input": "7 -1000000000\n3", "output": "0" }, { "input": "-999999997 999999997\n6", "output": "20" }, { "input": "3 4\n6", "output": "1000000006" }, { "input": "-1 2\n6", "output": "1000000004" }, { "input": "2 3\n12", "output": "1000000006" }, { "input": "4 18\n6", "output": "999999993" }, { "input": "1 2\n6", "output": "1000000006" }, { "input": "1000000000 -1000000000\n6", "output": "999999993" }, { "input": "999999999 -999999999\n3", "output": "16" }, { "input": "-1 0\n1", "output": "1000000006" }, { "input": "1000000000 -1000000000\n9", "output": "14" }, { "input": "999999999 -1000000000\n12", "output": "999999992" }, { "input": "1000000000 -7\n3", "output": "0" }, { "input": "-5 5\n6", "output": "999999997" }, { "input": "5 9\n6", "output": "1000000003" }, { "input": "-15 -10\n1", "output": "999999992" } ]
1,647,956,697
2,147,483,647
PyPy 3-64
TIME_LIMIT_EXCEEDED
TESTS
3
1,000
2,048,000
def fibonacci(n,a,b): if n < 0: print("Incorrect input") elif n == 0: return a%1000000007 elif n == 1: return b%1000000007 else: for i in range(2,n+1): c = b-a a = b b = c return b%1000000007 # Driver Program a,b=map(int,input().split()) n=int(input()) n-=1 print(fibonacci(n,a,b))
Title: Jzzhu and Sequences Time Limit: None seconds Memory Limit: None megabytes Problem Description: Jzzhu has invented a kind of sequences, they meet the following property: You are given *x* and *y*, please calculate *f**n* modulo 1000000007 (109<=+<=7). Input Specification: The first line contains two integers *x* and *y* (|*x*|,<=|*y*|<=≤<=109). The second line contains a single integer *n* (1<=≤<=*n*<=≤<=2·109). Output Specification: Output a single integer representing *f**n* modulo 1000000007 (109<=+<=7). Demo Input: ['2 3\n3\n', '0 -1\n2\n'] Demo Output: ['1\n', '1000000006\n'] Note: In the first sample, *f*<sub class="lower-index">2</sub> = *f*<sub class="lower-index">1</sub> + *f*<sub class="lower-index">3</sub>, 3 = 2 + *f*<sub class="lower-index">3</sub>, *f*<sub class="lower-index">3</sub> = 1. In the second sample, *f*<sub class="lower-index">2</sub> =  - 1;  - 1 modulo (10<sup class="upper-index">9</sup> + 7) equals (10<sup class="upper-index">9</sup> + 6).
```python def fibonacci(n,a,b): if n < 0: print("Incorrect input") elif n == 0: return a%1000000007 elif n == 1: return b%1000000007 else: for i in range(2,n+1): c = b-a a = b b = c return b%1000000007 # Driver Program a,b=map(int,input().split()) n=int(input()) n-=1 print(fibonacci(n,a,b)) ```
0
765
B
Code obfuscation
PROGRAMMING
1,100
[ "greedy", "implementation", "strings" ]
null
null
Kostya likes Codeforces contests very much. However, he is very disappointed that his solutions are frequently hacked. That's why he decided to obfuscate (intentionally make less readable) his code before upcoming contest. To obfuscate the code, Kostya first looks at the first variable name used in his program and replaces all its occurrences with a single symbol *a*, then he looks at the second variable name that has not been replaced yet, and replaces all its occurrences with *b*, and so on. Kostya is well-mannered, so he doesn't use any one-letter names before obfuscation. Moreover, there are at most 26 unique identifiers in his programs. You are given a list of identifiers of some program with removed spaces and line breaks. Check if this program can be a result of Kostya's obfuscation.
In the only line of input there is a string *S* of lowercase English letters (1<=≤<=|*S*|<=≤<=500) — the identifiers of a program with removed whitespace characters.
If this program can be a result of Kostya's obfuscation, print "YES" (without quotes), otherwise print "NO".
[ "abacaba\n", "jinotega\n" ]
[ "YES\n", "NO\n" ]
In the first sample case, one possible list of identifiers would be "number string number character number string number". Here how Kostya would obfuscate the program: - replace all occurences of number with a, the result would be "a string a character a string a",- replace all occurences of string with b, the result would be "a b a character a b a",- replace all occurences of character with c, the result would be "a b a c a b a",- all identifiers have been replaced, thus the obfuscation is finished.
1,000
[ { "input": "abacaba", "output": "YES" }, { "input": "jinotega", "output": "NO" }, { "input": "aaaaaaaaaaa", "output": "YES" }, { "input": "aba", "output": "YES" }, { "input": "bab", "output": "NO" }, { "input": "a", "output": "YES" }, { "input": "abcdefghijklmnopqrstuvwxyz", "output": "YES" }, { "input": "fihyxmbnzq", "output": "NO" }, { "input": "aamlaswqzotaanasdhcvjoaiwdhctezzawagkdgfffeqkyrvbcrfqgkdsvximsnvmkmjyofswmtjdoxgwamsaatngenqvsvrvwlbzuoeaolfcnmdacrmdleafbsmerwmxzyylfhemnkoayuhtpbikm", "output": "NO" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "YES" }, { "input": "darbbbcwynbbbbaacbkvbakavabbbabzajlbajryaabbbccxraakgniagbtsswcfbkubdmcasccepybkaefcfsbzdddxgcjadybcfjtmqbspflqrdghgfwnccfveogdmifkociqscahdejctacwzbkhihajfilrgcjiofwfklifobozikcmvcfeqlidrgsgdfxffaaebzjxngsjxiclyolhjokqpdbfffooticxsezpgqkhhzmbmqgskkqvefzyijrwhpftcmbedmaflapmeljaudllojfpgfkpvgylaglrhrslxlprbhgknrctilngqccbddvpamhifsbmyowohczizjcbleehfrecjbqtxertnpfmalejmbxkhkkbyopuwlhkxuqellsybgcndvniyyxfoufalstdsdfjoxlnmigkqwmgojsppaannfstxytelluvvkdcezlqfsperwyjsdsmkvgjdbksswamhmoukcawiigkggztr", "output": "NO" }, { "input": "bbbbbb", "output": "NO" }, { "input": "aabbbd", "output": "NO" }, { "input": "abdefghijklmnopqrstuvwxyz", "output": "NO" }, { "input": "abcdeghijklmnopqrstuvwxyz", "output": "NO" }, { "input": "abcdefghijklmnopqrsuvwxyz", "output": "NO" }, { "input": "abcdefghijklmnopqrstuvwxy", "output": "YES" }, { "input": "abcdefghijklmnopqrsutvwxyz", "output": "NO" }, { "input": "acdef", "output": "NO" }, { "input": "z", "output": "NO" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaababaaababaabababccbabdbcbadccacdbdedabbeecbcabbdcaecdabbedddafeffaccgeacefbcahabfiiegecdbebabhhbdgfeghhbfahgagefbgghdbhadeicbdfgdchhefhigfcgdhcihecacfhadfgfejccibcjkfhbigbealjjkfldiecfdcafbamgfkbjlbifldghmiifkkglaflmjfmkfdjlbliijkgfdelklfnadbifgbmklfbqkhirhcadoadhmjrghlmelmjfpakqkdfcgqdkaeqpbcdoeqglqrarkipncckpfmajrqsfffldegbmahsfcqdfdqtrgrouqajgsojmmukptgerpanpcbejmergqtavwsvtveufdseuemwrhfmjqinxjodddnpcgqullrhmogflsxgsbapoghortiwcovejtinncozk", "output": "NO" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "YES" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbabbbabbaaabbaaaaabaabbaa", "output": "YES" }, { "input": "aababbabbaabbbbbaabababaabbbaaaaabbabbabbaabbbbabaabbaaababbaaacbbabbbbbbcbcababbccaaacbaccaccaababbccaacccaabaaccaaabacacbaabacbaacbaaabcbbbcbbaacaabcbcbccbacabbcbabcaccaaaaaabcbacabcbabbbbbabccbbcacbaaabbccbbaaaaaaaaaaaadbbbabdacabdaddddbaabbddbdabbdacbacbacaaaabbacadbcddddadaddabbdccaddbaaacbceebbceadbeaadecddbbbcaaecbdeaebaddbbdebbcbaabcacbdcdc", "output": "YES" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbaabaabaababbbabbacacbbbacbbaaaabbccacbaabaaccbbbbbcbbbacabbccaaabbaaacabcbacbcabbbbecbecadcbacbaadeeadabeacdebccdbbcaecdbeeebbebcaaaeacdcbdeccdbbdcdebdcbdacebcecbacddeeaebcedffedfggbeedceacaecagdfedfabcfchffceachgcbicbcffeeebgcgiefcafhibhceiedgbfebbccegbehhibhhfedbaeedbghggffehggaeaidifhdhaggdjcfjhiaieaichjacedchejg", "output": "NO" }, { "input": "b", "output": "NO" }, { "input": "ac", "output": "NO" }, { "input": "cde", "output": "NO" }, { "input": "abd", "output": "NO" }, { "input": "zx", "output": "NO" }, { "input": "bcd", "output": "NO" }, { "input": "aaac", "output": "NO" }, { "input": "aacb", "output": "NO" }, { "input": "acd", "output": "NO" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaz", "output": "NO" }, { "input": "abcdefghijklmnopqrstuvwxyzz", "output": "YES" }, { "input": "bc", "output": "NO" }, { "input": "aaaaaaaaad", "output": "NO" }, { "input": "abb", "output": "YES" }, { "input": "abcb", "output": "YES" }, { "input": "aac", "output": "NO" }, { "input": "abcbcb", "output": "YES" }, { "input": "bb", "output": "NO" }, { "input": "abbb", "output": "YES" }, { "input": "bbb", "output": "NO" }, { "input": "x", "output": "NO" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaazz", "output": "NO" }, { "input": "acbccccccccccc", "output": "NO" }, { "input": "za", "output": "NO" }, { "input": "ade", "output": "NO" }, { "input": "bbbbbbbbbb", "output": "NO" }, { "input": "bac", "output": "NO" }, { "input": "bcddcb", "output": "NO" }, { "input": "aaacb", "output": "NO" }, { "input": "aaaaac", "output": "NO" }, { "input": "aaaaaaaaaaad", "output": "NO" }, { "input": "c", "output": "NO" }, { "input": "abcccccccc", "output": "YES" }, { "input": "aaaaaaac", "output": "NO" } ]
1,551,615,756
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
11
124
0
m, seen = 'a', set() for ch in input(): if ch not in seen: if ch < m: print('NO') break m, seen = max(ch, m), seen | {ch} else: print('YES')
Title: Code obfuscation Time Limit: None seconds Memory Limit: None megabytes Problem Description: Kostya likes Codeforces contests very much. However, he is very disappointed that his solutions are frequently hacked. That's why he decided to obfuscate (intentionally make less readable) his code before upcoming contest. To obfuscate the code, Kostya first looks at the first variable name used in his program and replaces all its occurrences with a single symbol *a*, then he looks at the second variable name that has not been replaced yet, and replaces all its occurrences with *b*, and so on. Kostya is well-mannered, so he doesn't use any one-letter names before obfuscation. Moreover, there are at most 26 unique identifiers in his programs. You are given a list of identifiers of some program with removed spaces and line breaks. Check if this program can be a result of Kostya's obfuscation. Input Specification: In the only line of input there is a string *S* of lowercase English letters (1<=≤<=|*S*|<=≤<=500) — the identifiers of a program with removed whitespace characters. Output Specification: If this program can be a result of Kostya's obfuscation, print "YES" (without quotes), otherwise print "NO". Demo Input: ['abacaba\n', 'jinotega\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample case, one possible list of identifiers would be "number string number character number string number". Here how Kostya would obfuscate the program: - replace all occurences of number with a, the result would be "a string a character a string a",- replace all occurences of string with b, the result would be "a b a character a b a",- replace all occurences of character with c, the result would be "a b a c a b a",- all identifiers have been replaced, thus the obfuscation is finished.
```python m, seen = 'a', set() for ch in input(): if ch not in seen: if ch < m: print('NO') break m, seen = max(ch, m), seen | {ch} else: print('YES') ```
0
867
A
Between the Offices
PROGRAMMING
800
[ "implementation" ]
null
null
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane. You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days. The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise. You can print each letter in any case (upper or lower).
[ "4\nFSSF\n", "2\nSF\n", "10\nFFFFFFFFFF\n", "10\nSSFFSFFSFF\n" ]
[ "NO\n", "YES\n", "NO\n", "YES\n" ]
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO". In the second example you just flew from Seattle to San Francisco, so the answer is "YES". In the third example you stayed the whole period in San Francisco, so the answer is "NO". In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
500
[ { "input": "4\nFSSF", "output": "NO" }, { "input": "2\nSF", "output": "YES" }, { "input": "10\nFFFFFFFFFF", "output": "NO" }, { "input": "10\nSSFFSFFSFF", "output": "YES" }, { "input": "20\nSFSFFFFSSFFFFSSSSFSS", "output": "NO" }, { "input": "20\nSSFFFFFSFFFFFFFFFFFF", "output": "YES" }, { "input": "20\nSSFSFSFSFSFSFSFSSFSF", "output": "YES" }, { "input": "20\nSSSSFSFSSFSFSSSSSSFS", "output": "NO" }, { "input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF", "output": "NO" }, { "input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF", "output": "YES" }, { "input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS", "output": "NO" }, { "input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS", "output": "NO" }, { "input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS", "output": "NO" }, { "input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS", "output": "NO" }, { "input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS", "output": "NO" }, { "input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS", "output": "NO" }, { "input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS", "output": "NO" }, { "input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "YES" }, { "input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "YES" }, { "input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF", "output": "YES" }, { "input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF", "output": "YES" }, { "input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF", "output": "YES" }, { "input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF", "output": "YES" }, { "input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF", "output": "YES" }, { "input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF", "output": "YES" }, { "input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF", "output": "YES" }, { "input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF", "output": "YES" }, { "input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF", "output": "YES" }, { "input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF", "output": "YES" }, { "input": "2\nSS", "output": "NO" } ]
1,615,610,971
2,147,483,647
PyPy 3
OK
TESTS
34
93
0
n=int(input()) s=input() sf=0 fs=0 for i in range(1,n): if s[i-1]=="S" and s[i]=="F": sf+=1 elif s[i-1]=="F" and s[i]=="S": fs+=1 if sf>fs: print("YES") else: print("NO")
Title: Between the Offices Time Limit: None seconds Memory Limit: None megabytes Problem Description: As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane. You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not. Input Specification: The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days. The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence. Output Specification: Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise. You can print each letter in any case (upper or lower). Demo Input: ['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n'] Demo Output: ['NO\n', 'YES\n', 'NO\n', 'YES\n'] Note: In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO". In the second example you just flew from Seattle to San Francisco, so the answer is "YES". In the third example you stayed the whole period in San Francisco, so the answer is "NO". In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
```python n=int(input()) s=input() sf=0 fs=0 for i in range(1,n): if s[i-1]=="S" and s[i]=="F": sf+=1 elif s[i-1]=="F" and s[i]=="S": fs+=1 if sf>fs: print("YES") else: print("NO") ```
3
231
A
Team
PROGRAMMING
800
[ "brute force", "greedy" ]
null
null
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution. This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Print a single integer — the number of problems the friends will implement on the contest.
[ "3\n1 1 0\n1 1 1\n1 0 0\n", "2\n1 0 0\n0 1 1\n" ]
[ "2\n", "1\n" ]
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it. In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
500
[ { "input": "3\n1 1 0\n1 1 1\n1 0 0", "output": "2" }, { "input": "2\n1 0 0\n0 1 1", "output": "1" }, { "input": "1\n1 0 0", "output": "0" }, { "input": "2\n1 0 0\n1 1 1", "output": "1" }, { "input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0", "output": "1" }, { "input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0", "output": "4" }, { "input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1", "output": "10" }, { "input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1", "output": "29" }, { "input": "1\n1 1 1", "output": "1" }, { "input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1", "output": "4" }, { "input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1", "output": "16" } ]
1,698,305,966
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
60
0
n=int(input()) count=0 for _ in n: x, y, z=map(int,input().split()) if x+y+z>=2: count+=1 print(count)
Title: Team Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution. This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution. Input Specification: The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces. Output Specification: Print a single integer — the number of problems the friends will implement on the contest. Demo Input: ['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n'] Demo Output: ['2\n', '1\n'] Note: In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it. In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
```python n=int(input()) count=0 for _ in n: x, y, z=map(int,input().split()) if x+y+z>=2: count+=1 print(count) ```
-1
605
A
Sorting Railway Cars
PROGRAMMING
1,600
[ "constructive algorithms", "greedy" ]
null
null
An infinitely long railway has a train consisting of *n* cars, numbered from 1 to *n* (the numbers of all the cars are distinct) and positioned in arbitrary order. David Blaine wants to sort the railway cars in the order of increasing numbers. In one move he can make one of the cars disappear from its place and teleport it either to the beginning of the train, or to the end of the train, at his desire. What is the minimum number of actions David Blaine needs to perform in order to sort the train?
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of cars in the train. The second line contains *n* integers *p**i* (1<=≤<=*p**i*<=≤<=*n*, *p**i*<=≠<=*p**j* if *i*<=≠<=*j*) — the sequence of the numbers of the cars in the train.
Print a single integer — the minimum number of actions needed to sort the railway cars.
[ "5\n4 1 2 5 3\n", "4\n4 1 3 2\n" ]
[ "2\n", "2\n" ]
In the first sample you need first to teleport the 4-th car, and then the 5-th car to the end of the train.
500
[ { "input": "5\n4 1 2 5 3", "output": "2" }, { "input": "4\n4 1 3 2", "output": "2" }, { "input": "1\n1", "output": "0" }, { "input": "2\n1 2", "output": "0" }, { "input": "2\n2 1", "output": "1" }, { "input": "6\n5 3 6 1 4 2", "output": "4" }, { "input": "7\n1 2 3 6 7 4 5", "output": "2" }, { "input": "8\n6 2 1 8 5 7 3 4", "output": "5" }, { "input": "3\n1 2 3", "output": "0" }, { "input": "3\n1 3 2", "output": "1" }, { "input": "3\n2 1 3", "output": "1" }, { "input": "3\n2 3 1", "output": "1" }, { "input": "3\n3 1 2", "output": "1" }, { "input": "3\n3 2 1", "output": "2" }, { "input": "7\n1 3 5 7 2 4 6", "output": "5" }, { "input": "7\n1 5 2 6 3 7 4", "output": "3" }, { "input": "5\n1 4 2 3 5", "output": "2" }, { "input": "9\n1 6 4 5 9 8 7 3 2", "output": "7" }, { "input": "10\n5 1 6 2 8 3 4 10 9 7", "output": "6" }, { "input": "50\n39 8 41 9 45 1 5 18 38 31 28 7 12 49 33 19 26 6 42 13 37 27 2 21 20 22 14 16 48 47 32 50 25 17 35 24 36 4 29 15 43 10 11 30 40 46 3 23 44 34", "output": "46" }, { "input": "50\n43 15 10 33 32 31 13 7 5 22 36 1 25 14 38 19 8 6 24 42 28 21 44 35 4 3 49 30 27 46 2 9 17 37 45 41 18 39 12 11 16 20 50 26 29 34 40 47 48 23", "output": "47" }, { "input": "50\n10 40 34 43 50 17 15 13 9 2 32 18 11 46 27 24 36 16 29 45 42 4 47 19 48 37 41 5 21 26 22 25 44 31 35 49 20 8 12 23 6 38 14 1 7 28 3 33 39 30", "output": "46" }, { "input": "50\n10 37 3 46 45 29 36 13 21 25 35 5 18 33 12 19 50 16 30 47 20 42 39 28 2 6 38 8 7 31 22 27 26 9 15 14 34 48 4 32 40 43 44 24 11 1 23 17 49 41", "output": "46" }, { "input": "50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 42 37 38 39 40 41 36 43 44 45 46 47 48 49 50", "output": "14" }, { "input": "50\n1 2 3 4 5 6 7 8 43 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 50 33 34 35 36 37 38 39 40 41 42 9 44 45 46 47 48 49 32", "output": "27" }, { "input": "50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 49 40 41 47 43 44 45 46 42 50 39 48", "output": "11" }, { "input": "50\n1 2 3 4 27 6 7 8 9 10 30 12 13 14 15 16 17 18 19 20 21 22 23 24 28 26 5 25 29 11 31 32 33 34 38 36 37 35 39 40 41 42 43 44 45 46 47 48 49 50", "output": "36" }, { "input": "50\n1 2 3 4 5 6 7 49 9 10 17 12 13 14 15 16 11 18 19 20 21 22 23 24 25 26 27 38 29 36 30 32 33 34 35 31 37 28 39 40 41 42 43 44 45 46 47 48 8 50", "output": "38" }, { "input": "50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 31 18 19 20 21 23 22 24 25 26 27 28 29 49 17 32 33 34 39 36 37 38 47 44 41 42 43 40 45 46 35 48 30 50", "output": "33" }, { "input": "50\n1 2 15 4 5 6 7 8 9 10 11 12 13 14 3 16 17 18 19 32 21 22 36 28 23 26 27 24 29 30 31 20 33 34 37 25 35 38 40 39 41 42 43 44 45 46 47 48 49 50", "output": "39" }, { "input": "5\n4 3 1 2 5", "output": "3" }, { "input": "6\n1 3 5 6 4 2", "output": "4" }, { "input": "10\n2 1 4 3 6 5 8 7 10 9", "output": "8" }, { "input": "5\n1 2 4 5 3", "output": "2" }, { "input": "7\n1 4 2 3 7 6 5", "output": "4" }, { "input": "4\n3 1 2 4", "output": "2" }, { "input": "6\n2 5 4 3 6 1", "output": "4" }, { "input": "5\n1 3 4 5 2", "output": "2" }, { "input": "6\n2 4 6 5 1 3", "output": "4" }, { "input": "6\n1 2 4 5 6 3", "output": "3" }, { "input": "9\n9 8 7 4 5 6 3 2 1", "output": "6" }, { "input": "7\n4 1 2 3 6 5 7", "output": "4" } ]
1,482,527,064
2,147,483,647
Python 3
OK
TESTS
66
187
11,878,400
n = int(input()) l = list(map(int, input().split())) a = [0] * (n + 1) k = 0 for x in l: a[x] = a[x - 1] + 1 k = max(k, a[x]) print(n - k)
Title: Sorting Railway Cars Time Limit: None seconds Memory Limit: None megabytes Problem Description: An infinitely long railway has a train consisting of *n* cars, numbered from 1 to *n* (the numbers of all the cars are distinct) and positioned in arbitrary order. David Blaine wants to sort the railway cars in the order of increasing numbers. In one move he can make one of the cars disappear from its place and teleport it either to the beginning of the train, or to the end of the train, at his desire. What is the minimum number of actions David Blaine needs to perform in order to sort the train? Input Specification: The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of cars in the train. The second line contains *n* integers *p**i* (1<=≤<=*p**i*<=≤<=*n*, *p**i*<=≠<=*p**j* if *i*<=≠<=*j*) — the sequence of the numbers of the cars in the train. Output Specification: Print a single integer — the minimum number of actions needed to sort the railway cars. Demo Input: ['5\n4 1 2 5 3\n', '4\n4 1 3 2\n'] Demo Output: ['2\n', '2\n'] Note: In the first sample you need first to teleport the 4-th car, and then the 5-th car to the end of the train.
```python n = int(input()) l = list(map(int, input().split())) a = [0] * (n + 1) k = 0 for x in l: a[x] = a[x - 1] + 1 k = max(k, a[x]) print(n - k) ```
3
9
A
Die Roll
PROGRAMMING
800
[ "math", "probabilities" ]
A. Die Roll
1
64
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
[ "4 2\n" ]
[ "1/2\n" ]
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
0
[ { "input": "4 2", "output": "1/2" }, { "input": "1 1", "output": "1/1" }, { "input": "1 2", "output": "5/6" }, { "input": "1 3", "output": "2/3" }, { "input": "1 4", "output": "1/2" }, { "input": "1 5", "output": "1/3" }, { "input": "1 6", "output": "1/6" }, { "input": "2 1", "output": "5/6" }, { "input": "2 2", "output": "5/6" }, { "input": "2 3", "output": "2/3" }, { "input": "2 4", "output": "1/2" }, { "input": "2 5", "output": "1/3" }, { "input": "2 6", "output": "1/6" }, { "input": "3 1", "output": "2/3" }, { "input": "3 2", "output": "2/3" }, { "input": "3 3", "output": "2/3" }, { "input": "3 4", "output": "1/2" }, { "input": "3 5", "output": "1/3" }, { "input": "3 6", "output": "1/6" }, { "input": "4 1", "output": "1/2" }, { "input": "4 3", "output": "1/2" }, { "input": "4 4", "output": "1/2" }, { "input": "4 5", "output": "1/3" }, { "input": "4 6", "output": "1/6" }, { "input": "5 1", "output": "1/3" }, { "input": "5 2", "output": "1/3" }, { "input": "5 3", "output": "1/3" }, { "input": "5 4", "output": "1/3" }, { "input": "5 5", "output": "1/3" }, { "input": "5 6", "output": "1/6" }, { "input": "6 1", "output": "1/6" }, { "input": "6 2", "output": "1/6" }, { "input": "6 3", "output": "1/6" }, { "input": "6 4", "output": "1/6" }, { "input": "6 5", "output": "1/6" }, { "input": "6 6", "output": "1/6" } ]
1,594,987,259
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
1
622
30,310,400
from fractions import Fraction y, w = map(int,input().split()) if (Fraction((max(y,w)-1),6))!=1: print(Fraction((max(y,w)-1),6)) else: print("1/1")
Title: Die Roll Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win. Input Specification: The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls. Output Specification: Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1». Demo Input: ['4 2\n'] Demo Output: ['1/2\n'] Note: Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
```python from fractions import Fraction y, w = map(int,input().split()) if (Fraction((max(y,w)-1),6))!=1: print(Fraction((max(y,w)-1),6)) else: print("1/1") ```
0
952
D
I'm Feeling Lucky!
PROGRAMMING
1,800
[ "probabilities" ]
null
null
You have one chip and one chance to play roulette. Are you feeling lucky?
none
Print your bet. Your chip must be placed entirely within some square (not on an edge or a corner shared by adjacent squares).
[]
[]
none
0
[ { "input": "1", "output": "Red" }, { "input": "2", "output": "Red" } ]
1,646,024,830
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
30
0
print(23)
Title: I'm Feeling Lucky! Time Limit: None seconds Memory Limit: None megabytes Problem Description: You have one chip and one chance to play roulette. Are you feeling lucky? Input Specification: none Output Specification: Print your bet. Your chip must be placed entirely within some square (not on an edge or a corner shared by adjacent squares). Note: none
```python print(23) ```
0
430
B
Balls Game
PROGRAMMING
1,400
[ "brute force", "two pointers" ]
null
null
Iahub is training for the IOI. What is a better way to train than playing a Zuma-like game? There are *n* balls put in a row. Each ball is colored in one of *k* colors. Initially the row doesn't contain three or more contiguous balls with the same color. Iahub has a single ball of color *x*. He can insert his ball at any position in the row (probably, between two other balls). If at any moment there are three or more contiguous balls of the same color in the row, they are destroyed immediately. This rule is applied multiple times, until there are no more sets of 3 or more contiguous balls of the same color. For example, if Iahub has the row of balls [black, black, white, white, black, black] and a white ball, he can insert the ball between two white balls. Thus three white balls are destroyed, and then four black balls become contiguous, so all four balls are destroyed. The row will not contain any ball in the end, so Iahub can destroy all 6 balls. Iahub wants to destroy as many balls as possible. You are given the description of the row of balls, and the color of Iahub's ball. Help Iahub train for the IOI by telling him the maximum number of balls from the row he can destroy.
The first line of input contains three integers: *n* (1<=≤<=*n*<=≤<=100), *k* (1<=≤<=*k*<=≤<=100) and *x* (1<=≤<=*x*<=≤<=*k*). The next line contains *n* space-separated integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=*k*). Number *c**i* means that the *i*-th ball in the row has color *c**i*. It is guaranteed that the initial row of balls will never contain three or more contiguous balls of the same color.
Print a single integer — the maximum number of balls Iahub can destroy.
[ "6 2 2\n1 1 2 2 1 1\n", "1 1 1\n1\n" ]
[ "6\n", "0\n" ]
none
1,000
[ { "input": "6 2 2\n1 1 2 2 1 1", "output": "6" }, { "input": "1 1 1\n1", "output": "0" }, { "input": "10 2 1\n2 1 2 2 1 2 2 1 1 2", "output": "5" }, { "input": "50 2 1\n1 1 2 2 1 2 1 1 2 2 1 2 1 2 1 1 2 2 1 2 1 2 2 1 2 1 2 1 2 2 1 1 2 2 1 1 2 2 1 2 1 1 2 1 1 2 2 1 1 2", "output": "15" }, { "input": "75 5 5\n1 1 5 5 3 5 2 3 3 2 2 1 1 5 4 4 3 4 5 4 3 3 1 2 2 1 2 1 2 5 5 2 1 3 2 2 3 1 2 1 1 5 5 1 1 2 1 1 2 2 5 2 2 1 1 2 1 2 1 1 3 3 5 4 4 3 3 4 4 5 5 1 1 2 2", "output": "6" }, { "input": "100 3 2\n1 1 2 3 1 3 2 1 1 3 3 2 2 1 1 2 2 1 1 3 2 2 3 2 3 2 2 3 3 1 1 2 2 1 2 2 1 3 3 1 3 3 1 2 1 2 2 1 2 3 2 1 1 2 1 1 3 3 1 3 3 1 1 2 2 1 1 2 1 3 2 2 3 2 2 3 3 1 2 1 2 2 1 1 2 3 1 3 3 1 2 3 2 2 1 3 2 2 3 3", "output": "6" }, { "input": "100 2 1\n2 2 1 2 1 2 1 2 2 1 1 2 1 1 2 1 1 2 2 1 1 2 1 1 2 1 2 2 1 2 1 2 1 2 1 1 2 1 1 2 1 1 2 2 1 1 2 1 2 2 1 2 1 2 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 1 2 1 2 2 1 2 1 1 2 1 2 1 1 2 1 1 2 1 1 2 2 1 2 2 1 1 2 1", "output": "15" }, { "input": "100 2 2\n1 2 1 2 2 1 2 1 2 1 2 1 1 2 1 2 2 1 1 2 1 1 2 2 1 1 2 1 2 2 1 2 2 1 2 1 2 1 1 2 1 2 1 2 1 2 1 1 2 1 1 2 2 1 1 2 2 1 2 1 2 1 2 1 2 2 1 2 1 2 2 1 1 2 1 2 2 1 1 2 2 1 2 1 2 1 1 2 1 2 1 2 1 2 1 2 2 1 2 2", "output": "14" }, { "input": "100 2 2\n1 2 1 1 2 1 2 2 1 2 1 2 1 2 1 2 1 2 2 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 1 2 1 1 2 1 1 2 1 2 2 1 1 2 2 1 1 2 1 2 2 1 1 2 1 2 1 2 2 1 2 2 1 1 2 1 2 2 1 2 2 1 2 1 1 2 1 2 2 1 2 2 1 2 1 2 1 2 1 1 2 2 1 1 2 2", "output": "17" }, { "input": "100 2 2\n2 1 1 2 2 1 1 2 1 2 1 1 2 2 1 2 1 2 1 2 2 1 2 1 1 2 1 2 1 2 1 2 1 1 2 2 1 1 2 1 1 2 1 2 2 1 1 2 1 2 1 1 2 2 1 1 2 1 2 1 2 1 2 2 1 1 2 2 1 1 2 2 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 2 1 2 2 1 1 2 1 2 2 1 2 2", "output": "17" }, { "input": "100 2 2\n1 2 2 1 2 2 1 1 2 1 2 1 2 1 2 1 2 1 2 1 1 2 2 1 2 1 2 1 2 1 2 1 1 2 1 1 2 1 2 2 1 1 2 2 1 1 2 1 1 2 2 1 2 1 2 1 2 1 2 1 1 2 2 1 1 2 2 1 1 2 2 1 2 2 1 1 2 1 2 2 1 2 2 1 2 2 1 2 2 1 1 2 2 1 2 1 2 1 2 1", "output": "28" }, { "input": "100 2 2\n1 1 2 1 2 1 1 2 1 2 1 2 2 1 2 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 2 1 2 2 1 2 1 2 1 1 2 1 2 1 1 2 2 1 1 2 1 2 1 2 1 2 1 2 2 1 1 2 1 2 2 1 2 1 1 2 1 1 2 1 2 1 2 1 1 2 1 2 2 1 2 1 2 2 1 1 2 1 2 2 1 1 2 2", "output": "8" }, { "input": "100 100 50\n15 44 5 7 75 40 52 82 78 90 48 32 16 53 69 2 21 84 7 21 21 87 29 8 42 54 10 21 38 55 54 88 48 63 3 17 45 82 82 91 7 11 11 24 24 79 1 32 32 38 41 41 4 4 74 17 26 26 96 96 3 3 50 50 96 26 26 17 17 74 74 4 41 38 38 32 1 1 79 79 24 11 11 7 7 91 91 82 45 45 97 9 74 60 32 91 61 64 100 26", "output": "2" }, { "input": "100 50 22\n15 2 18 15 48 35 46 33 32 39 39 5 5 27 27 50 50 47 47 10 10 6 3 3 7 8 7 17 17 29 14 10 10 46 13 13 31 32 31 22 22 32 31 31 32 13 13 46 46 10 10 14 14 29 29 17 7 7 8 3 6 6 10 47 50 50 27 5 5 39 39 21 47 4 40 47 21 28 21 21 40 27 34 17 3 36 5 7 21 14 25 49 40 34 32 13 23 29 2 4", "output": "2" }, { "input": "100 3 3\n3 1 1 2 1 1 3 1 3 3 1 3 3 1 2 1 1 2 2 3 3 2 3 2 2 3 1 3 3 2 2 1 3 3 2 2 1 2 3 3 1 3 1 3 1 2 2 1 2 1 2 3 1 3 1 3 2 1 3 2 3 3 2 3 2 3 1 3 2 2 1 2 1 2 1 1 3 1 3 1 2 1 2 1 2 3 2 2 3 3 2 2 3 2 2 3 1 1 2 3", "output": "6" }, { "input": "100 100 100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "0" }, { "input": "100 2 2\n1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2", "output": "98" }, { "input": "6 20 10\n10 2 10 10 2 2", "output": "5" } ]
1,509,746,453
2,147,483,647
Python 3
OK
TESTS
18
93
409,600
import copy def main(): n, x, k = list(map(int, input().strip().split(' '))) balls = list(map(int, input().strip().split(' '))) original_balls = copy.deepcopy(balls) flag = 1 maxi = 0 # print(balls) for i in range(len(balls)): balls = copy.deepcopy(original_balls) if i + 1 < len(balls): if balls[i] == balls[i + 1] and balls[i] == k: # print(balls) new_balls = balls[:i + 1] + [k] + balls[i + 1:] # print(new_balls) flag = 1 while flag != 0: # print(new_balls) balls = new_balls new_balls = [] length = len(balls) flag = 0 for i in range(len(balls)): if i + 2 < length and balls[i] == balls[i + 1] and balls[i + 1] == balls[i + 2]: curr = i + 2 while curr + 1 < length and balls[i] == balls[curr + 1]: curr += 1 new_balls = balls[:i] + balls[curr + 1:] flag = 1 # print(len(new_balls)) break # print(len(balls)) maxi = max(maxi, len(original_balls) - len(balls)) print(maxi) if __name__ == '__main__': main()
Title: Balls Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Iahub is training for the IOI. What is a better way to train than playing a Zuma-like game? There are *n* balls put in a row. Each ball is colored in one of *k* colors. Initially the row doesn't contain three or more contiguous balls with the same color. Iahub has a single ball of color *x*. He can insert his ball at any position in the row (probably, between two other balls). If at any moment there are three or more contiguous balls of the same color in the row, they are destroyed immediately. This rule is applied multiple times, until there are no more sets of 3 or more contiguous balls of the same color. For example, if Iahub has the row of balls [black, black, white, white, black, black] and a white ball, he can insert the ball between two white balls. Thus three white balls are destroyed, and then four black balls become contiguous, so all four balls are destroyed. The row will not contain any ball in the end, so Iahub can destroy all 6 balls. Iahub wants to destroy as many balls as possible. You are given the description of the row of balls, and the color of Iahub's ball. Help Iahub train for the IOI by telling him the maximum number of balls from the row he can destroy. Input Specification: The first line of input contains three integers: *n* (1<=≤<=*n*<=≤<=100), *k* (1<=≤<=*k*<=≤<=100) and *x* (1<=≤<=*x*<=≤<=*k*). The next line contains *n* space-separated integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=*k*). Number *c**i* means that the *i*-th ball in the row has color *c**i*. It is guaranteed that the initial row of balls will never contain three or more contiguous balls of the same color. Output Specification: Print a single integer — the maximum number of balls Iahub can destroy. Demo Input: ['6 2 2\n1 1 2 2 1 1\n', '1 1 1\n1\n'] Demo Output: ['6\n', '0\n'] Note: none
```python import copy def main(): n, x, k = list(map(int, input().strip().split(' '))) balls = list(map(int, input().strip().split(' '))) original_balls = copy.deepcopy(balls) flag = 1 maxi = 0 # print(balls) for i in range(len(balls)): balls = copy.deepcopy(original_balls) if i + 1 < len(balls): if balls[i] == balls[i + 1] and balls[i] == k: # print(balls) new_balls = balls[:i + 1] + [k] + balls[i + 1:] # print(new_balls) flag = 1 while flag != 0: # print(new_balls) balls = new_balls new_balls = [] length = len(balls) flag = 0 for i in range(len(balls)): if i + 2 < length and balls[i] == balls[i + 1] and balls[i + 1] == balls[i + 2]: curr = i + 2 while curr + 1 < length and balls[i] == balls[curr + 1]: curr += 1 new_balls = balls[:i] + balls[curr + 1:] flag = 1 # print(len(new_balls)) break # print(len(balls)) maxi = max(maxi, len(original_balls) - len(balls)) print(maxi) if __name__ == '__main__': main() ```
3
932
A
Palindromic Supersequence
PROGRAMMING
800
[ "constructive algorithms" ]
null
null
You are given a string *A*. Find a string *B*, where *B* is a palindrome and *A* is a subsequence of *B*. A subsequence of a string is a string that can be derived from it by deleting some (not necessarily consecutive) characters without changing the order of the remaining characters. For example, "cotst" is a subsequence of "contest". A palindrome is a string that reads the same forward or backward. The length of string *B* should be at most 104. It is guaranteed that there always exists such string. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104.
First line contains a string *A* (1<=≤<=|*A*|<=≤<=103) consisting of lowercase Latin letters, where |*A*| is a length of *A*.
Output single line containing *B* consisting of only lowercase Latin letters. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. If there are many possible *B*, print any of them.
[ "aba\n", "ab\n" ]
[ "aba", "aabaa" ]
In the first example, "aba" is a subsequence of "aba" which is a palindrome. In the second example, "ab" is a subsequence of "aabaa" which is a palindrome.
500
[ { "input": "aba", "output": "abaaba" }, { "input": "ab", "output": "abba" }, { "input": "krnyoixirslfszfqivgkaflgkctvbvksipwomqxlyqxhlbceuhbjbfnhofcgpgwdseffycthmlpcqejgskwjkbkbbmifnurnwyhevsoqzmtvzgfiqajfrgyuzxnrtxectcnlyoisbglpdbjbslxlpoymrcxmdtqhcnlvtqdwftuzgbdxsyscwbrguostbelnvtaqdmkmihmoxqtqlxvlsssisvqvvzotoyqryuyqwoknnqcqggysrqpkrccvyhxsjmhoqoyocwcriplarjoyiqrmmpmueqbsbljddwrumauczfziodpudheexalbwpiypmdjlmwtgdrzhpxneofhqzjdmurgvmrwdotuwyknlrbvuvtnhiouvqitgyfgfieonbaapyhwpcrmehxcpkijzfiayfvoxkpa", "output": "krnyoixirslfszfqivgkaflgkctvbvksipwomqxlyqxhlbceuhbjbfnhofcgpgwdseffycthmlpcqejgskwjkbkbbmifnurnwyhevsoqzmtvzgfiqajfrgyuzxnrtxectcnlyoisbglpdbjbslxlpoymrcxmdtqhcnlvtqdwftuzgbdxsyscwbrguostbelnvtaqdmkmihmoxqtqlxvlsssisvqvvzotoyqryuyqwoknnqcqggysrqpkrccvyhxsjmhoqoyocwcriplarjoyiqrmmpmueqbsbljddwrumauczfziodpudheexalbwpiypmdjlmwtgdrzhpxneofhqzjdmurgvmrwdotuwyknlrbvuvtnhiouvqitgyfgfieonbaapyhwpcrmehxcpkijzfiayfvoxkpaapkxovfyaifzjikpcxhemrcpwhypaabnoeifgfygtiqvuoihntvuvbrlnkywutodwrmvgrumdjzqhfoenxphzrdgtwmljdm..." }, { "input": "mgrfmzxqpejcixxppqgvuawutgrmezjkteofjbnrvzzkvjtacfxjjokisavsgrslryxfqgrmdsqwptajbqzvethuljbdatxghfzqrwvfgakwmoawlzqjypmhllbbuuhbpriqsnibywlgjlxowyzagrfnqafvcqwktkcjwejevzbnxhsfmwojshcdypnvbuhhuzqmgovmvgwiizatoxgblyudipahfbkewmuneoqhjmbpdtwnznblwvtjrniwlbyblhppndspojrouffazpoxtqdfpjuhitvijrohavpqatofxwmksvjcvhdecxwwmosqiczjpkfafqlboxosnjgzgdraehzdltthemeusxhiiimrdrugabnxwsygsktkcslhjebfexucsyvlwrptebkjhefsvfrmcqqdlanbetrgzwylizmrystvpgrkhlicfadco", "output": "mgrfmzxqpejcixxppqgvuawutgrmezjkteofjbnrvzzkvjtacfxjjokisavsgrslryxfqgrmdsqwptajbqzvethuljbdatxghfzqrwvfgakwmoawlzqjypmhllbbuuhbpriqsnibywlgjlxowyzagrfnqafvcqwktkcjwejevzbnxhsfmwojshcdypnvbuhhuzqmgovmvgwiizatoxgblyudipahfbkewmuneoqhjmbpdtwnznblwvtjrniwlbyblhppndspojrouffazpoxtqdfpjuhitvijrohavpqatofxwmksvjcvhdecxwwmosqiczjpkfafqlboxosnjgzgdraehzdltthemeusxhiiimrdrugabnxwsygsktkcslhjebfexucsyvlwrptebkjhefsvfrmcqqdlanbetrgzwylizmrystvpgrkhlicfadcoocdafcilhkrgpvtsyrmzilywzgrtebnaldqqcmrfvsfehjkbetprwlvyscuxef..." }, { "input": "hdmasfcjuigrwjchmjslmpynewnzpphmudzcbxzdexjuhktdtcoibzvevsmwaxakrtdfoivkvoooypyemiidadquqepxwqkesdnakxkbzrcjkgvwwxtqxvfpxcwitljyehldgsjytmekimkkndjvnzqtjykiymkmdzpwakxdtkzcqcatlevppgfhyykgmipuodjrnfjzhcmjdbzvhywprbwdcfxiffpzbjbmbyijkqnosslqbfvvicxvoeuzruraetglthgourzhfpnubzvblfzmmbgepjjyshchthulxar", "output": "hdmasfcjuigrwjchmjslmpynewnzpphmudzcbxzdexjuhktdtcoibzvevsmwaxakrtdfoivkvoooypyemiidadquqepxwqkesdnakxkbzrcjkgvwwxtqxvfpxcwitljyehldgsjytmekimkkndjvnzqtjykiymkmdzpwakxdtkzcqcatlevppgfhyykgmipuodjrnfjzhcmjdbzvhywprbwdcfxiffpzbjbmbyijkqnosslqbfvvicxvoeuzruraetglthgourzhfpnubzvblfzmmbgepjjyshchthulxarraxluhthchsyjjpegbmmzflbvzbunpfhzruoghtlgtearurzueovxcivvfbqlssonqkjiybmbjbzpffixfcdwbrpwyhvzbdjmchzjfnrjdoupimgkyyhfgppveltacqczktdxkawpzdmkmyikyjtqznvjdnkkmikemtyjsgdlheyjltiwcxpfvxqtxwwvgkjcrzbkxkandsekqwxpequ..." }, { "input": "fggbyzobbmxtwdajawqdywnppflkkmtxzjvxopqvliwdwhzepcuiwelhbuotlkvesexnwkytonfrpqcxzzqzdvsmbsjcxxeugavekozfjlolrtqgwzqxsfgrnvrgfrqpixhsskbpzghndesvwptpvvkasfalzsetopervpwzmkgpcexqnvtnoulprwnowmsorscecvvvrjfwumcjqyrounqsgdruxttvtmrkivtxauhosokdiahsyrftzsgvgyveqwkzhqstbgywrvmsgfcfyuxpphvmyydzpohgdicoxbtjnsbyhoidnkrialowvlvmjpxcfeygqzphmbcjkupojsmmuqlydixbaluwezvnfasjfxilbyllwyipsmovdzosuwotcxerzcfuvxprtziseshjfcosalyqglpotxvxaanpocypsiyazsejjoximnbvqucftuvdksaxutvjeunodbipsumlaymjnzljurefjg", "output": "fggbyzobbmxtwdajawqdywnppflkkmtxzjvxopqvliwdwhzepcuiwelhbuotlkvesexnwkytonfrpqcxzzqzdvsmbsjcxxeugavekozfjlolrtqgwzqxsfgrnvrgfrqpixhsskbpzghndesvwptpvvkasfalzsetopervpwzmkgpcexqnvtnoulprwnowmsorscecvvvrjfwumcjqyrounqsgdruxttvtmrkivtxauhosokdiahsyrftzsgvgyveqwkzhqstbgywrvmsgfcfyuxpphvmyydzpohgdicoxbtjnsbyhoidnkrialowvlvmjpxcfeygqzphmbcjkupojsmmuqlydixbaluwezvnfasjfxilbyllwyipsmovdzosuwotcxerzcfuvxprtziseshjfcosalyqglpotxvxaanpocypsiyazsejjoximnbvqucftuvdksaxutvjeunodbipsumlaymjnzljurefjggjferujlznjmyalmuspib..." }, { "input": "qyyxqkbxsvfnjzttdqmpzinbdgayllxpfrpopwciejjjzadguurnnhvixgueukugkkjyghxknedojvmdrskswiotgatsajowionuiumuhyggjuoympuxyfahwftwufvocdguxmxabbxnfviscxtilzzauizsgugwcqtbqgoosefhkumhodwpgolfdkbuiwlzjydonwbgyzzrjwxnceltqgqelrrljmzdbftmaogiuosaqhngmdzxzlmyrwefzhqawmkdckfnyyjgdjgadtfjvrkdwysqofcgyqrnyzutycvspzbjmmesobvhshtqlrytztyieknnkporrbcmlopgtknlmsstzkigreqwgsvagmvbrvwypoxttmzzsgm", "output": "qyyxqkbxsvfnjzttdqmpzinbdgayllxpfrpopwciejjjzadguurnnhvixgueukugkkjyghxknedojvmdrskswiotgatsajowionuiumuhyggjuoympuxyfahwftwufvocdguxmxabbxnfviscxtilzzauizsgugwcqtbqgoosefhkumhodwpgolfdkbuiwlzjydonwbgyzzrjwxnceltqgqelrrljmzdbftmaogiuosaqhngmdzxzlmyrwefzhqawmkdckfnyyjgdjgadtfjvrkdwysqofcgyqrnyzutycvspzbjmmesobvhshtqlrytztyieknnkporrbcmlopgtknlmsstzkigreqwgsvagmvbrvwypoxttmzzsgmmgszzmttxopywvrbvmgavsgwqergikztssmlnktgpolmcbrropknnkeiytztyrlqthshvbosemmjbzpsvcytuzynrqygcfoqsywdkrvjftdagjdgjyynfkcdkmwaqhzfewry..." }, { "input": "scvlhflaqvniyiyofonowwcuqajuwscdrzhbvasymvqfnthzvtjcfuaftrbjghhvslcohwpxkggrbtatjtgehuqtorwinwvrtdldyoeeozxwippuahgkuehvsmyqtodqvlufqqmqautaqirvwzvtodzxtgxiinubhrbeoiybidutrqamsdnasctxatzkvkjkrmavdravnsxyngjlugwftmhmcvvxdbfndurrbmcpuoigjpssqcortmqoqttrabhoqvopjkxvpbqdqsilvlplhgqazauyvnodsxtwnomlinjpozwhrgrkqwmlwcwdkxjxjftexiavwrejvdjcfptterblxysjcheesyqsbgdrzjxbfjqgjgmvccqcyj", "output": "scvlhflaqvniyiyofonowwcuqajuwscdrzhbvasymvqfnthzvtjcfuaftrbjghhvslcohwpxkggrbtatjtgehuqtorwinwvrtdldyoeeozxwippuahgkuehvsmyqtodqvlufqqmqautaqirvwzvtodzxtgxiinubhrbeoiybidutrqamsdnasctxatzkvkjkrmavdravnsxyngjlugwftmhmcvvxdbfndurrbmcpuoigjpssqcortmqoqttrabhoqvopjkxvpbqdqsilvlplhgqazauyvnodsxtwnomlinjpozwhrgrkqwmlwcwdkxjxjftexiavwrejvdjcfptterblxysjcheesyqsbgdrzjxbfjqgjgmvccqcyjjycqccvmgjgqjfbxjzrdgbsqyseehcjsyxlbrettpfcjdvjerwvaixetfjxjxkdwcwlmwqkrgrhwzopjnilmonwtxsdonvyuazaqghlplvlisqdqbpvxkjpovqohbarttqoqm..." }, { "input": "oohkqxxtvxzmvfjjxyjwlbqmeqwwlienzkdbhswgfbkhfygltsucdijozwaiewpixapyazfztksjeoqjugjfhdbqzuezbuajfvvffkwprroyivfoocvslejffgxuiofisenroxoeixmdbzonmreikpflciwsbafrdqfvdfojgoziiibqhwwsvhnzmptgirqqulkgmyzrfekzqqujmdumxkudsgexisupedisgmdgebvlvrpyfrbrqjknrxyzfpwmsxjxismgd", "output": "oohkqxxtvxzmvfjjxyjwlbqmeqwwlienzkdbhswgfbkhfygltsucdijozwaiewpixapyazfztksjeoqjugjfhdbqzuezbuajfvvffkwprroyivfoocvslejffgxuiofisenroxoeixmdbzonmreikpflciwsbafrdqfvdfojgoziiibqhwwsvhnzmptgirqqulkgmyzrfekzqqujmdumxkudsgexisupedisgmdgebvlvrpyfrbrqjknrxyzfpwmsxjxismgddgmsixjxsmwpfzyxrnkjqrbrfyprvlvbegdmgsidepusixegsdukxmudmjuqqzkefrzymgkluqqrigtpmznhvswwhqbiiizogjofdvfqdrfabswiclfpkiermnozbdmxieoxornesifoiuxgffjelsvcoofviyorrpwkffvvfjaubzeuzqbdhfjgujqoejsktzfzaypaxipweiawzojidcustlgyfhkbfgwshbdkzneilwwqemqblw..." }, { "input": "gilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlwzjyeyfktduzdjnivcldjjarfzmmdbyytvipbbnjqolfnlqjpidotxxfobgtgpvjmpddcyddwdcjsxxumuoyznhpvpqccgqnuouzojntanfwctthcgynrukcvshsuuqrxfdvqqggaatwytikkitywtaaggqqvdfxrquushsvckurnygchttcwfnatnjozuounqgccqpvphnzyoumuxxsjcdwddycddpmjvpgtgbofxxtodipjqlnfloqjnbbpivtyybdmmzfrajjdlcvinjdzudtkfyeyjzwlzcnrgkdxrnjwyfwtnzawmeljknllaqhrgdagttixpljuupcivnlejkemrqnafdigjzxiohlig", "output": "gilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlwzjyeyfktduzdjnivcldjjarfzmmdbyytvipbbnjqolfnlqjpidotxxfobgtgpvjmpddcyddwdcjsxxumuoyznhpvpqccgqnuouzojntanfwctthcgynrukcvshsuuqrxfdvqqggaatwytikkitywtaaggqqvdfxrquushsvckurnygchttcwfnatnjozuounqgccqpvphnzyoumuxxsjcdwddycddpmjvpgtgbofxxtodipjqlnfloqjnbbpivtyybdmmzfrajjdlcvinjdzudtkfyeyjzwlzcnrgkdxrnjwyfwtnzawmeljknllaqhrgdagttixpljuupcivnlejkemrqnafdigjzxiohliggilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlw..." }, { "input": "abcab", "output": "abcabbacba" }, { "input": "baaaaaaa", "output": "baaaaaaaaaaaaaab" }, { "input": "baaaaaa", "output": "baaaaaaaaaaaab" }, { "input": "baaaaaaaaa", "output": "baaaaaaaaaaaaaaaaaab" }, { "input": "baaaaaaaa", "output": "baaaaaaaaaaaaaaaab" } ]
1,519,151,149
49
Python 3
OK
TESTS
48
62
5,632,000
x = input() print(x+x[::-1])
Title: Palindromic Supersequence Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a string *A*. Find a string *B*, where *B* is a palindrome and *A* is a subsequence of *B*. A subsequence of a string is a string that can be derived from it by deleting some (not necessarily consecutive) characters without changing the order of the remaining characters. For example, "cotst" is a subsequence of "contest". A palindrome is a string that reads the same forward or backward. The length of string *B* should be at most 104. It is guaranteed that there always exists such string. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. Input Specification: First line contains a string *A* (1<=≤<=|*A*|<=≤<=103) consisting of lowercase Latin letters, where |*A*| is a length of *A*. Output Specification: Output single line containing *B* consisting of only lowercase Latin letters. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. If there are many possible *B*, print any of them. Demo Input: ['aba\n', 'ab\n'] Demo Output: ['aba', 'aabaa'] Note: In the first example, "aba" is a subsequence of "aba" which is a palindrome. In the second example, "ab" is a subsequence of "aabaa" which is a palindrome.
```python x = input() print(x+x[::-1]) ```
3
507
B
Amr and Pins
PROGRAMMING
1,400
[ "geometry", "math" ]
null
null
Amr loves Geometry. One day he came up with a very interesting problem. Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*'). In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin. Help Amr to achieve his goal in minimum number of steps.
Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=≤<=*r*<=≤<=105, <=-<=105<=≤<=*x*,<=*y*,<=*x*',<=*y*'<=≤<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively.
Output a single integer — minimum number of steps required to move the center of the circle to the destination point.
[ "2 0 0 0 4\n", "1 1 1 4 4\n", "4 5 6 5 6\n" ]
[ "1\n", "3\n", "0\n" ]
In the first sample test the optimal way is to put a pin at point (0, 2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter). <img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/>
1,000
[ { "input": "2 0 0 0 4", "output": "1" }, { "input": "1 1 1 4 4", "output": "3" }, { "input": "4 5 6 5 6", "output": "0" }, { "input": "10 20 0 40 0", "output": "1" }, { "input": "9 20 0 40 0", "output": "2" }, { "input": "5 -1 -6 -5 1", "output": "1" }, { "input": "99125 26876 -21414 14176 17443", "output": "1" }, { "input": "8066 7339 19155 -90534 -60666", "output": "8" }, { "input": "100000 -100000 -100000 100000 100000", "output": "2" }, { "input": "10 20 0 41 0", "output": "2" }, { "input": "25 -64 -6 -56 64", "output": "2" }, { "input": "125 455 450 439 721", "output": "2" }, { "input": "5 6 3 7 2", "output": "1" }, { "input": "24 130 14786 3147 2140", "output": "271" }, { "input": "125 -363 176 93 330", "output": "2" }, { "input": "1 14 30 30 14", "output": "12" }, { "input": "25 96 13 7 2", "output": "2" }, { "input": "4 100000 -100000 100000 -100000", "output": "0" }, { "input": "1 3 4 2 5", "output": "1" }, { "input": "1 -3 3 2 6", "output": "3" }, { "input": "2 7 20 13 -5", "output": "7" }, { "input": "1 1 1 1 4", "output": "2" }, { "input": "249 -54242 -30537 -45023 -89682", "output": "121" }, { "input": "4 100000 -100000 100000 -99999", "output": "1" }, { "input": "97741 23818 78751 97583 26933", "output": "1" }, { "input": "56767 -29030 51625 79823 -56297", "output": "2" }, { "input": "98260 13729 74998 23701 9253", "output": "1" }, { "input": "67377 -80131 -90254 -57320 14102", "output": "1" }, { "input": "1 100000 100000 100000 -100000", "output": "100000" }, { "input": "19312 19470 82059 58064 62231", "output": "2" }, { "input": "67398 -68747 -79056 -34193 29400", "output": "1" }, { "input": "91099 37184 -71137 75650 -3655", "output": "1" }, { "input": "46456 -2621 -23623 -98302 -99305", "output": "2" }, { "input": "100 100000 -100000 100000 -99999", "output": "1" }, { "input": "1 100000 -100000 100000 -100000", "output": "0" }, { "input": "8 0 0 0 32", "output": "2" }, { "input": "100000 100000 1 -100000 0", "output": "2" } ]
1,606,894,000
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
5
124
0
r, x, y, x1, y1 = map(int, input().split()) s = ((x1-x)//(2*r))+((y1-y)//(2*r)) if x+(2*r)*((x1-x)//(2*r)) != x1 or y+(2*r)*((y1-y)//(2*r)) != y1: s += 1 print(s)
Title: Amr and Pins Time Limit: None seconds Memory Limit: None megabytes Problem Description: Amr loves Geometry. One day he came up with a very interesting problem. Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*'). In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin. Help Amr to achieve his goal in minimum number of steps. Input Specification: Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=≤<=*r*<=≤<=105, <=-<=105<=≤<=*x*,<=*y*,<=*x*',<=*y*'<=≤<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively. Output Specification: Output a single integer — minimum number of steps required to move the center of the circle to the destination point. Demo Input: ['2 0 0 0 4\n', '1 1 1 4 4\n', '4 5 6 5 6\n'] Demo Output: ['1\n', '3\n', '0\n'] Note: In the first sample test the optimal way is to put a pin at point (0, 2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter). <img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/>
```python r, x, y, x1, y1 = map(int, input().split()) s = ((x1-x)//(2*r))+((y1-y)//(2*r)) if x+(2*r)*((x1-x)//(2*r)) != x1 or y+(2*r)*((y1-y)//(2*r)) != y1: s += 1 print(s) ```
0
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,620,205,660
2,147,483,647
PyPy 3
OK
TESTS
30
186
0
word= input(" ") count1=0 count2=0 for i in word: if i.isupper(): count1=count1+1 if i.islower(): count2=count2+1 if count1>count2: print(word.upper()) else: print(word.lower())
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python word= input(" ") count1=0 count2=0 for i in word: if i.isupper(): count1=count1+1 if i.islower(): count2=count2+1 if count1>count2: print(word.upper()) else: print(word.lower()) ```
3.9535
929
B
Места в самолёте
PROGRAMMING
1,300
[ "*special", "implementation" ]
null
null
В самолёте есть *n* рядов мест. Если смотреть на ряды сверху, то в каждом ряду есть 3 места слева, затем проход между рядами, затем 4 центральных места, затем ещё один проход между рядами, а затем ещё 3 места справа. Известно, что некоторые места уже заняты пассажирами. Всего есть два вида пассажиров — статусные (те, которые часто летают) и обычные. Перед вами стоит задача рассадить ещё *k* обычных пассажиров так, чтобы суммарное число соседей у статусных пассажиров было минимально возможным. Два пассажира считаются соседями, если они сидят в одном ряду и между ними нет других мест и прохода между рядами. Если пассажир является соседним пассажиром для двух статусных пассажиров, то его следует учитывать в сумме соседей дважды.
В первой строке следуют два целых числа *n* и *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=10·*n*) — количество рядов мест в самолёте и количество пассажиров, которых нужно рассадить. Далее следует описание рядов мест самолёта по одному ряду в строке. Если очередной символ равен '-', то это проход между рядами. Если очередной символ равен '.', то это свободное место. Если очередной символ равен 'S', то на текущем месте будет сидеть статусный пассажир. Если очередной символ равен 'P', то на текущем месте будет сидеть обычный пассажир. Гарантируется, что количество свободных мест не меньше *k*. Гарантируется, что все ряды удовлетворяют описанному в условии формату.
В первую строку выведите минимальное суммарное число соседей у статусных пассажиров. Далее выведите план рассадки пассажиров, который минимизирует суммарное количество соседей у статусных пассажиров, в том же формате, что и во входных данных. Если в свободное место нужно посадить одного из *k* пассажиров, выведите строчную букву 'x' вместо символа '.'.
[ "1 2\nSP.-SS.S-S.S\n", "4 9\nPP.-PPPS-S.S\nPSP-PPSP-.S.\n.S.-S..P-SS.\nP.S-P.PP-PSP\n" ]
[ "5\nSPx-SSxS-S.S\n", "15\nPPx-PPPS-S.S\nPSP-PPSP-xSx\nxSx-SxxP-SSx\nP.S-PxPP-PSP\n" ]
В первом примере нужно посадить ещё двух обычных пассажиров. Для минимизации соседей у статусных пассажиров, нужно посадить первого из них на третье слева место, а второго на любое из оставшихся двух мест, так как независимо от выбора места он станет соседом двух статусных пассажиров. Изначально, у статусного пассажира, который сидит на самом левом месте уже есть сосед. Также на четвёртом и пятом местах слева сидят статусные пассажиры, являющиеся соседями друг для друга (что добавляет к сумме 2). Таким образом, после посадки ещё двух обычных пассажиров, итоговое суммарное количество соседей у статусных пассажиров станет равно пяти.
1,000
[ { "input": "1 2\nSP.-SS.S-S.S", "output": "5\nSPx-SSxS-S.S" }, { "input": "4 9\nPP.-PPPS-S.S\nPSP-PPSP-.S.\n.S.-S..P-SS.\nP.S-P.PP-PSP", "output": "15\nPPx-PPPS-S.S\nPSP-PPSP-xSx\nxSx-SxxP-SSx\nP.S-PxPP-PSP" }, { "input": "3 7\n.S.-SSSP-..S\nS..-.SPP-S.P\n.S.-PPPP-PSP", "output": "13\nxSx-SSSP-xxS\nSxx-xSPP-S.P\n.S.-PPPP-PSP" }, { "input": "5 6\nPP.-PS.P-P..\nPPS-SP..-P.P\nP.P-....-S..\nSPP-.P.S-.S.\nSP.-S.PS-PPP", "output": "6\nPPx-PS.P-Pxx\nPPS-SPxx-PxP\nP.P-....-S..\nSPP-.P.S-.S.\nSP.-S.PS-PPP" }, { "input": "1 1\n..S-PS..-.PP", "output": "1\nx.S-PS..-.PP" }, { "input": "2 2\nPP.-S.SS-.S.\nSSP-SSSS-S.S", "output": "12\nPPx-S.SS-xS.\nSSP-SSSS-S.S" }, { "input": "30 1\nPPP-PPP.-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP", "output": "0\nPPP-PPPx-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP" }, { "input": "1 1\nSPS-....-P.P", "output": "2\nSPS-x...-P.P" }, { "input": "2 1\nSSS-S.S.-SSS\nSSP-.PP.-S.S", "output": "11\nSSS-S.S.-SSS\nSSP-xPP.-S.S" }, { "input": "30 1\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPP.-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP", "output": "0\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPx-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP" } ]
1,520,081,838
76,938
Python 3
WRONG_ANSWER
PRETESTS
1
62
6,348,800
import re best_set = '' best_result = 999999 def parse_string(s: str) -> []: return list(map(int, s.split(' '))) def list_to_string(lst: list) -> str: return ''.join(lst) def check_and_remember(plane_set: str): result = count_inconvenience(plane_set) global best_result global best_set if result < best_result: best_set = plane_set best_result = result def count_inconvenience(plane: str) -> int: result = 0 for i, v in enumerate(plane): if v == 'S': if i - 1 >= 0: previous = plane[i - 1] if previous == 'P' or previous == 'S' or previous == 'x': result += 1 if i + 1 <= len(plane) - 1: next = plane[i + 1] if next == 'P' or next == 'S' or next == 'x': result += 1 return result def per(x: list, y: list, k: int, plane: str): if k == 0: new_str = list(plane) for i in x: new_str[i] = 'x' check_and_remember(''.join(new_str)) for i, v in enumerate(y): new_x = list(x) new_x.append(v) new_y = list(y[i + 1:]) new_k = k - 1 per(new_x, new_y, new_k, plane) if __name__ == '__main__': # f = open('input1.txt') (n, k) = parse_string(input()) plane_lst = [] for i in range(n): plane_lst.append(input()) plane = list_to_string(plane_lst) per([], [m.start() for m in re.finditer('\.', plane)], k, plane) print(best_result) print(best_set)
Title: Места в самолёте Time Limit: None seconds Memory Limit: None megabytes Problem Description: В самолёте есть *n* рядов мест. Если смотреть на ряды сверху, то в каждом ряду есть 3 места слева, затем проход между рядами, затем 4 центральных места, затем ещё один проход между рядами, а затем ещё 3 места справа. Известно, что некоторые места уже заняты пассажирами. Всего есть два вида пассажиров — статусные (те, которые часто летают) и обычные. Перед вами стоит задача рассадить ещё *k* обычных пассажиров так, чтобы суммарное число соседей у статусных пассажиров было минимально возможным. Два пассажира считаются соседями, если они сидят в одном ряду и между ними нет других мест и прохода между рядами. Если пассажир является соседним пассажиром для двух статусных пассажиров, то его следует учитывать в сумме соседей дважды. Input Specification: В первой строке следуют два целых числа *n* и *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=10·*n*) — количество рядов мест в самолёте и количество пассажиров, которых нужно рассадить. Далее следует описание рядов мест самолёта по одному ряду в строке. Если очередной символ равен '-', то это проход между рядами. Если очередной символ равен '.', то это свободное место. Если очередной символ равен 'S', то на текущем месте будет сидеть статусный пассажир. Если очередной символ равен 'P', то на текущем месте будет сидеть обычный пассажир. Гарантируется, что количество свободных мест не меньше *k*. Гарантируется, что все ряды удовлетворяют описанному в условии формату. Output Specification: В первую строку выведите минимальное суммарное число соседей у статусных пассажиров. Далее выведите план рассадки пассажиров, который минимизирует суммарное количество соседей у статусных пассажиров, в том же формате, что и во входных данных. Если в свободное место нужно посадить одного из *k* пассажиров, выведите строчную букву 'x' вместо символа '.'. Demo Input: ['1 2\nSP.-SS.S-S.S\n', '4 9\nPP.-PPPS-S.S\nPSP-PPSP-.S.\n.S.-S..P-SS.\nP.S-P.PP-PSP\n'] Demo Output: ['5\nSPx-SSxS-S.S\n', '15\nPPx-PPPS-S.S\nPSP-PPSP-xSx\nxSx-SxxP-SSx\nP.S-PxPP-PSP\n'] Note: В первом примере нужно посадить ещё двух обычных пассажиров. Для минимизации соседей у статусных пассажиров, нужно посадить первого из них на третье слева место, а второго на любое из оставшихся двух мест, так как независимо от выбора места он станет соседом двух статусных пассажиров. Изначально, у статусного пассажира, который сидит на самом левом месте уже есть сосед. Также на четвёртом и пятом местах слева сидят статусные пассажиры, являющиеся соседями друг для друга (что добавляет к сумме 2). Таким образом, после посадки ещё двух обычных пассажиров, итоговое суммарное количество соседей у статусных пассажиров станет равно пяти.
```python import re best_set = '' best_result = 999999 def parse_string(s: str) -> []: return list(map(int, s.split(' '))) def list_to_string(lst: list) -> str: return ''.join(lst) def check_and_remember(plane_set: str): result = count_inconvenience(plane_set) global best_result global best_set if result < best_result: best_set = plane_set best_result = result def count_inconvenience(plane: str) -> int: result = 0 for i, v in enumerate(plane): if v == 'S': if i - 1 >= 0: previous = plane[i - 1] if previous == 'P' or previous == 'S' or previous == 'x': result += 1 if i + 1 <= len(plane) - 1: next = plane[i + 1] if next == 'P' or next == 'S' or next == 'x': result += 1 return result def per(x: list, y: list, k: int, plane: str): if k == 0: new_str = list(plane) for i in x: new_str[i] = 'x' check_and_remember(''.join(new_str)) for i, v in enumerate(y): new_x = list(x) new_x.append(v) new_y = list(y[i + 1:]) new_k = k - 1 per(new_x, new_y, new_k, plane) if __name__ == '__main__': # f = open('input1.txt') (n, k) = parse_string(input()) plane_lst = [] for i in range(n): plane_lst.append(input()) plane = list_to_string(plane_lst) per([], [m.start() for m in re.finditer('\.', plane)], k, plane) print(best_result) print(best_set) ```
0
294
A
Shaass and Oskols
PROGRAMMING
800
[ "implementation", "math" ]
null
null
Shaass has decided to hunt some birds. There are *n* horizontal electricity wires aligned parallel to each other. Wires are numbered 1 to *n* from top to bottom. On each wire there are some oskols sitting next to each other. Oskol is the name of a delicious kind of birds in Shaass's territory. Supposed there are *a**i* oskols sitting on the *i*-th wire. Sometimes Shaass shots one of the birds and the bird dies (suppose that this bird sat at the *i*-th wire). Consequently all the birds on the *i*-th wire to the left of the dead bird get scared and jump up on the wire number *i*<=-<=1, if there exists no upper wire they fly away. Also all the birds to the right of the dead bird jump down on wire number *i*<=+<=1, if there exists no such wire they fly away. Shaass has shot *m* birds. You're given the initial number of birds on each wire, tell him how many birds are sitting on each wire after the shots.
The first line of the input contains an integer *n*, (1<=≤<=*n*<=≤<=100). The next line contains a list of space-separated integers *a*1,<=*a*2,<=...,<=*a**n*, (0<=≤<=*a**i*<=≤<=100). The third line contains an integer *m*, (0<=≤<=*m*<=≤<=100). Each of the next *m* lines contains two integers *x**i* and *y**i*. The integers mean that for the *i*-th time Shaass shoot the *y**i*-th (from left) bird on the *x**i*-th wire, (1<=≤<=*x**i*<=≤<=*n*,<=1<=≤<=*y**i*). It's guaranteed there will be at least *y**i* birds on the *x**i*-th wire at that moment.
On the *i*-th line of the output print the number of birds on the *i*-th wire.
[ "5\n10 10 10 10 10\n5\n2 5\n3 13\n2 12\n1 13\n4 6\n", "3\n2 4 1\n1\n2 2\n" ]
[ "0\n12\n5\n0\n16\n", "3\n0\n3\n" ]
none
500
[ { "input": "5\n10 10 10 10 10\n5\n2 5\n3 13\n2 12\n1 13\n4 6", "output": "0\n12\n5\n0\n16" }, { "input": "3\n2 4 1\n1\n2 2", "output": "3\n0\n3" }, { "input": "5\n58 51 45 27 48\n5\n4 9\n5 15\n4 5\n5 8\n1 43", "output": "0\n66\n57\n7\n0" }, { "input": "10\n48 53 10 28 91 56 81 2 67 52\n2\n2 40\n6 51", "output": "87\n0\n23\n28\n141\n0\n86\n2\n67\n52" }, { "input": "2\n72 45\n6\n1 69\n2 41\n1 19\n2 7\n1 5\n2 1", "output": "0\n0" }, { "input": "10\n95 54 36 39 98 30 19 24 14 12\n3\n9 5\n8 15\n7 5", "output": "95\n54\n36\n39\n98\n34\n0\n28\n13\n21" }, { "input": "100\n95 15 25 18 64 62 23 59 70 84 50 26 87 35 75 86 0 22 77 60 66 41 21 9 75 50 25 3 69 14 39 68 64 46 59 99 2 0 21 76 90 12 61 42 6 91 36 39 47 41 93 81 66 57 70 36 68 89 52 1 19 93 67 22 76 20 8 81 98 18 100 73 61 93 75 80 53 72 40 20 2 86 33 59 27 16 11 26 55 44 47 55 94 58 2 55 82 22 9 95\n0", "output": "95\n15\n25\n18\n64\n62\n23\n59\n70\n84\n50\n26\n87\n35\n75\n86\n0\n22\n77\n60\n66\n41\n21\n9\n75\n50\n25\n3\n69\n14\n39\n68\n64\n46\n59\n99\n2\n0\n21\n76\n90\n12\n61\n42\n6\n91\n36\n39\n47\n41\n93\n81\n66\n57\n70\n36\n68\n89\n52\n1\n19\n93\n67\n22\n76\n20\n8\n81\n98\n18\n100\n73\n61\n93\n75\n80\n53\n72\n40\n20\n2\n86\n33\n59\n27\n16\n11\n26\n55\n44\n47\n55\n94\n58\n2\n55\n82\n22\n9\n95" }, { "input": "1\n100\n1\n1 100", "output": "0" }, { "input": "1\n100\n1\n1 1", "output": "0" }, { "input": "1\n50\n1\n1 25", "output": "0" }, { "input": "2\n50 0\n1\n1 1", "output": "0\n49" }, { "input": "1\n10\n0", "output": "10" } ]
1,659,009,680
2,147,483,647
PyPy 3-64
OK
TESTS
31
124
0
import sys get_int_list = lambda: list(map(int, sys.stdin.readline().rstrip("\n\r").split())) def main(): input() # Useless wires = {k+1:v for k,v in enumerate(get_int_list())} for _ in range(int(input())): x, y = get_int_list() left = y - 1 # For the dead bird right = wires[x] - y wires[x] = 0 if x-1 in wires: wires[x-1] += left if x+1 in wires: wires[x+1] += right print(*wires.values(),sep="\n") main()
Title: Shaass and Oskols Time Limit: None seconds Memory Limit: None megabytes Problem Description: Shaass has decided to hunt some birds. There are *n* horizontal electricity wires aligned parallel to each other. Wires are numbered 1 to *n* from top to bottom. On each wire there are some oskols sitting next to each other. Oskol is the name of a delicious kind of birds in Shaass's territory. Supposed there are *a**i* oskols sitting on the *i*-th wire. Sometimes Shaass shots one of the birds and the bird dies (suppose that this bird sat at the *i*-th wire). Consequently all the birds on the *i*-th wire to the left of the dead bird get scared and jump up on the wire number *i*<=-<=1, if there exists no upper wire they fly away. Also all the birds to the right of the dead bird jump down on wire number *i*<=+<=1, if there exists no such wire they fly away. Shaass has shot *m* birds. You're given the initial number of birds on each wire, tell him how many birds are sitting on each wire after the shots. Input Specification: The first line of the input contains an integer *n*, (1<=≤<=*n*<=≤<=100). The next line contains a list of space-separated integers *a*1,<=*a*2,<=...,<=*a**n*, (0<=≤<=*a**i*<=≤<=100). The third line contains an integer *m*, (0<=≤<=*m*<=≤<=100). Each of the next *m* lines contains two integers *x**i* and *y**i*. The integers mean that for the *i*-th time Shaass shoot the *y**i*-th (from left) bird on the *x**i*-th wire, (1<=≤<=*x**i*<=≤<=*n*,<=1<=≤<=*y**i*). It's guaranteed there will be at least *y**i* birds on the *x**i*-th wire at that moment. Output Specification: On the *i*-th line of the output print the number of birds on the *i*-th wire. Demo Input: ['5\n10 10 10 10 10\n5\n2 5\n3 13\n2 12\n1 13\n4 6\n', '3\n2 4 1\n1\n2 2\n'] Demo Output: ['0\n12\n5\n0\n16\n', '3\n0\n3\n'] Note: none
```python import sys get_int_list = lambda: list(map(int, sys.stdin.readline().rstrip("\n\r").split())) def main(): input() # Useless wires = {k+1:v for k,v in enumerate(get_int_list())} for _ in range(int(input())): x, y = get_int_list() left = y - 1 # For the dead bird right = wires[x] - y wires[x] = 0 if x-1 in wires: wires[x-1] += left if x+1 in wires: wires[x+1] += right print(*wires.values(),sep="\n") main() ```
3
350
A
TL
PROGRAMMING
1,200
[ "brute force", "greedy", "implementation" ]
null
null
Valera wanted to prepare a Codesecrof round. He's already got one problem and he wants to set a time limit (TL) on it. Valera has written *n* correct solutions. For each correct solution, he knows its running time (in seconds). Valera has also wrote *m* wrong solutions and for each wrong solution he knows its running time (in seconds). Let's suppose that Valera will set *v* seconds TL in the problem. Then we can say that a solution passes the system testing if its running time is at most *v* seconds. We can also say that a solution passes the system testing with some "extra" time if for its running time, *a* seconds, an inequality 2*a*<=≤<=*v* holds. As a result, Valera decided to set *v* seconds TL, that the following conditions are met: 1. *v* is a positive integer; 1. all correct solutions pass the system testing; 1. at least one correct solution passes the system testing with some "extra" time; 1. all wrong solutions do not pass the system testing; 1. value *v* is minimum among all TLs, for which points 1, 2, 3, 4 hold. Help Valera and find the most suitable TL or else state that such TL doesn't exist.
The first line contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100). The second line contains *n* space-separated positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) — the running time of each of the *n* correct solutions in seconds. The third line contains *m* space-separated positive integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=100) — the running time of each of *m* wrong solutions in seconds.
If there is a valid TL value, print it. Otherwise, print -1.
[ "3 6\n4 5 2\n8 9 6 10 7 11\n", "3 1\n3 4 5\n6\n" ]
[ "5", "-1\n" ]
none
500
[ { "input": "3 6\n4 5 2\n8 9 6 10 7 11", "output": "5" }, { "input": "3 1\n3 4 5\n6", "output": "-1" }, { "input": "2 5\n45 99\n49 41 77 83 45", "output": "-1" }, { "input": "50 50\n18 13 5 34 10 36 36 12 15 11 16 17 14 36 23 45 32 24 31 18 24 32 7 1 31 3 49 8 16 23 3 39 47 43 42 38 40 22 41 1 49 47 9 8 19 15 29 30 16 18\n91 58 86 51 94 94 73 84 98 69 74 56 52 80 88 61 53 99 88 50 55 95 65 84 87 79 51 52 69 60 74 73 93 61 73 59 64 56 95 78 86 72 79 70 93 78 54 61 71 50", "output": "49" }, { "input": "55 44\n93 17 74 15 34 16 41 80 26 54 94 94 86 93 20 44 63 72 39 43 67 4 37 49 76 94 5 51 64 74 11 47 77 97 57 30 42 72 71 26 8 14 67 64 49 57 30 23 40 4 76 78 87 78 79\n38 55 17 65 26 7 36 65 48 28 49 93 18 98 31 90 26 57 1 26 88 56 48 56 23 13 8 67 80 2 51 3 21 33 20 54 2 45 21 36 3 98 62 2", "output": "-1" }, { "input": "32 100\n30 8 4 35 18 41 18 12 33 39 39 18 39 19 33 46 45 33 34 27 14 39 40 21 38 9 42 35 27 10 14 14\n65 49 89 64 47 78 59 52 73 51 84 82 88 63 91 99 67 87 53 99 75 47 85 82 58 47 80 50 65 91 83 90 77 52 100 88 97 74 98 99 50 93 65 61 65 65 65 96 61 51 84 67 79 90 92 83 100 100 100 95 80 54 77 51 98 64 74 62 60 96 73 74 94 55 89 60 92 65 74 79 66 81 53 47 71 51 54 85 74 97 68 72 88 94 100 85 65 63 65 90", "output": "46" }, { "input": "1 50\n7\n65 52 99 78 71 19 96 72 80 15 50 94 20 35 79 95 44 41 45 53 77 50 74 66 59 96 26 84 27 48 56 84 36 78 89 81 67 34 79 74 99 47 93 92 90 96 72 28 78 66", "output": "14" }, { "input": "1 1\n4\n9", "output": "8" }, { "input": "1 1\n2\n4", "output": "-1" }, { "input": "22 56\n49 20 42 68 15 46 98 78 82 8 7 33 50 30 75 96 36 88 35 99 19 87\n15 18 81 24 35 89 25 32 23 3 48 24 52 69 18 32 23 61 48 98 50 38 5 17 70 20 38 32 49 54 68 11 51 81 46 22 19 59 29 38 45 83 18 13 91 17 84 62 25 60 97 32 23 13 83 58", "output": "-1" }, { "input": "1 1\n50\n100", "output": "-1" }, { "input": "1 1\n49\n100", "output": "98" }, { "input": "1 1\n100\n100", "output": "-1" }, { "input": "1 1\n99\n100", "output": "-1" }, { "input": "8 4\n1 2 49 99 99 95 78 98\n100 100 100 100", "output": "99" }, { "input": "68 85\n43 55 2 4 72 45 19 56 53 81 18 90 11 87 47 8 94 88 24 4 67 9 21 70 25 66 65 27 46 13 8 51 65 99 37 43 71 59 71 79 32 56 49 43 57 85 95 81 40 28 60 36 72 81 60 40 16 78 61 37 29 26 15 95 70 27 50 97\n6 6 48 72 54 31 1 50 29 64 93 9 29 93 66 63 25 90 52 1 66 13 70 30 24 87 32 90 84 72 44 13 25 45 31 16 92 60 87 40 62 7 20 63 86 78 73 88 5 36 74 100 64 34 9 5 62 29 58 48 81 46 84 56 27 1 60 14 54 88 31 93 62 7 9 69 27 48 10 5 33 10 53 66 2", "output": "-1" }, { "input": "5 100\n1 1 1 1 1\n77 53 38 29 97 33 64 17 78 100 27 12 42 44 20 24 44 68 58 57 65 90 8 24 4 6 74 68 61 43 25 69 8 62 36 85 67 48 69 30 35 41 42 12 87 66 50 92 53 76 38 67 85 7 80 78 53 76 94 8 37 50 4 100 4 71 10 48 34 47 83 42 25 81 64 72 25 51 53 75 43 98 53 77 94 38 81 15 89 91 72 76 7 36 27 41 88 18 19 75", "output": "2" }, { "input": "3 3\n2 3 4\n8 9 10", "output": "4" }, { "input": "2 1\n2 3\n15", "output": "4" }, { "input": "2 1\n2 4\n4", "output": "-1" }, { "input": "2 3\n4 5\n10 11 12", "output": "8" }, { "input": "3 1\n2 3 3\n5", "output": "4" }, { "input": "2 1\n9 10\n100", "output": "18" }, { "input": "3 3\n3 12 15\n7 8 9", "output": "-1" }, { "input": "2 2\n3 5\n7 8", "output": "6" }, { "input": "3 3\n4 5 6\n10 11 12", "output": "8" }, { "input": "3 5\n2 3 3\n6 6 6 6 2", "output": "-1" }, { "input": "3 6\n4 5 3\n8 9 7 10 7 11", "output": "6" }, { "input": "3 6\n4 5 2\n8 9 6 10 7 4", "output": "-1" }, { "input": "2 1\n4 6\n10", "output": "8" }, { "input": "1 2\n1\n3 1", "output": "-1" }, { "input": "2 1\n5 6\n20", "output": "10" }, { "input": "2 1\n1 5\n5", "output": "-1" }, { "input": "3 2\n10 20 30\n30 40", "output": "-1" }, { "input": "2 2\n5 6\n7 100", "output": "-1" }, { "input": "2 1\n2 5\n7", "output": "5" }, { "input": "1 1\n5\n20", "output": "10" }, { "input": "2 1\n10 11\n100", "output": "20" }, { "input": "1 1\n1\n10", "output": "2" }, { "input": "1 1\n10\n100", "output": "20" } ]
1,692,382,829
2,147,483,647
PyPy 3
OK
TESTS
45
184
0
n, m = map(int,input().split()) correct = list(map(int,input().split())) wrong = list (map(int, input().split())) correct.sort() wrong.sort() wrong_time_limit = wrong[0] minm_time_limit = correct[0]*2 correct_time_limit= correct[-1] tle = 0 if minm_time_limit>=correct_time_limit: tle = minm_time_limit else: tle = correct_time_limit if wrong_time_limit>tle : print(tle) else: print(-1)
Title: TL Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera wanted to prepare a Codesecrof round. He's already got one problem and he wants to set a time limit (TL) on it. Valera has written *n* correct solutions. For each correct solution, he knows its running time (in seconds). Valera has also wrote *m* wrong solutions and for each wrong solution he knows its running time (in seconds). Let's suppose that Valera will set *v* seconds TL in the problem. Then we can say that a solution passes the system testing if its running time is at most *v* seconds. We can also say that a solution passes the system testing with some "extra" time if for its running time, *a* seconds, an inequality 2*a*<=≤<=*v* holds. As a result, Valera decided to set *v* seconds TL, that the following conditions are met: 1. *v* is a positive integer; 1. all correct solutions pass the system testing; 1. at least one correct solution passes the system testing with some "extra" time; 1. all wrong solutions do not pass the system testing; 1. value *v* is minimum among all TLs, for which points 1, 2, 3, 4 hold. Help Valera and find the most suitable TL or else state that such TL doesn't exist. Input Specification: The first line contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100). The second line contains *n* space-separated positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) — the running time of each of the *n* correct solutions in seconds. The third line contains *m* space-separated positive integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=100) — the running time of each of *m* wrong solutions in seconds. Output Specification: If there is a valid TL value, print it. Otherwise, print -1. Demo Input: ['3 6\n4 5 2\n8 9 6 10 7 11\n', '3 1\n3 4 5\n6\n'] Demo Output: ['5', '-1\n'] Note: none
```python n, m = map(int,input().split()) correct = list(map(int,input().split())) wrong = list (map(int, input().split())) correct.sort() wrong.sort() wrong_time_limit = wrong[0] minm_time_limit = correct[0]*2 correct_time_limit= correct[-1] tle = 0 if minm_time_limit>=correct_time_limit: tle = minm_time_limit else: tle = correct_time_limit if wrong_time_limit>tle : print(tle) else: print(-1) ```
3
822
B
Crossword solving
PROGRAMMING
1,000
[ "brute force", "implementation", "strings" ]
null
null
Erelong Leha was bored by calculating of the greatest common divisor of two factorials. Therefore he decided to solve some crosswords. It's well known that it is a very interesting occupation though it can be very difficult from time to time. In the course of solving one of the crosswords, Leha had to solve a simple task. You are able to do it too, aren't you? Leha has two strings *s* and *t*. The hacker wants to change the string *s* at such way, that it can be found in *t* as a substring. All the changes should be the following: Leha chooses one position in the string *s* and replaces the symbol in this position with the question mark "?". The hacker is sure that the question mark in comparison can play the role of an arbitrary symbol. For example, if he gets string *s*="ab?b" as a result, it will appear in *t*="aabrbb" as a substring. Guaranteed that the length of the string *s* doesn't exceed the length of the string *t*. Help the hacker to replace in *s* as few symbols as possible so that the result of the replacements can be found in *t* as a substring. The symbol "?" should be considered equal to any other symbol.
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=*m*<=≤<=1000) — the length of the string *s* and the length of the string *t* correspondingly. The second line contains *n* lowercase English letters — string *s*. The third line contains *m* lowercase English letters — string *t*.
In the first line print single integer *k* — the minimal number of symbols that need to be replaced. In the second line print *k* distinct integers denoting the positions of symbols in the string *s* which need to be replaced. Print the positions in any order. If there are several solutions print any of them. The numbering of the positions begins from one.
[ "3 5\nabc\nxaybz\n", "4 10\nabcd\nebceabazcd\n" ]
[ "2\n2 3 \n", "1\n2 \n" ]
none
750
[ { "input": "3 5\nabc\nxaybz", "output": "2\n2 3 " }, { "input": "4 10\nabcd\nebceabazcd", "output": "1\n2 " }, { "input": "1 1\na\na", "output": "0" }, { "input": "1 1\na\nz", "output": "1\n1 " }, { "input": "3 5\naaa\naaaaa", "output": "0" }, { "input": "3 5\naaa\naabaa", "output": "1\n3 " }, { "input": "5 5\ncoder\ncored", "output": "2\n3 5 " }, { "input": "1 1\nz\nz", "output": "0" }, { "input": "1 2\nf\nrt", "output": "1\n1 " }, { "input": "1 2\nf\nfg", "output": "0" }, { "input": "1 2\nf\ngf", "output": "0" }, { "input": "2 5\naa\naabaa", "output": "0" }, { "input": "2 5\naa\navaca", "output": "1\n2 " }, { "input": "3 5\naaa\nbbbbb", "output": "3\n1 2 3 " }, { "input": "3 5\naba\ncbcbc", "output": "2\n1 3 " }, { "input": "3 5\naba\nbbbbb", "output": "2\n1 3 " }, { "input": "3 5\naaa\naabvd", "output": "1\n3 " }, { "input": "3 5\nvvv\nbqavv", "output": "1\n1 " }, { "input": "10 100\nmpmmpmmmpm\nmppppppmppmmpmpppmpppmmpppmpppppmpppmmmppmpmpmmmpmmpmppmmpppppmpmppppmmppmpmppmmmmpmmppmmmpmpmmmpppp", "output": "2\n5 6 " }, { "input": "26 26\nabcdefghijklmnopqrstuvwxyz\nffffffffffffffffffffffffff", "output": "25\n1 2 3 4 5 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 " }, { "input": "3 5\nabc\nxyzab", "output": "3\n1 2 3 " }, { "input": "4 4\nabcd\nxabc", "output": "4\n1 2 3 4 " }, { "input": "3 4\nabc\nabcd", "output": "0" }, { "input": "3 3\nabc\nxxa", "output": "3\n1 2 3 " }, { "input": "3 5\naab\nzfhka", "output": "3\n1 2 3 " }, { "input": "3 3\nabc\nxya", "output": "3\n1 2 3 " }, { "input": "3 3\nabc\ncab", "output": "3\n1 2 3 " }, { "input": "5 5\nabcde\nxxabc", "output": "5\n1 2 3 4 5 " }, { "input": "3 10\nass\nabcdefssss", "output": "1\n1 " }, { "input": "4 4\nabcd\neeab", "output": "4\n1 2 3 4 " }, { "input": "3 4\nabh\nbhaa", "output": "3\n1 2 3 " }, { "input": "2 3\nzb\naaz", "output": "2\n1 2 " }, { "input": "2 3\nab\ndda", "output": "2\n1 2 " }, { "input": "3 3\ncba\nbac", "output": "3\n1 2 3 " }, { "input": "3 4\nabc\nxxxa", "output": "3\n1 2 3 " }, { "input": "2 3\nab\nbbb", "output": "1\n1 " }, { "input": "10 15\nsdkjeaafww\nefjklffnkddkfey", "output": "9\n1 2 4 5 6 7 8 9 10 " }, { "input": "3 3\nabc\nzbc", "output": "1\n1 " }, { "input": "3 7\nabc\neeeeeab", "output": "3\n1 2 3 " }, { "input": "2 6\nab\nxyxbab", "output": "0" }, { "input": "4 7\nabcd\nzzzzabc", "output": "4\n1 2 3 4 " }, { "input": "3 5\nabc\nabzzz", "output": "1\n3 " }, { "input": "3 3\naaz\nzaa", "output": "2\n1 3 " }, { "input": "3 6\nabc\nxaybzd", "output": "2\n2 3 " }, { "input": "4 5\naaaa\naaaap", "output": "0" } ]
1,642,919,657
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
10
77
0
import math n, m = map(int, input().split()) s = list(input()) t = list(input()) idx = -1 mv = math.inf for i in range(m - n + 1): cnt = 0 for j in range(n): if s[j] != t[i + j]: cnt += 1 if cnt < mv: idx = i mv = cnt print(cnt) for i in range(n): if s[i] != t[idx + i]: print(i + 1, end=' ')
Title: Crossword solving Time Limit: None seconds Memory Limit: None megabytes Problem Description: Erelong Leha was bored by calculating of the greatest common divisor of two factorials. Therefore he decided to solve some crosswords. It's well known that it is a very interesting occupation though it can be very difficult from time to time. In the course of solving one of the crosswords, Leha had to solve a simple task. You are able to do it too, aren't you? Leha has two strings *s* and *t*. The hacker wants to change the string *s* at such way, that it can be found in *t* as a substring. All the changes should be the following: Leha chooses one position in the string *s* and replaces the symbol in this position with the question mark "?". The hacker is sure that the question mark in comparison can play the role of an arbitrary symbol. For example, if he gets string *s*="ab?b" as a result, it will appear in *t*="aabrbb" as a substring. Guaranteed that the length of the string *s* doesn't exceed the length of the string *t*. Help the hacker to replace in *s* as few symbols as possible so that the result of the replacements can be found in *t* as a substring. The symbol "?" should be considered equal to any other symbol. Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=*m*<=≤<=1000) — the length of the string *s* and the length of the string *t* correspondingly. The second line contains *n* lowercase English letters — string *s*. The third line contains *m* lowercase English letters — string *t*. Output Specification: In the first line print single integer *k* — the minimal number of symbols that need to be replaced. In the second line print *k* distinct integers denoting the positions of symbols in the string *s* which need to be replaced. Print the positions in any order. If there are several solutions print any of them. The numbering of the positions begins from one. Demo Input: ['3 5\nabc\nxaybz\n', '4 10\nabcd\nebceabazcd\n'] Demo Output: ['2\n2 3 \n', '1\n2 \n'] Note: none
```python import math n, m = map(int, input().split()) s = list(input()) t = list(input()) idx = -1 mv = math.inf for i in range(m - n + 1): cnt = 0 for j in range(n): if s[j] != t[i + j]: cnt += 1 if cnt < mv: idx = i mv = cnt print(cnt) for i in range(n): if s[i] != t[idx + i]: print(i + 1, end=' ') ```
0
363
B
Fence
PROGRAMMING
1,100
[ "brute force", "dp" ]
null
null
There is a fence in front of Polycarpus's home. The fence consists of *n* planks of the same width which go one after another from left to right. The height of the *i*-th plank is *h**i* meters, distinct planks can have distinct heights. Polycarpus has bought a posh piano and is thinking about how to get it into the house. In order to carry out his plan, he needs to take exactly *k* consecutive planks from the fence. Higher planks are harder to tear off the fence, so Polycarpus wants to find such *k* consecutive planks that the sum of their heights is minimal possible. Write the program that finds the indexes of *k* consecutive planks with minimal total height. Pay attention, the fence is not around Polycarpus's home, it is in front of home (in other words, the fence isn't cyclic).
The first line of the input contains integers *n* and *k* (1<=≤<=*n*<=≤<=1.5·105,<=1<=≤<=*k*<=≤<=*n*) — the number of planks in the fence and the width of the hole for the piano. The second line contains the sequence of integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=100), where *h**i* is the height of the *i*-th plank of the fence.
Print such integer *j* that the sum of the heights of planks *j*, *j*<=+<=1, ..., *j*<=+<=*k*<=-<=1 is the minimum possible. If there are multiple such *j*'s, print any of them.
[ "7 3\n1 2 6 1 1 7 1\n" ]
[ "3\n" ]
In the sample, your task is to find three consecutive planks with the minimum sum of heights. In the given case three planks with indexes 3, 4 and 5 have the required attribute, their total height is 8.
1,000
[ { "input": "7 3\n1 2 6 1 1 7 1", "output": "3" }, { "input": "1 1\n100", "output": "1" }, { "input": "2 1\n10 20", "output": "1" }, { "input": "10 5\n1 2 3 1 2 2 3 1 4 5", "output": "1" }, { "input": "10 2\n3 1 4 1 4 6 2 1 4 6", "output": "7" }, { "input": "2 2\n20 10", "output": "1" }, { "input": "2 1\n20 1", "output": "2" }, { "input": "3 1\n1 2 3", "output": "1" }, { "input": "3 1\n2 1 3", "output": "2" }, { "input": "3 1\n3 2 1", "output": "3" }, { "input": "3 2\n1 2 3", "output": "1" }, { "input": "3 2\n3 2 1", "output": "2" }, { "input": "3 3\n1 2 3", "output": "1" }, { "input": "4 2\n9 8 11 7", "output": "1" }, { "input": "4 2\n10 1 2 3", "output": "2" }, { "input": "6 3\n56 56 56 2 1 2", "output": "4" }, { "input": "8 3\n1 1 1 1 2 60 90 1", "output": "1" }, { "input": "4 1\n1 5 2 2", "output": "1" }, { "input": "4 2\n4 6 7 4", "output": "1" }, { "input": "10 4\n1 1 1 4 4 4 4 4 4 3", "output": "1" }, { "input": "6 3\n1 2 1 3 1 1", "output": "1" }, { "input": "5 2\n100 100 100 1 1", "output": "4" } ]
1,684,094,355
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
1
46
0
input() input() print(3)
Title: Fence Time Limit: None seconds Memory Limit: None megabytes Problem Description: There is a fence in front of Polycarpus's home. The fence consists of *n* planks of the same width which go one after another from left to right. The height of the *i*-th plank is *h**i* meters, distinct planks can have distinct heights. Polycarpus has bought a posh piano and is thinking about how to get it into the house. In order to carry out his plan, he needs to take exactly *k* consecutive planks from the fence. Higher planks are harder to tear off the fence, so Polycarpus wants to find such *k* consecutive planks that the sum of their heights is minimal possible. Write the program that finds the indexes of *k* consecutive planks with minimal total height. Pay attention, the fence is not around Polycarpus's home, it is in front of home (in other words, the fence isn't cyclic). Input Specification: The first line of the input contains integers *n* and *k* (1<=≤<=*n*<=≤<=1.5·105,<=1<=≤<=*k*<=≤<=*n*) — the number of planks in the fence and the width of the hole for the piano. The second line contains the sequence of integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=100), where *h**i* is the height of the *i*-th plank of the fence. Output Specification: Print such integer *j* that the sum of the heights of planks *j*, *j*<=+<=1, ..., *j*<=+<=*k*<=-<=1 is the minimum possible. If there are multiple such *j*'s, print any of them. Demo Input: ['7 3\n1 2 6 1 1 7 1\n'] Demo Output: ['3\n'] Note: In the sample, your task is to find three consecutive planks with the minimum sum of heights. In the given case three planks with indexes 3, 4 and 5 have the required attribute, their total height is 8.
```python input() input() print(3) ```
0
0
none
none
none
0
[ "none" ]
null
null
By 2312 there were *n* Large Hadron Colliders in the inhabited part of the universe. Each of them corresponded to a single natural number from 1 to *n*. However, scientists did not know what activating several colliders simultaneously could cause, so the colliders were deactivated. In 2312 there was a startling discovery: a collider's activity is safe if and only if all numbers of activated colliders are pairwise relatively prime to each other (two numbers are relatively prime if their greatest common divisor equals 1)! If two colliders with relatively nonprime numbers are activated, it will cause a global collapse. Upon learning this, physicists rushed to turn the colliders on and off and carry out all sorts of experiments. To make sure than the scientists' quickness doesn't end with big trouble, the Large Hadron Colliders' Large Remote Control was created. You are commissioned to write the software for the remote (well, you do not expect anybody to operate it manually, do you?). Initially, all colliders are deactivated. Your program receives multiple requests of the form "activate/deactivate the *i*-th collider". The program should handle requests in the order of receiving them. The program should print the processed results in the format described below. To the request of "+ i" (that is, to activate the *i*-th collider), the program should print exactly one of the following responses: - "Success" if the activation was successful. - "Already on", if the *i*-th collider was already activated before the request. - "Conflict with j", if there is a conflict with the *j*-th collider (that is, the *j*-th collider is on, and numbers *i* and *j* are not relatively prime). In this case, the *i*-th collider shouldn't be activated. If a conflict occurs with several colliders simultaneously, you should print the number of any of them. The request of "- i" (that is, to deactivate the *i*-th collider), should receive one of the following responses from the program: - "Success", if the deactivation was successful. - "Already off", if the *i*-th collider was already deactivated before the request. You don't need to print quotes in the output of the responses to the requests.
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the number of colliders and the number of requests, correspondingly. Next *m* lines contain numbers of requests, one per line, in the form of either "+ i" (without the quotes) — activate the *i*-th collider, or "- i" (without the quotes) — deactivate the *i*-th collider (1<=≤<=*i*<=≤<=*n*).
Print *m* lines — the results of executing requests in the above given format. The requests should be processed in the order, in which they are given in the input. Don't forget that the responses to the requests should be printed without quotes.
[ "10 10\n+ 6\n+ 10\n+ 5\n- 10\n- 5\n- 6\n+ 10\n+ 3\n+ 6\n+ 3\n" ]
[ "Success\nConflict with 6\nSuccess\nAlready off\nSuccess\nSuccess\nSuccess\nSuccess\nConflict with 10\nAlready on\n" ]
Note that in the sample the colliders don't turn on after the second and ninth requests. The ninth request could also receive response "Conflict with 3".
0
[ { "input": "10 10\n+ 6\n+ 10\n+ 5\n- 10\n- 5\n- 6\n+ 10\n+ 3\n+ 6\n+ 3", "output": "Success\nConflict with 6\nSuccess\nAlready off\nSuccess\nSuccess\nSuccess\nSuccess\nConflict with 10\nAlready on" }, { "input": "7 5\n+ 7\n+ 6\n+ 4\n+ 3\n- 7", "output": "Success\nSuccess\nConflict with 6\nConflict with 6\nSuccess" }, { "input": "10 5\n+ 2\n- 8\n- 4\n- 10\n+ 1", "output": "Success\nAlready off\nAlready off\nAlready off\nSuccess" }, { "input": "10 10\n+ 1\n+ 10\n- 1\n- 10\n+ 1\n- 1\n+ 7\n+ 8\n+ 6\n- 7", "output": "Success\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nConflict with 8\nSuccess" }, { "input": "15 15\n+ 12\n+ 6\n+ 13\n- 13\n+ 7\n+ 14\n+ 8\n+ 13\n- 13\n+ 15\n+ 4\n+ 10\n+ 11\n+ 2\n- 14", "output": "Success\nConflict with 12\nSuccess\nSuccess\nSuccess\nConflict with 12\nConflict with 12\nSuccess\nSuccess\nConflict with 12\nConflict with 12\nConflict with 12\nSuccess\nConflict with 12\nAlready off" }, { "input": "2 20\n+ 1\n+ 2\n- 2\n+ 2\n- 1\n- 2\n+ 2\n- 2\n+ 2\n+ 1\n- 1\n+ 1\n- 1\n- 2\n+ 1\n- 1\n+ 1\n- 1\n+ 2\n+ 1", "output": "Success\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess" }, { "input": "2 20\n- 1\n- 2\n- 1\n- 2\n+ 2\n+ 1\n- 1\n+ 1\n+ 1\n+ 2\n- 2\n+ 1\n- 2\n+ 2\n+ 1\n+ 1\n+ 1\n- 1\n- 1\n- 2", "output": "Already off\nAlready off\nAlready off\nAlready off\nSuccess\nSuccess\nSuccess\nSuccess\nAlready on\nAlready on\nSuccess\nAlready on\nAlready off\nSuccess\nAlready on\nAlready on\nAlready on\nSuccess\nAlready off\nSuccess" }, { "input": "25 20\n+ 7\n+ 14\n- 7\n+ 11\n+ 15\n+ 10\n+ 20\n- 15\n+ 13\n- 14\n+ 4\n- 11\n- 20\n+ 15\n+ 16\n+ 3\n+ 11\n+ 22\n- 16\n- 22", "output": "Success\nConflict with 7\nSuccess\nSuccess\nSuccess\nConflict with 15\nConflict with 15\nSuccess\nSuccess\nAlready off\nSuccess\nSuccess\nAlready off\nSuccess\nConflict with 4\nConflict with 15\nSuccess\nConflict with 4\nAlready off\nAlready off" }, { "input": "50 30\n- 39\n- 2\n+ 37\n- 10\n+ 27\n- 25\n+ 41\n+ 23\n- 36\n+ 49\n+ 5\n- 28\n+ 22\n+ 45\n+ 1\n+ 23\n+ 36\n+ 35\n- 4\n- 28\n- 10\n- 36\n- 38\n- 2\n- 38\n- 38\n- 37\n+ 8\n- 27\n- 28", "output": "Already off\nAlready off\nSuccess\nAlready off\nSuccess\nAlready off\nSuccess\nSuccess\nAlready off\nSuccess\nSuccess\nAlready off\nSuccess\nConflict with 27\nSuccess\nAlready on\nConflict with 22\nConflict with 5\nAlready off\nAlready off\nAlready off\nAlready off\nAlready off\nAlready off\nAlready off\nAlready off\nSuccess\nConflict with 22\nSuccess\nAlready off" }, { "input": "50 50\n+ 14\n+ 4\n+ 20\n+ 37\n+ 50\n+ 46\n+ 19\n- 20\n+ 25\n+ 47\n+ 10\n+ 6\n+ 34\n+ 12\n+ 41\n- 47\n+ 9\n+ 22\n+ 28\n- 41\n- 34\n+ 47\n+ 40\n- 12\n+ 42\n- 9\n- 4\n+ 15\n- 15\n+ 27\n+ 8\n+ 38\n+ 9\n+ 4\n+ 17\n- 8\n+ 13\n- 47\n+ 7\n- 9\n- 38\n+ 30\n+ 48\n- 50\n- 7\n+ 41\n+ 34\n+ 23\n+ 11\n+ 16", "output": "Success\nConflict with 14\nConflict with 14\nSuccess\nConflict with 14\nConflict with 14\nSuccess\nAlready off\nSuccess\nSuccess\nConflict with 14\nConflict with 14\nConflict with 14\nConflict with 14\nSuccess\nSuccess\nSuccess\nConflict with 14\nConflict with 14\nSuccess\nAlready off\nSuccess\nConflict with 14\nAlready off\nConflict with 14\nSuccess\nAlready off\nConflict with 25\nAlready off\nSuccess\nConflict with 14\nConflict with 14\nConflict with 27\nConflict with 14\nSuccess\nAlready off\nSuccess\nS..." }, { "input": "100 1\n+ 51", "output": "Success" }, { "input": "1 100\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1", "output": "Success\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess..." }, { "input": "100 50\n+ 2\n+ 3\n+ 5\n+ 7\n+ 11\n+ 13\n+ 17\n+ 19\n+ 23\n+ 29\n+ 31\n+ 37\n+ 41\n+ 43\n+ 47\n+ 53\n+ 59\n+ 61\n+ 67\n+ 71\n+ 73\n+ 79\n+ 83\n+ 89\n+ 97\n+ 52\n+ 96\n+ 54\n+ 56\n+ 88\n+ 69\n+ 65\n+ 84\n+ 10\n+ 85\n- 37\n+ 80\n- 53\n+ 25\n- 5\n+ 45\n+ 90\n+ 95\n+ 33\n+ 81\n+ 6\n+ 20\n- 10\n+ 94\n- 61", "output": "Success\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nConflict with 2\nConflict with 2\nConflict with 2\nConflict with 2\nConflict with 2\nConflict with 3\nConflict with 5\nConflict with 2\nConflict with 2\nConflict with 5\nSuccess\nConflict with 2\nSuccess\nConflict with 5\nSuccess\nConflict with 3\nConflict with 2\nConflict with 19\nCon..." }, { "input": "100000 1\n+ 12345", "output": "Success" }, { "input": "4 2\n+ 2\n+ 4", "output": "Success\nConflict with 2" }, { "input": "100000 2\n+ 57314\n+ 85971", "output": "Success\nConflict with 57314" }, { "input": "100000 4\n+ 81799\n+ 81799\n- 81799\n+ 81799", "output": "Success\nAlready on\nSuccess\nSuccess" } ]
1,689,436,158
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
92
0
print("_RANDOM_GUESS_1689436158.0150642")# 1689436158.0150845
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: By 2312 there were *n* Large Hadron Colliders in the inhabited part of the universe. Each of them corresponded to a single natural number from 1 to *n*. However, scientists did not know what activating several colliders simultaneously could cause, so the colliders were deactivated. In 2312 there was a startling discovery: a collider's activity is safe if and only if all numbers of activated colliders are pairwise relatively prime to each other (two numbers are relatively prime if their greatest common divisor equals 1)! If two colliders with relatively nonprime numbers are activated, it will cause a global collapse. Upon learning this, physicists rushed to turn the colliders on and off and carry out all sorts of experiments. To make sure than the scientists' quickness doesn't end with big trouble, the Large Hadron Colliders' Large Remote Control was created. You are commissioned to write the software for the remote (well, you do not expect anybody to operate it manually, do you?). Initially, all colliders are deactivated. Your program receives multiple requests of the form "activate/deactivate the *i*-th collider". The program should handle requests in the order of receiving them. The program should print the processed results in the format described below. To the request of "+ i" (that is, to activate the *i*-th collider), the program should print exactly one of the following responses: - "Success" if the activation was successful. - "Already on", if the *i*-th collider was already activated before the request. - "Conflict with j", if there is a conflict with the *j*-th collider (that is, the *j*-th collider is on, and numbers *i* and *j* are not relatively prime). In this case, the *i*-th collider shouldn't be activated. If a conflict occurs with several colliders simultaneously, you should print the number of any of them. The request of "- i" (that is, to deactivate the *i*-th collider), should receive one of the following responses from the program: - "Success", if the deactivation was successful. - "Already off", if the *i*-th collider was already deactivated before the request. You don't need to print quotes in the output of the responses to the requests. Input Specification: The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the number of colliders and the number of requests, correspondingly. Next *m* lines contain numbers of requests, one per line, in the form of either "+ i" (without the quotes) — activate the *i*-th collider, or "- i" (without the quotes) — deactivate the *i*-th collider (1<=≤<=*i*<=≤<=*n*). Output Specification: Print *m* lines — the results of executing requests in the above given format. The requests should be processed in the order, in which they are given in the input. Don't forget that the responses to the requests should be printed without quotes. Demo Input: ['10 10\n+ 6\n+ 10\n+ 5\n- 10\n- 5\n- 6\n+ 10\n+ 3\n+ 6\n+ 3\n'] Demo Output: ['Success\nConflict with 6\nSuccess\nAlready off\nSuccess\nSuccess\nSuccess\nSuccess\nConflict with 10\nAlready on\n'] Note: Note that in the sample the colliders don't turn on after the second and ninth requests. The ninth request could also receive response "Conflict with 3".
```python print("_RANDOM_GUESS_1689436158.0150642")# 1689436158.0150845 ```
0
268
B
Buttons
PROGRAMMING
1,000
[ "implementation", "math" ]
null
null
Manao is trying to open a rather challenging lock. The lock has *n* buttons on it and to open it, you should press the buttons in a certain order to open the lock. When you push some button, it either stays pressed into the lock (that means that you've guessed correctly and pushed the button that goes next in the sequence), or all pressed buttons return to the initial position. When all buttons are pressed into the lock at once, the lock opens. Consider an example with three buttons. Let's say that the opening sequence is: {2, 3, 1}. If you first press buttons 1 or 3, the buttons unpress immediately. If you first press button 2, it stays pressed. If you press 1 after 2, all buttons unpress. If you press 3 after 2, buttons 3 and 2 stay pressed. As soon as you've got two pressed buttons, you only need to press button 1 to open the lock. Manao doesn't know the opening sequence. But he is really smart and he is going to act in the optimal way. Calculate the number of times he's got to push a button in order to open the lock in the worst-case scenario.
A single line contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of buttons the lock has.
In a single line print the number of times Manao has to push a button in the worst-case scenario.
[ "2\n", "3\n" ]
[ "3\n", "7\n" ]
Consider the first test sample. Manao can fail his first push and push the wrong button. In this case he will already be able to guess the right one with his second push. And his third push will push the second right button. Thus, in the worst-case scenario he will only need 3 pushes.
1,000
[ { "input": "2", "output": "3" }, { "input": "3", "output": "7" }, { "input": "4", "output": "14" }, { "input": "1", "output": "1" }, { "input": "10", "output": "175" }, { "input": "2000", "output": "1333335000" }, { "input": "1747", "output": "888644743" }, { "input": "889", "output": "117099969" }, { "input": "1999", "output": "1331335999" }, { "input": "914", "output": "127259419" }, { "input": "996", "output": "164675486" }, { "input": "17", "output": "833" }, { "input": "50", "output": "20875" }, { "input": "91", "output": "125671" }, { "input": "92", "output": "129858" }, { "input": "256", "output": "2796416" }, { "input": "512", "output": "22370048" }, { "input": "666", "output": "49235271" }, { "input": "667", "output": "49457383" }, { "input": "314", "output": "5160119" }, { "input": "1241", "output": "318541121" }, { "input": "1500", "output": "562501250" }, { "input": "1837", "output": "1033182073" }, { "input": "1000", "output": "166667500" } ]
1,690,514,874
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
60
0
import math n = int(input()) print(math.factorial(n)+1)
Title: Buttons Time Limit: None seconds Memory Limit: None megabytes Problem Description: Manao is trying to open a rather challenging lock. The lock has *n* buttons on it and to open it, you should press the buttons in a certain order to open the lock. When you push some button, it either stays pressed into the lock (that means that you've guessed correctly and pushed the button that goes next in the sequence), or all pressed buttons return to the initial position. When all buttons are pressed into the lock at once, the lock opens. Consider an example with three buttons. Let's say that the opening sequence is: {2, 3, 1}. If you first press buttons 1 or 3, the buttons unpress immediately. If you first press button 2, it stays pressed. If you press 1 after 2, all buttons unpress. If you press 3 after 2, buttons 3 and 2 stay pressed. As soon as you've got two pressed buttons, you only need to press button 1 to open the lock. Manao doesn't know the opening sequence. But he is really smart and he is going to act in the optimal way. Calculate the number of times he's got to push a button in order to open the lock in the worst-case scenario. Input Specification: A single line contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of buttons the lock has. Output Specification: In a single line print the number of times Manao has to push a button in the worst-case scenario. Demo Input: ['2\n', '3\n'] Demo Output: ['3\n', '7\n'] Note: Consider the first test sample. Manao can fail his first push and push the wrong button. In this case he will already be able to guess the right one with his second push. And his third push will push the second right button. Thus, in the worst-case scenario he will only need 3 pushes.
```python import math n = int(input()) print(math.factorial(n)+1) ```
0
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,586,954,160
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
186
0
s = intput() low = 0 upper = 0 for i in range(len(s)): if s[i].isupper(): upper +=1 else: low+=1 if low >= upper: print(s.lower()) else: print(s.upper())
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python s = intput() low = 0 upper = 0 for i in range(len(s)): if s[i].isupper(): upper +=1 else: low+=1 if low >= upper: print(s.lower()) else: print(s.upper()) ```
-1
6
B
President's Office
PROGRAMMING
1,100
[ "implementation" ]
B. President's Office
2
64
President of Berland has a very vast office-room, where, apart from him, work his subordinates. Each subordinate, as well as President himself, has his own desk of a unique colour. Each desk is rectangular, and its sides are parallel to the office walls. One day President decided to establish an assembly, of which all his deputies will be members. Unfortunately, he does not remember the exact amount of his deputies, but he remembers that the desk of each his deputy is adjacent to his own desk, that is to say, the two desks (President's and each deputy's) have a common side of a positive length. The office-room plan can be viewed as a matrix with *n* rows and *m* columns. Each cell of this matrix is either empty, or contains a part of a desk. An uppercase Latin letter stands for each desk colour. The «period» character («.») stands for an empty cell.
The first line contains two separated by a space integer numbers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the length and the width of the office-room, and *c* character — the President's desk colour. The following *n* lines contain *m* characters each — the office-room description. It is guaranteed that the colour of each desk is unique, and each desk represents a continuous subrectangle of the given matrix. All colours are marked by uppercase Latin letters.
Print the only number — the amount of President's deputies.
[ "3 4 R\nG.B.\n.RR.\nTTT.\n", "3 3 Z\n...\n.H.\n..Z\n" ]
[ "2\n", "0\n" ]
none
0
[ { "input": "3 4 R\nG.B.\n.RR.\nTTT.", "output": "2" }, { "input": "3 3 Z\n...\n.H.\n..Z", "output": "0" }, { "input": "1 1 C\nC", "output": "0" }, { "input": "2 2 W\nKW\nKW", "output": "1" }, { "input": "1 10 H\n....DDHHHH", "output": "1" }, { "input": "3 2 W\nOO\nWW\nWW", "output": "1" }, { "input": "3 3 U\nUOO\nUVV\nUVV", "output": "2" }, { "input": "4 5 Z\n...ZZ\nUU.ZZ\nUUTT.\n..TT.", "output": "1" }, { "input": "4 4 X\nT..R\nTJJJ\nDJJJ\nXJJJ", "output": "2" }, { "input": "5 5 O\nCQGAV\nIHTUD\nRFPZO\nMYSKX\nJEWBN", "output": "3" }, { "input": "5 4 O\n.O.J\nWOBJ\nWOBJ\nDDBJ\nDD.J", "output": "3" }, { "input": "7 7 Q\n....RRR\nUUUURRR\nUUUUSS.\n....SSB\nPPP.OIB\n.MMTTIB\nQQQTTIB", "output": "2" }, { "input": "8 10 B\n..BBBBEEEE\n..BBBBEEEE\n..BBBBEEEE\n..BBBBEEEE\nJJJJYYYY..\nJJJJYYYY..\nJJJJYYYY..\nJJJJYYYY..", "output": "3" }, { "input": "7 13 G\n....GGGGGGXXX\nSSSSGGGGGGXXX\nSSSSJJFFFFFFF\nRRR.JJFFFFFFF\nRRRYYYYYYYAAA\nRRRYYYYYYYAAA\nRRR.......AAA", "output": "4" }, { "input": "10 10 T\nCCEEEKKKHJ\nCCRRRRRRHJ\nCC..XFFOOO\nZZZZZFFOOO\n..PTTFFOOO\nAAATTFFOOO\nAAATTYYYYY\nAAATTYYYYY\nAAAMMYYYYY\nAAA..YYYYY", "output": "6" }, { "input": "15 12 M\n............\n.....L..QQQQ\nNNN..L..QQQQ\nNNN..LJJJJJ.\nNNNEEEEEEEE.\nNNNEEEEEEEE.\nNNNMMMMM.AAA\nNNNMMMMM.AAA\n.RRMMMMM.AAA\n.RRMMMMMYAAA\n.RRMMMMMYAAA\n.RRMMMMMYAAA\nZRRMMMMMYAAA\nZRRMMMMM.AAA\nZRRMMMMM.AAA", "output": "4" } ]
1,610,629,779
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
62
204,800
x=input().split() y=[] for i in range(int(x[0])): y.append(input().split()) z=[] p=[] for i in range(int(x[0])): for j in range(int(x[1])): if y[i][j]==x[2]: p.append(j) z.append(i) a=min(z) b=max(z) c=min(p) d=max(p) q=[] for i in range(a-1,b+2): for j in range(c-1,d-c+2,d+2): if(y[i][j]!='.'): q.append(y[i][j]) r=set() for i in q: r.add(i) print(len(r))
Title: President's Office Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: President of Berland has a very vast office-room, where, apart from him, work his subordinates. Each subordinate, as well as President himself, has his own desk of a unique colour. Each desk is rectangular, and its sides are parallel to the office walls. One day President decided to establish an assembly, of which all his deputies will be members. Unfortunately, he does not remember the exact amount of his deputies, but he remembers that the desk of each his deputy is adjacent to his own desk, that is to say, the two desks (President's and each deputy's) have a common side of a positive length. The office-room plan can be viewed as a matrix with *n* rows and *m* columns. Each cell of this matrix is either empty, or contains a part of a desk. An uppercase Latin letter stands for each desk colour. The «period» character («.») stands for an empty cell. Input Specification: The first line contains two separated by a space integer numbers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the length and the width of the office-room, and *c* character — the President's desk colour. The following *n* lines contain *m* characters each — the office-room description. It is guaranteed that the colour of each desk is unique, and each desk represents a continuous subrectangle of the given matrix. All colours are marked by uppercase Latin letters. Output Specification: Print the only number — the amount of President's deputies. Demo Input: ['3 4 R\nG.B.\n.RR.\nTTT.\n', '3 3 Z\n...\n.H.\n..Z\n'] Demo Output: ['2\n', '0\n'] Note: none
```python x=input().split() y=[] for i in range(int(x[0])): y.append(input().split()) z=[] p=[] for i in range(int(x[0])): for j in range(int(x[1])): if y[i][j]==x[2]: p.append(j) z.append(i) a=min(z) b=max(z) c=min(p) d=max(p) q=[] for i in range(a-1,b+2): for j in range(c-1,d-c+2,d+2): if(y[i][j]!='.'): q.append(y[i][j]) r=set() for i in q: r.add(i) print(len(r)) ```
-1
714
A
Meeting of Old Friends
PROGRAMMING
1,100
[ "implementation", "math" ]
null
null
Today an outstanding event is going to happen in the forest — hedgehog Filya will come to his old fried Sonya! Sonya is an owl and she sleeps during the day and stay awake from minute *l*1 to minute *r*1 inclusive. Also, during the minute *k* she prinks and is unavailable for Filya. Filya works a lot and he plans to visit Sonya from minute *l*2 to minute *r*2 inclusive. Calculate the number of minutes they will be able to spend together.
The only line of the input contains integers *l*1, *r*1, *l*2, *r*2 and *k* (1<=≤<=*l*1,<=*r*1,<=*l*2,<=*r*2,<=*k*<=≤<=1018, *l*1<=≤<=*r*1, *l*2<=≤<=*r*2), providing the segments of time for Sonya and Filya and the moment of time when Sonya prinks.
Print one integer — the number of minutes Sonya and Filya will be able to spend together.
[ "1 10 9 20 1\n", "1 100 50 200 75\n" ]
[ "2\n", "50\n" ]
In the first sample, they will be together during minutes 9 and 10. In the second sample, they will be together from minute 50 to minute 74 and from minute 76 to minute 100.
500
[ { "input": "1 10 9 20 1", "output": "2" }, { "input": "1 100 50 200 75", "output": "50" }, { "input": "6 6 5 8 9", "output": "1" }, { "input": "1 1000000000 1 1000000000 1", "output": "999999999" }, { "input": "5 100 8 8 8", "output": "0" }, { "input": "1 1000000000000000000 2 99999999999999999 1000000000", "output": "99999999999999997" }, { "input": "1 1 1 1 1", "output": "0" }, { "input": "1 2 3 4 5", "output": "0" }, { "input": "1 1000000000 2 999999999 3141592", "output": "999999997" }, { "input": "24648817341102 41165114064236 88046848035 13602161452932 10000831349205", "output": "0" }, { "input": "1080184299348 34666828555290 6878390132365 39891656267344 15395310291636", "output": "27788438422925" }, { "input": "11814 27385 22309 28354 23595", "output": "5076" }, { "input": "4722316546398 36672578279675 796716437180 33840047334985 13411035401708", "output": "29117730788587" }, { "input": "14300093617438 14381698008501 6957847034861 32510754974307 66056597033082", "output": "81604391064" }, { "input": "700062402405871919 762322967106512617 297732773882447821 747309903322652819 805776739998108178", "output": "47247500916780901" }, { "input": "59861796371397621 194872039092923459 668110259718450585 841148673332698972 928360292123223779", "output": "0" }, { "input": "298248781360904821 346420922793050061 237084570581741798 726877079564549183 389611850470532358", "output": "48172141432145241" }, { "input": "420745791717606818 864206437350900994 764928840030524015 966634105370748487 793326512080703489", "output": "99277597320376979" }, { "input": "519325240668210886 776112702001665034 360568516809443669 875594219634943179 994594983925273138", "output": "256787461333454149" }, { "input": "170331212821058551 891149660635282032 125964175621755330 208256491683509799 526532153531983174", "output": "37925278862451249" }, { "input": "1 3 3 5 3", "output": "0" }, { "input": "1 5 8 10 9", "output": "0" }, { "input": "1 2 4 5 10", "output": "0" }, { "input": "1 2 2 3 5", "output": "1" }, { "input": "2 4 3 7 3", "output": "1" }, { "input": "1 2 9 10 1", "output": "0" }, { "input": "5 15 1 10 5", "output": "5" }, { "input": "1 4 9 20 25", "output": "0" }, { "input": "2 4 1 2 5", "output": "1" }, { "input": "10 1000 1 100 2", "output": "91" }, { "input": "1 3 3 8 10", "output": "1" }, { "input": "4 6 6 8 9", "output": "1" }, { "input": "2 3 1 4 3", "output": "1" }, { "input": "1 2 2 3 100", "output": "1" }, { "input": "1 2 100 120 2", "output": "0" }, { "input": "1 3 5 7 4", "output": "0" }, { "input": "1 3 5 7 5", "output": "0" }, { "input": "1 4 8 10 6", "output": "0" }, { "input": "1 2 5 6 100", "output": "0" }, { "input": "1 2 5 10 20", "output": "0" }, { "input": "1 2 5 6 7", "output": "0" }, { "input": "2 5 7 12 6", "output": "0" }, { "input": "10 20 50 100 80", "output": "0" }, { "input": "1 2 5 10 2", "output": "0" }, { "input": "1 2 5 6 4", "output": "0" }, { "input": "5 9 1 2 3", "output": "0" }, { "input": "50 100 1 20 3", "output": "0" }, { "input": "10 20 3 7 30", "output": "0" }, { "input": "1 5 10 10 100", "output": "0" }, { "input": "100 101 1 2 3", "output": "0" }, { "input": "1 5 10 20 6", "output": "0" }, { "input": "1 10 15 25 5", "output": "0" }, { "input": "1 2 5 10 3", "output": "0" }, { "input": "2 3 5 6 100", "output": "0" }, { "input": "1 2 4 5 6", "output": "0" }, { "input": "6 10 1 2 40", "output": "0" }, { "input": "20 30 1 5 1", "output": "0" }, { "input": "20 40 50 100 50", "output": "0" }, { "input": "1 1 4 9 2", "output": "0" }, { "input": "1 2 5 6 1", "output": "0" }, { "input": "1 100 400 500 450", "output": "0" }, { "input": "5 6 1 2 5", "output": "0" }, { "input": "1 10 21 30 50", "output": "0" }, { "input": "100 200 300 400 101", "output": "0" }, { "input": "2 8 12 16 9", "output": "0" }, { "input": "1 5 7 9 6", "output": "0" }, { "input": "300 400 100 200 101", "output": "0" }, { "input": "1 2 2 3 10", "output": "1" }, { "input": "1 10 100 200 5", "output": "0" }, { "input": "1 3 3 4 4", "output": "1" }, { "input": "10 20 30 40 25", "output": "0" }, { "input": "1 2 5 10 1", "output": "0" }, { "input": "2 4 8 10 1", "output": "0" }, { "input": "2 5 10 15 7", "output": "0" }, { "input": "100 200 5 10 1", "output": "0" }, { "input": "1 2 100 200 300", "output": "0" }, { "input": "30 100 10 20 25", "output": "0" }, { "input": "10 20 1 5 6", "output": "0" }, { "input": "4 5 1 2 4", "output": "0" }, { "input": "11 100 1 9 1000", "output": "0" }, { "input": "1 1 10 10 228", "output": "0" }, { "input": "5 7 10 20 15", "output": "0" }, { "input": "1 3 8 9 7", "output": "0" }, { "input": "1 10 2 8 8", "output": "6" }, { "input": "1 5 9 15 1", "output": "0" }, { "input": "1 3 5 6 12", "output": "0" }, { "input": "1 100 500 1000 3", "output": "0" }, { "input": "1 1 1 1 2", "output": "1" }, { "input": "1 1000 100 1000 200", "output": "900" }, { "input": "4 5 1 4 1", "output": "1" }, { "input": "1 5 5 7 3", "output": "1" }, { "input": "1 4 4 10 11", "output": "1" }, { "input": "1 1 3 4 100", "output": "0" }, { "input": "1 4 3 5 6", "output": "2" }, { "input": "10 100 20 30 40", "output": "11" }, { "input": "5 9 1 11 7", "output": "4" } ]
1,480,367,754
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
46
0
I = lambda :map(int, input().split()) l1,r1,l2,r2,k=I() ans=r1-l2+1 if l2<=k<=r1: ans-=1 print(max(0, ans))
Title: Meeting of Old Friends Time Limit: None seconds Memory Limit: None megabytes Problem Description: Today an outstanding event is going to happen in the forest — hedgehog Filya will come to his old fried Sonya! Sonya is an owl and she sleeps during the day and stay awake from minute *l*1 to minute *r*1 inclusive. Also, during the minute *k* she prinks and is unavailable for Filya. Filya works a lot and he plans to visit Sonya from minute *l*2 to minute *r*2 inclusive. Calculate the number of minutes they will be able to spend together. Input Specification: The only line of the input contains integers *l*1, *r*1, *l*2, *r*2 and *k* (1<=≤<=*l*1,<=*r*1,<=*l*2,<=*r*2,<=*k*<=≤<=1018, *l*1<=≤<=*r*1, *l*2<=≤<=*r*2), providing the segments of time for Sonya and Filya and the moment of time when Sonya prinks. Output Specification: Print one integer — the number of minutes Sonya and Filya will be able to spend together. Demo Input: ['1 10 9 20 1\n', '1 100 50 200 75\n'] Demo Output: ['2\n', '50\n'] Note: In the first sample, they will be together during minutes 9 and 10. In the second sample, they will be together from minute 50 to minute 74 and from minute 76 to minute 100.
```python I = lambda :map(int, input().split()) l1,r1,l2,r2,k=I() ans=r1-l2+1 if l2<=k<=r1: ans-=1 print(max(0, ans)) ```
0
272
A
Dima and Friends
PROGRAMMING
1,000
[ "implementation", "math" ]
null
null
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place. To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment. For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place. Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show. The numbers in the lines are separated by a single space.
In a single line print the answer to the problem.
[ "1\n1\n", "1\n2\n", "2\n3 5\n" ]
[ "3\n", "2\n", "3\n" ]
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend. In the second sample Dima can show 2 or 4 fingers.
500
[ { "input": "1\n1", "output": "3" }, { "input": "1\n2", "output": "2" }, { "input": "2\n3 5", "output": "3" }, { "input": "2\n3 5", "output": "3" }, { "input": "1\n5", "output": "3" }, { "input": "5\n4 4 3 5 1", "output": "4" }, { "input": "6\n2 3 2 2 1 3", "output": "4" }, { "input": "8\n2 2 5 3 4 3 3 2", "output": "4" }, { "input": "7\n4 1 3 2 2 4 5", "output": "4" }, { "input": "3\n3 5 1", "output": "4" }, { "input": "95\n4 2 3 4 4 5 2 2 4 4 3 5 3 3 3 5 4 2 5 4 2 1 1 3 4 2 1 3 5 4 2 1 1 5 1 1 2 2 4 4 5 4 5 5 2 1 2 2 2 4 5 5 2 4 3 4 4 3 5 2 4 1 5 4 5 1 3 2 4 2 2 1 5 3 1 5 3 4 3 3 2 1 2 2 1 3 1 5 2 3 1 1 2 5 2", "output": "5" }, { "input": "31\n3 2 3 3 3 3 4 4 1 5 5 4 2 4 3 2 2 1 4 4 1 2 3 1 1 5 5 3 4 4 1", "output": "4" }, { "input": "42\n3 1 2 2 5 1 2 2 4 5 4 5 2 5 4 5 4 4 1 4 3 3 4 4 4 4 3 2 1 3 4 5 5 2 1 2 1 5 5 2 4 4", "output": "5" }, { "input": "25\n4 5 5 5 3 1 1 4 4 4 3 5 4 4 1 4 4 1 2 4 2 5 4 5 3", "output": "5" }, { "input": "73\n3 4 3 4 5 1 3 4 2 1 4 2 2 3 5 3 1 4 2 3 2 1 4 5 3 5 2 2 4 3 2 2 5 3 2 3 5 1 3 1 1 4 5 2 4 2 5 1 4 3 1 3 1 4 2 3 3 3 3 5 5 2 5 2 5 4 3 1 1 5 5 2 3", "output": "4" }, { "input": "46\n1 4 4 5 4 5 2 3 5 5 3 2 5 4 1 3 2 2 1 4 3 1 5 5 2 2 2 2 4 4 1 1 4 3 4 3 1 4 2 2 4 2 3 2 5 2", "output": "4" }, { "input": "23\n5 2 1 1 4 2 5 5 3 5 4 5 5 1 1 5 2 4 5 3 4 4 3", "output": "5" }, { "input": "6\n4 2 3 1 3 5", "output": "4" }, { "input": "15\n5 5 5 3 5 4 1 3 3 4 3 4 1 4 4", "output": "5" }, { "input": "93\n1 3 1 4 3 3 5 3 1 4 5 4 3 2 2 4 3 1 4 1 2 3 3 3 2 5 1 3 1 4 5 1 1 1 4 2 1 2 3 1 1 1 5 1 5 5 1 2 5 4 3 2 2 4 4 2 5 4 5 5 3 1 3 1 2 1 3 1 1 2 3 4 4 5 5 3 2 1 3 3 5 1 3 5 4 4 1 3 3 4 2 3 2", "output": "5" }, { "input": "96\n1 5 1 3 2 1 2 2 2 2 3 4 1 1 5 4 4 1 2 3 5 1 4 4 4 1 3 3 1 4 5 4 1 3 5 3 4 4 3 2 1 1 4 4 5 1 1 2 5 1 2 3 1 4 1 2 2 2 3 2 3 3 2 5 2 2 3 3 3 3 2 1 2 4 5 5 1 5 3 2 1 4 3 5 5 5 3 3 5 3 4 3 4 2 1 3", "output": "5" }, { "input": "49\n1 4 4 3 5 2 2 1 5 1 2 1 2 5 1 4 1 4 5 2 4 5 3 5 2 4 2 1 3 4 2 1 4 2 1 1 3 3 2 3 5 4 3 4 2 4 1 4 1", "output": "5" }, { "input": "73\n4 1 3 3 3 1 5 2 1 4 1 1 3 5 1 1 4 5 2 1 5 4 1 5 3 1 5 2 4 5 1 4 3 3 5 2 2 3 3 2 5 1 4 5 2 3 1 4 4 3 5 2 3 5 1 4 3 5 1 2 4 1 3 3 5 4 2 4 2 4 1 2 5", "output": "5" }, { "input": "41\n5 3 5 4 2 5 4 3 1 1 1 5 4 3 4 3 5 4 2 5 4 1 1 3 2 4 5 3 5 1 5 5 1 1 1 4 4 1 2 4 3", "output": "5" }, { "input": "100\n3 3 1 4 2 4 4 3 1 5 1 1 4 4 3 4 4 3 5 4 5 2 4 3 4 1 2 4 5 4 2 1 5 4 1 1 4 3 2 4 1 2 1 4 4 5 5 4 4 5 3 2 5 1 4 2 2 1 1 2 5 2 5 1 5 3 1 4 3 2 4 3 2 2 4 5 5 1 2 3 1 4 1 2 2 2 5 5 2 3 2 4 3 1 1 2 1 2 1 2", "output": "5" }, { "input": "100\n2 1 1 3 5 4 4 2 3 4 3 4 5 4 5 4 2 4 5 3 4 5 4 1 1 4 4 1 1 2 5 4 2 4 5 3 2 5 4 3 4 5 1 3 4 2 5 4 5 4 5 2 4 1 2 5 3 1 4 4 5 3 4 3 1 2 5 4 2 5 4 1 5 3 5 4 1 2 5 3 1 1 1 1 5 3 4 3 5 1 1 5 5 1 1 2 2 1 5 1", "output": "5" }, { "input": "100\n4 4 3 3 2 5 4 4 2 1 4 4 4 5 4 1 2 1 5 2 4 3 4 1 4 1 2 5 1 4 5 4 2 1 2 5 3 4 5 5 2 1 2 2 2 2 2 3 2 5 1 2 2 3 2 5 5 1 3 4 5 2 1 3 4 2 2 4 4 3 3 3 2 3 2 1 5 5 5 2 1 4 2 3 5 1 4 4 2 3 2 5 5 4 3 5 1 3 5 5", "output": "5" }, { "input": "100\n4 4 2 5 4 2 2 3 4 4 3 2 3 3 1 3 4 3 3 4 1 3 1 4 5 3 4 3 1 1 1 3 3 2 3 4 3 4 2 2 1 5 1 4 5 1 1 1 3 3 1 1 3 2 5 4 2 5 2 4 5 4 4 1 1 2 1 1 4 5 1 1 5 3 3 2 5 5 5 1 4 1 4 1 1 3 2 3 4 4 2 5 5 2 5 1 1 3 5 3", "output": "5" }, { "input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "4" }, { "input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5", "output": "5" } ]
1,671,665,890
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
60
0
# -*- coding: utf-8 -*- """ Created on Wed Dec 21 20:24:07 2022 @author: Lenovo """ n = int(input()) s = input() s = s.split() for i in range(n): s[i] = int(s[i]) x = sum(s) for i in range(1,6): if (x+i)%(n+1)!=1: break print(i)
Title: Dima and Friends Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place. To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment. For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place. Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show. The numbers in the lines are separated by a single space. Output Specification: In a single line print the answer to the problem. Demo Input: ['1\n1\n', '1\n2\n', '2\n3 5\n'] Demo Output: ['3\n', '2\n', '3\n'] Note: In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend. In the second sample Dima can show 2 or 4 fingers.
```python # -*- coding: utf-8 -*- """ Created on Wed Dec 21 20:24:07 2022 @author: Lenovo """ n = int(input()) s = input() s = s.split() for i in range(n): s[i] = int(s[i]) x = sum(s) for i in range(1,6): if (x+i)%(n+1)!=1: break print(i) ```
0
911
C
Three Garlands
PROGRAMMING
1,400
[ "brute force", "constructive algorithms" ]
null
null
Mishka is decorating the Christmas tree. He has got three garlands, and all of them will be put on the tree. After that Mishka will switch these garlands on. When a garland is switched on, it periodically changes its state — sometimes it is lit, sometimes not. Formally, if *i*-th garland is switched on during *x*-th second, then it is lit only during seconds *x*, *x*<=+<=*k**i*, *x*<=+<=2*k**i*, *x*<=+<=3*k**i* and so on. Mishka wants to switch on the garlands in such a way that during each second after switching the garlands on there would be at least one lit garland. Formally, Mishka wants to choose three integers *x*1, *x*2 and *x*3 (not necessarily distinct) so that he will switch on the first garland during *x*1-th second, the second one — during *x*2-th second, and the third one — during *x*3-th second, respectively, and during each second starting from *max*(*x*1,<=*x*2,<=*x*3) at least one garland will be lit. Help Mishka by telling him if it is possible to do this!
The first line contains three integers *k*1, *k*2 and *k*3 (1<=≤<=*k**i*<=≤<=1500) — time intervals of the garlands.
If Mishka can choose moments of time to switch on the garlands in such a way that each second after switching the garlands on at least one garland will be lit, print YES. Otherwise, print NO.
[ "2 2 3\n", "4 2 3\n" ]
[ "YES\n", "NO\n" ]
In the first example Mishka can choose *x*<sub class="lower-index">1</sub> = 1, *x*<sub class="lower-index">2</sub> = 2, *x*<sub class="lower-index">3</sub> = 1. The first garland will be lit during seconds 1, 3, 5, 7, ..., the second — 2, 4, 6, 8, ..., which already cover all the seconds after the 2-nd one. It doesn't even matter what *x*<sub class="lower-index">3</sub> is chosen. Our choice will lead third to be lit during seconds 1, 4, 7, 10, ..., though. In the second example there is no way to choose such moments of time, there always be some seconds when no garland is lit.
0
[ { "input": "2 2 3", "output": "YES" }, { "input": "4 2 3", "output": "NO" }, { "input": "1499 1498 1500", "output": "NO" }, { "input": "1500 1500 1500", "output": "NO" }, { "input": "100 4 1", "output": "YES" }, { "input": "4 2 4", "output": "YES" }, { "input": "3 3 3", "output": "YES" }, { "input": "2 3 6", "output": "NO" }, { "input": "2 3 3", "output": "NO" }, { "input": "4 4 2", "output": "YES" }, { "input": "1 1 1", "output": "YES" }, { "input": "2 11 2", "output": "YES" }, { "input": "4 4 4", "output": "NO" }, { "input": "4 4 5", "output": "NO" }, { "input": "3 3 2", "output": "NO" }, { "input": "3 6 6", "output": "NO" }, { "input": "2 3 2", "output": "YES" }, { "input": "1 1 3", "output": "YES" }, { "input": "3 3 4", "output": "NO" }, { "input": "2 4 4", "output": "YES" }, { "input": "2 2 2", "output": "YES" }, { "input": "2 10 10", "output": "NO" }, { "input": "3 4 4", "output": "NO" }, { "input": "2 5 5", "output": "NO" }, { "input": "2 4 5", "output": "NO" }, { "input": "228 2 2", "output": "YES" }, { "input": "2 998 1000", "output": "NO" }, { "input": "2 6 6", "output": "NO" }, { "input": "6 4 7", "output": "NO" }, { "input": "2 5 2", "output": "YES" }, { "input": "2 100 100", "output": "NO" }, { "input": "7 7 2", "output": "NO" }, { "input": "3 3 6", "output": "NO" }, { "input": "82 3 82", "output": "NO" }, { "input": "2 3 5", "output": "NO" }, { "input": "1 218 924", "output": "YES" }, { "input": "4 4 123", "output": "NO" }, { "input": "4 4 3", "output": "NO" }, { "input": "3 4 2", "output": "NO" }, { "input": "2 2 5", "output": "YES" }, { "input": "2 10 2", "output": "YES" }, { "input": "5 2 2", "output": "YES" }, { "input": "3 3 9", "output": "NO" }, { "input": "1 5 5", "output": "YES" }, { "input": "2 4 6", "output": "NO" }, { "input": "15 3 3", "output": "NO" }, { "input": "1 5 10", "output": "YES" }, { "input": "2 3 14", "output": "NO" }, { "input": "1265 2 593", "output": "NO" }, { "input": "2 2 567", "output": "YES" }, { "input": "1 6 5", "output": "YES" }, { "input": "2 2 7", "output": "YES" }, { "input": "2 2 1500", "output": "YES" }, { "input": "3 6 9", "output": "NO" }, { "input": "1 46 79", "output": "YES" }, { "input": "4 3 3", "output": "NO" }, { "input": "2 4 8", "output": "NO" }, { "input": "1493 1489 1487", "output": "NO" }, { "input": "1 2 3", "output": "YES" }, { "input": "1 2 5", "output": "YES" }, { "input": "1 2 8", "output": "YES" }, { "input": "3 4 5", "output": "NO" }, { "input": "2 2 4", "output": "YES" }, { "input": "3 2 3", "output": "NO" }, { "input": "7 2 2", "output": "YES" }, { "input": "3 2 2", "output": "YES" }, { "input": "6 7 4", "output": "NO" } ]
1,649,672,194
2,147,483,647
PyPy 3-64
OK
TESTS
67
218
12,697,600
import sys,math,fractions #sys.stdin=open('input.txt','r') #sys.stdout=open('output.txt','w') input=sys.stdin.readline def Str()->str:return input() def Int()->int:return int(input()) def Float()->float:return float(input()) def Ints()->map:return map(int,input().split()) def listInt()->list:return list(Ints()) def Floats()->map:return map(float,input().split()) def listFloat()->list:return list(Floats()) a,b,c=sorted(Ints()) if a>3:print('NO') elif a==1:print('YES') elif a==3: if c==3:print('YES') else:print('NO') else: if b==2 or (b==4 and c==4):print('YES') else:print('NO')
Title: Three Garlands Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mishka is decorating the Christmas tree. He has got three garlands, and all of them will be put on the tree. After that Mishka will switch these garlands on. When a garland is switched on, it periodically changes its state — sometimes it is lit, sometimes not. Formally, if *i*-th garland is switched on during *x*-th second, then it is lit only during seconds *x*, *x*<=+<=*k**i*, *x*<=+<=2*k**i*, *x*<=+<=3*k**i* and so on. Mishka wants to switch on the garlands in such a way that during each second after switching the garlands on there would be at least one lit garland. Formally, Mishka wants to choose three integers *x*1, *x*2 and *x*3 (not necessarily distinct) so that he will switch on the first garland during *x*1-th second, the second one — during *x*2-th second, and the third one — during *x*3-th second, respectively, and during each second starting from *max*(*x*1,<=*x*2,<=*x*3) at least one garland will be lit. Help Mishka by telling him if it is possible to do this! Input Specification: The first line contains three integers *k*1, *k*2 and *k*3 (1<=≤<=*k**i*<=≤<=1500) — time intervals of the garlands. Output Specification: If Mishka can choose moments of time to switch on the garlands in such a way that each second after switching the garlands on at least one garland will be lit, print YES. Otherwise, print NO. Demo Input: ['2 2 3\n', '4 2 3\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first example Mishka can choose *x*<sub class="lower-index">1</sub> = 1, *x*<sub class="lower-index">2</sub> = 2, *x*<sub class="lower-index">3</sub> = 1. The first garland will be lit during seconds 1, 3, 5, 7, ..., the second — 2, 4, 6, 8, ..., which already cover all the seconds after the 2-nd one. It doesn't even matter what *x*<sub class="lower-index">3</sub> is chosen. Our choice will lead third to be lit during seconds 1, 4, 7, 10, ..., though. In the second example there is no way to choose such moments of time, there always be some seconds when no garland is lit.
```python import sys,math,fractions #sys.stdin=open('input.txt','r') #sys.stdout=open('output.txt','w') input=sys.stdin.readline def Str()->str:return input() def Int()->int:return int(input()) def Float()->float:return float(input()) def Ints()->map:return map(int,input().split()) def listInt()->list:return list(Ints()) def Floats()->map:return map(float,input().split()) def listFloat()->list:return list(Floats()) a,b,c=sorted(Ints()) if a>3:print('NO') elif a==1:print('YES') elif a==3: if c==3:print('YES') else:print('NO') else: if b==2 or (b==4 and c==4):print('YES') else:print('NO') ```
3
346
A
Alice and Bob
PROGRAMMING
1,600
[ "games", "math", "number theory" ]
null
null
It is so boring in the summer holiday, isn't it? So Alice and Bob have invented a new game to play. The rules are as follows. First, they get a set of *n* distinct integers. And then they take turns to make the following moves. During each move, either Alice or Bob (the player whose turn is the current) can choose two distinct integers *x* and *y* from the set, such that the set doesn't contain their absolute difference |*x*<=-<=*y*|. Then this player adds integer |*x*<=-<=*y*| to the set (so, the size of the set increases by one). If the current player has no valid move, he (or she) loses the game. The question is who will finally win the game if both players play optimally. Remember that Alice always moves first.
The first line contains an integer *n* (2<=≤<=*n*<=≤<=100) — the initial number of elements in the set. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the set.
Print a single line with the winner's name. If Alice wins print "Alice", otherwise print "Bob" (without quotes).
[ "2\n2 3\n", "2\n5 3\n", "3\n5 6 7\n" ]
[ "Alice\n", "Alice\n", "Bob\n" ]
Consider the first test sample. Alice moves first, and the only move she can do is to choose 2 and 3, then to add 1 to the set. Next Bob moves, there is no valid move anymore, so the winner is Alice.
500
[ { "input": "2\n2 3", "output": "Alice" }, { "input": "2\n5 3", "output": "Alice" }, { "input": "3\n5 6 7", "output": "Bob" }, { "input": "10\n72 96 24 66 6 18 12 30 60 48", "output": "Bob" }, { "input": "10\n78 66 6 60 18 84 36 96 72 48", "output": "Bob" }, { "input": "10\n98 63 42 56 14 77 70 35 84 21", "output": "Bob" }, { "input": "2\n1 1000000000", "output": "Bob" }, { "input": "2\n1000000000 999999999", "output": "Bob" }, { "input": "3\n2 4 6", "output": "Bob" }, { "input": "2\n4 6", "output": "Alice" }, { "input": "2\n2 6", "output": "Alice" }, { "input": "2\n6 2", "output": "Alice" }, { "input": "10\n100000000 200000000 300000000 400000000 500000000 600000000 700000000 800000000 900000000 1000000000", "output": "Bob" }, { "input": "2\n1 2", "output": "Bob" }, { "input": "10\n1 999999999 999999998 999999997 999999996 999999995 999999994 999999993 999999992 999999991", "output": "Alice" }, { "input": "3\n6 14 21", "output": "Bob" }, { "input": "3\n4 12 18", "output": "Bob" }, { "input": "4\n2 3 15 30", "output": "Bob" }, { "input": "2\n10 4", "output": "Alice" } ]
1,547,541,324
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
5
186
0
n = int(input()) a = [int(x) for x in input().split()] tr = False Al_Bo = 0 # 0 - Alice, 1- Bob a.sort() while True: for i in range(n): for ii in range(i+1, n): if a[ii]-a[i] not in a: a.append(a[ii]-a[i]) if Al_Bo == 0: Al_Bo = 1 else: Al_Bo = 0 tr = True if tr == False: if Al_Bo == 0: print("Bob") else: print("Alice") break tr = False #print(*a)
Title: Alice and Bob Time Limit: None seconds Memory Limit: None megabytes Problem Description: It is so boring in the summer holiday, isn't it? So Alice and Bob have invented a new game to play. The rules are as follows. First, they get a set of *n* distinct integers. And then they take turns to make the following moves. During each move, either Alice or Bob (the player whose turn is the current) can choose two distinct integers *x* and *y* from the set, such that the set doesn't contain their absolute difference |*x*<=-<=*y*|. Then this player adds integer |*x*<=-<=*y*| to the set (so, the size of the set increases by one). If the current player has no valid move, he (or she) loses the game. The question is who will finally win the game if both players play optimally. Remember that Alice always moves first. Input Specification: The first line contains an integer *n* (2<=≤<=*n*<=≤<=100) — the initial number of elements in the set. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the set. Output Specification: Print a single line with the winner's name. If Alice wins print "Alice", otherwise print "Bob" (without quotes). Demo Input: ['2\n2 3\n', '2\n5 3\n', '3\n5 6 7\n'] Demo Output: ['Alice\n', 'Alice\n', 'Bob\n'] Note: Consider the first test sample. Alice moves first, and the only move she can do is to choose 2 and 3, then to add 1 to the set. Next Bob moves, there is no valid move anymore, so the winner is Alice.
```python n = int(input()) a = [int(x) for x in input().split()] tr = False Al_Bo = 0 # 0 - Alice, 1- Bob a.sort() while True: for i in range(n): for ii in range(i+1, n): if a[ii]-a[i] not in a: a.append(a[ii]-a[i]) if Al_Bo == 0: Al_Bo = 1 else: Al_Bo = 0 tr = True if tr == False: if Al_Bo == 0: print("Bob") else: print("Alice") break tr = False #print(*a) ```
0
69
A
Young Physicist
PROGRAMMING
1,000
[ "implementation", "math" ]
A. Young Physicist
2
256
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
[ "3\n4 1 7\n-2 4 -1\n1 -5 -3\n", "3\n3 -1 7\n-5 2 -4\n2 -1 -3\n" ]
[ "NO", "YES" ]
none
500
[ { "input": "3\n4 1 7\n-2 4 -1\n1 -5 -3", "output": "NO" }, { "input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3", "output": "YES" }, { "input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41", "output": "NO" }, { "input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33", "output": "NO" }, { "input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7", "output": "NO" }, { "input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38", "output": "NO" }, { "input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6", "output": "YES" }, { "input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0", "output": "YES" }, { "input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0", "output": "YES" }, { "input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0", "output": "YES" }, { "input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0", "output": "YES" }, { "input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0", "output": "YES" }, { "input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87", "output": "YES" }, { "input": "3\n1 2 3\n3 2 1\n0 0 0", "output": "NO" }, { "input": "2\n5 -23 12\n0 0 0", "output": "NO" }, { "input": "1\n0 0 0", "output": "YES" }, { "input": "1\n1 -2 0", "output": "NO" }, { "input": "2\n-23 77 -86\n23 -77 86", "output": "YES" }, { "input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82", "output": "YES" }, { "input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0", "output": "YES" }, { "input": "3\n96 49 -12\n2 -66 28\n-98 17 -16", "output": "YES" }, { "input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0", "output": "YES" }, { "input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53", "output": "YES" }, { "input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1", "output": "YES" }, { "input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0", "output": "YES" }, { "input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0", "output": "YES" }, { "input": "3\n0 2 -2\n1 -1 3\n-3 0 0", "output": "NO" } ]
1,624,810,108
2,147,483,647
Python 3
OK
TESTS
81
154
0
import math n=int(input()) sum1=sum2=sum3=0 for item in range(n): m = input() x = m.split(" ") sum1+=int(x[0]) sum2+=int(x[1]) sum3+=int(x[2]) if sum1==0 and sum2==0 and sum3 ==0: print("YES") else: print("NO")
Title: Young Physicist Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. Input Specification: The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). Output Specification: Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. Demo Input: ['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n'] Demo Output: ['NO', 'YES'] Note: none
```python import math n=int(input()) sum1=sum2=sum3=0 for item in range(n): m = input() x = m.split(" ") sum1+=int(x[0]) sum2+=int(x[1]) sum3+=int(x[2]) if sum1==0 and sum2==0 and sum3 ==0: print("YES") else: print("NO") ```
3.9615
732
A
Buy a Shovel
PROGRAMMING
800
[ "brute force", "constructive algorithms", "implementation", "math" ]
null
null
Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop. In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9). What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel.
The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins". Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels.
Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change.
[ "117 3\n", "237 7\n", "15 2\n" ]
[ "9\n", "1\n", "2\n" ]
In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change. In the second example it is enough for Polycarp to buy one shovel. In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
500
[ { "input": "117 3", "output": "9" }, { "input": "237 7", "output": "1" }, { "input": "15 2", "output": "2" }, { "input": "1 1", "output": "1" }, { "input": "1 9", "output": "9" }, { "input": "1000 3", "output": "1" }, { "input": "1000 1", "output": "1" }, { "input": "1000 9", "output": "1" }, { "input": "1 2", "output": "2" }, { "input": "999 9", "output": "1" }, { "input": "999 8", "output": "2" }, { "input": "105 6", "output": "2" }, { "input": "403 9", "output": "3" }, { "input": "546 4", "output": "4" }, { "input": "228 9", "output": "5" }, { "input": "57 2", "output": "6" }, { "input": "437 9", "output": "7" }, { "input": "997 6", "output": "8" }, { "input": "109 1", "output": "9" }, { "input": "998 9", "output": "5" }, { "input": "4 2", "output": "3" }, { "input": "9 3", "output": "7" }, { "input": "8 2", "output": "4" }, { "input": "1 3", "output": "3" }, { "input": "1 4", "output": "4" }, { "input": "1 5", "output": "5" }, { "input": "1 6", "output": "6" }, { "input": "1 7", "output": "7" }, { "input": "1 8", "output": "8" }, { "input": "100 3", "output": "1" }, { "input": "1000 2", "output": "1" }, { "input": "1000 4", "output": "1" }, { "input": "1000 5", "output": "1" }, { "input": "1000 6", "output": "1" }, { "input": "1000 7", "output": "1" }, { "input": "1000 8", "output": "1" }, { "input": "23 4", "output": "8" }, { "input": "33 1", "output": "7" }, { "input": "33 2", "output": "4" }, { "input": "666 5", "output": "5" }, { "input": "2 3", "output": "5" }, { "input": "5 5", "output": "1" }, { "input": "3 6", "output": "2" }, { "input": "12 4", "output": "2" }, { "input": "15 5", "output": "1" }, { "input": "2 5", "output": "5" }, { "input": "25 5", "output": "1" }, { "input": "2 9", "output": "5" }, { "input": "6 7", "output": "5" }, { "input": "8 9", "output": "5" }, { "input": "2 7", "output": "5" }, { "input": "4 7", "output": "5" }, { "input": "2 1", "output": "5" }, { "input": "261 1", "output": "1" } ]
1,681,256,632
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
46
0
a,b = input().split() x = a[-1] i = 0 s = a while a[-1] != b and i < 11: i = i+1 n = int(s) * i a = str(n) print(i)
Title: Buy a Shovel Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop. In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9). What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel. Input Specification: The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins". Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels. Output Specification: Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change. Demo Input: ['117 3\n', '237 7\n', '15 2\n'] Demo Output: ['9\n', '1\n', '2\n'] Note: In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change. In the second example it is enough for Polycarp to buy one shovel. In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
```python a,b = input().split() x = a[-1] i = 0 s = a while a[-1] != b and i < 11: i = i+1 n = int(s) * i a = str(n) print(i) ```
0
4
A
Watermelon
PROGRAMMING
800
[ "brute force", "math" ]
A. Watermelon
1
64
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem. Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
[ "8\n" ]
[ "YES\n" ]
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
0
[ { "input": "8", "output": "YES" }, { "input": "5", "output": "NO" }, { "input": "4", "output": "YES" }, { "input": "3", "output": "NO" }, { "input": "2", "output": "NO" }, { "input": "1", "output": "NO" }, { "input": "7", "output": "NO" }, { "input": "6", "output": "YES" }, { "input": "10", "output": "YES" }, { "input": "9", "output": "NO" }, { "input": "53", "output": "NO" }, { "input": "77", "output": "NO" }, { "input": "32", "output": "YES" }, { "input": "44", "output": "YES" }, { "input": "98", "output": "YES" }, { "input": "99", "output": "NO" }, { "input": "90", "output": "YES" }, { "input": "67", "output": "NO" }, { "input": "100", "output": "YES" }, { "input": "88", "output": "YES" } ]
1,690,122,292
2,147,483,647
Python 3
OK
TESTS
20
92
0
def can_divide_watermelon(w): # Check if the weight of the watermelon is even and greater than 2 if w >= 4 and w % 2 == 0: return True else: return False # Test cases weight_of_watermelon = int(input()) if can_divide_watermelon(weight_of_watermelon): print("Yes") else: print("No")
Title: Watermelon Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem. Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight. Input Specification: The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys. Output Specification: Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case. Demo Input: ['8\n'] Demo Output: ['YES\n'] Note: For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
```python def can_divide_watermelon(w): # Check if the weight of the watermelon is even and greater than 2 if w >= 4 and w % 2 == 0: return True else: return False # Test cases weight_of_watermelon = int(input()) if can_divide_watermelon(weight_of_watermelon): print("Yes") else: print("No") ```
3.954
372
A
Counting Kangaroos is Fun
PROGRAMMING
1,600
[ "binary search", "greedy", "sortings", "two pointers" ]
null
null
There are *n* kangaroos with pockets. Each kangaroo has a size (integer number). A kangaroo can go into another kangaroo's pocket if and only if the size of kangaroo who hold the kangaroo is at least twice as large as the size of kangaroo who is held. Each kangaroo can hold at most one kangaroo, and the kangaroo who is held by another kangaroo cannot hold any kangaroos. The kangaroo who is held by another kangaroo cannot be visible from outside. Please, find a plan of holding kangaroos with the minimal number of kangaroos who is visible.
The first line contains a single integer — *n* (1<=≤<=*n*<=≤<=5·105). Each of the next *n* lines contains an integer *s**i* — the size of the *i*-th kangaroo (1<=≤<=*s**i*<=≤<=105).
Output a single integer — the optimal number of visible kangaroos.
[ "8\n2\n5\n7\n6\n9\n8\n4\n2\n", "8\n9\n1\n6\n2\n6\n5\n8\n3\n" ]
[ "5\n", "5\n" ]
none
500
[ { "input": "8\n2\n5\n7\n6\n9\n8\n4\n2", "output": "5" }, { "input": "8\n9\n1\n6\n2\n6\n5\n8\n3", "output": "5" }, { "input": "12\n3\n99\n24\n46\n75\n63\n57\n55\n10\n62\n34\n52", "output": "7" }, { "input": "12\n55\n75\n1\n98\n63\n64\n9\n39\n82\n18\n47\n9", "output": "6" }, { "input": "100\n678\n771\n96\n282\n135\n749\n168\n668\n17\n658\n979\n446\n998\n331\n606\n756\n37\n515\n538\n205\n647\n547\n904\n842\n647\n286\n774\n414\n267\n791\n595\n465\n8\n327\n855\n174\n339\n946\n184\n250\n807\n422\n679\n980\n64\n530\n312\n351\n676\n911\n803\n991\n669\n50\n293\n841\n545\n598\n737\n894\n231\n754\n588\n83\n873\n767\n833\n482\n905\n903\n970\n571\n715\n59\n777\n697\n537\n861\n339\n212\n149\n889\n905\n70\n970\n307\n830\n465\n968\n291\n430\n317\n942\n944\n330\n235\n814\n880\n415\n76", "output": "58" }, { "input": "100\n154\n60\n97\n638\n139\n150\n570\n579\n601\n647\n804\n237\n245\n549\n288\n347\n778\n282\n916\n441\n974\n145\n957\n886\n655\n702\n930\n618\n132\n520\n972\n48\n94\n54\n682\n433\n896\n134\n845\n636\n242\n842\n125\n141\n240\n130\n409\n666\n948\n938\n604\n110\n474\n484\n364\n40\n807\n271\n438\n288\n201\n814\n754\n589\n341\n576\n146\n952\n819\n923\n222\n535\n336\n83\n314\n911\n303\n911\n384\n601\n249\n330\n735\n271\n142\n204\n405\n783\n775\n449\n590\n139\n109\n276\n45\n205\n454\n836\n82\n841", "output": "50" }, { "input": "1\n1", "output": "1" }, { "input": "4\n1\n1\n1\n2", "output": "3" }, { "input": "5\n1\n2\n4\n8\n16", "output": "3" }, { "input": "7\n1\n2\n4\n8\n16\n32\n64", "output": "4" }, { "input": "3\n1\n2\n4", "output": "2" } ]
1,659,969,914
2,147,483,647
PyPy 3
TIME_LIMIT_EXCEEDED
TESTS
8
1,000
10,035,200
l=[] n=int(input()) for _ in range(n): l.append(int(input())) l.sort() e=n-n//2 a=l[:e] b=l[e:][::-1] e-=1 ans=0 for x in b: while True: if e<=-1: break if a[e]*2<=x: ans+=1 e-=1 break e-=1 print(n-ans)
Title: Counting Kangaroos is Fun Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* kangaroos with pockets. Each kangaroo has a size (integer number). A kangaroo can go into another kangaroo's pocket if and only if the size of kangaroo who hold the kangaroo is at least twice as large as the size of kangaroo who is held. Each kangaroo can hold at most one kangaroo, and the kangaroo who is held by another kangaroo cannot hold any kangaroos. The kangaroo who is held by another kangaroo cannot be visible from outside. Please, find a plan of holding kangaroos with the minimal number of kangaroos who is visible. Input Specification: The first line contains a single integer — *n* (1<=≤<=*n*<=≤<=5·105). Each of the next *n* lines contains an integer *s**i* — the size of the *i*-th kangaroo (1<=≤<=*s**i*<=≤<=105). Output Specification: Output a single integer — the optimal number of visible kangaroos. Demo Input: ['8\n2\n5\n7\n6\n9\n8\n4\n2\n', '8\n9\n1\n6\n2\n6\n5\n8\n3\n'] Demo Output: ['5\n', '5\n'] Note: none
```python l=[] n=int(input()) for _ in range(n): l.append(int(input())) l.sort() e=n-n//2 a=l[:e] b=l[e:][::-1] e-=1 ans=0 for x in b: while True: if e<=-1: break if a[e]*2<=x: ans+=1 e-=1 break e-=1 print(n-ans) ```
0
608
B
Hamming Distance Sum
PROGRAMMING
1,500
[ "combinatorics", "strings" ]
null
null
Genos needs your help. He was asked to solve the following programming problem by Saitama: The length of some string *s* is denoted |*s*|. The Hamming distance between two strings *s* and *t* of equal length is defined as , where *s**i* is the *i*-th character of *s* and *t**i* is the *i*-th character of *t*. For example, the Hamming distance between string "0011" and string "0110" is |0<=-<=0|<=+<=|0<=-<=1|<=+<=|1<=-<=1|<=+<=|1<=-<=0|<==<=0<=+<=1<=+<=0<=+<=1<==<=2. Given two binary strings *a* and *b*, find the sum of the Hamming distances between *a* and all contiguous substrings of *b* of length |*a*|.
The first line of the input contains binary string *a* (1<=≤<=|*a*|<=≤<=200<=000). The second line of the input contains binary string *b* (|*a*|<=≤<=|*b*|<=≤<=200<=000). Both strings are guaranteed to consist of characters '0' and '1' only.
Print a single integer — the sum of Hamming distances between *a* and all contiguous substrings of *b* of length |*a*|.
[ "01\n00111\n", "0011\n0110\n" ]
[ "3\n", "2\n" ]
For the first sample case, there are four contiguous substrings of *b* of length |*a*|: "00", "01", "11", and "11". The distance between "01" and "00" is |0 - 0| + |1 - 0| = 1. The distance between "01" and "01" is |0 - 0| + |1 - 1| = 0. The distance between "01" and "11" is |0 - 1| + |1 - 1| = 1. Last distance counts twice, as there are two occurrences of string "11". The sum of these edit distances is 1 + 0 + 1 + 1 = 3. The second sample case is described in the statement.
1,000
[ { "input": "01\n00111", "output": "3" }, { "input": "0011\n0110", "output": "2" }, { "input": "0\n0", "output": "0" }, { "input": "1\n0", "output": "1" }, { "input": "0\n1", "output": "1" }, { "input": "1\n1", "output": "0" }, { "input": "1001101001101110101101000\n01111000010011111111110010001101000100011110101111", "output": "321" }, { "input": "1110010001000101001011111\n00011011000000100001010000010100110011010001111010", "output": "316" } ]
1,450,890,438
1,938
Python 3
OK
TESTS
30
264
6,451,200
a, b = '0'+input(),'0'+input() m, n = len(a), len(b) c, s = [0]*(n+1), 0 if m <= n: for i in range(1,n): c[i] = int(b[i]) + c[i-1] for i in range(1,m): if a[i] == '0': s += c[i+n-m]-c[i-1] else: s += n-m+1 - (c[i+n-m]-c[i-1]) print(s)
Title: Hamming Distance Sum Time Limit: None seconds Memory Limit: None megabytes Problem Description: Genos needs your help. He was asked to solve the following programming problem by Saitama: The length of some string *s* is denoted |*s*|. The Hamming distance between two strings *s* and *t* of equal length is defined as , where *s**i* is the *i*-th character of *s* and *t**i* is the *i*-th character of *t*. For example, the Hamming distance between string "0011" and string "0110" is |0<=-<=0|<=+<=|0<=-<=1|<=+<=|1<=-<=1|<=+<=|1<=-<=0|<==<=0<=+<=1<=+<=0<=+<=1<==<=2. Given two binary strings *a* and *b*, find the sum of the Hamming distances between *a* and all contiguous substrings of *b* of length |*a*|. Input Specification: The first line of the input contains binary string *a* (1<=≤<=|*a*|<=≤<=200<=000). The second line of the input contains binary string *b* (|*a*|<=≤<=|*b*|<=≤<=200<=000). Both strings are guaranteed to consist of characters '0' and '1' only. Output Specification: Print a single integer — the sum of Hamming distances between *a* and all contiguous substrings of *b* of length |*a*|. Demo Input: ['01\n00111\n', '0011\n0110\n'] Demo Output: ['3\n', '2\n'] Note: For the first sample case, there are four contiguous substrings of *b* of length |*a*|: "00", "01", "11", and "11". The distance between "01" and "00" is |0 - 0| + |1 - 0| = 1. The distance between "01" and "01" is |0 - 0| + |1 - 1| = 0. The distance between "01" and "11" is |0 - 1| + |1 - 1| = 1. Last distance counts twice, as there are two occurrences of string "11". The sum of these edit distances is 1 + 0 + 1 + 1 = 3. The second sample case is described in the statement.
```python a, b = '0'+input(),'0'+input() m, n = len(a), len(b) c, s = [0]*(n+1), 0 if m <= n: for i in range(1,n): c[i] = int(b[i]) + c[i-1] for i in range(1,m): if a[i] == '0': s += c[i+n-m]-c[i-1] else: s += n-m+1 - (c[i+n-m]-c[i-1]) print(s) ```
3
290
A
Mysterious strings
PROGRAMMING
1,400
[ "*special", "implementation" ]
null
null
The input contains a single integer *a* (1<=≤<=*a*<=≤<=40). Output a single string.
The input contains a single integer *a* (1<=≤<=*a*<=≤<=40).
Output a single string.
[ "2\n", "8\n", "29\n" ]
[ "Adams\n", "Van Buren\n", "Harding\n" ]
none
0
[ { "input": "2", "output": "Adams" }, { "input": "8", "output": "Van Buren" }, { "input": "29", "output": "Harding" }, { "input": "1", "output": "Washington" }, { "input": "3", "output": "Jefferson" }, { "input": "4", "output": "Madison" }, { "input": "5", "output": "Monroe" }, { "input": "6", "output": "Adams" }, { "input": "7", "output": "Jackson" }, { "input": "9", "output": "Harrison" }, { "input": "10", "output": "Tyler" }, { "input": "11", "output": "Polk" }, { "input": "12", "output": "Taylor" }, { "input": "13", "output": "Fillmore" }, { "input": "14", "output": "Pierce" }, { "input": "15", "output": "Buchanan" }, { "input": "16", "output": "Lincoln" }, { "input": "17", "output": "Johnson" }, { "input": "18", "output": "Grant" }, { "input": "19", "output": "Hayes" }, { "input": "20", "output": "Garfield" }, { "input": "21", "output": "Arthur" }, { "input": "22", "output": "Cleveland" }, { "input": "23", "output": "Harrison" }, { "input": "24", "output": "Cleveland" }, { "input": "25", "output": "McKinley" }, { "input": "26", "output": "Roosevelt" }, { "input": "27", "output": "Taft" }, { "input": "28", "output": "Wilson" }, { "input": "30", "output": "Coolidge" }, { "input": "31", "output": "Hoover" }, { "input": "32", "output": "Roosevelt" }, { "input": "33", "output": "Truman" }, { "input": "34", "output": "Eisenhower" }, { "input": "35", "output": "Kennedy" }, { "input": "36", "output": "Johnson" }, { "input": "37", "output": "Nixon" }, { "input": "38", "output": "Ford" }, { "input": "39", "output": "Carter" }, { "input": "40", "output": "Reagan" } ]
1,584,735,638
2,147,483,647
Python 3
OK
TESTS
40
248
0
#author: riyan names = [ 'Washington','Adams','Jefferson','Madison','Monroe', 'Adams','Jackson','Van Buren','Harrison','Tyler', 'Polk','Taylor','Fillmore','Pierce','Buchanan', 'Lincoln','Johnson','Grant','Hayes','Garfield', 'Arthur','Cleveland','Harrison','Cleveland','McKinley', 'Roosevelt','Taft','Wilson','Harding','Coolidge', 'Hoover','Roosevelt','Truman','Eisenhower','Kennedy', 'Johnson','Nixon','Ford','Carter','Reagan' ] if __name__ == '__main__': n = int(input().strip()) print(names[n - 1])
Title: Mysterious strings Time Limit: None seconds Memory Limit: None megabytes Problem Description: The input contains a single integer *a* (1<=≤<=*a*<=≤<=40). Output a single string. Input Specification: The input contains a single integer *a* (1<=≤<=*a*<=≤<=40). Output Specification: Output a single string. Demo Input: ['2\n', '8\n', '29\n'] Demo Output: ['Adams\n', 'Van Buren\n', 'Harding\n'] Note: none
```python #author: riyan names = [ 'Washington','Adams','Jefferson','Madison','Monroe', 'Adams','Jackson','Van Buren','Harrison','Tyler', 'Polk','Taylor','Fillmore','Pierce','Buchanan', 'Lincoln','Johnson','Grant','Hayes','Garfield', 'Arthur','Cleveland','Harrison','Cleveland','McKinley', 'Roosevelt','Taft','Wilson','Harding','Coolidge', 'Hoover','Roosevelt','Truman','Eisenhower','Kennedy', 'Johnson','Nixon','Ford','Carter','Reagan' ] if __name__ == '__main__': n = int(input().strip()) print(names[n - 1]) ```
3
259
A
Little Elephant and Chess
PROGRAMMING
1,000
[ "brute force", "strings" ]
null
null
The Little Elephant loves chess very much. One day the Little Elephant and his friend decided to play chess. They've got the chess pieces but the board is a problem. They've got an 8<=×<=8 checkered board, each square is painted either black or white. The Little Elephant and his friend know that a proper chessboard doesn't have any side-adjacent cells with the same color and the upper left cell is white. To play chess, they want to make the board they have a proper chessboard. For that the friends can choose any row of the board and cyclically shift the cells of the chosen row, that is, put the last (rightmost) square on the first place in the row and shift the others one position to the right. You can run the described operation multiple times (or not run it at all). For example, if the first line of the board looks like that "BBBBBBWW" (the white cells of the line are marked with character "W", the black cells are marked with character "B"), then after one cyclic shift it will look like that "WBBBBBBW". Help the Little Elephant and his friend to find out whether they can use any number of the described operations to turn the board they have into a proper chessboard.
The input consists of exactly eight lines. Each line contains exactly eight characters "W" or "B" without any spaces: the *j*-th character in the *i*-th line stands for the color of the *j*-th cell of the *i*-th row of the elephants' board. Character "W" stands for the white color, character "B" stands for the black color. Consider the rows of the board numbered from 1 to 8 from top to bottom, and the columns — from 1 to 8 from left to right. The given board can initially be a proper chessboard.
In a single line print "YES" (without the quotes), if we can make the board a proper chessboard and "NO" (without the quotes) otherwise.
[ "WBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\n", "WBWBWBWB\nWBWBWBWB\nBBWBWWWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWWW\nBWBWBWBW\nBWBWBWBW\n" ]
[ "YES\n", "NO\n" ]
In the first sample you should shift the following lines one position to the right: the 3-rd, the 6-th, the 7-th and the 8-th. In the second sample there is no way you can achieve the goal.
500
[ { "input": "WBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB", "output": "YES" }, { "input": "WBWBWBWB\nWBWBWBWB\nBBWBWWWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWWW\nBWBWBWBW\nBWBWBWBW", "output": "NO" }, { "input": "BWBWBWBW\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB", "output": "YES" }, { "input": "BWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB", "output": "YES" }, { "input": "WBWBWBWB\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW", "output": "YES" }, { "input": "WBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB\nBWWWBWBW", "output": "NO" }, { "input": "BBBBBWWW\nWBBWBWWB\nWWWWWBWW\nBWBWWBWW\nBBBWWBWW\nBBBBBWBW\nWBBBWBWB\nWBWBWWWB", "output": "NO" }, { "input": "BWBWBWBW\nBWBWBWBW\nBWWWWWBB\nBBWBWBWB\nWBWBWBWB\nWWBWWBWW\nBWBWBWBW\nWBWWBBBB", "output": "NO" }, { "input": "WBWBWBWB\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nWBWWBWBB", "output": "NO" }, { "input": "WBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW", "output": "YES" }, { "input": "WBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW", "output": "YES" }, { "input": "WWWWBWWB\nBWBWBWBW\nBWBWBWBW\nWWBWBBBB\nBBWWBBBB\nBBBWWBBW\nBWWWWWWB\nBWWBBBWW", "output": "NO" }, { "input": "WBBWWBWB\nBBWBWBWB\nBWBWBWBW\nBWBWBWBW\nWBWBWBBW\nWBWBBBBW\nBWWWWBWB\nBBBBBBBW", "output": "NO" }, { "input": "BWBWBWBW\nBWBWBWBW\nBBWWWBBB\nWBBBBBWW\nWBBBBWBB\nWBWBWBWB\nWBWWBWWB\nWBBWBBWW", "output": "NO" }, { "input": "WBBBBBWB\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBBBBBWBB\nWBBWWBWB\nBWBWBWBW", "output": "NO" }, { "input": "BWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nWBBWWBWB", "output": "NO" }, { "input": "BWBWBWBW\nWBWBWBWB\nBWBWBWBW\nBWWWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBBW", "output": "NO" }, { "input": "WBWBWBWB\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW", "output": "YES" }, { "input": "BWBWBWBW\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW", "output": "YES" }, { "input": "BWBWBWBW\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW", "output": "YES" }, { "input": "WWBBWWBB\nBWWBBWWB\nBWBWBWBW\nWWBBWWWB\nWBWWWWBB\nWBWWBBWB\nBWBBWBWW\nBWBWWWWW", "output": "NO" }, { "input": "WBWBWBWB\nWBWBWBWB\nWWBBWBBB\nWBWBWBWB\nWWWWBWWB\nWBBBBWWW\nBWBWWWBW\nWWWBWBBB", "output": "NO" }, { "input": "WBWBWBWB\nBWWBWWWW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nWWBBBBBW\nWWWBWWBW\nWWBBBBWW", "output": "NO" }, { "input": "BWBWBWBW\nBWBBBWWB\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW", "output": "NO" }, { "input": "BWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW", "output": "YES" }, { "input": "BBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB\nWWWWWWWW\nWWWWWWWW\nWWWWWWWW\nWWWWWWWW", "output": "NO" }, { "input": "BBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB", "output": "NO" }, { "input": "BWBWBWBB\nBWBWBWBB\nBWBWBWBB\nBWBWBWBB\nBWBWBWBB\nBWBWBWBB\nBWBWBWBB\nBWBWBWBB", "output": "NO" }, { "input": "WWBWWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW", "output": "NO" }, { "input": "WWWWWWWW\nBBBBBBBB\nWWWWWWWW\nBBBBBBBB\nWWWWWWWW\nBBBBBBBB\nWWWWWWWW\nBBBBBBBB", "output": "NO" }, { "input": "BBBBBBBB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB", "output": "NO" }, { "input": "BBBBBBBW\nBBBBBBBW\nBBBBBBBW\nBBBBBBBW\nBBBBBBBW\nBBBBBBBW\nBBBBBBBW\nBBBBBBBW", "output": "NO" }, { "input": "BBBWWWWW\nWWWBBBBB\nBBBWWWWW\nWWWBBBBB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB", "output": "NO" } ]
1,586,778,686
2,147,483,647
Python 3
OK
TESTS
33
218
0
def chess(li): for i in range(8): for j in range(8): if li[i][0] == li[i][7]: return False if j+1<len(li) and li[i][j] == li[i][j+1] : return False return True li =[] for i in range(8): a=input() li.append(list(a)) if chess(li): print("YES") else: print("NO")
Title: Little Elephant and Chess Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Little Elephant loves chess very much. One day the Little Elephant and his friend decided to play chess. They've got the chess pieces but the board is a problem. They've got an 8<=×<=8 checkered board, each square is painted either black or white. The Little Elephant and his friend know that a proper chessboard doesn't have any side-adjacent cells with the same color and the upper left cell is white. To play chess, they want to make the board they have a proper chessboard. For that the friends can choose any row of the board and cyclically shift the cells of the chosen row, that is, put the last (rightmost) square on the first place in the row and shift the others one position to the right. You can run the described operation multiple times (or not run it at all). For example, if the first line of the board looks like that "BBBBBBWW" (the white cells of the line are marked with character "W", the black cells are marked with character "B"), then after one cyclic shift it will look like that "WBBBBBBW". Help the Little Elephant and his friend to find out whether they can use any number of the described operations to turn the board they have into a proper chessboard. Input Specification: The input consists of exactly eight lines. Each line contains exactly eight characters "W" or "B" without any spaces: the *j*-th character in the *i*-th line stands for the color of the *j*-th cell of the *i*-th row of the elephants' board. Character "W" stands for the white color, character "B" stands for the black color. Consider the rows of the board numbered from 1 to 8 from top to bottom, and the columns — from 1 to 8 from left to right. The given board can initially be a proper chessboard. Output Specification: In a single line print "YES" (without the quotes), if we can make the board a proper chessboard and "NO" (without the quotes) otherwise. Demo Input: ['WBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\n', 'WBWBWBWB\nWBWBWBWB\nBBWBWWWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWWW\nBWBWBWBW\nBWBWBWBW\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample you should shift the following lines one position to the right: the 3-rd, the 6-th, the 7-th and the 8-th. In the second sample there is no way you can achieve the goal.
```python def chess(li): for i in range(8): for j in range(8): if li[i][0] == li[i][7]: return False if j+1<len(li) and li[i][j] == li[i][j+1] : return False return True li =[] for i in range(8): a=input() li.append(list(a)) if chess(li): print("YES") else: print("NO") ```
3
352
A
Jeff and Digits
PROGRAMMING
1,000
[ "brute force", "implementation", "math" ]
null
null
Jeff's got *n* cards, each card contains either digit 0, or digit 5. Jeff can choose several cards and put them in a line so that he gets some number. What is the largest possible number divisible by 90 Jeff can make from the cards he's got? Jeff must make the number without leading zero. At that, we assume that number 0 doesn't contain any leading zeroes. Jeff doesn't have to use all the cards.
The first line contains integer *n* (1<=≤<=*n*<=≤<=103). The next line contains *n* integers *a*1, *a*2, ..., *a**n* (*a**i*<==<=0 or *a**i*<==<=5). Number *a**i* represents the digit that is written on the *i*-th card.
In a single line print the answer to the problem — the maximum number, divisible by 90. If you can't make any divisible by 90 number from the cards, print -1.
[ "4\n5 0 5 0\n", "11\n5 5 5 5 5 5 5 5 0 5 5\n" ]
[ "0\n", "5555555550\n" ]
In the first test you can make only one number that is a multiple of 90 — 0. In the second test you can make number 5555555550, it is a multiple of 90.
500
[ { "input": "4\n5 0 5 0", "output": "0" }, { "input": "11\n5 5 5 5 5 5 5 5 0 5 5", "output": "5555555550" }, { "input": "7\n5 5 5 5 5 5 5", "output": "-1" }, { "input": "1\n5", "output": "-1" }, { "input": "1\n0", "output": "0" }, { "input": "11\n5 0 5 5 5 0 0 5 5 5 5", "output": "0" }, { "input": "23\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 0 0 0 0 0", "output": "55555555555555555500000" }, { "input": "9\n5 5 5 5 5 5 5 5 5", "output": "-1" }, { "input": "24\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 0 0 0 0 0", "output": "55555555555555555500000" }, { "input": "10\n0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "10\n5 5 5 5 5 0 0 5 0 5", "output": "0" }, { "input": "3\n5 5 0", "output": "0" }, { "input": "5\n5 5 0 5 5", "output": "0" }, { "input": "14\n0 5 5 0 0 0 0 0 0 5 5 5 5 5", "output": "0" }, { "input": "3\n5 5 5", "output": "-1" }, { "input": "3\n0 5 5", "output": "0" }, { "input": "13\n0 0 5 0 5 0 5 5 0 0 0 0 0", "output": "0" }, { "input": "9\n5 5 0 5 5 5 5 5 5", "output": "0" }, { "input": "8\n0 0 0 0 0 0 0 0", "output": "0" }, { "input": "101\n5 0 0 0 0 0 0 0 5 0 0 0 0 5 0 0 5 0 0 0 0 0 5 0 0 0 0 0 0 0 0 5 0 0 5 0 0 0 0 0 0 0 5 0 0 5 0 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 5 0 0 0 0 0 0 0 0 0 5 0 0 5 0 0 0 0 5 0 0", "output": "5555555550000000000000000000000000000000000000000000000000000000000000000000000000000000000000" }, { "input": "214\n5 0 5 0 5 0 0 0 5 5 0 5 0 5 5 0 5 0 0 0 0 5 5 0 0 5 5 0 0 0 0 5 5 5 5 0 5 0 0 0 0 0 0 5 0 0 0 5 0 0 5 0 0 5 5 0 0 5 5 0 0 0 0 0 5 0 5 0 5 5 0 5 0 0 5 5 5 0 5 0 5 0 5 5 0 5 0 0 0 5 5 0 5 0 5 5 5 5 5 0 0 0 0 0 0 5 0 5 5 0 5 0 5 0 5 5 0 0 0 0 5 0 5 0 5 0 0 5 0 0 5 5 5 5 5 0 0 5 0 0 5 0 0 5 0 0 5 0 0 5 0 5 0 0 0 5 0 0 5 5 5 0 0 5 5 5 0 0 5 5 0 0 0 5 0 0 5 5 5 5 5 5 0 5 0 0 5 5 5 5 0 5 5 0 0 0 5 5 5 5 0 0 0 0 5 0 0 5 0 0 5 5 0 0", "output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555550000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000" }, { "input": "80\n0 0 0 0 5 0 5 5 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 5 0 0 0 0 0 0 0 0 0 5 5 0 5 0 0 0 0 0 0 5 0 0 0 0 0 0 0 5 0 0 0 0 5 0 5 5 0 0 0", "output": "555555555000000000000000000000000000000000000000000000000000000000000000000" }, { "input": "2\n0 0", "output": "0" }, { "input": "3\n5 0 0", "output": "0" }, { "input": "4\n5 5 5 5", "output": "-1" }, { "input": "2\n0 5", "output": "0" }, { "input": "14\n5 5 5 5 5 5 5 5 5 5 5 5 5 0", "output": "5555555550" }, { "input": "18\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5", "output": "-1" }, { "input": "10\n5 5 5 5 5 5 5 5 5 0", "output": "5555555550" }, { "input": "10\n5 5 5 5 5 5 5 5 5 5", "output": "-1" }, { "input": "20\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5", "output": "-1" } ]
1,663,491,195
2,147,483,647
Python 3
OK
TESTS
42
92
102,400
from collections import Counter input() d = Counter(map(int, input().split())) if d[0] < 1: print(-1) else: f = "5" * (9 * (d[5] // 9)) print(int(f + "0" * d[0]))
Title: Jeff and Digits Time Limit: None seconds Memory Limit: None megabytes Problem Description: Jeff's got *n* cards, each card contains either digit 0, or digit 5. Jeff can choose several cards and put them in a line so that he gets some number. What is the largest possible number divisible by 90 Jeff can make from the cards he's got? Jeff must make the number without leading zero. At that, we assume that number 0 doesn't contain any leading zeroes. Jeff doesn't have to use all the cards. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=103). The next line contains *n* integers *a*1, *a*2, ..., *a**n* (*a**i*<==<=0 or *a**i*<==<=5). Number *a**i* represents the digit that is written on the *i*-th card. Output Specification: In a single line print the answer to the problem — the maximum number, divisible by 90. If you can't make any divisible by 90 number from the cards, print -1. Demo Input: ['4\n5 0 5 0\n', '11\n5 5 5 5 5 5 5 5 0 5 5\n'] Demo Output: ['0\n', '5555555550\n'] Note: In the first test you can make only one number that is a multiple of 90 — 0. In the second test you can make number 5555555550, it is a multiple of 90.
```python from collections import Counter input() d = Counter(map(int, input().split())) if d[0] < 1: print(-1) else: f = "5" * (9 * (d[5] // 9)) print(int(f + "0" * d[0])) ```
3
855
B
Marvolo Gaunt's Ring
PROGRAMMING
1,500
[ "brute force", "data structures", "dp" ]
null
null
Professor Dumbledore is helping Harry destroy the Horcruxes. He went to Gaunt Shack as he suspected a Horcrux to be present there. He saw Marvolo Gaunt's Ring and identified it as a Horcrux. Although he destroyed it, he is still affected by its curse. Professor Snape is helping Dumbledore remove the curse. For this, he wants to give Dumbledore exactly *x* drops of the potion he made. Value of *x* is calculated as maximum of *p*·*a**i*<=+<=*q*·*a**j*<=+<=*r*·*a**k* for given *p*,<=*q*,<=*r* and array *a*1,<=*a*2,<=... *a**n* such that 1<=≤<=*i*<=≤<=*j*<=≤<=*k*<=≤<=*n*. Help Snape find the value of *x*. Do note that the value of *x* may be negative.
First line of input contains 4 integers *n*,<=*p*,<=*q*,<=*r* (<=-<=109<=≤<=*p*,<=*q*,<=*r*<=≤<=109,<=1<=≤<=*n*<=≤<=105). Next line of input contains *n* space separated integers *a*1,<=*a*2,<=... *a**n* (<=-<=109<=≤<=*a**i*<=≤<=109).
Output a single integer the maximum value of *p*·*a**i*<=+<=*q*·*a**j*<=+<=*r*·*a**k* that can be obtained provided 1<=≤<=*i*<=≤<=*j*<=≤<=*k*<=≤<=*n*.
[ "5 1 2 3\n1 2 3 4 5\n", "5 1 2 -3\n-1 -2 -3 -4 -5\n" ]
[ "30\n", "12\n" ]
In the first sample case, we can take *i* = *j* = *k* = 5, thus making the answer as 1·5 + 2·5 + 3·5 = 30. In second sample case, selecting *i* = *j* = 1 and *k* = 5 gives the answer 12.
1,000
[ { "input": "5 1 2 3\n1 2 3 4 5", "output": "30" }, { "input": "5 1 2 -3\n-1 -2 -3 -4 -5", "output": "12" }, { "input": "5 886327859 82309257 -68295239\n-731225382 354766539 -48222231 -474691998 360965777", "output": "376059240645059046" }, { "input": "4 -96405765 -495906217 625385006\n-509961652 392159235 -577128498 -744548876", "output": "547306902373544674" }, { "input": "43 959134961 -868367850 142426380\n921743429 63959718 -797293233 122041422 -407576197 700139744 299598010 168207043 362252658 591926075 941946099 812263640 -76679927 -824267725 89529990 -73303355 83596189 -982699817 -235197848 654773327 125211479 -497091570 -2301804 203486596 -126652024 309810546 -581289415 -740125230 64425927 -501018049 304730559 34930193 -762964086 723645139 -826821494 495947907 816331024 9932423 -876541603 -782692568 322360800 841436938 40787162", "output": "1876641179289775029" }, { "input": "1 0 0 0\n0", "output": "0" }, { "input": "1 1000000000 1000000000 1000000000\n1000000000", "output": "3000000000000000000" }, { "input": "1 -1000000000 -1000000000 1000000000\n1000000000", "output": "-1000000000000000000" }, { "input": "1 -1000000000 -1000000000 -1000000000\n1000000000", "output": "-3000000000000000000" }, { "input": "3 1000000000 1000000000 1000000000\n-1000000000 -1000000000 -1000000000", "output": "-3000000000000000000" }, { "input": "1 1 1 1\n-1", "output": "-3" }, { "input": "1 -1 -1 -1\n1", "output": "-3" }, { "input": "1 1000000000 1000000000 1000000000\n-1000000000", "output": "-3000000000000000000" }, { "input": "1 1 2 3\n-1", "output": "-6" }, { "input": "3 -1000000000 -1000000000 -1000000000\n1000000000 1000000000 1000000000", "output": "-3000000000000000000" }, { "input": "2 -1000000000 -1000000000 -1000000000\n1000000000 1000000000", "output": "-3000000000000000000" }, { "input": "3 1 1 1\n-1 -1 -1", "output": "-3" }, { "input": "1 -1000000000 0 0\n1000000000", "output": "-1000000000000000000" }, { "input": "1 -100 -100 -100\n100", "output": "-30000" }, { "input": "5 -1000000000 -1000000000 -1000000000\n1000000000 1000000000 1000000000 1000000000 1000000000", "output": "-3000000000000000000" }, { "input": "1 999999999 999999999 999999999\n-999999999", "output": "-2999999994000000003" }, { "input": "3 -1000000000 -1000000000 1\n1000000000 1000000000 1000000000", "output": "-1999999999000000000" }, { "input": "3 -2 3 -2\n1 2 1", "output": "2" }, { "input": "2 1 -1 1\n1 -1", "output": "1" }, { "input": "1 -1000000000 1 -1000000000\n1000000000", "output": "-1999999999000000000" }, { "input": "1 1000000000 1000000000 -1000000000\n-1000000000", "output": "-1000000000000000000" }, { "input": "1 -1000000000 -1000000000 0\n1000000000", "output": "-2000000000000000000" } ]
1,608,822,532
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
4
2,000
4,505,600
n,p,q,r=map(int,input().split()) l=list(map(int,input().split())) c=p*l[0] + q*l[0] + r*l[0] for j in range(n): s=l[:j+1] s2=l[j:] i1=max(s) i2=min(s) #print(i1,i2) k1=max(s2) k2=min(s2) if i1*p>i2*p: i=i1*p else: i=i2*p if k1*r>k2*r: k=k1*r else: k=k2*r v=l[j]*q+i+k c=max(c,v) print(c)
Title: Marvolo Gaunt's Ring Time Limit: None seconds Memory Limit: None megabytes Problem Description: Professor Dumbledore is helping Harry destroy the Horcruxes. He went to Gaunt Shack as he suspected a Horcrux to be present there. He saw Marvolo Gaunt's Ring and identified it as a Horcrux. Although he destroyed it, he is still affected by its curse. Professor Snape is helping Dumbledore remove the curse. For this, he wants to give Dumbledore exactly *x* drops of the potion he made. Value of *x* is calculated as maximum of *p*·*a**i*<=+<=*q*·*a**j*<=+<=*r*·*a**k* for given *p*,<=*q*,<=*r* and array *a*1,<=*a*2,<=... *a**n* such that 1<=≤<=*i*<=≤<=*j*<=≤<=*k*<=≤<=*n*. Help Snape find the value of *x*. Do note that the value of *x* may be negative. Input Specification: First line of input contains 4 integers *n*,<=*p*,<=*q*,<=*r* (<=-<=109<=≤<=*p*,<=*q*,<=*r*<=≤<=109,<=1<=≤<=*n*<=≤<=105). Next line of input contains *n* space separated integers *a*1,<=*a*2,<=... *a**n* (<=-<=109<=≤<=*a**i*<=≤<=109). Output Specification: Output a single integer the maximum value of *p*·*a**i*<=+<=*q*·*a**j*<=+<=*r*·*a**k* that can be obtained provided 1<=≤<=*i*<=≤<=*j*<=≤<=*k*<=≤<=*n*. Demo Input: ['5 1 2 3\n1 2 3 4 5\n', '5 1 2 -3\n-1 -2 -3 -4 -5\n'] Demo Output: ['30\n', '12\n'] Note: In the first sample case, we can take *i* = *j* = *k* = 5, thus making the answer as 1·5 + 2·5 + 3·5 = 30. In second sample case, selecting *i* = *j* = 1 and *k* = 5 gives the answer 12.
```python n,p,q,r=map(int,input().split()) l=list(map(int,input().split())) c=p*l[0] + q*l[0] + r*l[0] for j in range(n): s=l[:j+1] s2=l[j:] i1=max(s) i2=min(s) #print(i1,i2) k1=max(s2) k2=min(s2) if i1*p>i2*p: i=i1*p else: i=i2*p if k1*r>k2*r: k=k1*r else: k=k2*r v=l[j]*q+i+k c=max(c,v) print(c) ```
0
413
A
Data Recovery
PROGRAMMING
1,200
[ "implementation" ]
null
null
Not so long ago company R2 bought company R1 and consequently, all its developments in the field of multicore processors. Now the R2 laboratory is testing one of the R1 processors. The testing goes in *n* steps, at each step the processor gets some instructions, and then its temperature is measured. The head engineer in R2 is keeping a report record on the work of the processor: he writes down the minimum and the maximum measured temperature in his notebook. His assistant had to write down all temperatures into his notebook, but (for unknown reasons) he recorded only *m*. The next day, the engineer's assistant filed in a report with all the *m* temperatures. However, the chief engineer doubts that the assistant wrote down everything correctly (naturally, the chief engineer doesn't doubt his notes). So he asked you to help him. Given numbers *n*, *m*, *min*, *max* and the list of *m* temperatures determine whether you can upgrade the set of *m* temperatures to the set of *n* temperatures (that is add *n*<=-<=*m* temperatures), so that the minimum temperature was *min* and the maximum one was *max*.
The first line contains four integers *n*,<=*m*,<=*min*,<=*max* (1<=≤<=*m*<=&lt;<=*n*<=≤<=100; 1<=≤<=*min*<=&lt;<=*max*<=≤<=100). The second line contains *m* space-separated integers *t**i* (1<=≤<=*t**i*<=≤<=100) — the temperatures reported by the assistant. Note, that the reported temperatures, and the temperatures you want to add can contain equal temperatures.
If the data is consistent, print 'Correct' (without the quotes). Otherwise, print 'Incorrect' (without the quotes).
[ "2 1 1 2\n1\n", "3 1 1 3\n2\n", "2 1 1 3\n2\n" ]
[ "Correct\n", "Correct\n", "Incorrect\n" ]
In the first test sample one of the possible initial configurations of temperatures is [1, 2]. In the second test sample one of the possible initial configurations of temperatures is [2, 1, 3]. In the third test sample it is impossible to add one temperature to obtain the minimum equal to 1 and the maximum equal to 3.
500
[ { "input": "2 1 1 2\n1", "output": "Correct" }, { "input": "3 1 1 3\n2", "output": "Correct" }, { "input": "2 1 1 3\n2", "output": "Incorrect" }, { "input": "3 1 1 5\n3", "output": "Correct" }, { "input": "3 2 1 5\n1 5", "output": "Correct" }, { "input": "3 2 1 5\n1 1", "output": "Correct" }, { "input": "3 2 1 5\n5 5", "output": "Correct" }, { "input": "3 2 1 5\n1 6", "output": "Incorrect" }, { "input": "3 2 5 10\n1 10", "output": "Incorrect" }, { "input": "6 5 3 6\n4 4 4 4 4", "output": "Incorrect" }, { "input": "100 50 68 97\n20 42 93 1 98 6 32 11 48 46 82 96 24 73 40 100 99 10 55 87 65 80 97 54 59 48 30 22 16 92 66 2 22 60 23 81 64 60 34 60 99 99 4 70 91 99 30 20 41 96", "output": "Incorrect" }, { "input": "100 50 1 2\n1 1 2 1 1 2 2 1 1 1 1 1 2 2 1 2 1 2 2 1 1 1 2 2 2 1 1 2 1 1 1 1 2 2 1 1 1 1 1 2 1 1 1 2 1 2 2 2 1 2", "output": "Correct" }, { "input": "100 99 1 2\n2 1 1 1 2 2 1 1 1 2 2 2 1 2 1 1 2 1 1 2 1 2 2 1 2 1 2 1 2 1 2 2 2 2 1 1 1 1 1 2 1 2 2 1 2 2 2 1 1 1 1 1 2 2 2 2 1 2 2 1 1 1 2 1 1 2 1 1 2 1 2 1 2 1 1 1 1 2 1 1 1 1 1 2 2 2 1 1 1 1 2 2 2 2 1 1 2 2 2", "output": "Correct" }, { "input": "3 2 2 100\n40 1", "output": "Incorrect" }, { "input": "3 2 2 3\n4 4", "output": "Incorrect" }, { "input": "5 2 2 4\n2 2", "output": "Correct" }, { "input": "5 1 1 4\n1", "output": "Correct" }, { "input": "9 7 1 4\n4 3 3 2 2 4 1", "output": "Correct" }, { "input": "9 5 2 3\n4 2 4 3 3", "output": "Incorrect" }, { "input": "6 3 1 3\n1 4 2", "output": "Incorrect" }, { "input": "3 2 1 99\n34 100", "output": "Incorrect" }, { "input": "4 2 1 99\n100 38", "output": "Incorrect" }, { "input": "5 2 1 99\n100 38", "output": "Incorrect" }, { "input": "4 2 1 99\n36 51", "output": "Correct" }, { "input": "7 6 3 10\n5 10 7 7 4 5", "output": "Correct" }, { "input": "8 6 3 10\n8 5 7 8 4 4", "output": "Correct" }, { "input": "9 6 3 10\n9 7 7 5 3 10", "output": "Correct" }, { "input": "16 15 30 40\n36 37 35 36 34 34 37 35 32 33 31 38 39 38 38", "output": "Incorrect" }, { "input": "17 15 30 40\n38 36 37 34 30 38 38 31 38 38 36 39 39 37 35", "output": "Correct" }, { "input": "18 15 30 40\n35 37 31 32 30 33 36 38 36 38 31 30 39 32 36", "output": "Correct" }, { "input": "17 16 30 40\n39 32 37 31 40 32 36 34 56 34 40 36 37 36 33 36", "output": "Incorrect" }, { "input": "18 16 30 40\n32 35 33 39 34 30 37 34 30 34 39 18 32 37 37 36", "output": "Incorrect" }, { "input": "19 16 30 40\n36 30 37 30 37 32 34 30 35 35 33 35 39 37 46 37", "output": "Incorrect" }, { "input": "2 1 2 100\n38", "output": "Incorrect" }, { "input": "3 1 2 100\n1", "output": "Incorrect" }, { "input": "4 1 2 100\n1", "output": "Incorrect" }, { "input": "91 38 1 3\n3 2 3 2 3 2 3 3 1 1 1 2 2 1 3 2 3 1 3 3 1 3 3 2 1 2 2 3 1 2 1 3 2 2 3 1 1 2", "output": "Correct" }, { "input": "4 3 2 10\n6 3 10", "output": "Correct" }, { "input": "41 6 4 10\n10 7 4 9 9 10", "output": "Correct" }, { "input": "21 1 1 9\n9", "output": "Correct" }, { "input": "2 1 9 10\n10", "output": "Correct" }, { "input": "2 1 2 9\n9", "output": "Correct" }, { "input": "8 7 5 9\n6 7 8 5 5 6 6", "output": "Correct" }, { "input": "3 2 2 8\n7 2", "output": "Correct" }, { "input": "71 36 1 10\n7 10 8 1 3 8 5 7 3 10 8 1 6 4 5 7 8 2 4 3 4 10 8 5 1 2 8 8 10 10 4 3 7 9 7 8", "output": "Correct" }, { "input": "85 3 4 9\n4 8 7", "output": "Correct" }, { "input": "4 3 4 10\n9 10 5", "output": "Correct" }, { "input": "2 1 1 5\n1", "output": "Correct" }, { "input": "91 75 1 10\n2 6 9 7 4 9 4 8 10 6 4 1 10 6 5 9 7 5 1 4 6 4 8 2 1 3 5 7 6 9 5 5 8 1 7 1 4 2 8 3 1 6 6 2 10 6 2 2 8 5 4 5 5 3 10 9 4 3 1 9 10 3 2 4 8 7 4 9 3 1 1 1 3 4 5", "output": "Correct" }, { "input": "10 4 1 8\n7 9 6 6", "output": "Incorrect" }, { "input": "18 1 3 10\n2", "output": "Incorrect" }, { "input": "6 2 4 8\n6 3", "output": "Incorrect" }, { "input": "17 6 2 8\n3 8 6 1 6 4", "output": "Incorrect" }, { "input": "21 1 5 8\n4", "output": "Incorrect" }, { "input": "2 1 1 10\n9", "output": "Incorrect" }, { "input": "2 1 4 8\n5", "output": "Incorrect" }, { "input": "2 1 1 7\n6", "output": "Incorrect" }, { "input": "2 1 4 9\n5", "output": "Incorrect" }, { "input": "2 1 3 8\n7", "output": "Incorrect" }, { "input": "2 1 5 9\n6", "output": "Incorrect" }, { "input": "3 2 1 10\n4 9", "output": "Incorrect" }, { "input": "2 1 4 10\n7", "output": "Incorrect" }, { "input": "2 1 2 9\n8", "output": "Incorrect" }, { "input": "2 1 3 9\n3", "output": "Correct" }, { "input": "3 2 6 7\n6 6", "output": "Correct" }, { "input": "6 4 1 10\n11 10 9 1", "output": "Incorrect" }, { "input": "7 6 3 8\n3 4 5 6 7 8", "output": "Correct" }, { "input": "5 3 1 5\n2 3 4", "output": "Correct" } ]
1,620,445,092
2,147,483,647
Python 3
OK
TESTS
68
62
6,758,400
n,m,mini,maxi = list(map(int,input().split())) ar = list(map(int,input().split())) minix = min(ar) maxix = max(ar) diff = n-m if diff ==1 and ( minix != mini and maxix != maxi): print("Incorrect") exit() if minix < mini or maxix > maxi: print("Incorrect") exit() print("Correct")
Title: Data Recovery Time Limit: None seconds Memory Limit: None megabytes Problem Description: Not so long ago company R2 bought company R1 and consequently, all its developments in the field of multicore processors. Now the R2 laboratory is testing one of the R1 processors. The testing goes in *n* steps, at each step the processor gets some instructions, and then its temperature is measured. The head engineer in R2 is keeping a report record on the work of the processor: he writes down the minimum and the maximum measured temperature in his notebook. His assistant had to write down all temperatures into his notebook, but (for unknown reasons) he recorded only *m*. The next day, the engineer's assistant filed in a report with all the *m* temperatures. However, the chief engineer doubts that the assistant wrote down everything correctly (naturally, the chief engineer doesn't doubt his notes). So he asked you to help him. Given numbers *n*, *m*, *min*, *max* and the list of *m* temperatures determine whether you can upgrade the set of *m* temperatures to the set of *n* temperatures (that is add *n*<=-<=*m* temperatures), so that the minimum temperature was *min* and the maximum one was *max*. Input Specification: The first line contains four integers *n*,<=*m*,<=*min*,<=*max* (1<=≤<=*m*<=&lt;<=*n*<=≤<=100; 1<=≤<=*min*<=&lt;<=*max*<=≤<=100). The second line contains *m* space-separated integers *t**i* (1<=≤<=*t**i*<=≤<=100) — the temperatures reported by the assistant. Note, that the reported temperatures, and the temperatures you want to add can contain equal temperatures. Output Specification: If the data is consistent, print 'Correct' (without the quotes). Otherwise, print 'Incorrect' (without the quotes). Demo Input: ['2 1 1 2\n1\n', '3 1 1 3\n2\n', '2 1 1 3\n2\n'] Demo Output: ['Correct\n', 'Correct\n', 'Incorrect\n'] Note: In the first test sample one of the possible initial configurations of temperatures is [1, 2]. In the second test sample one of the possible initial configurations of temperatures is [2, 1, 3]. In the third test sample it is impossible to add one temperature to obtain the minimum equal to 1 and the maximum equal to 3.
```python n,m,mini,maxi = list(map(int,input().split())) ar = list(map(int,input().split())) minix = min(ar) maxix = max(ar) diff = n-m if diff ==1 and ( minix != mini and maxix != maxi): print("Incorrect") exit() if minix < mini or maxix > maxi: print("Incorrect") exit() print("Correct") ```
3
460
A
Vasya and Socks
PROGRAMMING
900
[ "brute force", "implementation", "math" ]
null
null
Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks?
The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space.
Print a single integer — the answer to the problem.
[ "2 2\n", "9 3\n" ]
[ "3\n", "13\n" ]
In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two. In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day.
500
[ { "input": "2 2", "output": "3" }, { "input": "9 3", "output": "13" }, { "input": "1 2", "output": "1" }, { "input": "2 3", "output": "2" }, { "input": "1 99", "output": "1" }, { "input": "4 4", "output": "5" }, { "input": "10 2", "output": "19" }, { "input": "10 9", "output": "11" }, { "input": "100 100", "output": "101" }, { "input": "2 27", "output": "2" }, { "input": "99 100", "output": "99" }, { "input": "99 2", "output": "197" }, { "input": "100 3", "output": "149" }, { "input": "98 3", "output": "146" }, { "input": "4 4", "output": "5" }, { "input": "100 2", "output": "199" }, { "input": "62 4", "output": "82" }, { "input": "99 10", "output": "109" }, { "input": "100 5", "output": "124" }, { "input": "80 80", "output": "81" }, { "input": "95 16", "output": "101" }, { "input": "75 16", "output": "79" }, { "input": "99 74", "output": "100" }, { "input": "20 21", "output": "20" }, { "input": "52 96", "output": "52" }, { "input": "24 5", "output": "29" } ]
1,654,925,030
2,147,483,647
Python 3
OK
TESTS
26
46
0
n,m=map(int,input().split()) c = 0 while(n!=0): n = n - 1 c = c + 1 if(c%m==0): n = n + 1 print(c)
Title: Vasya and Socks Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks? Input Specification: The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space. Output Specification: Print a single integer — the answer to the problem. Demo Input: ['2 2\n', '9 3\n'] Demo Output: ['3\n', '13\n'] Note: In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two. In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day.
```python n,m=map(int,input().split()) c = 0 while(n!=0): n = n - 1 c = c + 1 if(c%m==0): n = n + 1 print(c) ```
3
38
A
Army
PROGRAMMING
800
[ "implementation" ]
A. Army
2
256
The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank. One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible. Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream.
The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=&lt;<=*b*<=≤<=*n*). The numbers on the lines are space-separated.
Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*.
[ "3\n5 6\n1 2\n", "3\n5 6\n1 3\n" ]
[ "5\n", "11\n" ]
none
0
[ { "input": "3\n5 6\n1 2", "output": "5" }, { "input": "3\n5 6\n1 3", "output": "11" }, { "input": "2\n55\n1 2", "output": "55" }, { "input": "3\n85 78\n1 3", "output": "163" }, { "input": "4\n63 4 49\n2 3", "output": "4" }, { "input": "5\n93 83 42 56\n2 5", "output": "181" }, { "input": "6\n22 9 87 89 57\n1 6", "output": "264" }, { "input": "7\n52 36 31 23 74 78\n2 7", "output": "242" }, { "input": "8\n82 14 24 5 91 49 94\n3 8", "output": "263" }, { "input": "9\n12 40 69 39 59 21 59 5\n4 6", "output": "98" }, { "input": "10\n95 81 32 59 71 30 50 61 100\n1 6", "output": "338" }, { "input": "15\n89 55 94 4 15 69 19 60 91 77 3 94 91 62\n3 14", "output": "617" }, { "input": "20\n91 1 41 51 95 67 92 35 23 70 44 91 57 50 21 8 9 71 40\n8 17", "output": "399" }, { "input": "25\n70 95 21 84 97 39 12 98 53 24 78 29 84 65 70 22 100 17 69 27 62 48 35 80\n8 23", "output": "846" }, { "input": "30\n35 69 50 44 19 56 86 56 98 24 21 2 61 24 85 30 2 22 57 35 59 84 12 77 92 53 50 92 9\n1 16", "output": "730" }, { "input": "35\n2 34 47 15 27 61 6 88 67 20 53 65 29 68 77 5 78 86 44 98 32 81 91 79 54 84 95 23 65 97 22 33 42 87\n8 35", "output": "1663" }, { "input": "40\n32 88 59 36 95 45 28 78 73 30 97 13 13 47 48 100 43 21 22 45 88 25 15 13 63 25 72 92 29 5 25 11 50 5 54 51 48 84 23\n7 26", "output": "862" }, { "input": "45\n83 74 73 95 10 31 100 26 29 15 80 100 22 70 31 88 9 56 19 70 2 62 48 30 27 47 52 50 94 44 21 94 23 85 15 3 95 72 43 62 94 89 68 88\n17 40", "output": "1061" }, { "input": "50\n28 8 16 29 19 82 70 51 96 84 74 72 17 69 12 21 37 21 39 3 18 66 19 49 86 96 94 93 2 90 96 84 59 88 58 15 61 33 55 22 35 54 51 29 64 68 29 38 40\n23 28", "output": "344" }, { "input": "60\n24 28 25 21 43 71 64 73 71 90 51 83 69 43 75 43 78 72 56 61 99 7 23 86 9 16 16 94 23 74 18 56 20 72 13 31 75 34 35 86 61 49 4 72 84 7 65 70 66 52 21 38 6 43 69 40 73 46 5\n28 60", "output": "1502" }, { "input": "70\n69 95 34 14 67 61 6 95 94 44 28 94 73 66 39 13 19 71 73 71 28 48 26 22 32 88 38 95 43 59 88 77 80 55 17 95 40 83 67 1 38 95 58 63 56 98 49 2 41 4 73 8 78 41 64 71 60 71 41 61 67 4 4 19 97 14 39 20 27\n9 41", "output": "1767" }, { "input": "80\n65 15 43 6 43 98 100 16 69 98 4 54 25 40 2 35 12 23 38 29 10 89 30 6 4 8 7 96 64 43 11 49 89 38 20 59 54 85 46 16 16 89 60 54 28 37 32 34 67 9 78 30 50 87 58 53 99 48 77 3 5 6 19 99 16 20 31 10 80 76 82 56 56 83 72 81 84 60 28\n18 24", "output": "219" }, { "input": "90\n61 35 100 99 67 87 42 90 44 4 81 65 29 63 66 56 53 22 55 87 39 30 34 42 27 80 29 97 85 28 81 22 50 22 24 75 67 86 78 79 94 35 13 97 48 76 68 66 94 13 82 1 22 85 5 36 86 73 65 97 43 56 35 26 87 25 74 47 81 67 73 75 99 75 53 38 70 21 66 78 38 17 57 40 93 57 68 55 1\n12 44", "output": "1713" }, { "input": "95\n37 74 53 96 65 84 65 72 95 45 6 77 91 35 58 50 51 51 97 30 51 20 79 81 92 10 89 34 40 76 71 54 26 34 73 72 72 28 53 19 95 64 97 10 44 15 12 38 5 63 96 95 86 8 36 96 45 53 81 5 18 18 47 97 65 9 33 53 41 86 37 53 5 40 15 76 83 45 33 18 26 5 19 90 46 40 100 42 10 90 13 81 40 53\n6 15", "output": "570" }, { "input": "96\n51 32 95 75 23 54 70 89 67 3 1 51 4 100 97 30 9 35 56 38 54 77 56 98 43 17 60 43 72 46 87 61 100 65 81 22 74 38 16 96 5 10 54 22 23 22 10 91 9 54 49 82 29 73 33 98 75 8 4 26 24 90 71 42 90 24 94 74 94 10 41 98 56 63 18 43 56 21 26 64 74 33 22 38 67 66 38 60 64 76 53 10 4 65 76\n21 26", "output": "328" }, { "input": "97\n18 90 84 7 33 24 75 55 86 10 96 72 16 64 37 9 19 71 62 97 5 34 85 15 46 72 82 51 52 16 55 68 27 97 42 72 76 97 32 73 14 56 11 86 2 81 59 95 60 93 1 22 71 37 77 100 6 16 78 47 78 62 94 86 16 91 56 46 47 35 93 44 7 86 70 10 29 45 67 62 71 61 74 39 36 92 24 26 65 14 93 92 15 28 79 59\n6 68", "output": "3385" }, { "input": "98\n32 47 26 86 43 42 79 72 6 68 40 46 29 80 24 89 29 7 21 56 8 92 13 33 50 79 5 7 84 85 24 23 1 80 51 21 26 55 96 51 24 2 68 98 81 88 57 100 64 84 54 10 14 2 74 1 89 71 1 20 84 85 17 31 42 58 69 67 48 60 97 90 58 10 21 29 2 21 60 61 68 89 77 39 57 18 61 44 67 100 33 74 27 40 83 29 6\n8 77", "output": "3319" }, { "input": "99\n46 5 16 66 53 12 84 89 26 27 35 68 41 44 63 17 88 43 80 15 59 1 42 50 53 34 75 16 16 55 92 30 28 11 12 71 27 65 11 28 86 47 24 10 60 47 7 53 16 75 6 49 56 66 70 3 20 78 75 41 38 57 89 23 16 74 30 39 1 32 49 84 9 33 25 95 75 45 54 59 17 17 29 40 79 96 47 11 69 86 73 56 91 4 87 47 31 24\n23 36", "output": "514" }, { "input": "100\n63 65 21 41 95 23 3 4 12 23 95 50 75 63 58 34 71 27 75 31 23 94 96 74 69 34 43 25 25 55 44 19 43 86 68 17 52 65 36 29 72 96 84 25 84 23 71 54 6 7 71 7 21 100 99 58 93 35 62 47 36 70 68 9 75 13 35 70 76 36 62 22 52 51 2 87 66 41 54 35 78 62 30 35 65 44 74 93 78 37 96 70 26 32 71 27 85 85 63\n43 92", "output": "2599" }, { "input": "51\n85 38 22 38 42 36 55 24 36 80 49 15 66 91 88 61 46 82 1 61 89 92 6 56 28 8 46 80 56 90 91 38 38 17 69 64 57 68 13 44 45 38 8 72 61 39 87 2 73 88\n15 27", "output": "618" }, { "input": "2\n3\n1 2", "output": "3" }, { "input": "5\n6 8 22 22\n2 3", "output": "8" }, { "input": "6\n3 12 27 28 28\n3 4", "output": "27" }, { "input": "9\n1 2 2 2 2 3 3 5\n3 7", "output": "9" }, { "input": "10\n1 1 1 1 1 1 1 1 1\n6 8", "output": "2" }, { "input": "20\n1 1 1 1 1 1 1 1 2 2 2 2 2 3 3 3 3 3 3\n5 17", "output": "23" }, { "input": "25\n1 1 1 4 5 6 8 11 11 11 11 12 13 14 14 14 15 16 16 17 17 17 19 19\n4 8", "output": "23" }, { "input": "35\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2\n30 31", "output": "2" }, { "input": "45\n1 1 1 1 2 2 2 2 2 2 2 3 3 3 3 3 3 4 5 5 5 5 6 6 6 6 6 6 6 7 7 7 7 8 8 8 9 9 9 9 9 10 10 10\n42 45", "output": "30" }, { "input": "50\n1 8 8 13 14 15 15 16 19 21 22 24 26 31 32 37 45 47 47 47 50 50 51 54 55 56 58 61 61 61 63 63 64 66 66 67 67 70 71 80 83 84 85 92 92 94 95 95 100\n4 17", "output": "285" }, { "input": "60\n1 2 4 4 4 6 6 8 9 10 10 13 14 18 20 20 21 22 23 23 26 29 30 32 33 34 35 38 40 42 44 44 46 48 52 54 56 56 60 60 66 67 68 68 69 73 73 74 80 80 81 81 82 84 86 86 87 89 89\n56 58", "output": "173" }, { "input": "70\n1 2 3 3 4 5 5 7 7 7 8 8 8 8 9 9 10 12 12 12 12 13 16 16 16 16 16 16 17 17 18 18 20 20 21 23 24 25 25 26 29 29 29 29 31 32 32 34 35 36 36 37 37 38 39 39 40 40 40 40 41 41 42 43 44 44 44 45 45\n62 65", "output": "126" }, { "input": "80\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 4 4 4 4 5 5 5 5 5 5 5 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12\n17 65", "output": "326" }, { "input": "90\n1 1 3 5 8 9 10 11 11 11 11 12 13 14 15 15 15 16 16 19 19 20 22 23 24 25 25 28 29 29 30 31 33 34 35 37 37 38 41 43 43 44 45 47 51 54 55 56 58 58 59 59 60 62 66 67 67 67 68 68 69 70 71 72 73 73 76 77 77 78 78 78 79 79 79 82 83 84 85 85 87 87 89 93 93 93 95 99 99\n28 48", "output": "784" }, { "input": "95\n2 2 3 3 4 6 6 7 7 7 9 10 12 12 12 12 13 14 15 16 17 18 20 20 20 20 21 21 21 21 22 22 22 22 22 23 23 23 25 26 26 27 27 27 28 29 29 30 30 31 32 33 34 36 37 37 38 39 39 39 42 43 43 43 45 47 48 50 50 51 52 53 54 54 54 55 55 55 58 59 60 61 61 61 61 62 62 63 64 65 66 67 67 67\n64 93", "output": "1636" }, { "input": "96\n1 1 2 3 3 5 8 9 9 10 10 10 11 11 11 11 11 12 13 13 13 14 15 15 16 16 17 17 17 17 18 18 20 20 20 21 21 21 23 24 24 25 25 26 27 27 27 27 29 29 29 30 30 30 32 32 32 32 32 32 33 33 34 34 34 35 35 35 36 36 37 37 37 38 39 40 41 41 41 41 42 42 43 43 45 45 45 46 46 47 47 49 50 52 52\n76 96", "output": "898" }, { "input": "98\n2 3 4 4 5 7 8 10 10 10 11 11 12 12 12 12 13 14 15 15 16 16 18 19 19 20 21 21 21 21 22 23 24 25 26 26 27 27 27 27 29 29 30 30 31 31 37 40 40 40 41 41 41 42 43 44 44 44 46 46 47 49 49 50 50 50 51 53 55 55 56 56 56 56 56 57 57 58 59 60 60 60 62 62 63 64 64 64 65 66 66 67 68 70 70 71 71\n8 90", "output": "3016" }, { "input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n66 95", "output": "29" }, { "input": "100\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 10 10 10 10 11 11 11 11 12 12 12 13 13 13 13 13 13 13 13 13 13 14 14 14 14 14 14 15 15 15 15 15 15 16 16 16 17 17\n39 52", "output": "82" }, { "input": "51\n5 7 9 16 19 25 26 29 29 30 31 32 32 41 43 44 47 49 50 50 51 52 54 55 56 63 64 66 67 70 74 74 77 78 79 80 80 85 86 87 89 89 90 92 93 94 94 95 95 97\n3 44", "output": "2268" } ]
1,692,537,365
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
62
0
n = int(input()) sum = 0 list = list(map(int,input().split())) l, r = map(int,input().split()) for i in range(l - 1, r, 1): sum += list[i] print(sum)
Title: Army Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank. One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible. Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream. Input Specification: The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=&lt;<=*b*<=≤<=*n*). The numbers on the lines are space-separated. Output Specification: Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*. Demo Input: ['3\n5 6\n1 2\n', '3\n5 6\n1 3\n'] Demo Output: ['5\n', '11\n'] Note: none
```python n = int(input()) sum = 0 list = list(map(int,input().split())) l, r = map(int,input().split()) for i in range(l - 1, r, 1): sum += list[i] print(sum) ```
0
369
E
Valera and Queries
PROGRAMMING
2,200
[ "binary search", "data structures" ]
null
null
Valera loves segments. He has recently come up with one interesting problem. The *Ox* axis of coordinates has *n* segments, the *i*-th segment starts in position *l**i* and ends in position *r**i* (we will mark it as [*l**i*,<=*r**i*]). Your task is to process *m* queries, each consists of number *cnt**i* and a set of *cnt**i* coordinates of points located on the *Ox* axis. The answer to the query is the number of segments, such that each of them contains at least one point from the query. Segment [*l*,<=*r*] contains point *q*, if *l*<=≤<=*q*<=≤<=*r*. Valera found the solution of this problem too difficult. So he asked you to help him. Help Valera.
The first line contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=3·105) — the number of segments on the axis of coordinates and the number of queries. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two positive integers *l**i*, *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=106) — the borders of the *i*-th segment. Next *m* lines contain the description of the queries, one per line. Each line starts from integer *cnt**i* (1<=≤<=*cnt**i*<=≤<=3·105) — the number of points in the *i*-th query. Then the line contains *cnt**i* distinct positive integers *p*1,<=*p*2,<=...,<=*p**cnt**i* (1<=≤<=*p*1<=&lt;<=*p*2<=&lt;<=...<=&lt;<=*p**cnt**i*<=≤<=106) — the coordinates of points in the *i*-th query. It is guaranteed that the total number of points in all queries doesn't exceed 3·105.
Print *m* non-negative integers, where the *i*-th number is the response to the *i*-th query.
[ "3 3\n1 3\n4 5\n6 7\n3 1 4 7\n2 4 5\n1 8\n" ]
[ "3\n1\n0\n" ]
none
2,500
[ { "input": "3 3\n1 3\n4 5\n6 7\n3 1 4 7\n2 4 5\n1 8", "output": "3\n1\n0" }, { "input": "1 1\n172921 894619\n1 14141", "output": "0" }, { "input": "3 1\n439010 864662\n377278 743032\n771051 955458\n1 568232", "output": "2" }, { "input": "3 3\n328789 478281\n248154 348247\n820715 860013\n1 344703\n1 592310\n1 104937", "output": "2\n0\n0" }, { "input": "5 3\n529971 921435\n466874 801474\n178558 921765\n193565 251465\n346414 727740\n5 328292 498601 509140 588519 820032\n5 221904 249439 491524 570871 945281\n5 357080 543431 566949 932654 947658", "output": "4\n5\n4" }, { "input": "5 1\n678201 810289\n778357 940848\n778406 946358\n151271 684580\n203524 382911\n5 358312 424531 460539 542697 775332", "output": "3" }, { "input": "5 1\n862248 965768\n78738 994773\n236426 318177\n186078 241439\n76304 568725\n1 509307", "output": "2" }, { "input": "5 3\n547230 805495\n810625 899397\n203912 240535\n432981 477594\n229222 465101\n1 908682\n1 942879\n1 808024", "output": "0\n0\n0" }, { "input": "5 5\n643450 686584\n30981 862245\n68908 575075\n558374 713102\n480946 865118\n1 680156\n1 557501\n1 95807\n1 972121\n1 262787", "output": "4\n3\n2\n0\n2" }, { "input": "10 3\n172267 379903\n546621 772370\n581059 880021\n321531 376831\n229673 432639\n106645 948268\n855783 967973\n541573 920416\n7682 695665\n492612 836502\n1 873101\n1 818922\n1 198181", "output": "4\n4\n3" }, { "input": "10 3\n356907 564385\n519660 960519\n84077 747040\n374095 956206\n476778 728678\n278858 977832\n158558 723270\n130593 261834\n125493 250966\n307770 792762\n3 56100 382258 579673\n3 40029 266600 440635\n3 36944 414002 843837", "output": "8\n6\n7" }, { "input": "10 10\n366228 895993\n228160 722127\n400056 671311\n683144 765009\n196492 360241\n304744 916576\n450846 764055\n211322 967136\n696553 766931\n282539 425248\n1 130996\n1 682994\n1 183255\n1 165896\n1 396547\n1 558594\n1 894712\n1 945830\n1 842172\n1 704247", "output": "0\n5\n0\n0\n5\n6\n3\n1\n3\n7" }, { "input": "3 4\n1000000 1000000\n5000 5000\n1 1\n1 1\n1 1000000\n1 999999\n1 2", "output": "1\n1\n0\n0" }, { "input": "3 4\n1 1000000\n5000 5000\n1 1\n1 1\n1 1000000\n1 999999\n1 2", "output": "2\n1\n1\n1" }, { "input": "1 1\n1000000 1000000\n1 1000000", "output": "1" }, { "input": "1 1\n1 1\n1 1", "output": "1" } ]
1,518,894,796
5,596
Python 3
TIME_LIMIT_EXCEEDED
TESTS
10
2,000
6,451,200
n, m = [int(x) for x in input().split(' ')] segment = [] for i in range(n): sample = [int(x)for x in input().split(' ')] segment.append(sample) for j in range(m): used = [] #Used to store the segement.... query = [int(x) for x in input().split(' ')] query.pop(0) for l in query: for m in segment: if (l >= m[0] and l<=m[1]): if(m not in used): used.append(m) print(len(used))
Title: Valera and Queries Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera loves segments. He has recently come up with one interesting problem. The *Ox* axis of coordinates has *n* segments, the *i*-th segment starts in position *l**i* and ends in position *r**i* (we will mark it as [*l**i*,<=*r**i*]). Your task is to process *m* queries, each consists of number *cnt**i* and a set of *cnt**i* coordinates of points located on the *Ox* axis. The answer to the query is the number of segments, such that each of them contains at least one point from the query. Segment [*l*,<=*r*] contains point *q*, if *l*<=≤<=*q*<=≤<=*r*. Valera found the solution of this problem too difficult. So he asked you to help him. Help Valera. Input Specification: The first line contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=3·105) — the number of segments on the axis of coordinates and the number of queries. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two positive integers *l**i*, *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=106) — the borders of the *i*-th segment. Next *m* lines contain the description of the queries, one per line. Each line starts from integer *cnt**i* (1<=≤<=*cnt**i*<=≤<=3·105) — the number of points in the *i*-th query. Then the line contains *cnt**i* distinct positive integers *p*1,<=*p*2,<=...,<=*p**cnt**i* (1<=≤<=*p*1<=&lt;<=*p*2<=&lt;<=...<=&lt;<=*p**cnt**i*<=≤<=106) — the coordinates of points in the *i*-th query. It is guaranteed that the total number of points in all queries doesn't exceed 3·105. Output Specification: Print *m* non-negative integers, where the *i*-th number is the response to the *i*-th query. Demo Input: ['3 3\n1 3\n4 5\n6 7\n3 1 4 7\n2 4 5\n1 8\n'] Demo Output: ['3\n1\n0\n'] Note: none
```python n, m = [int(x) for x in input().split(' ')] segment = [] for i in range(n): sample = [int(x)for x in input().split(' ')] segment.append(sample) for j in range(m): used = [] #Used to store the segement.... query = [int(x) for x in input().split(' ')] query.pop(0) for l in query: for m in segment: if (l >= m[0] and l<=m[1]): if(m not in used): used.append(m) print(len(used)) ```
0
681
A
A Good Contest
PROGRAMMING
800
[ "implementation" ]
null
null
Codeforces user' handle color depends on his rating — it is red if his rating is greater or equal to 2400; it is orange if his rating is less than 2400 but greater or equal to 2200, etc. Each time participant takes part in a rated contest, his rating is changed depending on his performance. Anton wants the color of his handle to become red. He considers his performance in the rated contest to be good if he outscored some participant, whose handle was colored red before the contest and his rating has increased after it. Anton has written a program that analyses contest results and determines whether he performed good or not. Are you able to do the same?
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants Anton has outscored in this contest . The next *n* lines describe participants results: the *i*-th of them consists of a participant handle *name**i* and two integers *before**i* and *after**i* (<=-<=4000<=≤<=*before**i*,<=*after**i*<=≤<=4000) — participant's rating before and after the contest, respectively. Each handle is a non-empty string, consisting of no more than 10 characters, which might be lowercase and uppercase English letters, digits, characters «_» and «-» characters. It is guaranteed that all handles are distinct.
Print «YES» (quotes for clarity), if Anton has performed good in the contest and «NO» (quotes for clarity) otherwise.
[ "3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749\n", "3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450\n" ]
[ "YES", "NO" ]
In the first sample, Anton has outscored user with handle Burunduk1, whose handle was colored red before the contest and his rating has increased after the contest. In the second sample, Applejack's rating has not increased after the contest, while both Fluttershy's and Pinkie_Pie's handles were not colored red before the contest.
500
[ { "input": "3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749", "output": "YES" }, { "input": "3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450", "output": "NO" }, { "input": "1\nDb -3373 3591", "output": "NO" }, { "input": "5\nQ2bz 960 2342\nhmX 2710 -1348\ngbAe -1969 -963\nE -160 196\npsi 2665 -3155", "output": "NO" }, { "input": "9\nmwAz9lQ 1786 -1631\nnYgYFXZQfY -1849 -1775\nKU4jF -1773 -3376\nopR 3752 2931\nGl -1481 -1002\nR -1111 3778\n0i9B21DC 3650 289\nQ8L2dS0 358 -3305\ng -2662 3968", "output": "NO" }, { "input": "5\nzMSBcOUf -2883 -2238\nYN -3314 -1480\nfHpuccQn06 -1433 -589\naM1NVEPQi 399 3462\n_L 2516 -3290", "output": "NO" }, { "input": "1\na 2400 2401", "output": "YES" }, { "input": "1\nfucker 4000 4000", "output": "NO" }, { "input": "1\nJora 2400 2401", "output": "YES" }, { "input": "1\nACA 2400 2420", "output": "YES" }, { "input": "1\nAca 2400 2420", "output": "YES" }, { "input": "1\nSub_d 2401 2402", "output": "YES" }, { "input": "2\nHack 2400 2401\nDum 1243 555", "output": "YES" }, { "input": "1\nXXX 2400 2500", "output": "YES" }, { "input": "1\nfucker 2400 2401", "output": "YES" }, { "input": "1\nX 2400 2500", "output": "YES" }, { "input": "1\nvineet 2400 2401", "output": "YES" }, { "input": "1\nabc 2400 2500", "output": "YES" }, { "input": "1\naaaaa 2400 2401", "output": "YES" }, { "input": "1\nhoge 2400 2401", "output": "YES" }, { "input": "1\nInfinity 2400 2468", "output": "YES" }, { "input": "1\nBurunduk1 2400 2401", "output": "YES" }, { "input": "1\nFuck 2400 2401", "output": "YES" }, { "input": "1\nfuck 2400 2401", "output": "YES" }, { "input": "3\nApplejack 2400 2401\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450", "output": "YES" }, { "input": "1\nalex 2400 2401", "output": "YES" }, { "input": "1\nA 2400 2401", "output": "YES" }, { "input": "1\na 2400 2455", "output": "YES" }, { "input": "1\nlol 2400 2401", "output": "YES" }, { "input": "2\nBurunduk1 2400 2537\nBudAlNik 2084 2214", "output": "YES" }, { "input": "1\naaaaaa 2400 2401", "output": "YES" }, { "input": "1\nBurunduk1 2400 2500", "output": "YES" }, { "input": "1\nds 2400 2410", "output": "YES" }, { "input": "1\nas 2400 2401", "output": "YES" }, { "input": "1\nabc 2400 2401", "output": "YES" }, { "input": "3\nBudAlNik 2084 2214\nsubscriber 2833 2749\nBurunduk1 2526 2537", "output": "YES" }, { "input": "1\ncaonima 2400 2401", "output": "YES" }, { "input": "1\narr 2400 2500", "output": "YES" }, { "input": "1\nx 2400 2401", "output": "YES" }, { "input": "1\narrr 2400 2500", "output": "YES" }, { "input": "1\nabc 2400 2405", "output": "YES" }, { "input": "3\nBurunduk1 2400 2420\nBudAlNik 2084 2214\nsubscriber 2833 2749", "output": "YES" }, { "input": "1\nBurunduk1 2400 2537", "output": "YES" }, { "input": "1\nHELLO 2400 2401", "output": "YES" }, { "input": "1\neatmore 2400 2500", "output": "YES" }, { "input": "1\nb 2400 2401", "output": "YES" }, { "input": "3\nBurunduk1 2400 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749", "output": "YES" }, { "input": "1\nApplejack 2400 2410", "output": "YES" }, { "input": "1\nabacaba 2400 2451", "output": "YES" }, { "input": "1\nrekt_n00b 2500 2600", "output": "YES" } ]
1,528,210,184
2,147,483,647
Python 3
OK
TESTS
60
93
7,065,600
ok = 0 for i in range(int(input())): a , b , c= input().split() if (int(b) >= 2400 and (int(c) > int(b))):print('YES');ok=1;break; if(ok == 0):print('NO')
Title: A Good Contest Time Limit: None seconds Memory Limit: None megabytes Problem Description: Codeforces user' handle color depends on his rating — it is red if his rating is greater or equal to 2400; it is orange if his rating is less than 2400 but greater or equal to 2200, etc. Each time participant takes part in a rated contest, his rating is changed depending on his performance. Anton wants the color of his handle to become red. He considers his performance in the rated contest to be good if he outscored some participant, whose handle was colored red before the contest and his rating has increased after it. Anton has written a program that analyses contest results and determines whether he performed good or not. Are you able to do the same? Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants Anton has outscored in this contest . The next *n* lines describe participants results: the *i*-th of them consists of a participant handle *name**i* and two integers *before**i* and *after**i* (<=-<=4000<=≤<=*before**i*,<=*after**i*<=≤<=4000) — participant's rating before and after the contest, respectively. Each handle is a non-empty string, consisting of no more than 10 characters, which might be lowercase and uppercase English letters, digits, characters «_» and «-» characters. It is guaranteed that all handles are distinct. Output Specification: Print «YES» (quotes for clarity), if Anton has performed good in the contest and «NO» (quotes for clarity) otherwise. Demo Input: ['3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749\n', '3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450\n'] Demo Output: ['YES', 'NO'] Note: In the first sample, Anton has outscored user with handle Burunduk1, whose handle was colored red before the contest and his rating has increased after the contest. In the second sample, Applejack's rating has not increased after the contest, while both Fluttershy's and Pinkie_Pie's handles were not colored red before the contest.
```python ok = 0 for i in range(int(input())): a , b , c= input().split() if (int(b) >= 2400 and (int(c) > int(b))):print('YES');ok=1;break; if(ok == 0):print('NO') ```
3
222
B
Cosmic Tables
PROGRAMMING
1,300
[ "data structures", "implementation" ]
null
null
The Free Meteor Association (FMA) has got a problem: as meteors are moving, the Universal Cosmic Descriptive Humorous Program (UCDHP) needs to add a special module that would analyze this movement. UCDHP stores some secret information about meteors as an *n*<=×<=*m* table with integers in its cells. The order of meteors in the Universe is changing. That's why the main UCDHP module receives the following queries: - The query to swap two table rows; - The query to swap two table columns; - The query to obtain a secret number in a particular table cell. As the main UCDHP module is critical, writing the functional of working with the table has been commissioned to you.
The first line contains three space-separated integers *n*, *m* and *k* (1<=≤<=*n*,<=*m*<=≤<=1000, 1<=≤<=*k*<=≤<=500000) — the number of table columns and rows and the number of queries, correspondingly. Next *n* lines contain *m* space-separated numbers each — the initial state of the table. Each number *p* in the table is an integer and satisfies the inequality 0<=≤<=*p*<=≤<=106. Next *k* lines contain queries in the format "*s**i* *x**i* *y**i*", where *s**i* is one of the characters "с", "r" or "g", and *x**i*, *y**i* are two integers. - If *s**i* = "c", then the current query is the query to swap columns with indexes *x**i* and *y**i* (1<=≤<=*x*,<=*y*<=≤<=*m*,<=*x*<=≠<=*y*); - If *s**i* = "r", then the current query is the query to swap rows with indexes *x**i* and *y**i* (1<=≤<=*x*,<=*y*<=≤<=*n*,<=*x*<=≠<=*y*); - If *s**i* = "g", then the current query is the query to obtain the number that located in the *x**i*-th row and in the *y**i*-th column (1<=≤<=*x*<=≤<=*n*,<=1<=≤<=*y*<=≤<=*m*). The table rows are considered to be indexed from top to bottom from 1 to *n*, and the table columns — from left to right from 1 to *m*.
For each query to obtain a number (*s**i* = "g") print the required number. Print the answers to the queries in the order of the queries in the input.
[ "3 3 5\n1 2 3\n4 5 6\n7 8 9\ng 3 2\nr 3 2\nc 2 3\ng 2 2\ng 3 2\n", "2 3 3\n1 2 4\n3 1 5\nc 2 1\nr 1 2\ng 1 3\n" ]
[ "8\n9\n6\n", "5\n" ]
Let's see how the table changes in the second test case. After the first operation is fulfilled, the table looks like that: 2 1 4 1 3 5 After the second operation is fulfilled, the table looks like that: 1 3 5 2 1 4 So the answer to the third query (the number located in the first row and in the third column) will be 5.
1,000
[ { "input": "3 3 5\n1 2 3\n4 5 6\n7 8 9\ng 3 2\nr 3 2\nc 2 3\ng 2 2\ng 3 2", "output": "8\n9\n6" }, { "input": "2 3 3\n1 2 4\n3 1 5\nc 2 1\nr 1 2\ng 1 3", "output": "5" }, { "input": "1 1 15\n1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1", "output": "1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1" }, { "input": "1 2 3\n1 2\nc 1 2\ng 1 1\ng 1 2", "output": "2\n1" }, { "input": "2 2 6\n1 2\n3 4\nc 1 2\nr 1 2\ng 1 1\ng 1 2\ng 2 1\ng 2 2", "output": "4\n3\n2\n1" }, { "input": "3 4 5\n1 2 3 4\n5 6 7 8\n9 10 11 12\nr 1 2\nr 1 3\nr 2 3\ng 1 1\ng 2 2", "output": "9\n6" }, { "input": "5 5 12\n1 2 3 4 5\n6 7 8 9 10\n11 12 13 14 15\n16 17 18 19 20\n21 22 23 24 25\nc 1 2\nr 1 2\nr 2 3\nr 1 2\nr 4 5\nc 3 4\ng 1 1\ng 2 2\ng 3 3\ng 4 4\ng 5 5\ng 2 3", "output": "12\n6\n4\n23\n20\n9" }, { "input": "6 5 30\n536048 34640 572197 62457 304174\n194764 325606 270468 784237 551632\n10580 294606 63164 543647 531895\n430397 576813 678878 323394 603231\n534567 804015 403517 886087 981939\n518845 962097 609792 877955 88610\nc 1 5\nc 2 5\nc 2 5\nr 5 3\nc 5 2\nc 4 5\nr 6 5\nc 2 1\nr 3 4\nr 4 3\nc 4 5\nc 2 1\nr 1 5\nr 5 6\nc 3 1\ng 1 1\ng 5 4\ng 2 2\ng 2 1\nr 4 5\ng 1 1\nr 3 2\ng 5 1\nr 2 3\nr 6 5\nr 4 2\ng 5 2\nr 1 3\nr 1 3\nc 5 1", "output": "609792\n543647\n194764\n270468\n609792\n678878\n536048" }, { "input": "2 1 3\n1\n2\nr 1 2\ng 1 1\ng 2 1", "output": "2\n1" }, { "input": "3 3 13\n1 2 3\n4 5 6\n7 8 9\nc 1 2\nc 2 3\nr 2 3\nr 1 2\ng 1 1\ng 1 2\ng 1 3\ng 2 1\ng 2 2\ng 2 3\ng 3 1\ng 3 2\ng 3 3", "output": "8\n9\n7\n2\n3\n1\n5\n6\n4" }, { "input": "1 3 7\n1 2 3\nc 1 2\nc 2 3\nc 1 3\nc 2 3\ng 1 1\ng 1 2\ng 1 3", "output": "1\n2\n3" }, { "input": "3 1 7\n1\n2\n3\nr 1 2\nr 2 3\nr 1 3\nr 2 3\ng 1 1\ng 2 1\ng 3 1", "output": "1\n2\n3" }, { "input": "5 6 20\n495907 68740 954868 197572 577456 641857\n16591 602443 981187 646143 137121 884307\n371452 725384 373988 59165 980490 837686\n514286 881540 886532 10541 684975 411009\n314261 127191 461802 89232 749116 563889\nr 2 1\nr 3 4\nc 3 4\nr 2 3\nc 6 3\nc 5 6\nc 4 1\nc 4 2\nr 2 4\nc 1 6\nr 5 3\nr 2 5\nr 4 2\ng 3 4\nc 2 5\nc 3 1\ng 3 6\ng 4 3\ng 2 3\nr 5 4", "output": "127191\n461802\n577456\n684975" } ]
1,381,232,722
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
8
92
0
n, m, k = map(int, input().split()) t = [list(map(int, input().split())) for i in range(n)] c = [0] + list(range(m)) r = [0] + list(range(m)) for i in range(k): s, x, y = input().split() x, y = int(x), int(y) if s == 'c': c[x], c[y] = c[y], c[x] elif s == 'r': r[x], r[y] = r[y], r[x] else: print(t[r[x]][c[y]])
Title: Cosmic Tables Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Free Meteor Association (FMA) has got a problem: as meteors are moving, the Universal Cosmic Descriptive Humorous Program (UCDHP) needs to add a special module that would analyze this movement. UCDHP stores some secret information about meteors as an *n*<=×<=*m* table with integers in its cells. The order of meteors in the Universe is changing. That's why the main UCDHP module receives the following queries: - The query to swap two table rows; - The query to swap two table columns; - The query to obtain a secret number in a particular table cell. As the main UCDHP module is critical, writing the functional of working with the table has been commissioned to you. Input Specification: The first line contains three space-separated integers *n*, *m* and *k* (1<=≤<=*n*,<=*m*<=≤<=1000, 1<=≤<=*k*<=≤<=500000) — the number of table columns and rows and the number of queries, correspondingly. Next *n* lines contain *m* space-separated numbers each — the initial state of the table. Each number *p* in the table is an integer and satisfies the inequality 0<=≤<=*p*<=≤<=106. Next *k* lines contain queries in the format "*s**i* *x**i* *y**i*", where *s**i* is one of the characters "с", "r" or "g", and *x**i*, *y**i* are two integers. - If *s**i* = "c", then the current query is the query to swap columns with indexes *x**i* and *y**i* (1<=≤<=*x*,<=*y*<=≤<=*m*,<=*x*<=≠<=*y*); - If *s**i* = "r", then the current query is the query to swap rows with indexes *x**i* and *y**i* (1<=≤<=*x*,<=*y*<=≤<=*n*,<=*x*<=≠<=*y*); - If *s**i* = "g", then the current query is the query to obtain the number that located in the *x**i*-th row and in the *y**i*-th column (1<=≤<=*x*<=≤<=*n*,<=1<=≤<=*y*<=≤<=*m*). The table rows are considered to be indexed from top to bottom from 1 to *n*, and the table columns — from left to right from 1 to *m*. Output Specification: For each query to obtain a number (*s**i* = "g") print the required number. Print the answers to the queries in the order of the queries in the input. Demo Input: ['3 3 5\n1 2 3\n4 5 6\n7 8 9\ng 3 2\nr 3 2\nc 2 3\ng 2 2\ng 3 2\n', '2 3 3\n1 2 4\n3 1 5\nc 2 1\nr 1 2\ng 1 3\n'] Demo Output: ['8\n9\n6\n', '5\n'] Note: Let's see how the table changes in the second test case. After the first operation is fulfilled, the table looks like that: 2 1 4 1 3 5 After the second operation is fulfilled, the table looks like that: 1 3 5 2 1 4 So the answer to the third query (the number located in the first row and in the third column) will be 5.
```python n, m, k = map(int, input().split()) t = [list(map(int, input().split())) for i in range(n)] c = [0] + list(range(m)) r = [0] + list(range(m)) for i in range(k): s, x, y = input().split() x, y = int(x), int(y) if s == 'c': c[x], c[y] = c[y], c[x] elif s == 'r': r[x], r[y] = r[y], r[x] else: print(t[r[x]][c[y]]) ```
-1
714
B
Filya and Homework
PROGRAMMING
1,200
[ "implementation", "sortings" ]
null
null
Today, hedgehog Filya went to school for the very first time! Teacher gave him a homework which Filya was unable to complete without your help. Filya is given an array of non-negative integers *a*1,<=*a*2,<=...,<=*a**n*. First, he pick an integer *x* and then he adds *x* to some elements of the array (no more than once), subtract *x* from some other elements (also, no more than once) and do no change other elements. He wants all elements of the array to be equal. Now he wonders if it's possible to pick such integer *x* and change some elements of the array using this *x* in order to make all elements equal.
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of integers in the Filya's array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — elements of the array.
If it's impossible to make all elements of the array equal using the process given in the problem statement, then print "NO" (without quotes) in the only line of the output. Otherwise print "YES" (without quotes).
[ "5\n1 3 3 2 1\n", "5\n1 2 3 4 5\n" ]
[ "YES\n", "NO\n" ]
In the first sample Filya should select *x* = 1, then add it to the first and the last elements of the array and subtract from the second and the third elements.
1,000
[ { "input": "5\n1 3 3 2 1", "output": "YES" }, { "input": "5\n1 2 3 4 5", "output": "NO" }, { "input": "2\n1 2", "output": "YES" }, { "input": "3\n1 2 3", "output": "YES" }, { "input": "3\n1 1 1", "output": "YES" }, { "input": "2\n1 1000000000", "output": "YES" }, { "input": "4\n1 2 3 4", "output": "NO" }, { "input": "10\n1 1 1 1 1 2 2 2 2 2", "output": "YES" }, { "input": "2\n4 2", "output": "YES" }, { "input": "4\n1 1 4 7", "output": "YES" }, { "input": "3\n99999999 1 50000000", "output": "YES" }, { "input": "1\n0", "output": "YES" }, { "input": "5\n0 0 0 0 0", "output": "YES" }, { "input": "4\n4 2 2 1", "output": "NO" }, { "input": "3\n1 4 2", "output": "NO" }, { "input": "3\n1 4 100", "output": "NO" }, { "input": "3\n2 5 11", "output": "NO" }, { "input": "3\n1 4 6", "output": "NO" }, { "input": "3\n1 2 4", "output": "NO" }, { "input": "3\n1 2 7", "output": "NO" }, { "input": "5\n1 1 1 4 5", "output": "NO" }, { "input": "2\n100000001 100000003", "output": "YES" }, { "input": "3\n7 4 5", "output": "NO" }, { "input": "3\n2 3 5", "output": "NO" }, { "input": "3\n1 2 5", "output": "NO" }, { "input": "2\n2 3", "output": "YES" }, { "input": "3\n2 100 29", "output": "NO" }, { "input": "3\n0 1 5", "output": "NO" }, { "input": "3\n1 3 6", "output": "NO" }, { "input": "3\n2 1 3", "output": "YES" }, { "input": "3\n1 5 100", "output": "NO" }, { "input": "3\n1 4 8", "output": "NO" }, { "input": "3\n1 7 10", "output": "NO" }, { "input": "3\n5 4 1", "output": "NO" }, { "input": "3\n1 6 10", "output": "NO" }, { "input": "4\n1 3 4 5", "output": "NO" }, { "input": "3\n1 5 4", "output": "NO" }, { "input": "5\n1 2 3 3 5", "output": "NO" }, { "input": "3\n2 3 1", "output": "YES" }, { "input": "3\n2 3 8", "output": "NO" }, { "input": "3\n0 3 5", "output": "NO" }, { "input": "3\n1 5 10", "output": "NO" }, { "input": "3\n1 7 2", "output": "NO" }, { "input": "3\n1 3 9", "output": "NO" }, { "input": "3\n1 1 2", "output": "YES" }, { "input": "7\n1 1 1 1 1 2 4", "output": "NO" }, { "input": "5\n1 4 4 4 6", "output": "NO" }, { "input": "5\n1 2 2 4 4", "output": "NO" }, { "input": "3\n1 9 10", "output": "NO" }, { "input": "8\n1 1 1 1 1 1 2 3", "output": "YES" }, { "input": "3\n1 2 100", "output": "NO" }, { "input": "3\n1 3 4", "output": "NO" }, { "input": "3\n1 15 14", "output": "NO" }, { "input": "3\n1 3 8", "output": "NO" }, { "input": "3\n1 2 10", "output": "NO" }, { "input": "4\n2 2 4 5", "output": "NO" }, { "input": "3\n1 3 5", "output": "YES" }, { "input": "5\n3 6 7 8 9", "output": "NO" }, { "input": "3\n7 6 8", "output": "YES" }, { "input": "3\n3 2 1", "output": "YES" }, { "input": "5\n1 2 2 2 3", "output": "YES" }, { "input": "3\n4 6 7", "output": "NO" }, { "input": "3\n2 0 4", "output": "YES" }, { "input": "4\n10 20 21 30", "output": "NO" }, { "input": "4\n0 2 3 4", "output": "NO" }, { "input": "3\n3 6 12", "output": "NO" }, { "input": "5\n0 0 1 3 5", "output": "NO" }, { "input": "3\n3 5 8", "output": "NO" }, { "input": "3\n1 4 4", "output": "YES" }, { "input": "4\n2 4 5 6", "output": "NO" } ]
1,595,669,648
2,147,483,647
Python 3
OK
TESTS
79
140
16,076,800
a=int(input()) b=list(set(map(int,input().split()))) b.sort() if(len(b)<=2): print('yes') else: if(b[2]-b[1]==b[1]-b[0] and len(b)==3): print('yes') else: print('no')
Title: Filya and Homework Time Limit: None seconds Memory Limit: None megabytes Problem Description: Today, hedgehog Filya went to school for the very first time! Teacher gave him a homework which Filya was unable to complete without your help. Filya is given an array of non-negative integers *a*1,<=*a*2,<=...,<=*a**n*. First, he pick an integer *x* and then he adds *x* to some elements of the array (no more than once), subtract *x* from some other elements (also, no more than once) and do no change other elements. He wants all elements of the array to be equal. Now he wonders if it's possible to pick such integer *x* and change some elements of the array using this *x* in order to make all elements equal. Input Specification: The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of integers in the Filya's array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — elements of the array. Output Specification: If it's impossible to make all elements of the array equal using the process given in the problem statement, then print "NO" (without quotes) in the only line of the output. Otherwise print "YES" (without quotes). Demo Input: ['5\n1 3 3 2 1\n', '5\n1 2 3 4 5\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample Filya should select *x* = 1, then add it to the first and the last elements of the array and subtract from the second and the third elements.
```python a=int(input()) b=list(set(map(int,input().split()))) b.sort() if(len(b)<=2): print('yes') else: if(b[2]-b[1]==b[1]-b[0] and len(b)==3): print('yes') else: print('no') ```
3
895
A
Pizza Separation
PROGRAMMING
1,200
[ "brute force", "implementation" ]
null
null
Students Vasya and Petya are studying at the BSU (Byteland State University). At one of the breaks they decided to order a pizza. In this problem pizza is a circle of some radius. The pizza was delivered already cut into *n* pieces. The *i*-th piece is a sector of angle equal to *a**i*. Vasya and Petya want to divide all pieces of pizza into two continuous sectors in such way that the difference between angles of these sectors is minimal. Sector angle is sum of angles of all pieces in it. Pay attention, that one of sectors can be empty.
The first line contains one integer *n* (1<=≤<=*n*<=≤<=360)  — the number of pieces into which the delivered pizza was cut. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=360)  — the angles of the sectors into which the pizza was cut. The sum of all *a**i* is 360.
Print one integer  — the minimal difference between angles of sectors that will go to Vasya and Petya.
[ "4\n90 90 90 90\n", "3\n100 100 160\n", "1\n360\n", "4\n170 30 150 10\n" ]
[ "0\n", "40\n", "360\n", "0\n" ]
In first sample Vasya can take 1 and 2 pieces, Petya can take 3 and 4 pieces. Then the answer is |(90 + 90) - (90 + 90)| = 0. In third sample there is only one piece of pizza that can be taken by only one from Vasya and Petya. So the answer is |360 - 0| = 360. In fourth sample Vasya can take 1 and 4 pieces, then Petya will take 2 and 3 pieces. So the answer is |(170 + 10) - (30 + 150)| = 0. Picture explaning fourth sample: <img class="tex-graphics" src="https://espresso.codeforces.com/4bb3450aca241f92fedcba5479bf1b6d22cf813d.png" style="max-width: 100.0%;max-height: 100.0%;"/> Both red and green sectors consist of two adjacent pieces of pizza. So Vasya can take green sector, then Petya will take red sector.
500
[ { "input": "4\n90 90 90 90", "output": "0" }, { "input": "3\n100 100 160", "output": "40" }, { "input": "1\n360", "output": "360" }, { "input": "4\n170 30 150 10", "output": "0" }, { "input": "5\n10 10 10 10 320", "output": "280" }, { "input": "8\n45 45 45 45 45 45 45 45", "output": "0" }, { "input": "3\n120 120 120", "output": "120" }, { "input": "5\n110 90 70 50 40", "output": "40" }, { "input": "2\n170 190", "output": "20" }, { "input": "15\n25 25 25 25 25 25 25 25 25 25 25 25 25 25 10", "output": "10" }, { "input": "5\n30 60 180 60 30", "output": "0" }, { "input": "2\n359 1", "output": "358" }, { "input": "5\n100 100 30 100 30", "output": "40" }, { "input": "5\n36 34 35 11 244", "output": "128" }, { "input": "5\n96 94 95 71 4", "output": "18" }, { "input": "2\n85 275", "output": "190" }, { "input": "3\n281 67 12", "output": "202" }, { "input": "5\n211 113 25 9 2", "output": "62" }, { "input": "13\n286 58 6 1 1 1 1 1 1 1 1 1 1", "output": "212" }, { "input": "15\n172 69 41 67 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "20\n226 96 2 20 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "92" }, { "input": "50\n148 53 32 11 4 56 8 2 5 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "3\n1 1 358", "output": "356" }, { "input": "20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 341", "output": "322" }, { "input": "33\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 328", "output": "296" }, { "input": "70\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 291", "output": "222" }, { "input": "130\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 231", "output": "102" }, { "input": "200\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 161", "output": "0" }, { "input": "222\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 139", "output": "0" }, { "input": "10\n8 3 11 4 1 10 10 1 8 304", "output": "248" }, { "input": "12\n8 7 7 3 11 2 10 1 10 8 10 283", "output": "206" }, { "input": "13\n10 8 9 10 5 9 4 1 10 11 1 7 275", "output": "190" }, { "input": "14\n1 6 3 11 9 5 9 8 5 6 7 3 7 280", "output": "200" }, { "input": "15\n10 11 5 4 11 5 4 1 5 4 5 5 9 6 275", "output": "190" }, { "input": "30\n8 7 5 8 3 7 2 4 3 8 11 3 9 11 2 4 1 4 5 6 11 5 8 3 6 3 11 2 11 189", "output": "18" }, { "input": "70\n5 3 6 8 9 2 8 9 11 5 2 8 9 11 7 6 6 9 7 11 7 6 3 8 2 4 4 8 4 3 2 2 3 5 6 5 11 2 7 7 5 8 10 5 2 1 10 9 4 10 7 1 8 10 9 1 5 1 1 1 2 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "29\n2 10 1 5 7 2 9 11 9 9 10 8 4 11 2 5 4 1 4 9 6 10 8 3 1 3 8 9 189", "output": "18" }, { "input": "35\n3 4 11 4 4 2 3 4 3 9 7 10 2 7 8 3 11 3 6 4 6 7 11 10 8 7 6 7 2 8 5 3 2 2 168", "output": "0" }, { "input": "60\n4 10 3 10 6 3 11 8 11 9 3 5 9 2 6 5 6 9 4 10 1 1 3 7 2 10 5 5 3 10 5 2 1 2 9 11 11 9 11 4 11 7 5 6 10 9 3 4 7 8 7 3 6 7 8 5 1 1 1 5", "output": "0" }, { "input": "71\n3 11 8 1 10 1 7 9 6 4 11 10 11 2 4 1 11 7 9 10 11 4 8 7 11 3 8 4 1 8 4 2 9 9 7 10 10 9 5 7 9 7 2 1 7 6 5 11 5 9 4 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "63\n2 11 5 8 7 9 9 8 10 5 9 10 11 8 10 2 3 5 3 7 5 10 2 9 4 8 1 8 5 9 7 7 1 8 7 7 9 10 10 10 8 7 7 2 2 8 9 7 10 8 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "81\n5 8 7 11 2 7 1 1 5 8 7 2 3 11 4 9 7 6 4 4 2 1 1 7 9 4 1 8 3 1 4 10 7 9 9 8 11 3 4 3 10 8 6 4 7 2 4 3 6 11 11 10 7 10 2 10 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "47\n5 3 7 4 2 7 8 1 9 10 5 11 10 7 7 5 1 3 2 11 3 8 6 1 6 10 8 3 2 10 5 6 8 6 9 7 10 9 7 4 8 11 10 1 5 11 68", "output": "0" }, { "input": "100\n5 8 9 3 2 3 9 8 11 10 4 8 1 1 1 1 6 5 10 9 5 3 7 7 2 11 10 2 3 2 2 8 7 3 5 5 10 9 2 5 10 6 7 7 4 7 7 8 2 8 9 9 2 4 1 1 3 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "120\n9 11 3 7 3 7 9 1 10 7 11 4 1 5 3 5 6 3 1 11 8 8 11 7 3 5 1 9 1 7 10 10 10 10 9 5 4 8 2 8 2 1 4 5 3 11 3 5 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "200\n7 7 9 8 2 8 5 8 3 9 7 10 2 9 11 8 11 7 5 2 6 3 11 9 5 1 10 2 1 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "220\n3 2 8 1 3 5 5 11 1 5 2 6 9 2 2 6 8 10 7 1 3 2 10 9 10 10 4 10 9 5 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "6\n27 15 28 34 41 215", "output": "70" }, { "input": "7\n41 38 41 31 22 41 146", "output": "14" }, { "input": "8\n24 27 34 23 29 23 30 170", "output": "20" }, { "input": "9\n11 11 20 20 33 32 35 26 172", "output": "6" }, { "input": "10\n36 13 28 13 33 34 23 25 34 121", "output": "0" }, { "input": "11\n19 37 13 41 37 15 32 12 19 35 100", "output": "10" }, { "input": "12\n37 25 34 38 21 24 34 38 11 29 28 41", "output": "2" }, { "input": "13\n24 40 20 26 25 29 39 29 35 28 19 18 28", "output": "2" }, { "input": "14\n11 21 40 19 28 34 13 16 23 30 34 22 25 44", "output": "4" }, { "input": "3\n95 91 174", "output": "12" }, { "input": "4\n82 75 78 125", "output": "46" }, { "input": "6\n87 75 88 94 15 1", "output": "4" }, { "input": "10\n27 52 58 64 45 64 1 19 2 28", "output": "12" }, { "input": "50\n14 12 11 8 1 6 11 6 7 8 4 11 4 5 7 3 5 4 7 24 10 2 3 4 6 13 2 1 8 7 5 13 10 8 5 20 1 2 23 7 14 3 4 4 2 8 8 2 6 1", "output": "0" }, { "input": "100\n3 3 4 3 3 6 3 2 8 2 13 3 1 1 2 1 3 4 1 7 1 2 2 6 3 2 10 3 1 2 5 6 2 3 3 2 3 11 8 3 2 6 1 3 3 4 7 7 2 2 1 2 6 3 3 2 3 1 3 8 2 6 4 2 1 12 2 2 2 1 4 1 4 1 3 1 3 1 5 2 6 6 7 1 2 3 2 4 4 2 5 9 8 2 4 6 5 1 1 3", "output": "0" }, { "input": "150\n1 5 1 2 2 2 1 4 2 2 2 3 1 2 1 2 2 2 2 1 2 2 2 1 5 3 4 1 3 4 5 2 4 2 1 2 2 1 1 2 3 2 4 2 2 3 3 1 1 5 2 3 2 1 9 2 1 1 2 1 4 1 1 3 2 2 2 1 2 2 2 1 3 3 4 2 2 1 3 3 3 1 4 3 4 1 2 2 1 1 1 2 2 5 4 1 1 1 2 1 2 3 2 2 6 3 3 3 1 2 1 1 2 8 2 2 4 3 4 5 3 1 4 2 2 2 2 1 4 4 1 1 2 2 4 9 6 3 1 1 2 1 3 4 1 3 2 2 2 1", "output": "0" }, { "input": "200\n1 2 1 3 1 3 1 2 1 4 6 1 2 2 2 2 1 1 1 1 3 2 1 2 2 2 1 2 2 2 2 1 1 1 3 2 3 1 1 2 1 1 2 1 1 1 1 1 1 2 1 2 2 4 1 3 1 2 1 2 2 1 2 1 3 1 1 2 2 1 1 1 1 2 4 1 2 1 1 1 2 1 3 1 1 3 1 2 2 4 1 1 2 1 2 1 2 2 2 2 1 1 2 1 2 1 3 3 1 1 1 2 1 3 3 1 2 1 3 1 3 3 1 2 2 1 4 1 2 2 1 2 2 4 2 5 1 2 2 1 2 1 2 1 5 2 1 2 2 1 2 4 1 2 2 4 2 3 2 3 1 2 1 1 2 2 2 1 1 2 1 4 1 2 1 1 2 1 2 3 1 1 1 2 2 3 1 3 2 2 3 1 2 1 2 1 1 2 1 2", "output": "0" }, { "input": "5\n35 80 45 100 100", "output": "40" }, { "input": "4\n90 179 90 1", "output": "2" }, { "input": "5\n50 50 20 160 80", "output": "0" }, { "input": "5\n30 175 30 5 120", "output": "10" }, { "input": "4\n170 30 10 150", "output": "20" }, { "input": "6\n90 30 90 30 90 30", "output": "60" }, { "input": "4\n70 80 110 100", "output": "20" }, { "input": "7\n35 45 70 100 10 10 90", "output": "0" }, { "input": "6\n50 90 10 90 20 100", "output": "20" }, { "input": "6\n10 155 162 1 26 6", "output": "18" }, { "input": "7\n80 90 80 45 10 10 45", "output": "20" }, { "input": "4\n18 36 162 144", "output": "36" }, { "input": "5\n20 50 50 160 80", "output": "40" }, { "input": "5\n10 30 140 20 160", "output": "0" }, { "input": "6\n90 80 60 50 40 40", "output": "20" }, { "input": "9\n40 20 20 20 20 20 20 40 160", "output": "40" }, { "input": "4\n90 54 90 126", "output": "72" }, { "input": "4\n150 170 30 10", "output": "20" }, { "input": "8\n130 12 13 85 41 67 5 7", "output": "26" }, { "input": "7\n70 170 20 10 30 30 30", "output": "20" }, { "input": "8\n100 100 50 50 15 15 15 15", "output": "40" }, { "input": "4\n100 70 80 110", "output": "20" }, { "input": "5\n160 130 40 20 10", "output": "20" }, { "input": "4\n20 149 151 40", "output": "22" }, { "input": "4\n100 10 100 150", "output": "60" }, { "input": "6\n19 64 105 168 1 3", "output": "16" }, { "input": "8\n10 10 70 70 90 90 10 10", "output": "0" } ]
1,511,793,427
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
61
5,529,600
minnum = int(1000) num = input() nums = input().split(' ', maxsplit = int(num) - 1) def findsmalldistance (index, arr): leftnum = 0 rightnum = 0 global minnum for i in range(len(arr)): for j in range(index-i, index): if index - j < 0: leftnum = leftnum + int(arr[len(arr) + index - j]) else: leftnum = leftnum + int(arr[j]) for j in range(index + 1, index + (len(arr) -i) - 1): if index + j > len(arr): rightnum = rightnum + int(arr[j+index-len(arr)-1]) else: rightnum = rightnum + int(arr[j]) if abs(rightnum-leftnum) < minnum: minnum = abs(rightnum-leftnum) for index in range(len(nums)): findsmalldistance(index, nums) print(minnum)
Title: Pizza Separation Time Limit: None seconds Memory Limit: None megabytes Problem Description: Students Vasya and Petya are studying at the BSU (Byteland State University). At one of the breaks they decided to order a pizza. In this problem pizza is a circle of some radius. The pizza was delivered already cut into *n* pieces. The *i*-th piece is a sector of angle equal to *a**i*. Vasya and Petya want to divide all pieces of pizza into two continuous sectors in such way that the difference between angles of these sectors is minimal. Sector angle is sum of angles of all pieces in it. Pay attention, that one of sectors can be empty. Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=360)  — the number of pieces into which the delivered pizza was cut. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=360)  — the angles of the sectors into which the pizza was cut. The sum of all *a**i* is 360. Output Specification: Print one integer  — the minimal difference between angles of sectors that will go to Vasya and Petya. Demo Input: ['4\n90 90 90 90\n', '3\n100 100 160\n', '1\n360\n', '4\n170 30 150 10\n'] Demo Output: ['0\n', '40\n', '360\n', '0\n'] Note: In first sample Vasya can take 1 and 2 pieces, Petya can take 3 and 4 pieces. Then the answer is |(90 + 90) - (90 + 90)| = 0. In third sample there is only one piece of pizza that can be taken by only one from Vasya and Petya. So the answer is |360 - 0| = 360. In fourth sample Vasya can take 1 and 4 pieces, then Petya will take 2 and 3 pieces. So the answer is |(170 + 10) - (30 + 150)| = 0. Picture explaning fourth sample: <img class="tex-graphics" src="https://espresso.codeforces.com/4bb3450aca241f92fedcba5479bf1b6d22cf813d.png" style="max-width: 100.0%;max-height: 100.0%;"/> Both red and green sectors consist of two adjacent pieces of pizza. So Vasya can take green sector, then Petya will take red sector.
```python minnum = int(1000) num = input() nums = input().split(' ', maxsplit = int(num) - 1) def findsmalldistance (index, arr): leftnum = 0 rightnum = 0 global minnum for i in range(len(arr)): for j in range(index-i, index): if index - j < 0: leftnum = leftnum + int(arr[len(arr) + index - j]) else: leftnum = leftnum + int(arr[j]) for j in range(index + 1, index + (len(arr) -i) - 1): if index + j > len(arr): rightnum = rightnum + int(arr[j+index-len(arr)-1]) else: rightnum = rightnum + int(arr[j]) if abs(rightnum-leftnum) < minnum: minnum = abs(rightnum-leftnum) for index in range(len(nums)): findsmalldistance(index, nums) print(minnum) ```
0
224
A
Parallelepiped
PROGRAMMING
1,100
[ "brute force", "geometry", "math" ]
null
null
You've got a rectangular parallelepiped with integer edge lengths. You know the areas of its three faces that have a common vertex. Your task is to find the sum of lengths of all 12 edges of this parallelepiped.
The first and the single line contains three space-separated integers — the areas of the parallelepiped's faces. The area's values are positive (<=&gt;<=0) and do not exceed 104. It is guaranteed that there exists at least one parallelepiped that satisfies the problem statement.
Print a single number — the sum of all edges of the parallelepiped.
[ "1 1 1\n", "4 6 6\n" ]
[ "12\n", "28\n" ]
In the first sample the parallelepiped has sizes 1 × 1 × 1, in the second one — 2 × 2 × 3.
500
[ { "input": "1 1 1", "output": "12" }, { "input": "4 6 6", "output": "28" }, { "input": "20 10 50", "output": "68" }, { "input": "9 4 36", "output": "56" }, { "input": "324 9 36", "output": "184" }, { "input": "1333 93 129", "output": "308" }, { "input": "1022 584 112", "output": "380" }, { "input": "66 174 319", "output": "184" }, { "input": "912 276 1748", "output": "444" }, { "input": "65 156 60", "output": "120" }, { "input": "1 10000 10000", "output": "40008" }, { "input": "1485 55 27", "output": "332" }, { "input": "152 108 4104", "output": "528" }, { "input": "1656 6900 1350", "output": "740" }, { "input": "12 14 42", "output": "60" }, { "input": "615 18 1230", "output": "856" }, { "input": "680 60 408", "output": "336" }, { "input": "644 966 6", "output": "1308" }, { "input": "1 432 432", "output": "1736" }, { "input": "2239 2239 1", "output": "8964" }, { "input": "4106 8212 2", "output": "16436" }, { "input": "10000 10000 10000", "output": "1200" }, { "input": "3623 3623 1", "output": "14500" }, { "input": "9801 9801 9801", "output": "1188" }, { "input": "10000 1 10000", "output": "40008" }, { "input": "9 9 9", "output": "36" }, { "input": "9801 9702 9702", "output": "1184" } ]
1,627,149,926
2,147,483,647
PyPy 3
OK
TESTS
27
218
20,172,800
ab,bc,ac = [int(i) for i in input().split()] c = ((ac/ab)*bc)**0.5 b = ab/ac*c a = ab/b print(round(4*a+4*b+4*c))
Title: Parallelepiped Time Limit: None seconds Memory Limit: None megabytes Problem Description: You've got a rectangular parallelepiped with integer edge lengths. You know the areas of its three faces that have a common vertex. Your task is to find the sum of lengths of all 12 edges of this parallelepiped. Input Specification: The first and the single line contains three space-separated integers — the areas of the parallelepiped's faces. The area's values are positive (<=&gt;<=0) and do not exceed 104. It is guaranteed that there exists at least one parallelepiped that satisfies the problem statement. Output Specification: Print a single number — the sum of all edges of the parallelepiped. Demo Input: ['1 1 1\n', '4 6 6\n'] Demo Output: ['12\n', '28\n'] Note: In the first sample the parallelepiped has sizes 1 × 1 × 1, in the second one — 2 × 2 × 3.
```python ab,bc,ac = [int(i) for i in input().split()] c = ((ac/ab)*bc)**0.5 b = ab/ac*c a = ab/b print(round(4*a+4*b+4*c)) ```
3
770
A
New Password
PROGRAMMING
800
[ "*special", "implementation" ]
null
null
Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help. Innokentiy decides that new password should satisfy the following conditions: - the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct. Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions.
The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it. Pay attention that a desired new password always exists.
Print any password which satisfies all conditions given by Innokentiy.
[ "4 3\n", "6 6\n", "5 2\n" ]
[ "java\n", "python\n", "phphp\n" ]
In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it. In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters. In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it. Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests.
500
[ { "input": "4 3", "output": "abca" }, { "input": "6 6", "output": "abcdef" }, { "input": "5 2", "output": "ababa" }, { "input": "3 2", "output": "aba" }, { "input": "10 2", "output": "ababababab" }, { "input": "26 13", "output": "abcdefghijklmabcdefghijklm" }, { "input": "100 2", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababab" }, { "input": "100 10", "output": "abcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij" }, { "input": "3 3", "output": "abc" }, { "input": "6 3", "output": "abcabc" }, { "input": "10 3", "output": "abcabcabca" }, { "input": "50 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab" }, { "input": "90 2", "output": "ababababababababababababababababababababababababababababababababababababababababababababab" }, { "input": "6 2", "output": "ababab" }, { "input": "99 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabc" }, { "input": "4 2", "output": "abab" }, { "input": "100 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca" }, { "input": "40 22", "output": "abcdefghijklmnopqrstuvabcdefghijklmnopqr" }, { "input": "13 8", "output": "abcdefghabcde" }, { "input": "16 15", "output": "abcdefghijklmnoa" }, { "input": "17 17", "output": "abcdefghijklmnopq" }, { "input": "19 4", "output": "abcdabcdabcdabcdabc" }, { "input": "100 26", "output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv" }, { "input": "100 25", "output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxy" }, { "input": "26 26", "output": "abcdefghijklmnopqrstuvwxyz" }, { "input": "27 26", "output": "abcdefghijklmnopqrstuvwxyza" }, { "input": "2 2", "output": "ab" }, { "input": "26 25", "output": "abcdefghijklmnopqrstuvwxya" }, { "input": "99 2", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababa" }, { "input": "99 26", "output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstu" }, { "input": "4 4", "output": "abcd" }, { "input": "5 3", "output": "abcab" }, { "input": "5 4", "output": "abcda" }, { "input": "5 5", "output": "abcde" }, { "input": "24 22", "output": "abcdefghijklmnopqrstuvab" }, { "input": "26 14", "output": "abcdefghijklmnabcdefghijkl" }, { "input": "26 15", "output": "abcdefghijklmnoabcdefghijk" }, { "input": "30 12", "output": "abcdefghijklabcdefghijklabcdef" }, { "input": "35 4", "output": "abcdabcdabcdabcdabcdabcdabcdabcdabc" }, { "input": "79 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca" }, { "input": "79 14", "output": "abcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghi" }, { "input": "85 13", "output": "abcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefg" }, { "input": "90 25", "output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmno" }, { "input": "90 19", "output": "abcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmn" }, { "input": "26 24", "output": "abcdefghijklmnopqrstuvwxab" }, { "input": "100 17", "output": "abcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmno" }, { "input": "26 2", "output": "ababababababababababababab" } ]
1,655,650,508
2,147,483,647
Python 3
OK
TESTS
47
61
0
import random n,k=map(int,input().split()) password=[] while len(password)!=k: a=chr(random.randint(97,122)) if a not in password: password.append(a) while len(password)!=n: a = chr(random.randint(97, 122)) if password[-1]!=a and a in password: password.append(a) print(''.join(password))
Title: New Password Time Limit: None seconds Memory Limit: None megabytes Problem Description: Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help. Innokentiy decides that new password should satisfy the following conditions: - the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct. Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions. Input Specification: The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it. Pay attention that a desired new password always exists. Output Specification: Print any password which satisfies all conditions given by Innokentiy. Demo Input: ['4 3\n', '6 6\n', '5 2\n'] Demo Output: ['java\n', 'python\n', 'phphp\n'] Note: In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it. In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters. In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it. Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests.
```python import random n,k=map(int,input().split()) password=[] while len(password)!=k: a=chr(random.randint(97,122)) if a not in password: password.append(a) while len(password)!=n: a = chr(random.randint(97, 122)) if password[-1]!=a and a in password: password.append(a) print(''.join(password)) ```
3
236
A
Boy or Girl
PROGRAMMING
800
[ "brute force", "implementation", "strings" ]
null
null
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network. But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names. This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
[ "wjmzbmr\n", "xiaodao\n", "sevenkplus\n" ]
[ "CHAT WITH HER!\n", "IGNORE HIM!\n", "CHAT WITH HER!\n" ]
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
500
[ { "input": "wjmzbmr", "output": "CHAT WITH HER!" }, { "input": "xiaodao", "output": "IGNORE HIM!" }, { "input": "sevenkplus", "output": "CHAT WITH HER!" }, { "input": "pezu", "output": "CHAT WITH HER!" }, { "input": "wnemlgppy", "output": "CHAT WITH HER!" }, { "input": "zcinitufxoldnokacdvtmdohsfdjepyfioyvclhmujiqwvmudbfjzxjfqqxjmoiyxrfsbvseawwoyynn", "output": "IGNORE HIM!" }, { "input": "qsxxuoynwtebujwpxwpajitiwxaxwgbcylxneqiebzfphugwkftpaikixmumkhfbjiswmvzbtiyifbx", "output": "CHAT WITH HER!" }, { "input": "qwbdfzfylckctudyjlyrtmvbidfatdoqfmrfshsqqmhzohhsczscvwzpwyoyswhktjlykumhvaounpzwpxcspxwlgt", "output": "IGNORE HIM!" }, { "input": "nuezoadauueermoeaabjrkxttkatspjsjegjcjcdmcxgodowzbwuqncfbeqlhkk", "output": "IGNORE HIM!" }, { "input": "lggvdmulrsvtuagoavstuyufhypdxfomjlzpnduulukszqnnwfvxbvxyzmleocmofwclmzz", "output": "IGNORE HIM!" }, { "input": "tgcdptnkc", "output": "IGNORE HIM!" }, { "input": "wvfgnfrzabgibzxhzsojskmnlmrokydjoexnvi", "output": "IGNORE HIM!" }, { "input": "sxtburpzskucowowebgrbovhadrrayamuwypmmxhscrujkmcgvyinp", "output": "IGNORE HIM!" }, { "input": "pjqxhvxkyeqqvyuujxhmbspatvrckhhkfloottuybjivkkhpyivcighxumavrxzxslfpggnwbtalmhysyfllznphzia", "output": "IGNORE HIM!" }, { "input": "fpellxwskyekoyvrfnuf", "output": "CHAT WITH HER!" }, { "input": "xninyvkuvakfbs", "output": "IGNORE HIM!" }, { "input": "vnxhrweyvhqufpfywdwftoyrfgrhxuamqhblkvdpxmgvphcbeeqbqssresjifwyzgfhurmamhkwupymuomak", "output": "CHAT WITH HER!" }, { "input": "kmsk", "output": "IGNORE HIM!" }, { "input": "lqonogasrkzhryjxppjyriyfxmdfubieglthyswz", "output": "CHAT WITH HER!" }, { "input": "ndormkufcrkxlihdhmcehzoimcfhqsmombnfjrlcalffq", "output": "CHAT WITH HER!" }, { "input": "zqzlnnuwcfufwujygtczfakhcpqbtxtejrbgoodychepzdphdahtxyfpmlrycyicqthsgm", "output": "IGNORE HIM!" }, { "input": "ppcpbnhwoizajrl", "output": "IGNORE HIM!" }, { "input": "sgubujztzwkzvztitssxxxwzanfmddfqvv", "output": "CHAT WITH HER!" }, { "input": "ptkyaxycecpbrjnvxcjtbqiocqcswnmicxbvhdsptbxyxswbw", "output": "IGNORE HIM!" }, { "input": "yhbtzfppwcycxqjpqdfmjnhwaogyuaxamwxpnrdrnqsgdyfvxu", "output": "CHAT WITH HER!" }, { "input": "ojjvpnkrxibyevxk", "output": "CHAT WITH HER!" }, { "input": "wjweqcrqfuollfvfbiyriijovweg", "output": "IGNORE HIM!" }, { "input": "hkdbykboclchfdsuovvpknwqr", "output": "IGNORE HIM!" }, { "input": "stjvyfrfowopwfjdveduedqylerqugykyu", "output": "IGNORE HIM!" }, { "input": "rafcaanqytfclvfdegak", "output": "CHAT WITH HER!" }, { "input": "xczn", "output": "CHAT WITH HER!" }, { "input": "arcoaeozyeawbveoxpmafxxzdjldsielp", "output": "IGNORE HIM!" }, { "input": "smdfafbyehdylhaleevhoggiurdgeleaxkeqdixyfztkuqsculgslheqfafxyghyuibdgiuwrdxfcitojxika", "output": "CHAT WITH HER!" }, { "input": "vbpfgjqnhfazmvtkpjrdasfhsuxnpiepxfrzvoh", "output": "CHAT WITH HER!" }, { "input": "dbdokywnpqnotfrhdbrzmuyoxfdtrgrzcccninbtmoqvxfatcqg", "output": "CHAT WITH HER!" }, { "input": "udlpagtpq", "output": "CHAT WITH HER!" }, { "input": "zjurevbytijifnpfuyswfchdzelxheboruwjqijxcucylysmwtiqsqqhktexcynquvcwhbjsipy", "output": "CHAT WITH HER!" }, { "input": "qagzrqjomdwhagkhrjahhxkieijyten", "output": "CHAT WITH HER!" }, { "input": "achhcfjnnfwgoufxamcqrsontgjjhgyfzuhklkmiwybnrlsvblnsrjqdytglipxsulpnphpjpoewvlusalsgovwnsngb", "output": "CHAT WITH HER!" }, { "input": "qbkjsdwpahdbbohggbclfcufqelnojoehsxxkr", "output": "CHAT WITH HER!" }, { "input": "cpvftiwgyvnlmbkadiafddpgfpvhqqvuehkypqjsoibpiudfvpkhzlfrykc", "output": "IGNORE HIM!" }, { "input": "lnpdosnceumubvk", "output": "IGNORE HIM!" }, { "input": "efrk", "output": "CHAT WITH HER!" }, { "input": "temnownneghnrujforif", "output": "IGNORE HIM!" }, { "input": "ottnneymszwbumgobazfjyxewkjakglbfflsajuzescplpcxqta", "output": "IGNORE HIM!" }, { "input": "eswpaclodzcwhgixhpyzvhdwsgneqidanbzdzszquefh", "output": "IGNORE HIM!" }, { "input": "gwntwbpj", "output": "IGNORE HIM!" }, { "input": "wuqvlbblkddeindiiswsinkfrnkxghhwunzmmvyovpqapdfbolyim", "output": "IGNORE HIM!" }, { "input": "swdqsnzmzmsyvktukaoyqsqzgfmbzhezbfaqeywgwizrwjyzquaahucjchegknqaioliqd", "output": "CHAT WITH HER!" }, { "input": "vlhrpzezawyolhbmvxbwhtjustdbqggexmzxyieihjlelvwjosmkwesfjmramsikhkupzvfgezmrqzudjcalpjacmhykhgfhrjx", "output": "IGNORE HIM!" }, { "input": "lxxwbkrjgnqjwsnflfnsdyxihmlspgivirazsbveztnkuzpaxtygidniflyjheejelnjyjvgkgvdqks", "output": "CHAT WITH HER!" }, { "input": "wpxbxzfhtdecetpljcrvpjjnllosdqirnkzesiqeukbedkayqx", "output": "CHAT WITH HER!" }, { "input": "vmzxgacicvweclaodrunmjnfwtimceetsaoickarqyrkdghcmyjgmtgsqastcktyrjgvjqimdc", "output": "CHAT WITH HER!" }, { "input": "yzlzmesxdttfcztooypjztlgxwcr", "output": "IGNORE HIM!" }, { "input": "qpbjwzwgdzmeluheirjrvzrhbmagfsjdgvzgwumjtjzecsfkrfqjasssrhhtgdqqfydlmrktlgfc", "output": "IGNORE HIM!" }, { "input": "aqzftsvezdgouyrirsxpbuvdjupnzvbhguyayeqozfzymfnepvwgblqzvmxxkxcilmsjvcgyqykpoaktjvsxbygfgsalbjoq", "output": "CHAT WITH HER!" }, { "input": "znicjjgijhrbdlnwmtjgtdgziollrfxroabfhadygnomodaembllreorlyhnehijfyjbfxucazellblegyfrzuraogadj", "output": "IGNORE HIM!" }, { "input": "qordzrdiknsympdrkgapjxokbldorpnmnpucmwakklmqenpmkom", "output": "CHAT WITH HER!" }, { "input": "wqfldgihuxfktzanyycluzhtewmwvnawqlfoavuguhygqrrxtstxwouuzzsryjqtfqo", "output": "CHAT WITH HER!" }, { "input": "vujtrrpshinkskgyknlcfckmqdrwtklkzlyipmetjvaqxdsslkskschbalmdhzsdrrjmxdltbtnxbh", "output": "IGNORE HIM!" }, { "input": "zioixjibuhrzyrbzqcdjbbhhdmpgmqykixcxoqupggaqajuzonrpzihbsogjfsrrypbiphehonyhohsbybnnukqebopppa", "output": "CHAT WITH HER!" }, { "input": "oh", "output": "CHAT WITH HER!" }, { "input": "kxqthadqesbpgpsvpbcbznxpecqrzjoilpauttzlnxvaczcqwuri", "output": "IGNORE HIM!" }, { "input": "zwlunigqnhrwirkvufqwrnwcnkqqonebrwzcshcbqqwkjxhymjjeakuzjettebciadjlkbfp", "output": "CHAT WITH HER!" }, { "input": "fjuldpuejgmggvvigkwdyzytfxzwdlofrpifqpdnhfyroginqaufwgjcbgshyyruwhofctsdaisqpjxqjmtpp", "output": "CHAT WITH HER!" }, { "input": "xiwntnheuitbtqxrmzvxmieldudakogealwrpygbxsbluhsqhtwmdlpjwzyafckrqrdduonkgo", "output": "CHAT WITH HER!" }, { "input": "mnmbupgo", "output": "IGNORE HIM!" }, { "input": "mcjehdiygkbmrbfjqwpwxidbdfelifwhstaxdapigbymmsgrhnzsdjhsqchl", "output": "IGNORE HIM!" }, { "input": "yocxrzspinchmhtmqo", "output": "CHAT WITH HER!" }, { "input": "vasvvnpymtgjirnzuynluluvmgpquskuaafwogeztfnvybblajvuuvfomtifeuzpikjrolzeeoftv", "output": "CHAT WITH HER!" }, { "input": "ecsdicrznvglwggrdbrvehwzaenzjutjydhvimtqegweurpxtjkmpcznshtrvotkvrghxhacjkedidqqzrduzad", "output": "IGNORE HIM!" }, { "input": "ubvhyaebyxoghakajqrpqpctwbrfqzli", "output": "CHAT WITH HER!" }, { "input": "gogbxfeqylxoummvgxpkoqzsmobasesxbqjjktqbwqxeiaagnnhbvepbpy", "output": "IGNORE HIM!" }, { "input": "nheihhxkbbrmlpxpxbhnpofcjmxemyvqqdbanwd", "output": "IGNORE HIM!" }, { "input": "acrzbavz", "output": "CHAT WITH HER!" }, { "input": "drvzznznvrzskftnrhvvzxcalwutxmdza", "output": "IGNORE HIM!" }, { "input": "oacwxipdfcoabhkwxqdbtowiekpnflnqhlrkustgzryvws", "output": "CHAT WITH HER!" }, { "input": "tpnwfmfsibnccvdwjvzviyvjfljupinfigfunyff", "output": "CHAT WITH HER!" }, { "input": "gavaihhamfolcndgytcsgucqdqngxkrlovpthvteacmmthoglxu", "output": "CHAT WITH HER!" }, { "input": "hsfcfvameeupldgvchmogrvwxrvsmnwxxkxoawwodtsahqvehlcw", "output": "IGNORE HIM!" }, { "input": "sbkydrscoojychxchqsuciperfroumenelgiyiwlqfwximrgdbyvkmacy", "output": "CHAT WITH HER!" }, { "input": "rhh", "output": "CHAT WITH HER!" }, { "input": "zhdouqfmlkenjzdijxdfxnlegxeuvhelo", "output": "IGNORE HIM!" }, { "input": "yufkkfwyhhvcjntsgsvpzbhqtmtgyxifqoewmuplphykmptfdebjxuaxigomjtwgtljwdjhjernkitifbomifbhysnmadtnyn", "output": "CHAT WITH HER!" }, { "input": "urigreuzpxnej", "output": "CHAT WITH HER!" } ]
1,699,464,534
2,147,483,647
Python 3
OK
TESTS
85
92
0
username = list(input()) count = len(set(username)) if count % 2 == 0: print("CHAT WITH HER!") else: print("IGNORE HIM!")
Title: Boy or Girl Time Limit: None seconds Memory Limit: None megabytes Problem Description: Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network. But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names. This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method. Input Specification: The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters. Output Specification: If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes). Demo Input: ['wjmzbmr\n', 'xiaodao\n', 'sevenkplus\n'] Demo Output: ['CHAT WITH HER!\n', 'IGNORE HIM!\n', 'CHAT WITH HER!\n'] Note: For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
```python username = list(input()) count = len(set(username)) if count % 2 == 0: print("CHAT WITH HER!") else: print("IGNORE HIM!") ```
3
41
A
Translation
PROGRAMMING
800
[ "implementation", "strings" ]
A. Translation
2
256
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
[ "code\nedoc\n", "abb\naba\n", "code\ncode\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
500
[ { "input": "code\nedoc", "output": "YES" }, { "input": "abb\naba", "output": "NO" }, { "input": "code\ncode", "output": "NO" }, { "input": "abacaba\nabacaba", "output": "YES" }, { "input": "q\nq", "output": "YES" }, { "input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk", "output": "NO" }, { "input": "z\na", "output": "NO" }, { "input": "asd\ndsa", "output": "YES" }, { "input": "abcdef\nfecdba", "output": "NO" }, { "input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu", "output": "NO" }, { "input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf", "output": "NO" }, { "input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp", "output": "NO" }, { "input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb", "output": "NO" }, { "input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom", "output": "NO" }, { "input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh", "output": "NO" }, { "input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy", "output": "NO" }, { "input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko", "output": "NO" }, { "input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv", "output": "NO" }, { "input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd", "output": "NO" }, { "input": "w\nw", "output": "YES" }, { "input": "vz\nzv", "output": "YES" }, { "input": "ry\nyr", "output": "YES" }, { "input": "xou\nuox", "output": "YES" }, { "input": "axg\ngax", "output": "NO" }, { "input": "zdsl\nlsdz", "output": "YES" }, { "input": "kudl\nldku", "output": "NO" }, { "input": "zzlzwnqlcl\nlclqnwzlzz", "output": "YES" }, { "input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv", "output": "YES" }, { "input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar", "output": "NO" }, { "input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn", "output": "YES" }, { "input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum", "output": "YES" }, { "input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv", "output": "YES" }, { "input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm", "output": "NO" }, { "input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd", "output": "NO" }, { "input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg", "output": "YES" }, { "input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis", "output": "YES" }, { "input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy", "output": "NO" }, { "input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw", "output": "YES" }, { "input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi", "output": "YES" }, { "input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib", "output": "YES" } ]
1,682,601,480
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
60
0
a,b=input().split('\r\n') if a[::-1]==a: print('YES') else: print('NO')
Title: Translation Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. Input Specification: The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. Output Specification: If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. Demo Input: ['code\nedoc\n', 'abb\naba\n', 'code\ncode\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python a,b=input().split('\r\n') if a[::-1]==a: print('YES') else: print('NO') ```
-1
706
B
Interesting drink
PROGRAMMING
1,100
[ "binary search", "dp", "implementation" ]
null
null
Vasiliy likes to rest after a hard work, so you may often meet him in some bar nearby. As all programmers do, he loves the famous drink "Beecola", which can be bought in *n* different shops in the city. It's known that the price of one bottle in the shop *i* is equal to *x**i* coins. Vasiliy plans to buy his favorite drink for *q* consecutive days. He knows, that on the *i*-th day he will be able to spent *m**i* coins. Now, for each of the days he want to know in how many different shops he can buy a bottle of "Beecola".
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of shops in the city that sell Vasiliy's favourite drink. The second line contains *n* integers *x**i* (1<=≤<=*x**i*<=≤<=100<=000) — prices of the bottles of the drink in the *i*-th shop. The third line contains a single integer *q* (1<=≤<=*q*<=≤<=100<=000) — the number of days Vasiliy plans to buy the drink. Then follow *q* lines each containing one integer *m**i* (1<=≤<=*m**i*<=≤<=109) — the number of coins Vasiliy can spent on the *i*-th day.
Print *q* integers. The *i*-th of them should be equal to the number of shops where Vasiliy will be able to buy a bottle of the drink on the *i*-th day.
[ "5\n3 10 8 6 11\n4\n1\n10\n3\n11\n" ]
[ "0\n4\n1\n5\n" ]
On the first day, Vasiliy won't be able to buy a drink in any of the shops. On the second day, Vasiliy can buy a drink in the shops 1, 2, 3 and 4. On the third day, Vasiliy can buy a drink only in the shop number 1. Finally, on the last day Vasiliy can buy a drink in any shop.
1,000
[ { "input": "5\n3 10 8 6 11\n4\n1\n10\n3\n11", "output": "0\n4\n1\n5" }, { "input": "5\n868 987 714 168 123\n10\n424\n192\n795\n873\n117\n914\n735\n158\n631\n471", "output": "2\n2\n3\n4\n0\n4\n3\n1\n2\n2" }, { "input": "3\n435 482 309\n7\n245\n241\n909\n745\n980\n29\n521", "output": "0\n0\n3\n3\n3\n0\n3" }, { "input": "1\n653\n9\n903\n980\n80\n770\n965\n874\n381\n657\n969", "output": "1\n1\n0\n1\n1\n1\n0\n1\n1" }, { "input": "12\n35345 58181 32223 84621 35905 73863 99537 30666 67771 39229 36847 29038\n23\n55052824\n82504840\n35160556\n78141700\n73401989\n86305919\n39430705\n31939373\n23501765\n4406029\n61436920\n14295390\n34275309\n28028753\n85724689\n70158847\n2396455\n66994588\n84024224\n30175981\n65622319\n76517111\n76605341", "output": "12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12" }, { "input": "4\n698 193 1584 76192\n4\n553640\n310518\n274280\n429192", "output": "4\n4\n4\n4" }, { "input": "1\n1\n1\n1000000000", "output": "1" }, { "input": "1\n1\n1\n100005", "output": "1" }, { "input": "3\n1 2 3\n1\n100005", "output": "3" }, { "input": "2\n1 2\n3\n100004\n100005\n100006", "output": "2\n2\n2" }, { "input": "3\n1 1 1\n1\n1", "output": "3" }, { "input": "1\n1\n1\n1", "output": "1" }, { "input": "3\n1 2 3\n1\n100000", "output": "3" }, { "input": "5\n1 1 1 1 10\n2\n1\n10", "output": "4\n5" }, { "input": "5\n3 10 8 6 11\n1\n10000000", "output": "5" } ]
1,696,173,831
2,147,483,647
Python 3
OK
TESTS
103
904
13,619,200
n = int(input()) x_lst = sorted(list(map(int,input().split()))) num = x_lst[-1] q = int(input()) result = [] for _ in range(q): m = int(input()) low = 0 high = n - 1 if m >= num: result.append(n) else: low = 0 high = n - 1 count = 0 while low <= high: middle = (low + high)//2 middle_value = x_lst[middle] if m >= middle_value: count = middle + 1 low = middle + 1 else: high = middle - 1 result.append(count) for letter in result: print(letter)
Title: Interesting drink Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasiliy likes to rest after a hard work, so you may often meet him in some bar nearby. As all programmers do, he loves the famous drink "Beecola", which can be bought in *n* different shops in the city. It's known that the price of one bottle in the shop *i* is equal to *x**i* coins. Vasiliy plans to buy his favorite drink for *q* consecutive days. He knows, that on the *i*-th day he will be able to spent *m**i* coins. Now, for each of the days he want to know in how many different shops he can buy a bottle of "Beecola". Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of shops in the city that sell Vasiliy's favourite drink. The second line contains *n* integers *x**i* (1<=≤<=*x**i*<=≤<=100<=000) — prices of the bottles of the drink in the *i*-th shop. The third line contains a single integer *q* (1<=≤<=*q*<=≤<=100<=000) — the number of days Vasiliy plans to buy the drink. Then follow *q* lines each containing one integer *m**i* (1<=≤<=*m**i*<=≤<=109) — the number of coins Vasiliy can spent on the *i*-th day. Output Specification: Print *q* integers. The *i*-th of them should be equal to the number of shops where Vasiliy will be able to buy a bottle of the drink on the *i*-th day. Demo Input: ['5\n3 10 8 6 11\n4\n1\n10\n3\n11\n'] Demo Output: ['0\n4\n1\n5\n'] Note: On the first day, Vasiliy won't be able to buy a drink in any of the shops. On the second day, Vasiliy can buy a drink in the shops 1, 2, 3 and 4. On the third day, Vasiliy can buy a drink only in the shop number 1. Finally, on the last day Vasiliy can buy a drink in any shop.
```python n = int(input()) x_lst = sorted(list(map(int,input().split()))) num = x_lst[-1] q = int(input()) result = [] for _ in range(q): m = int(input()) low = 0 high = n - 1 if m >= num: result.append(n) else: low = 0 high = n - 1 count = 0 while low <= high: middle = (low + high)//2 middle_value = x_lst[middle] if m >= middle_value: count = middle + 1 low = middle + 1 else: high = middle - 1 result.append(count) for letter in result: print(letter) ```
3
474
B
Worms
PROGRAMMING
1,200
[ "binary search", "implementation" ]
null
null
It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch. Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding. Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained. Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile. The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot. The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms.
Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is.
[ "5\n2 7 3 4 9\n3\n1 25 11\n" ]
[ "1\n5\n3\n" ]
For the sample input: - The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
1,000
[ { "input": "5\n2 7 3 4 9\n3\n1 25 11", "output": "1\n5\n3" } ]
1,687,288,226
2,147,483,647
Python 3
OK
TESTS
38
670
14,131,200
n = int(input()) a = [int(x) for x in input().split()] m = int(input()) q = [int(x) for x in input().split()] s = [0] * (n + 1) for i in range(1, n + 1): s[i] = s[i - 1] + a[i - 1] for x in q: left = 0 right = n while right - left > 1: mid = (right + left) // 2 if s[mid] < x: left = mid else: right = mid print(right)
Title: Worms Time Limit: None seconds Memory Limit: None megabytes Problem Description: It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch. Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding. Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained. Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile. The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot. The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms. Output Specification: Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is. Demo Input: ['5\n2 7 3 4 9\n3\n1 25 11\n'] Demo Output: ['1\n5\n3\n'] Note: For the sample input: - The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
```python n = int(input()) a = [int(x) for x in input().split()] m = int(input()) q = [int(x) for x in input().split()] s = [0] * (n + 1) for i in range(1, n + 1): s[i] = s[i - 1] + a[i - 1] for x in q: left = 0 right = n while right - left > 1: mid = (right + left) // 2 if s[mid] < x: left = mid else: right = mid print(right) ```
3
1
A
Theatre Square
PROGRAMMING
1,000
[ "math" ]
A. Theatre Square
1
256
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Write the needed number of flagstones.
[ "6 6 4\n" ]
[ "4\n" ]
none
0
[ { "input": "6 6 4", "output": "4" }, { "input": "1 1 1", "output": "1" }, { "input": "2 1 1", "output": "2" }, { "input": "1 2 1", "output": "2" }, { "input": "2 2 1", "output": "4" }, { "input": "2 1 2", "output": "1" }, { "input": "1 1 3", "output": "1" }, { "input": "2 3 4", "output": "1" }, { "input": "1000000000 1000000000 1", "output": "1000000000000000000" }, { "input": "12 13 4", "output": "12" }, { "input": "222 332 5", "output": "3015" }, { "input": "1000 1000 10", "output": "10000" }, { "input": "1001 1000 10", "output": "10100" }, { "input": "100 10001 1000000000", "output": "1" }, { "input": "1000000000 1000000000 1000000000", "output": "1" }, { "input": "1000000000 1000000000 999999999", "output": "4" }, { "input": "1000000000 1000000000 192", "output": "27126743055556" }, { "input": "1000000000 987654321 1", "output": "987654321000000000" }, { "input": "456784567 1000000000 51", "output": "175618850864484" }, { "input": "39916800 134217728 40320", "output": "3295710" } ]
1,666,718,760
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
15
0
n,m,a=map(int,input().split()) if n<=a and m<=a: print(1) elif n>a and m>a: if n%a==0 and m%a==0: print(m//a*n//a) elif n>a and m<=a: if n%a==0: print(n//a) else: print(n//a+1) elif n<=a and m>a: if m%a==0: print(m//a) else: print(m//a+1)
Title: Theatre Square Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. Input Specification: The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). Output Specification: Write the needed number of flagstones. Demo Input: ['6 6 4\n'] Demo Output: ['4\n'] Note: none
```python n,m,a=map(int,input().split()) if n<=a and m<=a: print(1) elif n>a and m>a: if n%a==0 and m%a==0: print(m//a*n//a) elif n>a and m<=a: if n%a==0: print(n//a) else: print(n//a+1) elif n<=a and m>a: if m%a==0: print(m//a) else: print(m//a+1) ```
0
858
C
Did you mean...
PROGRAMMING
1,500
[ "dp", "greedy", "implementation" ]
null
null
Beroffice text editor has a wide range of features that help working with text. One of the features is an automatic search for typos and suggestions of how to fix them. Beroffice works only with small English letters (i.e. with 26 letters from a to z). Beroffice thinks that a word is typed with a typo if there are three or more consonants in a row in the word. The only exception is that if the block of consonants has all letters the same, then this block (even if its length is greater than three) is not considered a typo. Formally, a word is typed with a typo if there is a block of not less that three consonants in a row, and there are at least two different letters in this block. For example: - the following words have typos: "hellno", "hackcerrs" and "backtothefutttture"; - the following words don't have typos: "helllllooooo", "tobeornottobe" and "oooooo". When Beroffice editor finds a word with a typo, it inserts as little as possible number of spaces in this word (dividing it into several words) in such a way that each of the resulting words is typed without any typos. Implement this feature of Beroffice editor. Consider the following letters as the only vowels: 'a', 'e', 'i', 'o' and 'u'. All the other letters are consonants in this problem.
The only line contains a non-empty word consisting of small English letters. The length of the word is between 1 and 3000 letters.
Print the given word without any changes if there are no typos. If there is at least one typo in the word, insert the minimum number of spaces into the word so that each of the resulting words doesn't have any typos. If there are multiple solutions, print any of them.
[ "hellno\n", "abacaba\n", "asdfasdf\n" ]
[ "hell no \n", "abacaba \n", "asd fasd f \n" ]
none
1,500
[ { "input": "hellno", "output": "hell no " }, { "input": "abacaba", "output": "abacaba " }, { "input": "asdfasdf", "output": "asd fasd f " }, { "input": "ooo", "output": "ooo " }, { "input": "moyaoborona", "output": "moyaoborona " }, { "input": "jxegxxx", "output": "jxegx xx " }, { "input": "orfyaenanabckumulsboloyhljhacdgcmnooxvxrtuhcslxgslfpnfnyejbxqisxjyoyvcvuddboxkqgbogkfz", "output": "orf yaenanabc kumuls boloyh lj hacd gc mnooxv xr tuhc sl xg sl fp nf nyejb xqisx jyoyv cvudd boxk qg bogk fz " }, { "input": "zxdgmhsjotvajkwshjpvzcuwehpeyfhakhtlvuoftkgdmvpafmxcliqvrztloocziqdkexhzcbdgxaoyvte", "output": "zx dg mh sjotvajk ws hj pv zcuwehpeyf hakh tl vuoft kg dm vpafm xc liqv rz tloocziqd kexh zc bd gxaoyv te " }, { "input": "niblehmwtycadhbfuginpyafszjbucaszihijndzjtuyuaxkrovotshtsajmdcflnfdmahzbvpymiczqqleedpofcnvhieknlz", "output": "niblehm wt ycadh bfuginp yafs zj bucaszihijn dz jtuyuaxk rovots ht sajm dc fl nf dmahz bv py micz qq leedpofc nv hiekn lz " }, { "input": "pqvtgtctpkgjgxnposjqedofficoyznxlerxyqypyzpoehejtjvyafjxjppywwgeakf", "output": "pq vt gt ct pk gj gx nposj qedofficoyz nx lerx yq yp yz poehejt jv yafj xj pp yw wgeakf " }, { "input": "mvjajoyeg", "output": "mv jajoyeg " }, { "input": "dipxocwjosvdaillxolmthjhzhsxskzqslebpixpuhpgeesrkedhohisdsjsrkiktbjzlhectrfcathvewzficirqbdvzq", "output": "dipxocw josv daill xolm th jh zh sx sk zq slebpixpuhp geesr kedhohisd sj sr kikt bj zl hect rf cath vewz ficirq bd vz q " }, { "input": "ibbtvelwjirxqermucqrgmoauonisgmarjxxybllktccdykvef", "output": "ibb tvelw jirx qermucq rg moauonisg marj xx yb ll kt cc dy kvef " }, { "input": "jxevkmrwlomaaahaubvjzqtyfqhqbhpqhomxqpiuersltohinvfyeykmlooujymldjqhgqjkvqknlyj", "output": "jxevk mr wlomaaahaubv jz qt yf qh qb hp qhomx qpiuers ltohinv fyeyk mlooujy ml dj qh gq jk vq kn ly j " }, { "input": "hzxkuwqxonsulnndlhygvmallghjerwp", "output": "hz xkuwq xonsuln nd lh yg vmall gh jerw p " }, { "input": "jbvcsjdyzlzmxwcvmixunfzxidzvwzaqqdhguvelwbdosbd", "output": "jb vc sj dy zl zm xw cv mixunf zxidz vw zaqq dh guvelw bdosb d " }, { "input": "uyrsxaqmtibbxpfabprvnvbinjoxubupvfyjlqnfrfdeptipketwghr", "output": "uyr sxaqm tibb xp fabp rv nv binjoxubupv fy jl qn fr fdeptipketw gh r " }, { "input": "xfcftysljytybkkzkpqdzralahgvbkxdtheqrhfxpecdjqofnyiahggnkiuusalu", "output": "xf cf ty sl jy ty bk kz kp qd zralahg vb kx dt heqr hf xpecd jqofn yiahg gn kiuusalu " }, { "input": "a", "output": "a " }, { "input": "b", "output": "b " }, { "input": "aa", "output": "aa " }, { "input": "ab", "output": "ab " }, { "input": "ba", "output": "ba " }, { "input": "bb", "output": "bb " }, { "input": "aaa", "output": "aaa " }, { "input": "aab", "output": "aab " }, { "input": "aba", "output": "aba " }, { "input": "abb", "output": "abb " }, { "input": "baa", "output": "baa " }, { "input": "bab", "output": "bab " }, { "input": "bba", "output": "bba " }, { "input": "bbb", "output": "bbb " }, { "input": "bbc", "output": "bb c " }, { "input": "bcb", "output": "bc b " }, { "input": "cbb", "output": "cb b " }, { "input": "bababcdfabbcabcdfacbbabcdfacacabcdfacbcabcdfaccbabcdfacaaabcdfabacabcdfabcbabcdfacbaabcdfabaaabcdfabbaabcdfacababcdfabbbabcdfabcaabcdfaaababcdfabccabcdfacccabcdfaacbabcdfaabaabcdfaabcabcdfaaacabcdfaccaabcdfaabbabcdfaaaaabcdfaacaabcdfaacc", "output": "bababc dfabb cabc dfacb babc dfacacabc dfacb cabc dfacc babc dfacaaabc dfabacabc dfabc babc dfacbaabc dfabaaabc dfabbaabc dfacababc dfabbbabc dfabcaabc dfaaababc dfabc cabc dfacccabc dfaacbabc dfaabaabc dfaabcabc dfaaacabc dfaccaabc dfaabbabc dfaaaaabc dfaacaabc dfaacc " }, { "input": "bddabcdfaccdabcdfadddabcdfabbdabcdfacddabcdfacdbabcdfacbbabcdfacbcabcdfacbdabcdfadbbabcdfabdbabcdfabdcabcdfabbcabcdfabccabcdfabbbabcdfaddcabcdfaccbabcdfadbdabcdfacccabcdfadcdabcdfadcbabcdfabcbabcdfadbcabcdfacdcabcdfabcdabcdfadccabcdfaddb", "output": "bd dabc dfacc dabc dfadddabc dfabb dabc dfacd dabc dfacd babc dfacb babc dfacb cabc dfacb dabc dfadb babc dfabd babc dfabd cabc dfabb cabc dfabc cabc dfabbbabc dfadd cabc dfacc babc dfadb dabc dfacccabc dfadc dabc dfadc babc dfabc babc dfadb cabc dfacd cabc dfabc dabc dfadc cabc dfadd b " }, { "input": "helllllooooo", "output": "helllllooooo " }, { "input": "bbbzxxx", "output": "bbb zx xx " }, { "input": "ffff", "output": "ffff " }, { "input": "cdddddddddddddddddd", "output": "cd ddddddddddddddddd " }, { "input": "bbbc", "output": "bbb c " }, { "input": "lll", "output": "lll " }, { "input": "bbbbb", "output": "bbbbb " }, { "input": "llll", "output": "llll " }, { "input": "bbbbbbccc", "output": "bbbbbb ccc " }, { "input": "lllllb", "output": "lllll b " }, { "input": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzz", "output": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzz " }, { "input": "lllll", "output": "lllll " }, { "input": "bbbbbbbbbc", "output": "bbbbbbbbb c " }, { "input": "helllllno", "output": "helllll no " }, { "input": "nnnnnnnnnnnn", "output": "nnnnnnnnnnnn " }, { "input": "bbbbbccc", "output": "bbbbb ccc " }, { "input": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzz", "output": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzz " }, { "input": "nnnnnnnnnnnnnnnnnn", "output": "nnnnnnnnnnnnnnnnnn " }, { "input": "zzzzzzzzzzzzzzzzzzzzzzz", "output": "zzzzzzzzzzzzzzzzzzzzzzz " }, { "input": "hhhh", "output": "hhhh " }, { "input": "nnnnnnnnnnnnnnnnnnnnnnnnn", "output": "nnnnnnnnnnnnnnnnnnnnnnnnn " }, { "input": "zzzzzzzzzz", "output": "zzzzzzzzzz " }, { "input": "dddd", "output": "dddd " }, { "input": "heffffffgggggghhhhhh", "output": "heffffff gggggg hhhhhh " }, { "input": "bcddd", "output": "bc ddd " }, { "input": "x", "output": "x " }, { "input": "nnn", "output": "nnn " }, { "input": "xxxxxxxx", "output": "xxxxxxxx " }, { "input": "cclcc", "output": "cc lc c " }, { "input": "tttttttttttttt", "output": "tttttttttttttt " }, { "input": "xxxxxxx", "output": "xxxxxxx " }, { "input": "ccccb", "output": "cccc b " }, { "input": "bcecccc", "output": "bcecccc " }, { "input": "jjja", "output": "jjja " }, { "input": "zzz", "output": "zzz " }, { "input": "xxxxxxxxxzzzzzzzzzzzz", "output": "xxxxxxxxx zzzzzzzzzzzz " }, { "input": "alllewww", "output": "alllewww " }, { "input": "bbbbbbbbb", "output": "bbbbbbbbb " }, { "input": "jjj", "output": "jjj " }, { "input": "bbbbbbbbbbbbbbbbbbbbbbbbb", "output": "bbbbbbbbbbbbbbbbbbbbbbbbb " }, { "input": "kkkkkkkkkklllllllllllllll", "output": "kkkkkkkkkk lllllllllllllll " }, { "input": "helllllllllllo", "output": "helllllllllllo " }, { "input": "ttttsttttt", "output": "tttt st tttt " }, { "input": "tttttttsssssss", "output": "ttttttt sssssss " }, { "input": "assstttttatsfatsfdjfdhtsjdsaatttssssststsss", "output": "asss tttttats fats fd jf dh ts jd saattt sssss ts ts ss " }, { "input": "xxxxx", "output": "xxxxx " }, { "input": "bbbhbbb", "output": "bbb hb bb " }, { "input": "bbbbbbbb", "output": "bbbbbbbb " } ]
1,540,069,255
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
6
124
0
line = input() shift = [0] gl = 'aeiou' count = 0 for i in range(len(line)): if gl.find(line[i]) == -1: count += 1 if count == 3: shift.append(i) count = 0 else: count = 0 for i in range(1, len(shift)): print(line[shift[i - 1]:shift[i]], end = ' ') print(line[shift[-1]:])
Title: Did you mean... Time Limit: None seconds Memory Limit: None megabytes Problem Description: Beroffice text editor has a wide range of features that help working with text. One of the features is an automatic search for typos and suggestions of how to fix them. Beroffice works only with small English letters (i.e. with 26 letters from a to z). Beroffice thinks that a word is typed with a typo if there are three or more consonants in a row in the word. The only exception is that if the block of consonants has all letters the same, then this block (even if its length is greater than three) is not considered a typo. Formally, a word is typed with a typo if there is a block of not less that three consonants in a row, and there are at least two different letters in this block. For example: - the following words have typos: "hellno", "hackcerrs" and "backtothefutttture"; - the following words don't have typos: "helllllooooo", "tobeornottobe" and "oooooo". When Beroffice editor finds a word with a typo, it inserts as little as possible number of spaces in this word (dividing it into several words) in such a way that each of the resulting words is typed without any typos. Implement this feature of Beroffice editor. Consider the following letters as the only vowels: 'a', 'e', 'i', 'o' and 'u'. All the other letters are consonants in this problem. Input Specification: The only line contains a non-empty word consisting of small English letters. The length of the word is between 1 and 3000 letters. Output Specification: Print the given word without any changes if there are no typos. If there is at least one typo in the word, insert the minimum number of spaces into the word so that each of the resulting words doesn't have any typos. If there are multiple solutions, print any of them. Demo Input: ['hellno\n', 'abacaba\n', 'asdfasdf\n'] Demo Output: ['hell no \n', 'abacaba \n', 'asd fasd f \n'] Note: none
```python line = input() shift = [0] gl = 'aeiou' count = 0 for i in range(len(line)): if gl.find(line[i]) == -1: count += 1 if count == 3: shift.append(i) count = 0 else: count = 0 for i in range(1, len(shift)): print(line[shift[i - 1]:shift[i]], end = ' ') print(line[shift[-1]:]) ```
0
415
A
Mashmokh and Lights
PROGRAMMING
900
[ "implementation" ]
null
null
Mashmokh works in a factory. At the end of each day he must turn off all of the lights. The lights on the factory are indexed from 1 to *n*. There are *n* buttons in Mashmokh's room indexed from 1 to *n* as well. If Mashmokh pushes button with index *i*, then each light with index not less than *i* that is still turned on turns off. Mashmokh is not very clever. So instead of pushing the first button he pushes some of the buttons randomly each night. He pushed *m* distinct buttons *b*1,<=*b*2,<=...,<=*b**m* (the buttons were pushed consecutively in the given order) this night. Now he wants to know for each light the index of the button that turned this light off. Please note that the index of button *b**i* is actually *b**i*, not *i*. Please, help Mashmokh, print these indices.
The first line of the input contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), the number of the factory lights and the pushed buttons respectively. The next line contains *m* distinct space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*). It is guaranteed that all lights will be turned off after pushing all buttons.
Output *n* space-separated integers where the *i*-th number is index of the button that turns the *i*-th light off.
[ "5 4\n4 3 1 2\n", "5 5\n5 4 3 2 1\n" ]
[ "1 1 3 4 4 \n", "1 2 3 4 5 \n" ]
In the first sample, after pressing button number 4, lights 4 and 5 are turned off and lights 1, 2 and 3 are still on. Then after pressing button number 3, light number 3 is turned off as well. Pressing button number 1 turns off lights number 1 and 2 as well so pressing button number 2 in the end has no effect. Thus button number 4 turned lights 4 and 5 off, button number 3 turned light 3 off and button number 1 turned light 1 and 2 off.
500
[ { "input": "5 4\n4 3 1 2", "output": "1 1 3 4 4 " }, { "input": "5 5\n5 4 3 2 1", "output": "1 2 3 4 5 " }, { "input": "16 11\n8 5 12 10 14 2 6 3 15 9 1", "output": "1 2 2 2 5 5 5 8 8 8 8 8 8 8 8 8 " }, { "input": "79 22\n76 32 48 28 33 44 58 59 1 51 77 13 15 64 49 72 74 21 61 12 60 57", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 28 28 28 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 76 76 76 76 " }, { "input": "25 19\n3 12 21 11 19 6 5 15 4 16 20 8 9 1 22 23 25 18 13", "output": "1 1 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 " }, { "input": "48 8\n42 27 40 1 18 3 19 2", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 27 27 27 27 27 27 27 27 27 27 27 27 27 27 27 42 42 42 42 42 42 42 " }, { "input": "44 19\n13 20 7 10 9 14 43 17 18 39 21 42 37 1 33 8 35 4 6", "output": "1 1 1 1 1 1 7 7 7 7 7 7 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 " }, { "input": "80 29\n79 51 28 73 65 39 10 1 59 29 7 70 64 3 35 17 24 71 74 2 6 49 66 80 13 18 60 15 12", "output": "1 1 1 1 1 1 1 1 1 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 79 79 " }, { "input": "31 4\n8 18 30 1", "output": "1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 " }, { "input": "62 29\n61 55 35 13 51 56 23 6 8 26 27 40 48 11 18 12 19 50 54 14 24 21 32 17 43 33 1 2 3", "output": "1 1 1 1 1 6 6 6 6 6 6 6 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 55 55 55 55 55 55 61 61 " }, { "input": "5 4\n2 3 4 1", "output": "1 2 2 2 2 " }, { "input": "39 37\n2 5 17 24 19 33 35 16 20 3 1 34 10 36 15 37 14 8 28 21 13 31 30 29 7 25 32 12 6 27 22 4 11 39 18 9 26", "output": "1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 " }, { "input": "100 100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 " }, { "input": "1 1\n1", "output": "1 " }, { "input": "18 3\n18 1 11", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 18 " }, { "input": "67 20\n66 23 40 49 3 39 60 43 52 47 16 36 22 5 41 10 55 34 64 1", "output": "1 1 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 66 66 " }, { "input": "92 52\n9 85 44 13 27 61 8 1 28 41 6 14 70 67 39 71 56 80 34 21 5 10 40 73 63 38 90 57 37 36 82 86 65 46 7 54 81 12 45 49 83 59 64 26 62 25 60 24 91 47 53 55", "output": "1 1 1 1 1 1 1 8 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 " }, { "input": "66 36\n44 62 32 29 3 15 47 30 50 42 35 2 33 65 10 13 56 12 1 16 7 36 39 11 25 28 20 52 46 38 37 8 61 49 48 14", "output": "1 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 29 29 29 32 32 32 32 32 32 32 32 32 32 32 32 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 " }, { "input": "32 8\n27 23 1 13 18 24 17 26", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 23 23 23 23 27 27 27 27 27 27 " }, { "input": "26 13\n1 14 13 2 4 24 21 22 16 3 10 12 6", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "31 20\n10 11 20 2 4 26 31 7 13 12 28 1 30 18 21 8 3 16 15 19", "output": "1 2 2 2 2 2 2 2 2 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 " }, { "input": "86 25\n22 62 8 23 53 77 9 31 43 1 58 16 72 11 15 35 60 39 79 4 82 64 76 63 59", "output": "1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8 8 8 8 8 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 " }, { "input": "62 54\n2 5 4 47 40 61 37 31 41 16 44 42 48 32 10 6 62 38 52 49 11 20 55 22 3 36 25 21 50 8 28 14 18 39 34 54 53 19 46 27 15 23 12 24 60 17 33 57 58 1 35 29 51 7", "output": "1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 " }, { "input": "57 19\n43 45 37 40 42 55 16 33 47 32 34 35 9 41 1 6 8 15 5", "output": "1 1 1 1 1 1 1 1 9 9 9 9 9 9 9 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 37 37 37 37 37 37 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 " }, { "input": "32 14\n4 7 13 1 25 22 9 27 6 28 30 2 14 21", "output": "1 1 1 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 " }, { "input": "57 12\n8 53 51 38 1 6 16 33 13 46 28 35", "output": "1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 " }, { "input": "87 9\n57 34 78 1 52 67 56 6 54", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 " }, { "input": "88 42\n85 45 52 14 63 53 70 71 16 86 66 47 12 22 10 72 4 31 3 69 11 77 17 25 46 75 23 1 21 84 44 20 18 33 48 88 41 83 67 61 73 34", "output": "1 1 3 4 4 4 4 4 4 10 10 12 12 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 85 85 85 85 " }, { "input": "27 25\n9 21 17 5 16 3 23 7 12 4 14 11 13 1 15 19 27 8 20 10 22 25 6 18 26", "output": "1 1 3 3 5 5 5 5 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 " }, { "input": "89 28\n5 22 79 42 16 35 66 48 57 55 1 37 29 31 40 38 45 62 41 87 64 89 81 13 60 44 71 82", "output": "1 1 1 1 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 " }, { "input": "17 4\n4 3 1 2", "output": "1 1 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 " } ]
1,689,369,216
2,147,483,647
PyPy 3
OK
TESTS
31
93
0
n,m = map(int,input().split()) b = input().split() b = [int(x) for x in b] I = [0]*n for i in range(m) : j = b[i]-1 while j<n and I[j]==0 : I[j] = b[i] j += 1 for i in range(n) : print(I[i],end=" ")
Title: Mashmokh and Lights Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mashmokh works in a factory. At the end of each day he must turn off all of the lights. The lights on the factory are indexed from 1 to *n*. There are *n* buttons in Mashmokh's room indexed from 1 to *n* as well. If Mashmokh pushes button with index *i*, then each light with index not less than *i* that is still turned on turns off. Mashmokh is not very clever. So instead of pushing the first button he pushes some of the buttons randomly each night. He pushed *m* distinct buttons *b*1,<=*b*2,<=...,<=*b**m* (the buttons were pushed consecutively in the given order) this night. Now he wants to know for each light the index of the button that turned this light off. Please note that the index of button *b**i* is actually *b**i*, not *i*. Please, help Mashmokh, print these indices. Input Specification: The first line of the input contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), the number of the factory lights and the pushed buttons respectively. The next line contains *m* distinct space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*). It is guaranteed that all lights will be turned off after pushing all buttons. Output Specification: Output *n* space-separated integers where the *i*-th number is index of the button that turns the *i*-th light off. Demo Input: ['5 4\n4 3 1 2\n', '5 5\n5 4 3 2 1\n'] Demo Output: ['1 1 3 4 4 \n', '1 2 3 4 5 \n'] Note: In the first sample, after pressing button number 4, lights 4 and 5 are turned off and lights 1, 2 and 3 are still on. Then after pressing button number 3, light number 3 is turned off as well. Pressing button number 1 turns off lights number 1 and 2 as well so pressing button number 2 in the end has no effect. Thus button number 4 turned lights 4 and 5 off, button number 3 turned light 3 off and button number 1 turned light 1 and 2 off.
```python n,m = map(int,input().split()) b = input().split() b = [int(x) for x in b] I = [0]*n for i in range(m) : j = b[i]-1 while j<n and I[j]==0 : I[j] = b[i] j += 1 for i in range(n) : print(I[i],end=" ") ```
3
3
C
Tic-tac-toe
PROGRAMMING
1,800
[ "brute force", "games", "implementation" ]
C. Tic-tac-toe
1
64
Certainly, everyone is familiar with tic-tac-toe game. The rules are very simple indeed. Two players take turns marking the cells in a 3<=×<=3 grid (one player always draws crosses, the other — noughts). The player who succeeds first in placing three of his marks in a horizontal, vertical or diagonal line wins, and the game is finished. The player who draws crosses goes first. If the grid is filled, but neither Xs, nor 0s form the required line, a draw is announced. You are given a 3<=×<=3 grid, each grid cell is empty, or occupied by a cross or a nought. You have to find the player (first or second), whose turn is next, or print one of the verdicts below: - illegal — if the given board layout can't appear during a valid game; - the first player won — if in the given board layout the first player has just won; - the second player won — if in the given board layout the second player has just won; - draw — if the given board layout has just let to a draw.
The input consists of three lines, each of the lines contains characters ".", "X" or "0" (a period, a capital letter X, or a digit zero).
Print one of the six verdicts: first, second, illegal, the first player won, the second player won or draw.
[ "X0X\n.0.\n.X.\n" ]
[ "second\n" ]
none
0
[ { "input": "X0X\n.0.\n.X.", "output": "second" }, { "input": "0.X\nXX.\n000", "output": "illegal" }, { "input": "XXX\n.0.\n000", "output": "illegal" }, { "input": "XXX\n...\n000", "output": "illegal" }, { "input": "X.X\nX..\n00.", "output": "second" }, { "input": "X.X\nX.0\n0.0", "output": "first" }, { "input": "XXX\nX00\nX00", "output": "the first player won" }, { "input": "000\nX.X\nX.X", "output": "illegal" }, { "input": "XXX\n0.0\n0..", "output": "illegal" }, { "input": "X0X\n0X0\nX0X", "output": "the first player won" }, { "input": "XX.\nX0X\nX..", "output": "illegal" }, { "input": "X0X\n0X0\nX..", "output": "the first player won" }, { "input": "XX0\n0..\n000", "output": "illegal" }, { "input": "XXX\n0..\n.0.", "output": "the first player won" }, { "input": "XXX\nX..\n.00", "output": "illegal" }, { "input": "X00\n0.0\nXX0", "output": "illegal" }, { "input": "0.0\n0XX\n..0", "output": "illegal" }, { "input": ".00\nX.X\n0..", "output": "illegal" }, { "input": "..0\n.00\n.0X", "output": "illegal" }, { "input": "..0\n0..\n00X", "output": "illegal" }, { "input": "..0\n.XX\nX..", "output": "illegal" }, { "input": "0.X\n0X0\n.00", "output": "illegal" }, { "input": "..X\n0X0\n0X.", "output": "first" }, { "input": "0X0\nX..\nX.0", "output": "first" }, { "input": ".0.\nX.X\n0..", "output": "first" }, { "input": "0X0\n00X\n.00", "output": "illegal" }, { "input": ".0.\n.X0\nX..", "output": "first" }, { "input": "00X\n0.X\n00X", "output": "illegal" }, { "input": "00X\n0XX\n0X.", "output": "the second player won" }, { "input": "X00\n..0\nX.X", "output": "first" }, { "input": "X00\nX00\n.X0", "output": "illegal" }, { "input": "X0X\n.X0\n0..", "output": "first" }, { "input": "..0\nXXX\n000", "output": "illegal" }, { "input": "XXX\n...\n.0.", "output": "illegal" }, { "input": "0..\n000\nX0X", "output": "illegal" }, { "input": ".00\n0X.\n0.0", "output": "illegal" }, { "input": "X..\nX00\n0.0", "output": "illegal" }, { "input": ".X0\nXX0\nX.X", "output": "illegal" }, { "input": "X.X\n0.0\nX..", "output": "second" }, { "input": "00X\n.00\n..0", "output": "illegal" }, { "input": "..0\n0.X\n00.", "output": "illegal" }, { "input": "0.X\nX0X\n.X0", "output": "illegal" }, { "input": "0X.\n.X.\n0X0", "output": "illegal" }, { "input": "00.\nX0.\n..X", "output": "illegal" }, { "input": "..X\n.00\nXX.", "output": "second" }, { "input": ".00\n.0.\n.X.", "output": "illegal" }, { "input": "XX0\nX.0\nXX0", "output": "illegal" }, { "input": "00.\n00.\nX.X", "output": "illegal" }, { "input": "X00\nX.0\nX.0", "output": "illegal" }, { "input": "0X.\n0XX\n000", "output": "illegal" }, { "input": "00.\n00.\n.X.", "output": "illegal" }, { "input": "X0X\n00.\n0.X", "output": "illegal" }, { "input": "XX0\nXXX\n0X0", "output": "illegal" }, { "input": "XX0\n..X\nXX0", "output": "illegal" }, { "input": "0X.\n..X\nX..", "output": "illegal" }, { "input": "...\nX0.\nXX0", "output": "second" }, { "input": "..X\n.0.\n0..", "output": "illegal" }, { "input": "00X\nXX.\n00X", "output": "first" }, { "input": "..0\nXX0\n..X", "output": "second" }, { "input": ".0.\n.00\nX00", "output": "illegal" }, { "input": "X00\n.XX\n00.", "output": "illegal" }, { "input": ".00\n0.X\n000", "output": "illegal" }, { "input": "X0.\n..0\nX.0", "output": "illegal" }, { "input": "X0X\n.XX\n00.", "output": "second" }, { "input": "0X.\n00.\n.X.", "output": "illegal" }, { "input": ".0.\n...\n0.0", "output": "illegal" }, { "input": "..X\nX00\n0.0", "output": "illegal" }, { "input": "0XX\n...\nX0.", "output": "second" }, { "input": "X.X\n0X.\n.0X", "output": "illegal" }, { "input": "XX0\nX.X\n00.", "output": "second" }, { "input": ".0X\n.00\n00.", "output": "illegal" }, { "input": ".XX\nXXX\n0..", "output": "illegal" }, { "input": "XX0\n.X0\n.0.", "output": "first" }, { "input": "X00\n0.X\nX..", "output": "first" }, { "input": "X..\n.X0\nX0.", "output": "second" }, { "input": ".0X\nX..\nXXX", "output": "illegal" }, { "input": "X0X\nXXX\nX.X", "output": "illegal" }, { "input": ".00\nX0.\n00X", "output": "illegal" }, { "input": "0XX\n.X0\n0.0", "output": "illegal" }, { "input": "00X\nXXX\n..0", "output": "the first player won" }, { "input": "X0X\n...\n.X.", "output": "illegal" }, { "input": ".X0\n...\n0X.", "output": "first" }, { "input": "X..\n0X0\nX.0", "output": "first" }, { "input": "..0\n.00\nX.0", "output": "illegal" }, { "input": ".XX\n.0.\nX0X", "output": "illegal" }, { "input": "00.\n0XX\n..0", "output": "illegal" }, { "input": ".0.\n00.\n00.", "output": "illegal" }, { "input": "00.\n000\nX.X", "output": "illegal" }, { "input": "0X0\n.X0\n.X.", "output": "illegal" }, { "input": "00X\n0..\n0..", "output": "illegal" }, { "input": ".X.\n.X0\nX.0", "output": "second" }, { "input": ".0.\n0X0\nX0X", "output": "illegal" }, { "input": "...\nX.0\n0..", "output": "illegal" }, { "input": "..0\nXX.\n00X", "output": "first" }, { "input": "0.X\n.0X\nX00", "output": "illegal" }, { "input": "..X\n0X.\n.0.", "output": "first" }, { "input": "..X\nX.0\n.0X", "output": "second" }, { "input": "X0.\n.0X\nX0X", "output": "illegal" }, { "input": "...\n.0.\n.X0", "output": "illegal" }, { "input": ".X0\nXX0\n0..", "output": "first" }, { "input": "0X.\n...\nX..", "output": "second" }, { "input": ".0.\n0.0\n0.X", "output": "illegal" }, { "input": "XX.\n.X0\n.0X", "output": "illegal" }, { "input": ".0.\nX0X\nX00", "output": "illegal" }, { "input": "0X.\n.X0\nX..", "output": "second" }, { "input": "..0\n0X.\n000", "output": "illegal" }, { "input": "0.0\nX.X\nXX.", "output": "illegal" }, { "input": ".X.\n.XX\nX0.", "output": "illegal" }, { "input": "X.X\n.XX\n0X.", "output": "illegal" }, { "input": "X.0\n0XX\n..0", "output": "first" }, { "input": "X.0\n0XX\n.X0", "output": "second" }, { "input": "X00\n0XX\n.X0", "output": "first" }, { "input": "X00\n0XX\nXX0", "output": "draw" }, { "input": "X00\n0XX\n0X0", "output": "illegal" }, { "input": "XXX\nXXX\nXXX", "output": "illegal" }, { "input": "000\n000\n000", "output": "illegal" }, { "input": "XX0\n00X\nXX0", "output": "draw" }, { "input": "X00\n00X\nXX0", "output": "illegal" }, { "input": "X.0\n00.\nXXX", "output": "the first player won" }, { "input": "X..\nX0.\nX0.", "output": "the first player won" }, { "input": ".XX\n000\nXX0", "output": "the second player won" }, { "input": "X0.\nX.X\nX00", "output": "the first player won" }, { "input": "00X\nX00\nXXX", "output": "the first player won" }, { "input": "XXX\n.00\nX0.", "output": "the first player won" }, { "input": "XX0\n000\nXX.", "output": "the second player won" }, { "input": ".X0\n0.0\nXXX", "output": "the first player won" }, { "input": "0XX\nX00\n0XX", "output": "draw" }, { "input": "0XX\nX0X\n00X", "output": "the first player won" }, { "input": "XX0\n0XX\n0X0", "output": "the first player won" }, { "input": "0X0\nX0X\nX0X", "output": "draw" }, { "input": "X0X\n0XX\n00X", "output": "the first player won" }, { "input": "0XX\nX0.\nX00", "output": "the second player won" }, { "input": "X.0\n0X0\nXX0", "output": "the second player won" }, { "input": "X0X\nX0X\n0X0", "output": "draw" }, { "input": "X.0\n00X\n0XX", "output": "the second player won" }, { "input": "00X\nX0X\n.X0", "output": "the second player won" }, { "input": "X0X\n.00\nX0X", "output": "the second player won" }, { "input": "0XX\nX00\nX0X", "output": "draw" }, { "input": "000\nX0X\n.XX", "output": "the second player won" }, { "input": "0.0\n0.X\nXXX", "output": "the first player won" }, { "input": "X.0\nX0.\n0X.", "output": "the second player won" }, { "input": "X0X\n0X0\n..X", "output": "the first player won" }, { "input": "0X0\nXX0\n.X.", "output": "the first player won" }, { "input": "X0.\n.X.\n0.X", "output": "the first player won" }, { "input": "0XX\nX00\n.X0", "output": "the second player won" }, { "input": "0.0\nXXX\n0.X", "output": "the first player won" }, { "input": ".0X\n.X.\nX.0", "output": "the first player won" }, { "input": "XXX\nX.0\n0.0", "output": "the first player won" }, { "input": "XX0\nX..\nX00", "output": "the first player won" }, { "input": "XXX\n00X\n00X", "output": "the first player won" }, { "input": "X00\n00X\nXXX", "output": "the first player won" }, { "input": "0X0\nX0X\n0X.", "output": "the second player won" }, { "input": "XX0\nX00\n0X.", "output": "the second player won" }, { "input": "..X\n0X0\nX..", "output": "the first player won" }, { "input": "X0.\n00.\nXXX", "output": "the first player won" }, { "input": "0.X\nX00\nXX0", "output": "the second player won" }, { "input": "X0.\n0X.\n..X", "output": "the first player won" }, { "input": "00X\nX0.\nXX0", "output": "the second player won" }, { "input": "XX.\n000\n0XX", "output": "the second player won" }, { "input": "..X\n0.X\n.0X", "output": "the first player won" }, { "input": "X00\n.0X\n0XX", "output": "the second player won" }, { "input": "00X\n0X.\nXX.", "output": "the first player won" }, { "input": "X00\nXX.\n0.X", "output": "the first player won" }, { "input": "XXX\n00X\n0X0", "output": "the first player won" }, { "input": "X00\nXX0\n0XX", "output": "the first player won" }, { "input": "0X0\nX00\nXXX", "output": "the first player won" }, { "input": "XX0\nX00\n.X0", "output": "the second player won" } ]
1,687,982,995
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
1
92
0
a = input() b = input() c = input() board = a+b+c x = 0 o = 0 for i in board: if i == 'X': x += 1 if i == '0': o += 1 if x<=5 and o<=4 and (x-o)<=1 and (x-o)>= 0: if a[0] == b[0] and b[0] == c[0]: if a[0] == 'X': print("the player one has won") elif a[0] == "0": print("the player two has won") elif a[1] == b[1] and b[1] == c[1]: if a[1] == 'X': print("the player one has won") elif a[1] == "0": print("the player two has won") elif a[2] == b[2] and b[2] == c[2]: if a[2] == 'X': print("the player one has won") elif a[2] == "0": print("the player two has won") elif a[1] == a[1] and a[1] == a[2]: if a[1] == 'X': print("the player one has won") elif a[1] == "0": print("the player two has won") elif b[0] == b[1] and b[1] == b[2]: if b[0] == 'X': print("the player one has won") elif a[0] == "0": print("the player two has won") elif c[0] == c[1] and c[1] == c[2]: if c[0] == 'X': print("the player one has won") elif c[0] == "0": print("the player two has won") elif a[0] == b[1] and b[1] == c[2]: if a[0] == 'X': print("the player one has won") elif a[0] == "0": print("the player two has won") elif c[0] == b[1] and b[1] == a[2]: if c[0] == 'X': print("the player one has won") elif c[0] == "0": print("the player two has won") elif x == 5 and o == 4: print("draw") elif x%2 == 1: print("second") elif x%2 == 0: print("first")
Title: Tic-tac-toe Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: Certainly, everyone is familiar with tic-tac-toe game. The rules are very simple indeed. Two players take turns marking the cells in a 3<=×<=3 grid (one player always draws crosses, the other — noughts). The player who succeeds first in placing three of his marks in a horizontal, vertical or diagonal line wins, and the game is finished. The player who draws crosses goes first. If the grid is filled, but neither Xs, nor 0s form the required line, a draw is announced. You are given a 3<=×<=3 grid, each grid cell is empty, or occupied by a cross or a nought. You have to find the player (first or second), whose turn is next, or print one of the verdicts below: - illegal — if the given board layout can't appear during a valid game; - the first player won — if in the given board layout the first player has just won; - the second player won — if in the given board layout the second player has just won; - draw — if the given board layout has just let to a draw. Input Specification: The input consists of three lines, each of the lines contains characters ".", "X" or "0" (a period, a capital letter X, or a digit zero). Output Specification: Print one of the six verdicts: first, second, illegal, the first player won, the second player won or draw. Demo Input: ['X0X\n.0.\n.X.\n'] Demo Output: ['second\n'] Note: none
```python a = input() b = input() c = input() board = a+b+c x = 0 o = 0 for i in board: if i == 'X': x += 1 if i == '0': o += 1 if x<=5 and o<=4 and (x-o)<=1 and (x-o)>= 0: if a[0] == b[0] and b[0] == c[0]: if a[0] == 'X': print("the player one has won") elif a[0] == "0": print("the player two has won") elif a[1] == b[1] and b[1] == c[1]: if a[1] == 'X': print("the player one has won") elif a[1] == "0": print("the player two has won") elif a[2] == b[2] and b[2] == c[2]: if a[2] == 'X': print("the player one has won") elif a[2] == "0": print("the player two has won") elif a[1] == a[1] and a[1] == a[2]: if a[1] == 'X': print("the player one has won") elif a[1] == "0": print("the player two has won") elif b[0] == b[1] and b[1] == b[2]: if b[0] == 'X': print("the player one has won") elif a[0] == "0": print("the player two has won") elif c[0] == c[1] and c[1] == c[2]: if c[0] == 'X': print("the player one has won") elif c[0] == "0": print("the player two has won") elif a[0] == b[1] and b[1] == c[2]: if a[0] == 'X': print("the player one has won") elif a[0] == "0": print("the player two has won") elif c[0] == b[1] and b[1] == a[2]: if c[0] == 'X': print("the player one has won") elif c[0] == "0": print("the player two has won") elif x == 5 and o == 4: print("draw") elif x%2 == 1: print("second") elif x%2 == 0: print("first") ```
0
967
A
Mind the Gap
PROGRAMMING
1,100
[ "implementation" ]
null
null
These days Arkady works as an air traffic controller at a large airport. He controls a runway which is usually used for landings only. Thus, he has a schedule of planes that are landing in the nearest future, each landing lasts $1$ minute. He was asked to insert one takeoff in the schedule. The takeoff takes $1$ minute itself, but for safety reasons there should be a time space between the takeoff and any landing of at least $s$ minutes from both sides. Find the earliest time when Arkady can insert the takeoff.
The first line of input contains two integers $n$ and $s$ ($1 \le n \le 100$, $1 \le s \le 60$) — the number of landings on the schedule and the minimum allowed time (in minutes) between a landing and a takeoff. Each of next $n$ lines contains two integers $h$ and $m$ ($0 \le h \le 23$, $0 \le m \le 59$) — the time, in hours and minutes, when a plane will land, starting from current moment (i. e. the current time is $0$ $0$). These times are given in increasing order.
Print two integers $h$ and $m$ — the hour and the minute from the current moment of the earliest time Arkady can insert the takeoff.
[ "6 60\n0 0\n1 20\n3 21\n5 0\n19 30\n23 40\n", "16 50\n0 30\n1 20\n3 0\n4 30\n6 10\n7 50\n9 30\n11 10\n12 50\n14 30\n16 10\n17 50\n19 30\n21 10\n22 50\n23 59\n", "3 17\n0 30\n1 0\n12 0\n" ]
[ "6 1\n", "24 50\n", "0 0\n" ]
In the first example note that there is not enough time between 1:20 and 3:21, because each landing and the takeoff take one minute. In the second example there is no gaps in the schedule, so Arkady can only add takeoff after all landings. Note that it is possible that one should wait more than $24$ hours to insert the takeoff. In the third example Arkady can insert the takeoff even between the first landing.
500
[ { "input": "6 60\n0 0\n1 20\n3 21\n5 0\n19 30\n23 40", "output": "6 1" }, { "input": "16 50\n0 30\n1 20\n3 0\n4 30\n6 10\n7 50\n9 30\n11 10\n12 50\n14 30\n16 10\n17 50\n19 30\n21 10\n22 50\n23 59", "output": "24 50" }, { "input": "3 17\n0 30\n1 0\n12 0", "output": "0 0" }, { "input": "24 60\n0 21\n2 21\n2 46\n3 17\n4 15\n5 43\n6 41\n7 50\n8 21\n9 8\n10 31\n10 45\n12 30\n14 8\n14 29\n14 32\n14 52\n15 16\n16 7\n16 52\n18 44\n20 25\n21 13\n22 7", "output": "23 8" }, { "input": "20 60\n0 9\n0 19\n0 57\n2 42\n3 46\n3 47\n5 46\n8 1\n9 28\n9 41\n10 54\n12 52\n13 0\n14 49\n17 28\n17 39\n19 34\n20 52\n21 35\n23 22", "output": "6 47" }, { "input": "57 20\n0 2\n0 31\n1 9\n1 42\n1 58\n2 4\n2 35\n2 49\n3 20\n3 46\n4 23\n4 52\n5 5\n5 39\n6 7\n6 48\n6 59\n7 8\n7 35\n8 10\n8 46\n8 53\n9 19\n9 33\n9 43\n10 18\n10 42\n11 0\n11 26\n12 3\n12 5\n12 30\n13 1\n13 38\n14 13\n14 54\n15 31\n16 5\n16 44\n17 18\n17 30\n17 58\n18 10\n18 34\n19 13\n19 49\n19 50\n19 59\n20 17\n20 23\n20 40\n21 18\n21 57\n22 31\n22 42\n22 56\n23 37", "output": "23 58" }, { "input": "66 20\n0 16\n0 45\n0 58\n1 6\n1 19\n2 7\n2 9\n3 9\n3 25\n3 57\n4 38\n4 58\n5 21\n5 40\n6 16\n6 19\n6 58\n7 6\n7 26\n7 51\n8 13\n8 36\n8 55\n9 1\n9 15\n9 33\n10 12\n10 37\n11 15\n11 34\n12 8\n12 37\n12 55\n13 26\n14 0\n14 34\n14 36\n14 48\n15 23\n15 29\n15 43\n16 8\n16 41\n16 45\n17 5\n17 7\n17 15\n17 29\n17 46\n18 12\n18 19\n18 38\n18 57\n19 32\n19 58\n20 5\n20 40\n20 44\n20 50\n21 18\n21 49\n22 18\n22 47\n23 1\n23 38\n23 50", "output": "1 40" }, { "input": "1 1\n0 0", "output": "0 2" }, { "input": "10 1\n0 2\n0 4\n0 5\n0 8\n0 9\n0 11\n0 13\n0 16\n0 19\n0 21", "output": "0 0" }, { "input": "10 1\n0 2\n0 5\n0 8\n0 11\n0 15\n0 17\n0 25\n0 28\n0 29\n0 32", "output": "0 0" }, { "input": "15 20\n0 47\n2 24\n4 19\n4 34\n5 46\n8 15\n9 8\n10 28\n17 47\n17 52\n18 32\n19 50\n20 46\n20 50\n23 21", "output": "0 0" }, { "input": "1 5\n1 0", "output": "0 0" }, { "input": "24 60\n1 0\n2 0\n3 0\n4 0\n5 0\n6 0\n7 0\n8 0\n9 0\n10 0\n11 0\n12 0\n13 0\n14 0\n15 0\n16 0\n17 0\n18 0\n19 0\n20 0\n21 0\n22 0\n23 0\n23 59", "output": "25 0" }, { "input": "1 30\n0 29", "output": "1 0" }, { "input": "1 2\n3 0", "output": "0 0" }, { "input": "16 60\n0 30\n1 20\n3 0\n4 30\n6 10\n7 50\n9 30\n11 10\n12 50\n14 30\n16 10\n17 50\n19 30\n21 10\n22 50\n23 59", "output": "25 0" }, { "input": "1 5\n0 6", "output": "0 0" }, { "input": "2 60\n0 59\n23 59", "output": "2 0" }, { "input": "1 58\n0 1", "output": "1 0" }, { "input": "25 60\n0 0\n1 0\n2 0\n3 0\n4 0\n5 0\n6 0\n7 0\n8 0\n9 0\n10 0\n11 0\n12 0\n13 0\n14 0\n15 0\n16 0\n17 0\n18 0\n19 0\n20 0\n21 0\n22 0\n23 0\n23 59", "output": "25 0" }, { "input": "2 3\n0 3\n0 30", "output": "0 7" }, { "input": "16 50\n0 30\n1 20\n3 0\n4 30\n6 10\n7 50\n9 30\n11 10\n12 50\n14 30\n16 10\n17 50\n19 30\n21 10\n22 50\n23 9", "output": "24 0" }, { "input": "1 60\n2 0", "output": "0 0" }, { "input": "2 60\n0 0\n5 0", "output": "1 1" }, { "input": "1 30\n0 31", "output": "0 0" }, { "input": "2 60\n0 59\n3 1", "output": "2 0" }, { "input": "2 60\n0 59\n5 0", "output": "2 0" }, { "input": "1 59\n0 0", "output": "1 0" }, { "input": "3 25\n0 0\n1 0\n2 0", "output": "0 26" }, { "input": "1 2\n2 3", "output": "0 0" } ]
1,525,009,132
1,432
Python 3
WRONG_ANSWER
PRETESTS
0
46
7,065,600
n,s = input().split(' ') n = int(n) s = int(s) L = [] for i in range(n): (a,b) = input().split(' ') a = int(a) b = int(b) L.append((a,b)) S = [0] for time in L: S.append(time[0]*60+time[1]) if S[1] > s + 2: print(0,end=' ') print(0) exit() res = 0 for i in range(len(S)-1): if S[i+1] - S[i] >= 2*s+1: res = S[i] + s break if res == 0: res = S[-1] + s res = res + 1 # print(res) nasht = res % 60 mtel = res // 60 print(mtel, end =' ') print(nasht)
Title: Mind the Gap Time Limit: None seconds Memory Limit: None megabytes Problem Description: These days Arkady works as an air traffic controller at a large airport. He controls a runway which is usually used for landings only. Thus, he has a schedule of planes that are landing in the nearest future, each landing lasts $1$ minute. He was asked to insert one takeoff in the schedule. The takeoff takes $1$ minute itself, but for safety reasons there should be a time space between the takeoff and any landing of at least $s$ minutes from both sides. Find the earliest time when Arkady can insert the takeoff. Input Specification: The first line of input contains two integers $n$ and $s$ ($1 \le n \le 100$, $1 \le s \le 60$) — the number of landings on the schedule and the minimum allowed time (in minutes) between a landing and a takeoff. Each of next $n$ lines contains two integers $h$ and $m$ ($0 \le h \le 23$, $0 \le m \le 59$) — the time, in hours and minutes, when a plane will land, starting from current moment (i. e. the current time is $0$ $0$). These times are given in increasing order. Output Specification: Print two integers $h$ and $m$ — the hour and the minute from the current moment of the earliest time Arkady can insert the takeoff. Demo Input: ['6 60\n0 0\n1 20\n3 21\n5 0\n19 30\n23 40\n', '16 50\n0 30\n1 20\n3 0\n4 30\n6 10\n7 50\n9 30\n11 10\n12 50\n14 30\n16 10\n17 50\n19 30\n21 10\n22 50\n23 59\n', '3 17\n0 30\n1 0\n12 0\n'] Demo Output: ['6 1\n', '24 50\n', '0 0\n'] Note: In the first example note that there is not enough time between 1:20 and 3:21, because each landing and the takeoff take one minute. In the second example there is no gaps in the schedule, so Arkady can only add takeoff after all landings. Note that it is possible that one should wait more than $24$ hours to insert the takeoff. In the third example Arkady can insert the takeoff even between the first landing.
```python n,s = input().split(' ') n = int(n) s = int(s) L = [] for i in range(n): (a,b) = input().split(' ') a = int(a) b = int(b) L.append((a,b)) S = [0] for time in L: S.append(time[0]*60+time[1]) if S[1] > s + 2: print(0,end=' ') print(0) exit() res = 0 for i in range(len(S)-1): if S[i+1] - S[i] >= 2*s+1: res = S[i] + s break if res == 0: res = S[-1] + s res = res + 1 # print(res) nasht = res % 60 mtel = res // 60 print(mtel, end =' ') print(nasht) ```
0
743
B
Chloe and the sequence
PROGRAMMING
1,200
[ "binary search", "bitmasks", "constructive algorithms", "implementation" ]
null
null
Chloe, the same as Vladik, is a competitive programmer. She didn't have any problems to get to the olympiad like Vladik, but she was confused by the task proposed on the olympiad. Let's consider the following algorithm of generating a sequence of integers. Initially we have a sequence consisting of a single element equal to 1. Then we perform (*n*<=-<=1) steps. On each step we take the sequence we've got on the previous step, append it to the end of itself and insert in the middle the minimum positive integer we haven't used before. For example, we get the sequence [1,<=2,<=1] after the first step, the sequence [1,<=2,<=1,<=3,<=1,<=2,<=1] after the second step. The task is to find the value of the element with index *k* (the elements are numbered from 1) in the obtained sequence, i. e. after (*n*<=-<=1) steps. Please help Chloe to solve the problem!
The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=50, 1<=≤<=*k*<=≤<=2*n*<=-<=1).
Print single integer — the integer at the *k*-th position in the obtained sequence.
[ "3 2\n", "4 8\n" ]
[ "2", "4" ]
In the first sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1]. The number on the second position is 2. In the second sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1, 4, 1, 2, 1, 3, 1, 2, 1]. The number on the eighth position is 4.
1,000
[ { "input": "3 2", "output": "2" }, { "input": "4 8", "output": "4" }, { "input": "5 27", "output": "1" }, { "input": "7 44", "output": "3" }, { "input": "15 18432", "output": "12" }, { "input": "20 259676", "output": "3" }, { "input": "30 671088640", "output": "28" }, { "input": "38 137438953472", "output": "38" }, { "input": "1 1", "output": "1" }, { "input": "3 3", "output": "1" }, { "input": "4 12", "output": "3" }, { "input": "8 224", "output": "6" }, { "input": "13 1368", "output": "4" }, { "input": "16 49152", "output": "15" }, { "input": "19 1024", "output": "11" }, { "input": "24 15204352", "output": "20" }, { "input": "27 6586544", "output": "5" }, { "input": "31 536870912", "output": "30" }, { "input": "38 94489280512", "output": "34" }, { "input": "42 215268308020", "output": "3" }, { "input": "42 3452074721280", "output": "21" }, { "input": "46 34394312982528", "output": "15" }, { "input": "48 133865540681728", "output": "39" }, { "input": "49 76541041985542", "output": "2" }, { "input": "49 104822971826176", "output": "34" }, { "input": "49 351843720888320", "output": "47" }, { "input": "50 743042492421629", "output": "1" }, { "input": "50 666266740436818", "output": "2" }, { "input": "50 704239287953456", "output": "5" }, { "input": "50 116938486513664", "output": "17" }, { "input": "50 806423059496960", "output": "37" }, { "input": "50 985162418487296", "output": "48" }, { "input": "50 844424930131968", "output": "49" }, { "input": "50 562949953421312", "output": "50" }, { "input": "50 1", "output": "1" }, { "input": "50 1125899906842623", "output": "1" }, { "input": "50 1125899906842620", "output": "3" }, { "input": "39 549755813887", "output": "1" }, { "input": "50 100000000000", "output": "12" } ]
1,643,543,241
2,147,483,647
Python 3
MEMORY_LIMIT_EXCEEDED
TESTS
6
514
268,390,400
# cook your dish here n,k=map(int,input().split()) l=[1];i=1 while(n>1): l=l+[i+1]+l n-=1 i+=1 print(l[k-1])
Title: Chloe and the sequence Time Limit: None seconds Memory Limit: None megabytes Problem Description: Chloe, the same as Vladik, is a competitive programmer. She didn't have any problems to get to the olympiad like Vladik, but she was confused by the task proposed on the olympiad. Let's consider the following algorithm of generating a sequence of integers. Initially we have a sequence consisting of a single element equal to 1. Then we perform (*n*<=-<=1) steps. On each step we take the sequence we've got on the previous step, append it to the end of itself and insert in the middle the minimum positive integer we haven't used before. For example, we get the sequence [1,<=2,<=1] after the first step, the sequence [1,<=2,<=1,<=3,<=1,<=2,<=1] after the second step. The task is to find the value of the element with index *k* (the elements are numbered from 1) in the obtained sequence, i. e. after (*n*<=-<=1) steps. Please help Chloe to solve the problem! Input Specification: The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=50, 1<=≤<=*k*<=≤<=2*n*<=-<=1). Output Specification: Print single integer — the integer at the *k*-th position in the obtained sequence. Demo Input: ['3 2\n', '4 8\n'] Demo Output: ['2', '4'] Note: In the first sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1]. The number on the second position is 2. In the second sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1, 4, 1, 2, 1, 3, 1, 2, 1]. The number on the eighth position is 4.
```python # cook your dish here n,k=map(int,input().split()) l=[1];i=1 while(n>1): l=l+[i+1]+l n-=1 i+=1 print(l[k-1]) ```
0
99
A
Help Far Away Kingdom
PROGRAMMING
800
[ "strings" ]
A. Help Far Away Kingdom
2
256
In a far away kingdom lived the King, the Prince, the Shoemaker, the Dressmaker and many other citizens. They lived happily until great trouble came into the Kingdom. The ACMers settled there. Most damage those strange creatures inflicted upon the kingdom was that they loved high precision numbers. As a result, the Kingdom healers had already had three appointments with the merchants who were asked to sell, say, exactly 0.273549107 beer barrels. To deal with the problem somehow, the King issued an order obliging rounding up all numbers to the closest integer to simplify calculations. Specifically, the order went like this: - If a number's integer part does not end with digit 9 and its fractional part is strictly less than 0.5, then the rounded up number coincides with the number’s integer part. - If a number's integer part does not end with digit 9 and its fractional part is not less than 0.5, the rounded up number is obtained if we add 1 to the last digit of the number’s integer part.- If the number’s integer part ends with digit 9, to round up the numbers one should go to Vasilisa the Wise. In the whole Kingdom she is the only one who can perform the tricky operation of carrying into the next position. Merchants found the algorithm very sophisticated and they asked you (the ACMers) to help them. Can you write a program that would perform the rounding according to the King’s order?
The first line contains a single number to round up — the integer part (a non-empty set of decimal digits that do not start with 0 — with the exception of a case when the set consists of a single digit — in this case 0 can go first), then follows character «.» (a dot), and then follows the fractional part (any non-empty set of decimal digits). The number's length does not exceed 1000 characters, including the dot. There are no other characters in the input data.
If the last number of the integer part is not equal to 9, print the rounded-up number without leading zeroes. Otherwise, print the message "GOTO Vasilisa." (without the quotes).
[ "0.0\n", "1.49\n", "1.50\n", "2.71828182845904523536\n", "3.14159265358979323846\n", "12345678901234567890.1\n", "123456789123456789.999\n" ]
[ "0", "1", "2", "3", "3", "12345678901234567890", "GOTO Vasilisa." ]
none
500
[ { "input": "0.0", "output": "0" }, { "input": "1.49", "output": "1" }, { "input": "1.50", "output": "2" }, { "input": "2.71828182845904523536", "output": "3" }, { "input": "3.14159265358979323846", "output": "3" }, { "input": "12345678901234567890.1", "output": "12345678901234567890" }, { "input": "123456789123456789.999", "output": "GOTO Vasilisa." }, { "input": "12345678901234567890.9", "output": "12345678901234567891" }, { "input": "123456789123456788.999", "output": "123456789123456789" }, { "input": "9.000", "output": "GOTO Vasilisa." }, { "input": "0.1", "output": "0" }, { "input": "0.2", "output": "0" }, { "input": "0.3", "output": "0" }, { "input": "0.4", "output": "0" }, { "input": "0.5", "output": "1" }, { "input": "0.6", "output": "1" }, { "input": "0.7", "output": "1" }, { "input": "0.8", "output": "1" }, { "input": "0.9", "output": "1" }, { "input": "1.0", "output": "1" }, { "input": "1.1", "output": "1" }, { "input": "1.2", "output": "1" }, { "input": "1.3", "output": "1" }, { "input": "1.4", "output": "1" }, { "input": "1.5", "output": "2" }, { "input": "1.6", "output": "2" }, { "input": "1.7", "output": "2" }, { "input": "1.8", "output": "2" }, { "input": "1.9", "output": "2" }, { "input": "2.0", "output": "2" }, { "input": "2.1", "output": "2" }, { "input": "2.2", "output": "2" }, { "input": "2.3", "output": "2" }, { "input": "2.4", "output": "2" }, { "input": "2.5", "output": "3" }, { "input": "2.6", "output": "3" }, { "input": "2.7", "output": "3" }, { "input": "2.8", "output": "3" }, { "input": "2.9", "output": "3" }, { "input": "3.0", "output": "3" }, { "input": "3.1", "output": "3" }, { "input": "3.2", "output": "3" }, { "input": "3.3", "output": "3" }, { "input": "3.4", "output": "3" }, { "input": "3.5", "output": "4" }, { "input": "3.6", "output": "4" }, { "input": "3.7", "output": "4" }, { "input": "3.8", "output": "4" }, { "input": "3.9", "output": "4" }, { "input": "4.0", "output": "4" }, { "input": "4.1", "output": "4" }, { "input": "4.2", "output": "4" }, { "input": "4.3", "output": "4" }, { "input": "4.4", "output": "4" }, { "input": "4.5", "output": "5" }, { "input": "4.6", "output": "5" }, { "input": "4.7", "output": "5" }, { "input": "4.8", "output": "5" }, { "input": "4.9", "output": "5" }, { "input": "5.0", "output": "5" }, { "input": "5.1", "output": "5" }, { "input": "5.2", "output": "5" }, { "input": "5.3", "output": "5" }, { "input": "5.4", "output": "5" }, { "input": "5.5", "output": "6" }, { "input": "5.6", "output": "6" }, { "input": "5.7", "output": "6" }, { "input": "5.8", "output": "6" }, { "input": "5.9", "output": "6" }, { "input": "6.0", "output": "6" }, { "input": "6.1", "output": "6" }, { "input": "6.2", "output": "6" }, { "input": "6.3", "output": "6" }, { "input": "6.4", "output": "6" }, { "input": "6.5", "output": "7" }, { "input": "6.6", "output": "7" }, { "input": "6.7", "output": "7" }, { "input": "6.8", "output": "7" }, { "input": "6.9", "output": "7" }, { "input": "7.0", "output": "7" }, { "input": "7.1", "output": "7" }, { "input": "7.2", "output": "7" }, { "input": "7.3", "output": "7" }, { "input": "7.4", "output": "7" }, { "input": "7.5", "output": "8" }, { "input": "7.6", "output": "8" }, { "input": "7.7", "output": "8" }, { "input": "7.8", "output": "8" }, { "input": "7.9", "output": "8" }, { "input": "8.0", "output": "8" }, { "input": "8.1", "output": "8" }, { "input": "8.2", "output": "8" }, { "input": "8.3", "output": "8" }, { "input": "8.4", "output": "8" }, { "input": "8.5", "output": "9" }, { "input": "8.6", "output": "9" }, { "input": "8.7", "output": "9" }, { "input": "8.8", "output": "9" }, { "input": "8.9", "output": "9" }, { "input": "9.0", "output": "GOTO Vasilisa." }, { "input": "9.1", "output": "GOTO Vasilisa." }, { "input": "9.2", "output": "GOTO Vasilisa." }, { "input": "9.3", "output": "GOTO Vasilisa." }, { "input": "9.4", "output": "GOTO Vasilisa." }, { "input": "9.5", "output": "GOTO Vasilisa." }, { "input": "9.6", "output": "GOTO Vasilisa." }, { "input": "9.7", "output": "GOTO Vasilisa." }, { "input": "9.8", "output": "GOTO Vasilisa." }, { "input": "9.9", "output": "GOTO Vasilisa." }, { "input": "609942239104813108618306232517836377583566292129955473517174437591594761209877970062547641606473593416245554763832875919009472288995880898848455284062760160557686724163817329189799336769669146848904803188614226720978399787805489531837751080926098.1664915772983166314490532653577560222779830866949001942720729759794777105570672781798092416748052690224813237139640723361527601154465287615917169132637313918577673651098507390501962", "output": "609942239104813108618306232517836377583566292129955473517174437591594761209877970062547641606473593416245554763832875919009472288995880898848455284062760160557686724163817329189799336769669146848904803188614226720978399787805489531837751080926098" }, { "input": "7002108534951820589946967018226114921984364117669853212254634761258884835434844673935047882480101006606512119541798298905598015607366335061012709906661245805358900665571472645463994925687210711492820804158354236327017974683658305043146543214454877759341394.20211856263503281388748282682120712214711232598021393495443628276945042110862480888110959179019986486690931930108026302665438087068150666835901617457150158918705186964935221768346957536540345814875615118637945520917367155931078965", "output": "7002108534951820589946967018226114921984364117669853212254634761258884835434844673935047882480101006606512119541798298905598015607366335061012709906661245805358900665571472645463994925687210711492820804158354236327017974683658305043146543214454877759341394" }, { "input": "1950583094879039694852660558765931995628486712128191844305265555887022812284005463780616067.5000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "1950583094879039694852660558765931995628486712128191844305265555887022812284005463780616068" }, { "input": "718130341896330596635811874410345440628950330.500000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "718130341896330596635811874410345440628950331" }, { "input": "927925904158088313481229162503626281882161630091489367140850985555900173018122871746924067186432044676083646964286435457446768031295712712803570690846298544912543439221596866052681116386179629036945370280722.500000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "927925904158088313481229162503626281882161630091489367140850985555900173018122871746924067186432044676083646964286435457446768031295712712803570690846298544912543439221596866052681116386179629036945370280723" }, { "input": "68289614863244584294178637364598054554769889.500000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "GOTO Vasilisa." }, { "input": "7536521504744364134984603189602839063535643888645969434165019366202558753840519.4999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999", "output": "GOTO Vasilisa." }, { "input": "646188694587964249318078225173.5000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "646188694587964249318078225174" }, { "input": "7017472758334494297677068672222822550374695787171163207025095950296957261530.50", "output": "7017472758334494297677068672222822550374695787171163207025095950296957261531" }, { "input": "259085737066615534998640212505663524594409165063310128108448186246980628179842202905722595400477937071746695941939306735605849342959111887834258250883469840846714848774368.50000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "259085737066615534998640212505663524594409165063310128108448186246980628179842202905722595400477937071746695941939306735605849342959111887834258250883469840846714848774369" }, { "input": "682500858233333594535201113441004740771119672961581796618069185960107115823662126812159957094407454522028503739299.5000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "GOTO Vasilisa." }, { "input": "41203422675619090661099806687619.49999999999999999999999999999999999999999999999999999999999999999999999999999999999999999", "output": "GOTO Vasilisa." } ]
1,603,455,964
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
5
216
0
f=float(input()) if int(f)%10==9: print("GOTO Vasilisa.") else: print(int(round(f,0)))
Title: Help Far Away Kingdom Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: In a far away kingdom lived the King, the Prince, the Shoemaker, the Dressmaker and many other citizens. They lived happily until great trouble came into the Kingdom. The ACMers settled there. Most damage those strange creatures inflicted upon the kingdom was that they loved high precision numbers. As a result, the Kingdom healers had already had three appointments with the merchants who were asked to sell, say, exactly 0.273549107 beer barrels. To deal with the problem somehow, the King issued an order obliging rounding up all numbers to the closest integer to simplify calculations. Specifically, the order went like this: - If a number's integer part does not end with digit 9 and its fractional part is strictly less than 0.5, then the rounded up number coincides with the number’s integer part. - If a number's integer part does not end with digit 9 and its fractional part is not less than 0.5, the rounded up number is obtained if we add 1 to the last digit of the number’s integer part.- If the number’s integer part ends with digit 9, to round up the numbers one should go to Vasilisa the Wise. In the whole Kingdom she is the only one who can perform the tricky operation of carrying into the next position. Merchants found the algorithm very sophisticated and they asked you (the ACMers) to help them. Can you write a program that would perform the rounding according to the King’s order? Input Specification: The first line contains a single number to round up — the integer part (a non-empty set of decimal digits that do not start with 0 — with the exception of a case when the set consists of a single digit — in this case 0 can go first), then follows character «.» (a dot), and then follows the fractional part (any non-empty set of decimal digits). The number's length does not exceed 1000 characters, including the dot. There are no other characters in the input data. Output Specification: If the last number of the integer part is not equal to 9, print the rounded-up number without leading zeroes. Otherwise, print the message "GOTO Vasilisa." (without the quotes). Demo Input: ['0.0\n', '1.49\n', '1.50\n', '2.71828182845904523536\n', '3.14159265358979323846\n', '12345678901234567890.1\n', '123456789123456789.999\n'] Demo Output: ['0', '1', '2', '3', '3', '12345678901234567890', 'GOTO Vasilisa.'] Note: none
```python f=float(input()) if int(f)%10==9: print("GOTO Vasilisa.") else: print(int(round(f,0))) ```
0
352
A
Jeff and Digits
PROGRAMMING
1,000
[ "brute force", "implementation", "math" ]
null
null
Jeff's got *n* cards, each card contains either digit 0, or digit 5. Jeff can choose several cards and put them in a line so that he gets some number. What is the largest possible number divisible by 90 Jeff can make from the cards he's got? Jeff must make the number without leading zero. At that, we assume that number 0 doesn't contain any leading zeroes. Jeff doesn't have to use all the cards.
The first line contains integer *n* (1<=≤<=*n*<=≤<=103). The next line contains *n* integers *a*1, *a*2, ..., *a**n* (*a**i*<==<=0 or *a**i*<==<=5). Number *a**i* represents the digit that is written on the *i*-th card.
In a single line print the answer to the problem — the maximum number, divisible by 90. If you can't make any divisible by 90 number from the cards, print -1.
[ "4\n5 0 5 0\n", "11\n5 5 5 5 5 5 5 5 0 5 5\n" ]
[ "0\n", "5555555550\n" ]
In the first test you can make only one number that is a multiple of 90 — 0. In the second test you can make number 5555555550, it is a multiple of 90.
500
[ { "input": "4\n5 0 5 0", "output": "0" }, { "input": "11\n5 5 5 5 5 5 5 5 0 5 5", "output": "5555555550" }, { "input": "7\n5 5 5 5 5 5 5", "output": "-1" }, { "input": "1\n5", "output": "-1" }, { "input": "1\n0", "output": "0" }, { "input": "11\n5 0 5 5 5 0 0 5 5 5 5", "output": "0" }, { "input": "23\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 0 0 0 0 0", "output": "55555555555555555500000" }, { "input": "9\n5 5 5 5 5 5 5 5 5", "output": "-1" }, { "input": "24\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 0 0 0 0 0", "output": "55555555555555555500000" }, { "input": "10\n0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "10\n5 5 5 5 5 0 0 5 0 5", "output": "0" }, { "input": "3\n5 5 0", "output": "0" }, { "input": "5\n5 5 0 5 5", "output": "0" }, { "input": "14\n0 5 5 0 0 0 0 0 0 5 5 5 5 5", "output": "0" }, { "input": "3\n5 5 5", "output": "-1" }, { "input": "3\n0 5 5", "output": "0" }, { "input": "13\n0 0 5 0 5 0 5 5 0 0 0 0 0", "output": "0" }, { "input": "9\n5 5 0 5 5 5 5 5 5", "output": "0" }, { "input": "8\n0 0 0 0 0 0 0 0", "output": "0" }, { "input": "101\n5 0 0 0 0 0 0 0 5 0 0 0 0 5 0 0 5 0 0 0 0 0 5 0 0 0 0 0 0 0 0 5 0 0 5 0 0 0 0 0 0 0 5 0 0 5 0 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 5 0 0 0 0 0 0 0 0 0 5 0 0 5 0 0 0 0 5 0 0", "output": "5555555550000000000000000000000000000000000000000000000000000000000000000000000000000000000000" }, { "input": "214\n5 0 5 0 5 0 0 0 5 5 0 5 0 5 5 0 5 0 0 0 0 5 5 0 0 5 5 0 0 0 0 5 5 5 5 0 5 0 0 0 0 0 0 5 0 0 0 5 0 0 5 0 0 5 5 0 0 5 5 0 0 0 0 0 5 0 5 0 5 5 0 5 0 0 5 5 5 0 5 0 5 0 5 5 0 5 0 0 0 5 5 0 5 0 5 5 5 5 5 0 0 0 0 0 0 5 0 5 5 0 5 0 5 0 5 5 0 0 0 0 5 0 5 0 5 0 0 5 0 0 5 5 5 5 5 0 0 5 0 0 5 0 0 5 0 0 5 0 0 5 0 5 0 0 0 5 0 0 5 5 5 0 0 5 5 5 0 0 5 5 0 0 0 5 0 0 5 5 5 5 5 5 0 5 0 0 5 5 5 5 0 5 5 0 0 0 5 5 5 5 0 0 0 0 5 0 0 5 0 0 5 5 0 0", "output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555550000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000" }, { "input": "80\n0 0 0 0 5 0 5 5 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 5 0 0 0 0 0 0 0 0 0 5 5 0 5 0 0 0 0 0 0 5 0 0 0 0 0 0 0 5 0 0 0 0 5 0 5 5 0 0 0", "output": "555555555000000000000000000000000000000000000000000000000000000000000000000" }, { "input": "2\n0 0", "output": "0" }, { "input": "3\n5 0 0", "output": "0" }, { "input": "4\n5 5 5 5", "output": "-1" }, { "input": "2\n0 5", "output": "0" }, { "input": "14\n5 5 5 5 5 5 5 5 5 5 5 5 5 0", "output": "5555555550" }, { "input": "18\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5", "output": "-1" }, { "input": "10\n5 5 5 5 5 5 5 5 5 0", "output": "5555555550" }, { "input": "10\n5 5 5 5 5 5 5 5 5 5", "output": "-1" }, { "input": "20\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5", "output": "-1" } ]
1,651,052,191
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
30
0
amount = int(input()) res = sorted([int(x) for x in input().split()], key = lambda x: -x) if (0 not in res): mark = True elif res.count(5) % 9 == 0: res = ''.join([str(x) for x in res]) print(res) elif res.count(5) < 9 and 0 in res: print(0) elif res.count(5) > 9 and 0 in res: while res.count(5)%9 != 0: res = res[:res.count(5) - 1] + res[res.count(5):] print(''.join([str(x) for x in res]))
Title: Jeff and Digits Time Limit: None seconds Memory Limit: None megabytes Problem Description: Jeff's got *n* cards, each card contains either digit 0, or digit 5. Jeff can choose several cards and put them in a line so that he gets some number. What is the largest possible number divisible by 90 Jeff can make from the cards he's got? Jeff must make the number without leading zero. At that, we assume that number 0 doesn't contain any leading zeroes. Jeff doesn't have to use all the cards. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=103). The next line contains *n* integers *a*1, *a*2, ..., *a**n* (*a**i*<==<=0 or *a**i*<==<=5). Number *a**i* represents the digit that is written on the *i*-th card. Output Specification: In a single line print the answer to the problem — the maximum number, divisible by 90. If you can't make any divisible by 90 number from the cards, print -1. Demo Input: ['4\n5 0 5 0\n', '11\n5 5 5 5 5 5 5 5 0 5 5\n'] Demo Output: ['0\n', '5555555550\n'] Note: In the first test you can make only one number that is a multiple of 90 — 0. In the second test you can make number 5555555550, it is a multiple of 90.
```python amount = int(input()) res = sorted([int(x) for x in input().split()], key = lambda x: -x) if (0 not in res): mark = True elif res.count(5) % 9 == 0: res = ''.join([str(x) for x in res]) print(res) elif res.count(5) < 9 and 0 in res: print(0) elif res.count(5) > 9 and 0 in res: while res.count(5)%9 != 0: res = res[:res.count(5) - 1] + res[res.count(5):] print(''.join([str(x) for x in res])) ```
0
6
C
Alice, Bob and Chocolate
PROGRAMMING
1,200
[ "greedy", "two pointers" ]
C. Alice, Bob and Chocolate
2
64
Alice and Bob like games. And now they are ready to start a new game. They have placed *n* chocolate bars in a line. Alice starts to eat chocolate bars one by one from left to right, and Bob — from right to left. For each chocololate bar the time, needed for the player to consume it, is known (Alice and Bob eat them with equal speed). When the player consumes a chocolate bar, he immediately starts with another. It is not allowed to eat two chocolate bars at the same time, to leave the bar unfinished and to make pauses. If both players start to eat the same bar simultaneously, Bob leaves it to Alice as a true gentleman. How many bars each of the players will consume?
The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the amount of bars on the table. The second line contains a sequence *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000), where *t**i* is the time (in seconds) needed to consume the *i*-th bar (in the order from left to right).
Print two numbers *a* and *b*, where *a* is the amount of bars consumed by Alice, and *b* is the amount of bars consumed by Bob.
[ "5\n2 9 8 2 7\n" ]
[ "2 3\n" ]
none
0
[ { "input": "5\n2 9 8 2 7", "output": "2 3" }, { "input": "1\n1", "output": "1 0" }, { "input": "2\n1 1", "output": "1 1" }, { "input": "3\n1 1 1", "output": "2 1" }, { "input": "4\n1 1 1 1", "output": "2 2" }, { "input": "1\n6", "output": "1 0" }, { "input": "2\n8 2", "output": "1 1" }, { "input": "3\n6 8 4", "output": "1 2" }, { "input": "4\n4 3 2 8", "output": "3 1" }, { "input": "5\n1 9 8 2 7", "output": "2 3" }, { "input": "6\n1 4 7 3 2 1", "output": "3 3" }, { "input": "11\n7 9 1 8 7 1 7 1 4 8 1", "output": "4 7" }, { "input": "12\n4 2 7 1 9 5 6 2 7 8 5 7", "output": "7 5" }, { "input": "13\n9 9 9 9 9 9 9 9 9 9 9 9 9", "output": "7 6" } ]
1,550,024,701
2,147,483,647
Python 3
OK
TESTS
40
310
7,168,000
n = int(input()) t = list(map(int, input().split())) a = b = 0 ta = tb = 0 i = 0 j = n - 1 while i <= j: if ta <= tb: ta += t[i] i += 1 else: tb += t[j] j -= 1 print(i, n - i)
Title: Alice, Bob and Chocolate Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: Alice and Bob like games. And now they are ready to start a new game. They have placed *n* chocolate bars in a line. Alice starts to eat chocolate bars one by one from left to right, and Bob — from right to left. For each chocololate bar the time, needed for the player to consume it, is known (Alice and Bob eat them with equal speed). When the player consumes a chocolate bar, he immediately starts with another. It is not allowed to eat two chocolate bars at the same time, to leave the bar unfinished and to make pauses. If both players start to eat the same bar simultaneously, Bob leaves it to Alice as a true gentleman. How many bars each of the players will consume? Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the amount of bars on the table. The second line contains a sequence *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000), where *t**i* is the time (in seconds) needed to consume the *i*-th bar (in the order from left to right). Output Specification: Print two numbers *a* and *b*, where *a* is the amount of bars consumed by Alice, and *b* is the amount of bars consumed by Bob. Demo Input: ['5\n2 9 8 2 7\n'] Demo Output: ['2 3\n'] Note: none
```python n = int(input()) t = list(map(int, input().split())) a = b = 0 ta = tb = 0 i = 0 j = n - 1 while i <= j: if ta <= tb: ta += t[i] i += 1 else: tb += t[j] j -= 1 print(i, n - i) ```
3.869094
50
A
Domino piling
PROGRAMMING
800
[ "greedy", "math" ]
A. Domino piling
2
256
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions.
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output one number — the maximal number of dominoes, which can be placed.
[ "2 4\n", "3 3\n" ]
[ "4\n", "4\n" ]
none
500
[ { "input": "2 4", "output": "4" }, { "input": "3 3", "output": "4" }, { "input": "1 5", "output": "2" }, { "input": "1 6", "output": "3" }, { "input": "1 15", "output": "7" }, { "input": "1 16", "output": "8" }, { "input": "2 5", "output": "5" }, { "input": "2 6", "output": "6" }, { "input": "2 7", "output": "7" }, { "input": "2 14", "output": "14" }, { "input": "2 15", "output": "15" }, { "input": "1 4", "output": "2" }, { "input": "2 16", "output": "16" }, { "input": "3 5", "output": "7" }, { "input": "3 6", "output": "9" }, { "input": "3 10", "output": "15" }, { "input": "3 14", "output": "21" }, { "input": "3 15", "output": "22" }, { "input": "3 16", "output": "24" }, { "input": "5 7", "output": "17" }, { "input": "16 16", "output": "128" }, { "input": "15 16", "output": "120" }, { "input": "2 3", "output": "3" }, { "input": "15 15", "output": "112" }, { "input": "14 16", "output": "112" }, { "input": "11 13", "output": "71" }, { "input": "5 16", "output": "40" }, { "input": "8 15", "output": "60" }, { "input": "2 2", "output": "2" }, { "input": "3 4", "output": "6" }, { "input": "4 4", "output": "8" }, { "input": "1 1", "output": "0" }, { "input": "1 2", "output": "1" }, { "input": "1 3", "output": "1" }, { "input": "14 15", "output": "105" } ]
1,610,518,528
2,147,483,647
PyPy 3
RUNTIME_ERROR
TESTS
0
280
2,252,800
M = int(input()) N = int(input()) S = M * N x = S//2 print(x)
Title: Domino piling Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions. Input Specification: In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). Output Specification: Output one number — the maximal number of dominoes, which can be placed. Demo Input: ['2 4\n', '3 3\n'] Demo Output: ['4\n', '4\n'] Note: none
```python M = int(input()) N = int(input()) S = M * N x = S//2 print(x) ```
-1
6
A
Triangle
PROGRAMMING
900
[ "brute force", "geometry" ]
A. Triangle
2
64
Johnny has a younger sister Anne, who is very clever and smart. As she came home from the kindergarten, she told his brother about the task that her kindergartener asked her to solve. The task was just to construct a triangle out of four sticks of different colours. Naturally, one of the sticks is extra. It is not allowed to break the sticks or use their partial length. Anne has perfectly solved this task, now she is asking Johnny to do the same. The boy answered that he would cope with it without any difficulty. However, after a while he found out that different tricky things can occur. It can happen that it is impossible to construct a triangle of a positive area, but it is possible to construct a degenerate triangle. It can be so, that it is impossible to construct a degenerate triangle even. As Johnny is very lazy, he does not want to consider such a big amount of cases, he asks you to help him.
The first line of the input contains four space-separated positive integer numbers not exceeding 100 — lengthes of the sticks.
Output TRIANGLE if it is possible to construct a non-degenerate triangle. Output SEGMENT if the first case cannot take place and it is possible to construct a degenerate triangle. Output IMPOSSIBLE if it is impossible to construct any triangle. Remember that you are to use three sticks. It is not allowed to break the sticks or use their partial length.
[ "4 2 1 3\n", "7 2 2 4\n", "3 5 9 1\n" ]
[ "TRIANGLE\n", "SEGMENT\n", "IMPOSSIBLE\n" ]
none
0
[ { "input": "4 2 1 3", "output": "TRIANGLE" }, { "input": "7 2 2 4", "output": "SEGMENT" }, { "input": "3 5 9 1", "output": "IMPOSSIBLE" }, { "input": "3 1 5 1", "output": "IMPOSSIBLE" }, { "input": "10 10 10 10", "output": "TRIANGLE" }, { "input": "11 5 6 11", "output": "TRIANGLE" }, { "input": "1 1 1 1", "output": "TRIANGLE" }, { "input": "10 20 30 40", "output": "TRIANGLE" }, { "input": "45 25 5 15", "output": "IMPOSSIBLE" }, { "input": "20 5 8 13", "output": "TRIANGLE" }, { "input": "10 30 7 20", "output": "SEGMENT" }, { "input": "3 2 3 2", "output": "TRIANGLE" }, { "input": "70 10 100 30", "output": "SEGMENT" }, { "input": "4 8 16 2", "output": "IMPOSSIBLE" }, { "input": "3 3 3 10", "output": "TRIANGLE" }, { "input": "1 5 5 5", "output": "TRIANGLE" }, { "input": "13 25 12 1", "output": "SEGMENT" }, { "input": "10 100 7 3", "output": "SEGMENT" }, { "input": "50 1 50 100", "output": "TRIANGLE" }, { "input": "50 1 100 49", "output": "SEGMENT" }, { "input": "49 51 100 1", "output": "SEGMENT" }, { "input": "5 11 2 25", "output": "IMPOSSIBLE" }, { "input": "91 50 9 40", "output": "IMPOSSIBLE" }, { "input": "27 53 7 97", "output": "IMPOSSIBLE" }, { "input": "51 90 24 8", "output": "IMPOSSIBLE" }, { "input": "3 5 1 1", "output": "IMPOSSIBLE" }, { "input": "13 49 69 15", "output": "IMPOSSIBLE" }, { "input": "16 99 9 35", "output": "IMPOSSIBLE" }, { "input": "27 6 18 53", "output": "IMPOSSIBLE" }, { "input": "57 88 17 8", "output": "IMPOSSIBLE" }, { "input": "95 20 21 43", "output": "IMPOSSIBLE" }, { "input": "6 19 32 61", "output": "IMPOSSIBLE" }, { "input": "100 21 30 65", "output": "IMPOSSIBLE" }, { "input": "85 16 61 9", "output": "IMPOSSIBLE" }, { "input": "5 6 19 82", "output": "IMPOSSIBLE" }, { "input": "1 5 1 3", "output": "IMPOSSIBLE" }, { "input": "65 10 36 17", "output": "IMPOSSIBLE" }, { "input": "81 64 9 7", "output": "IMPOSSIBLE" }, { "input": "11 30 79 43", "output": "IMPOSSIBLE" }, { "input": "1 1 5 3", "output": "IMPOSSIBLE" }, { "input": "21 94 61 31", "output": "IMPOSSIBLE" }, { "input": "49 24 9 74", "output": "IMPOSSIBLE" }, { "input": "11 19 5 77", "output": "IMPOSSIBLE" }, { "input": "52 10 19 71", "output": "SEGMENT" }, { "input": "2 3 7 10", "output": "SEGMENT" }, { "input": "1 2 6 3", "output": "SEGMENT" }, { "input": "2 6 1 8", "output": "SEGMENT" }, { "input": "1 2 4 1", "output": "SEGMENT" }, { "input": "4 10 6 2", "output": "SEGMENT" }, { "input": "2 10 7 3", "output": "SEGMENT" }, { "input": "5 2 3 9", "output": "SEGMENT" }, { "input": "6 1 4 10", "output": "SEGMENT" }, { "input": "10 6 4 1", "output": "SEGMENT" }, { "input": "3 2 9 1", "output": "SEGMENT" }, { "input": "22 80 29 7", "output": "SEGMENT" }, { "input": "2 6 3 9", "output": "SEGMENT" }, { "input": "3 1 2 1", "output": "SEGMENT" }, { "input": "3 4 7 1", "output": "SEGMENT" }, { "input": "8 4 3 1", "output": "SEGMENT" }, { "input": "2 8 3 5", "output": "SEGMENT" }, { "input": "4 1 2 1", "output": "SEGMENT" }, { "input": "8 1 3 2", "output": "SEGMENT" }, { "input": "6 2 1 8", "output": "SEGMENT" }, { "input": "3 3 3 6", "output": "TRIANGLE" }, { "input": "3 6 3 3", "output": "TRIANGLE" }, { "input": "4 10 4 4", "output": "TRIANGLE" }, { "input": "1 1 2 1", "output": "TRIANGLE" }, { "input": "3 3 3 6", "output": "TRIANGLE" }, { "input": "5 4 5 5", "output": "TRIANGLE" }, { "input": "8 7 8 8", "output": "TRIANGLE" }, { "input": "3 3 3 1", "output": "TRIANGLE" }, { "input": "1 1 6 6", "output": "TRIANGLE" }, { "input": "1 9 1 9", "output": "TRIANGLE" }, { "input": "7 2 2 7", "output": "TRIANGLE" }, { "input": "7 2 3 2", "output": "TRIANGLE" }, { "input": "4 4 10 10", "output": "TRIANGLE" }, { "input": "7 7 10 7", "output": "TRIANGLE" }, { "input": "4 4 4 5", "output": "TRIANGLE" }, { "input": "1 10 9 2", "output": "TRIANGLE" }, { "input": "1 8 2 7", "output": "TRIANGLE" }, { "input": "4 3 2 8", "output": "TRIANGLE" }, { "input": "5 9 5 3", "output": "TRIANGLE" }, { "input": "4 10 3 5", "output": "TRIANGLE" } ]
1,665,949,742
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
60
4,505,600
def main(): lst = [] for i in range(4): lst.append(int(input())) lst.sort() seg = False ans = False for i in range(2): if lst[i]+lst[i + 1]==lst[i + 2]: seg = True elif lst[i]+lst[i + 1]>lst[i + 2]: ans = True if ans: print("TRIANGLE") elif seg: print("SEGMENT") else: print("IMPOSSIBLE") main()
Title: Triangle Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: Johnny has a younger sister Anne, who is very clever and smart. As she came home from the kindergarten, she told his brother about the task that her kindergartener asked her to solve. The task was just to construct a triangle out of four sticks of different colours. Naturally, one of the sticks is extra. It is not allowed to break the sticks or use their partial length. Anne has perfectly solved this task, now she is asking Johnny to do the same. The boy answered that he would cope with it without any difficulty. However, after a while he found out that different tricky things can occur. It can happen that it is impossible to construct a triangle of a positive area, but it is possible to construct a degenerate triangle. It can be so, that it is impossible to construct a degenerate triangle even. As Johnny is very lazy, he does not want to consider such a big amount of cases, he asks you to help him. Input Specification: The first line of the input contains four space-separated positive integer numbers not exceeding 100 — lengthes of the sticks. Output Specification: Output TRIANGLE if it is possible to construct a non-degenerate triangle. Output SEGMENT if the first case cannot take place and it is possible to construct a degenerate triangle. Output IMPOSSIBLE if it is impossible to construct any triangle. Remember that you are to use three sticks. It is not allowed to break the sticks or use their partial length. Demo Input: ['4 2 1 3\n', '7 2 2 4\n', '3 5 9 1\n'] Demo Output: ['TRIANGLE\n', 'SEGMENT\n', 'IMPOSSIBLE\n'] Note: none
```python def main(): lst = [] for i in range(4): lst.append(int(input())) lst.sort() seg = False ans = False for i in range(2): if lst[i]+lst[i + 1]==lst[i + 2]: seg = True elif lst[i]+lst[i + 1]>lst[i + 2]: ans = True if ans: print("TRIANGLE") elif seg: print("SEGMENT") else: print("IMPOSSIBLE") main() ```
-1
669
A
Little Artem and Presents
PROGRAMMING
800
[ "math" ]
null
null
Little Artem got *n* stones on his birthday and now wants to give some of them to Masha. He knows that Masha cares more about the fact of receiving the present, rather than the value of that present, so he wants to give her stones as many times as possible. However, Masha remembers the last present she received, so Artem can't give her the same number of stones twice in a row. For example, he can give her 3 stones, then 1 stone, then again 3 stones, but he can't give her 3 stones and then again 3 stones right after that. How many times can Artem give presents to Masha?
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=109) — number of stones Artem received on his birthday.
Print the maximum possible number of times Artem can give presents to Masha.
[ "1\n", "2\n", "3\n", "4\n" ]
[ "1\n", "1\n", "2\n", "3\n" ]
In the first sample, Artem can only give 1 stone to Masha. In the second sample, Atrem can give Masha 1 or 2 stones, though he can't give her 1 stone two times. In the third sample, Atrem can first give Masha 2 stones, a then 1 more stone. In the fourth sample, Atrem can first give Masha 1 stone, then 2 stones, and finally 1 stone again.
500
[ { "input": "1", "output": "1" }, { "input": "2", "output": "1" }, { "input": "3", "output": "2" }, { "input": "4", "output": "3" }, { "input": "100", "output": "67" }, { "input": "101", "output": "67" }, { "input": "102", "output": "68" }, { "input": "1000000000", "output": "666666667" }, { "input": "5", "output": "3" }, { "input": "6", "output": "4" }, { "input": "999999999", "output": "666666666" }, { "input": "999999998", "output": "666666665" }, { "input": "999999997", "output": "666666665" }, { "input": "999999996", "output": "666666664" }, { "input": "999999995", "output": "666666663" }, { "input": "999999994", "output": "666666663" }, { "input": "999999993", "output": "666666662" }, { "input": "999999992", "output": "666666661" }, { "input": "999999991", "output": "666666661" }, { "input": "1000", "output": "667" }, { "input": "10000", "output": "6667" }, { "input": "100000", "output": "66667" }, { "input": "1000000", "output": "666667" }, { "input": "10000000", "output": "6666667" }, { "input": "100000000", "output": "66666667" }, { "input": "7", "output": "5" } ]
1,626,814,876
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
77
6,758,400
num = int(input()) if num%3 == 0: print(num/3) else: print(num//3 + 1)
Title: Little Artem and Presents Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Artem got *n* stones on his birthday and now wants to give some of them to Masha. He knows that Masha cares more about the fact of receiving the present, rather than the value of that present, so he wants to give her stones as many times as possible. However, Masha remembers the last present she received, so Artem can't give her the same number of stones twice in a row. For example, he can give her 3 stones, then 1 stone, then again 3 stones, but he can't give her 3 stones and then again 3 stones right after that. How many times can Artem give presents to Masha? Input Specification: The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=109) — number of stones Artem received on his birthday. Output Specification: Print the maximum possible number of times Artem can give presents to Masha. Demo Input: ['1\n', '2\n', '3\n', '4\n'] Demo Output: ['1\n', '1\n', '2\n', '3\n'] Note: In the first sample, Artem can only give 1 stone to Masha. In the second sample, Atrem can give Masha 1 or 2 stones, though he can't give her 1 stone two times. In the third sample, Atrem can first give Masha 2 stones, a then 1 more stone. In the fourth sample, Atrem can first give Masha 1 stone, then 2 stones, and finally 1 stone again.
```python num = int(input()) if num%3 == 0: print(num/3) else: print(num//3 + 1) ```
0
50
A
Domino piling
PROGRAMMING
800
[ "greedy", "math" ]
A. Domino piling
2
256
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions.
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output one number — the maximal number of dominoes, which can be placed.
[ "2 4\n", "3 3\n" ]
[ "4\n", "4\n" ]
none
500
[ { "input": "2 4", "output": "4" }, { "input": "3 3", "output": "4" }, { "input": "1 5", "output": "2" }, { "input": "1 6", "output": "3" }, { "input": "1 15", "output": "7" }, { "input": "1 16", "output": "8" }, { "input": "2 5", "output": "5" }, { "input": "2 6", "output": "6" }, { "input": "2 7", "output": "7" }, { "input": "2 14", "output": "14" }, { "input": "2 15", "output": "15" }, { "input": "1 4", "output": "2" }, { "input": "2 16", "output": "16" }, { "input": "3 5", "output": "7" }, { "input": "3 6", "output": "9" }, { "input": "3 10", "output": "15" }, { "input": "3 14", "output": "21" }, { "input": "3 15", "output": "22" }, { "input": "3 16", "output": "24" }, { "input": "5 7", "output": "17" }, { "input": "16 16", "output": "128" }, { "input": "15 16", "output": "120" }, { "input": "2 3", "output": "3" }, { "input": "15 15", "output": "112" }, { "input": "14 16", "output": "112" }, { "input": "11 13", "output": "71" }, { "input": "5 16", "output": "40" }, { "input": "8 15", "output": "60" }, { "input": "2 2", "output": "2" }, { "input": "3 4", "output": "6" }, { "input": "4 4", "output": "8" }, { "input": "1 1", "output": "0" }, { "input": "1 2", "output": "1" }, { "input": "1 3", "output": "1" }, { "input": "14 15", "output": "105" } ]
1,673,191,700
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
60
0
M=eval(input()) N=eval(input()) if(M*N%2==0): d=M*N/2 print(d) else: d=M*N//2 print(d)
Title: Domino piling Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions. Input Specification: In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). Output Specification: Output one number — the maximal number of dominoes, which can be placed. Demo Input: ['2 4\n', '3 3\n'] Demo Output: ['4\n', '4\n'] Note: none
```python M=eval(input()) N=eval(input()) if(M*N%2==0): d=M*N/2 print(d) else: d=M*N//2 print(d) ```
-1