contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
686
|
A
|
Free Ice Cream
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
|
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
|
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
|
[
"5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n",
"5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n"
] |
[
"22 1\n",
"3 2\n"
] |
Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
| 500
|
[
{
"input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20",
"output": "22 1"
},
{
"input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98",
"output": "3 2"
},
{
"input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000",
"output": "7000000000 0"
},
{
"input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46",
"output": "46 0"
},
{
"input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100",
"output": "700 0"
},
{
"input": "1 0\n- 526403222",
"output": "0 1"
},
{
"input": "1 897986543\n- 371188251",
"output": "526798292 0"
},
{
"input": "1 0\n+ 1",
"output": "1 0"
},
{
"input": "1 0\n- 1",
"output": "0 1"
},
{
"input": "1 10\n+ 10",
"output": "20 0"
},
{
"input": "1 3\n- 5",
"output": "3 1"
},
{
"input": "1 0\n- 5",
"output": "0 1"
},
{
"input": "1 0\n+ 5",
"output": "5 0"
}
] | 1,615,823,070
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 77
| 307,200
|
a,b = input().split()
a,b =[int(a),int(b)]
distress=0
total = b
for i in range(a):
inp = eval(input())
if total+inp<0:
distress = distress + 1
else:
total = total+inp
print(f'{total} {distress}')
|
Title: Free Ice Cream
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
Input Specification:
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
Output Specification:
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
Demo Input:
['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n']
Demo Output:
['22 1\n', '3 2\n']
Note:
Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
|
```python
a,b = input().split()
a,b =[int(a),int(b)]
distress=0
total = b
for i in range(a):
inp = eval(input())
if total+inp<0:
distress = distress + 1
else:
total = total+inp
print(f'{total} {distress}')
```
| 3
|
|
946
|
A
|
Partition
|
PROGRAMMING
| 800
|
[
"greedy"
] | null | null |
You are given a sequence *a* consisting of *n* integers. You may partition this sequence into two sequences *b* and *c* in such a way that every element belongs exactly to one of these sequences.
Let *B* be the sum of elements belonging to *b*, and *C* be the sum of elements belonging to *c* (if some of these sequences is empty, then its sum is 0). What is the maximum possible value of *B*<=-<=*C*?
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in *a*.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (<=-<=100<=≤<=*a**i*<=≤<=100) — the elements of sequence *a*.
|
Print the maximum possible value of *B*<=-<=*C*, where *B* is the sum of elements of sequence *b*, and *C* is the sum of elements of sequence *c*.
|
[
"3\n1 -2 0\n",
"6\n16 23 16 15 42 8\n"
] |
[
"3\n",
"120\n"
] |
In the first example we may choose *b* = {1, 0}, *c* = { - 2}. Then *B* = 1, *C* = - 2, *B* - *C* = 3.
In the second example we choose *b* = {16, 23, 16, 15, 42, 8}, *c* = {} (an empty sequence). Then *B* = 120, *C* = 0, *B* - *C* = 120.
| 0
|
[
{
"input": "3\n1 -2 0",
"output": "3"
},
{
"input": "6\n16 23 16 15 42 8",
"output": "120"
},
{
"input": "1\n-1",
"output": "1"
},
{
"input": "100\n-100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100",
"output": "10000"
},
{
"input": "2\n-1 5",
"output": "6"
},
{
"input": "3\n-2 0 1",
"output": "3"
},
{
"input": "12\n-1 -2 -3 4 4 -6 -6 56 3 3 -3 3",
"output": "94"
},
{
"input": "4\n1 -1 1 -1",
"output": "4"
},
{
"input": "4\n100 -100 100 -100",
"output": "400"
},
{
"input": "3\n-2 -5 10",
"output": "17"
},
{
"input": "5\n1 -2 3 -4 5",
"output": "15"
},
{
"input": "3\n-100 100 -100",
"output": "300"
},
{
"input": "6\n1 -1 1 -1 1 -1",
"output": "6"
},
{
"input": "6\n2 -2 2 -2 2 -2",
"output": "12"
},
{
"input": "9\n12 93 -2 0 0 0 3 -3 -9",
"output": "122"
},
{
"input": "6\n-1 2 4 -5 -3 55",
"output": "70"
},
{
"input": "6\n-12 8 68 -53 1 -15",
"output": "157"
},
{
"input": "2\n-2 1",
"output": "3"
},
{
"input": "3\n100 -100 100",
"output": "300"
},
{
"input": "5\n100 100 -1 -100 2",
"output": "303"
},
{
"input": "6\n-5 -4 -3 -2 -1 0",
"output": "15"
},
{
"input": "6\n4 4 4 -3 -3 2",
"output": "20"
},
{
"input": "2\n-1 2",
"output": "3"
},
{
"input": "1\n100",
"output": "100"
},
{
"input": "5\n-1 -2 3 1 2",
"output": "9"
},
{
"input": "5\n100 -100 100 -100 100",
"output": "500"
},
{
"input": "5\n1 -1 1 -1 1",
"output": "5"
},
{
"input": "4\n0 0 0 -1",
"output": "1"
},
{
"input": "5\n100 -100 -1 2 100",
"output": "303"
},
{
"input": "2\n75 0",
"output": "75"
},
{
"input": "4\n55 56 -59 -58",
"output": "228"
},
{
"input": "2\n9 71",
"output": "80"
},
{
"input": "2\n9 70",
"output": "79"
},
{
"input": "2\n9 69",
"output": "78"
},
{
"input": "2\n100 -100",
"output": "200"
},
{
"input": "4\n-9 4 -9 5",
"output": "27"
},
{
"input": "42\n91 -27 -79 -56 80 -93 -23 10 80 94 61 -89 -64 81 34 99 31 -32 -69 92 79 -9 73 66 -8 64 99 99 58 -19 -40 21 1 -33 93 -23 -62 27 55 41 57 36",
"output": "2348"
},
{
"input": "7\n-1 2 2 2 -1 2 -1",
"output": "11"
},
{
"input": "6\n-12 8 17 -69 7 -88",
"output": "201"
},
{
"input": "3\n1 -2 5",
"output": "8"
},
{
"input": "6\n-2 3 -4 5 6 -1",
"output": "21"
},
{
"input": "2\n-5 1",
"output": "6"
},
{
"input": "4\n2 2 -2 4",
"output": "10"
},
{
"input": "68\n21 47 -75 -25 64 83 83 -21 89 24 43 44 -35 34 -42 92 -96 -52 -66 64 14 -87 25 -61 -78 83 -96 -18 95 83 -93 -28 75 49 87 65 -93 -69 -2 95 -24 -36 -61 -71 88 -53 -93 -51 -81 -65 -53 -46 -56 6 65 58 19 100 57 61 -53 44 -58 48 -8 80 -88 72",
"output": "3991"
},
{
"input": "5\n5 5 -10 -1 1",
"output": "22"
},
{
"input": "3\n-1 2 3",
"output": "6"
},
{
"input": "76\n57 -38 -48 -81 93 -32 96 55 -44 2 38 -46 42 64 71 -73 95 31 -39 -62 -1 75 -17 57 28 52 12 -11 82 -84 59 -86 73 -97 34 97 -57 -85 -6 39 -5 -54 95 24 -44 35 -18 9 91 7 -22 -61 -80 54 -40 74 -90 15 -97 66 -52 -49 -24 65 21 -93 -29 -24 -4 -1 76 -93 7 -55 -53 1",
"output": "3787"
},
{
"input": "5\n-1 -2 1 2 3",
"output": "9"
},
{
"input": "4\n2 2 -2 -2",
"output": "8"
},
{
"input": "6\n100 -100 100 -100 100 -100",
"output": "600"
},
{
"input": "100\n-59 -33 34 0 69 24 -22 58 62 -36 5 45 -19 -73 61 -9 95 42 -73 -64 91 -96 2 53 -8 82 -79 16 18 -5 -53 26 71 38 -31 12 -33 -1 -65 -6 3 -89 22 33 -27 -36 41 11 -47 -32 47 -56 -38 57 -63 -41 23 41 29 78 16 -65 90 -58 -12 6 -60 42 -36 -52 -54 -95 -10 29 70 50 -94 1 93 48 -71 -77 -16 54 56 -60 66 76 31 8 44 -61 -74 23 37 38 18 -18 29 41",
"output": "4362"
},
{
"input": "2\n-1 1",
"output": "2"
},
{
"input": "3\n1 -2 100",
"output": "103"
},
{
"input": "5\n1 -2 3 1 2",
"output": "9"
},
{
"input": "10\n100 -10 -100 10 10 10 10 10 10 10",
"output": "280"
},
{
"input": "4\n2 0 -2 4",
"output": "8"
},
{
"input": "4\n3 -3 1 -1",
"output": "8"
},
{
"input": "3\n1 -1 1",
"output": "3"
},
{
"input": "4\n2 5 -2 4",
"output": "13"
},
{
"input": "2\n-2 2",
"output": "4"
},
{
"input": "3\n1 -2 1",
"output": "4"
},
{
"input": "5\n-1 -2 1 1 -1",
"output": "6"
},
{
"input": "4\n-2 0 2 4",
"output": "8"
},
{
"input": "8\n-42 7 87 -16 -5 65 -88 1",
"output": "311"
},
{
"input": "3\n1 -3 4",
"output": "8"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "3\n-1 2 -1",
"output": "4"
},
{
"input": "18\n-21 12 65 66 -24 62 82 35 -45 -47 28 37 5 -32 22 -14 -69 -95",
"output": "761"
},
{
"input": "4\n-1 1 -1 1",
"output": "4"
},
{
"input": "5\n-1 2 1 1 1",
"output": "6"
},
{
"input": "3\n1 1 1",
"output": "3"
}
] | 1,576,870,063
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 72
| 155
| 0
|
n=input()
l=list(map(int,input().split()))
c=0
for i in l:
c+=abs(i)
print(c)
|
Title: Partition
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a sequence *a* consisting of *n* integers. You may partition this sequence into two sequences *b* and *c* in such a way that every element belongs exactly to one of these sequences.
Let *B* be the sum of elements belonging to *b*, and *C* be the sum of elements belonging to *c* (if some of these sequences is empty, then its sum is 0). What is the maximum possible value of *B*<=-<=*C*?
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in *a*.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (<=-<=100<=≤<=*a**i*<=≤<=100) — the elements of sequence *a*.
Output Specification:
Print the maximum possible value of *B*<=-<=*C*, where *B* is the sum of elements of sequence *b*, and *C* is the sum of elements of sequence *c*.
Demo Input:
['3\n1 -2 0\n', '6\n16 23 16 15 42 8\n']
Demo Output:
['3\n', '120\n']
Note:
In the first example we may choose *b* = {1, 0}, *c* = { - 2}. Then *B* = 1, *C* = - 2, *B* - *C* = 3.
In the second example we choose *b* = {16, 23, 16, 15, 42, 8}, *c* = {} (an empty sequence). Then *B* = 120, *C* = 0, *B* - *C* = 120.
|
```python
n=input()
l=list(map(int,input().split()))
c=0
for i in l:
c+=abs(i)
print(c)
```
| 3
|
|
743
|
B
|
Chloe and the sequence
|
PROGRAMMING
| 1,200
|
[
"binary search",
"bitmasks",
"constructive algorithms",
"implementation"
] | null | null |
Chloe, the same as Vladik, is a competitive programmer. She didn't have any problems to get to the olympiad like Vladik, but she was confused by the task proposed on the olympiad.
Let's consider the following algorithm of generating a sequence of integers. Initially we have a sequence consisting of a single element equal to 1. Then we perform (*n*<=-<=1) steps. On each step we take the sequence we've got on the previous step, append it to the end of itself and insert in the middle the minimum positive integer we haven't used before. For example, we get the sequence [1,<=2,<=1] after the first step, the sequence [1,<=2,<=1,<=3,<=1,<=2,<=1] after the second step.
The task is to find the value of the element with index *k* (the elements are numbered from 1) in the obtained sequence, i. e. after (*n*<=-<=1) steps.
Please help Chloe to solve the problem!
|
The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=50, 1<=≤<=*k*<=≤<=2*n*<=-<=1).
|
Print single integer — the integer at the *k*-th position in the obtained sequence.
|
[
"3 2\n",
"4 8\n"
] |
[
"2",
"4"
] |
In the first sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1]. The number on the second position is 2.
In the second sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1, 4, 1, 2, 1, 3, 1, 2, 1]. The number on the eighth position is 4.
| 1,000
|
[
{
"input": "3 2",
"output": "2"
},
{
"input": "4 8",
"output": "4"
},
{
"input": "5 27",
"output": "1"
},
{
"input": "7 44",
"output": "3"
},
{
"input": "15 18432",
"output": "12"
},
{
"input": "20 259676",
"output": "3"
},
{
"input": "30 671088640",
"output": "28"
},
{
"input": "38 137438953472",
"output": "38"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "3 3",
"output": "1"
},
{
"input": "4 12",
"output": "3"
},
{
"input": "8 224",
"output": "6"
},
{
"input": "13 1368",
"output": "4"
},
{
"input": "16 49152",
"output": "15"
},
{
"input": "19 1024",
"output": "11"
},
{
"input": "24 15204352",
"output": "20"
},
{
"input": "27 6586544",
"output": "5"
},
{
"input": "31 536870912",
"output": "30"
},
{
"input": "38 94489280512",
"output": "34"
},
{
"input": "42 215268308020",
"output": "3"
},
{
"input": "42 3452074721280",
"output": "21"
},
{
"input": "46 34394312982528",
"output": "15"
},
{
"input": "48 133865540681728",
"output": "39"
},
{
"input": "49 76541041985542",
"output": "2"
},
{
"input": "49 104822971826176",
"output": "34"
},
{
"input": "49 351843720888320",
"output": "47"
},
{
"input": "50 743042492421629",
"output": "1"
},
{
"input": "50 666266740436818",
"output": "2"
},
{
"input": "50 704239287953456",
"output": "5"
},
{
"input": "50 116938486513664",
"output": "17"
},
{
"input": "50 806423059496960",
"output": "37"
},
{
"input": "50 985162418487296",
"output": "48"
},
{
"input": "50 844424930131968",
"output": "49"
},
{
"input": "50 562949953421312",
"output": "50"
},
{
"input": "50 1",
"output": "1"
},
{
"input": "50 1125899906842623",
"output": "1"
},
{
"input": "50 1125899906842620",
"output": "3"
},
{
"input": "39 549755813887",
"output": "1"
},
{
"input": "50 100000000000",
"output": "12"
}
] | 1,640,961,707
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 39
| 109
| 0
|
import math
n, k = [int(i) for i in input().split()]
c = 0
while k % 2 == 0:
k = k//2
c += 1
print(c+1)
|
Title: Chloe and the sequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Chloe, the same as Vladik, is a competitive programmer. She didn't have any problems to get to the olympiad like Vladik, but she was confused by the task proposed on the olympiad.
Let's consider the following algorithm of generating a sequence of integers. Initially we have a sequence consisting of a single element equal to 1. Then we perform (*n*<=-<=1) steps. On each step we take the sequence we've got on the previous step, append it to the end of itself and insert in the middle the minimum positive integer we haven't used before. For example, we get the sequence [1,<=2,<=1] after the first step, the sequence [1,<=2,<=1,<=3,<=1,<=2,<=1] after the second step.
The task is to find the value of the element with index *k* (the elements are numbered from 1) in the obtained sequence, i. e. after (*n*<=-<=1) steps.
Please help Chloe to solve the problem!
Input Specification:
The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=50, 1<=≤<=*k*<=≤<=2*n*<=-<=1).
Output Specification:
Print single integer — the integer at the *k*-th position in the obtained sequence.
Demo Input:
['3 2\n', '4 8\n']
Demo Output:
['2', '4']
Note:
In the first sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1]. The number on the second position is 2.
In the second sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1, 4, 1, 2, 1, 3, 1, 2, 1]. The number on the eighth position is 4.
|
```python
import math
n, k = [int(i) for i in input().split()]
c = 0
while k % 2 == 0:
k = k//2
c += 1
print(c+1)
```
| 3
|
|
604
|
A
|
Uncowed Forces
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Kevin Sun has just finished competing in Codeforces Round #334! The round was 120 minutes long and featured five problems with maximum point values of 500, 1000, 1500, 2000, and 2500, respectively. Despite the challenging tasks, Kevin was uncowed and bulldozed through all of them, distinguishing himself from the herd as the best cowmputer scientist in all of Bovinia. Kevin knows his submission time for each problem, the number of wrong submissions that he made on each problem, and his total numbers of successful and unsuccessful hacks. Because Codeforces scoring is complicated, Kevin wants you to write a program to compute his final score.
Codeforces scores are computed as follows: If the maximum point value of a problem is *x*, and Kevin submitted correctly at minute *m* but made *w* wrong submissions, then his score on that problem is . His total score is equal to the sum of his scores for each problem. In addition, Kevin's total score gets increased by 100 points for each successful hack, but gets decreased by 50 points for each unsuccessful hack.
All arithmetic operations are performed with absolute precision and no rounding. It is guaranteed that Kevin's final score is an integer.
|
The first line of the input contains five space-separated integers *m*1, *m*2, *m*3, *m*4, *m*5, where *m**i* (0<=≤<=*m**i*<=≤<=119) is the time of Kevin's last submission for problem *i*. His last submission is always correct and gets accepted.
The second line contains five space-separated integers *w*1, *w*2, *w*3, *w*4, *w*5, where *w**i* (0<=≤<=*w**i*<=≤<=10) is Kevin's number of wrong submissions on problem *i*.
The last line contains two space-separated integers *h**s* and *h**u* (0<=≤<=*h**s*,<=*h**u*<=≤<=20), denoting the Kevin's numbers of successful and unsuccessful hacks, respectively.
|
Print a single integer, the value of Kevin's final score.
|
[
"20 40 60 80 100\n0 1 2 3 4\n1 0\n",
"119 119 119 119 119\n0 0 0 0 0\n10 0\n"
] |
[
"4900\n",
"4930\n"
] |
In the second sample, Kevin takes 119 minutes on all of the problems. Therefore, he gets <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/42158dc2bc78cd21fa679530ae9ef8b9ea298d15.png" style="max-width: 100.0%;max-height: 100.0%;"/> of the points on each problem. So his score from solving problems is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/fdf392d8508500b57f8057ac0c4c892ab5f925a2.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Adding in 10·100 = 1000 points from hacks, his total score becomes 3930 + 1000 = 4930.
| 500
|
[
{
"input": "20 40 60 80 100\n0 1 2 3 4\n1 0",
"output": "4900"
},
{
"input": "119 119 119 119 119\n0 0 0 0 0\n10 0",
"output": "4930"
},
{
"input": "3 6 13 38 60\n6 10 10 3 8\n9 9",
"output": "5088"
},
{
"input": "21 44 11 68 75\n6 2 4 8 4\n2 8",
"output": "4522"
},
{
"input": "16 112 50 114 68\n1 4 8 4 9\n19 11",
"output": "5178"
},
{
"input": "55 66 75 44 47\n6 0 6 6 10\n19 0",
"output": "6414"
},
{
"input": "47 11 88 5 110\n6 10 4 2 3\n10 6",
"output": "5188"
},
{
"input": "5 44 61 103 92\n9 0 10 4 8\n15 7",
"output": "4914"
},
{
"input": "115 53 96 62 110\n7 8 1 7 9\n7 16",
"output": "3416"
},
{
"input": "102 83 26 6 11\n3 4 1 8 3\n17 14",
"output": "6704"
},
{
"input": "36 102 73 101 19\n5 9 2 2 6\n4 13",
"output": "4292"
},
{
"input": "40 115 93 107 113\n5 7 2 6 8\n6 17",
"output": "2876"
},
{
"input": "53 34 53 107 81\n4 3 1 10 8\n7 7",
"output": "4324"
},
{
"input": "113 37 4 84 66\n2 0 10 3 0\n20 19",
"output": "6070"
},
{
"input": "10 53 101 62 1\n8 0 9 7 9\n0 11",
"output": "4032"
},
{
"input": "45 45 75 36 76\n6 2 2 0 0\n8 17",
"output": "5222"
},
{
"input": "47 16 44 78 111\n7 9 8 0 2\n1 19",
"output": "3288"
},
{
"input": "7 54 39 102 31\n6 0 2 10 1\n18 3",
"output": "6610"
},
{
"input": "0 46 86 72 40\n1 5 5 5 9\n6 5",
"output": "4924"
},
{
"input": "114 4 45 78 113\n0 4 8 10 2\n10 12",
"output": "4432"
},
{
"input": "56 56 96 105 107\n4 9 10 4 8\n2 1",
"output": "3104"
},
{
"input": "113 107 59 50 56\n3 7 10 6 3\n10 12",
"output": "4586"
},
{
"input": "96 104 9 94 84\n6 10 7 8 3\n14 11",
"output": "4754"
},
{
"input": "98 15 116 43 55\n4 3 0 9 3\n10 7",
"output": "5400"
},
{
"input": "0 26 99 108 35\n0 4 3 0 10\n9 5",
"output": "5388"
},
{
"input": "89 24 51 49 84\n5 6 2 2 9\n2 14",
"output": "4066"
},
{
"input": "57 51 76 45 96\n1 0 4 3 6\n12 15",
"output": "5156"
},
{
"input": "79 112 37 36 116\n2 8 4 7 5\n4 12",
"output": "3872"
},
{
"input": "71 42 60 20 7\n7 1 1 10 6\n1 7",
"output": "5242"
},
{
"input": "86 10 66 80 55\n0 2 5 10 5\n15 6",
"output": "5802"
},
{
"input": "66 109 22 22 62\n3 1 5 4 5\n10 5",
"output": "5854"
},
{
"input": "97 17 43 84 58\n2 8 3 8 6\n10 7",
"output": "5028"
},
{
"input": "109 83 5 114 104\n6 0 3 9 5\n5 2",
"output": "4386"
},
{
"input": "94 18 24 91 105\n2 0 7 10 3\n1 4",
"output": "4118"
},
{
"input": "64 17 86 59 45\n8 0 10 2 2\n4 4",
"output": "5144"
},
{
"input": "70 84 31 57 2\n7 0 0 2 7\n12 5",
"output": "6652"
},
{
"input": "98 118 117 86 4\n2 10 9 7 5\n11 15",
"output": "4476"
},
{
"input": "103 110 101 97 70\n4 2 1 0 5\n7 5",
"output": "4678"
},
{
"input": "78 96 6 97 62\n7 7 9 2 9\n10 3",
"output": "4868"
},
{
"input": "95 28 3 31 115\n1 9 0 7 3\n10 13",
"output": "5132"
},
{
"input": "45 17 116 58 3\n8 8 7 6 4\n3 19",
"output": "3992"
},
{
"input": "19 12 0 113 77\n3 0 10 9 2\n8 6",
"output": "5040"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0",
"output": "7500"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n20 0",
"output": "9500"
},
{
"input": "119 119 119 119 119\n10 10 10 10 10\n0 20",
"output": "1310"
},
{
"input": "0 0 0 0 0\n10 10 10 10 10\n0 20",
"output": "4150"
},
{
"input": "119 0 0 0 0\n10 0 0 0 0\n5 5",
"output": "7400"
},
{
"input": "0 119 0 0 0\n0 10 0 0 0\n5 5",
"output": "7050"
},
{
"input": "0 0 119 0 0\n0 0 10 0 0\n0 0",
"output": "6450"
},
{
"input": "0 0 0 119 0\n0 0 0 10 0\n5 5",
"output": "6350"
},
{
"input": "0 0 0 0 119\n0 0 0 0 10\n5 5",
"output": "6060"
},
{
"input": "119 0 0 0 0\n2 0 0 0 0\n5 5",
"output": "7412"
},
{
"input": "0 119 0 0 0\n0 2 0 0 0\n5 5",
"output": "7174"
},
{
"input": "0 0 119 0 0\n0 0 2 0 0\n5 5",
"output": "6936"
},
{
"input": "0 0 0 119 0\n0 0 0 2 0\n5 5",
"output": "6698"
},
{
"input": "0 0 0 0 119\n0 0 0 0 2\n5 5",
"output": "6460"
},
{
"input": "119 0 0 0 0\n0 0 0 0 0\n4 9",
"output": "7212"
}
] | 1,609,238,334
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 57
| 155
| 819,200
|
import math
import os
import random
import re
import sys
import functools
from operator import itemgetter, attrgetter
from collections import Counter
if __name__ == '__main__':
Y = lambda: list(map(int, input().split()))
P = lambda: map(int, input().split())
N = lambda: int(input())
m = Y()
w = Y()
hs, hu = P()
pt, ans = [500, 1000, 1500, 2000, 2500], 0
mx_pt = lambda x, m, w: max((30 * x) / 100, (1 - m / 250) * x - 50 * w)
for i in range(5):
ans += mx_pt(pt[i], m[i], w[i])
ans = ans + (hs * 100 - hu * 50)
print(int(ans))
|
Title: Uncowed Forces
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kevin Sun has just finished competing in Codeforces Round #334! The round was 120 minutes long and featured five problems with maximum point values of 500, 1000, 1500, 2000, and 2500, respectively. Despite the challenging tasks, Kevin was uncowed and bulldozed through all of them, distinguishing himself from the herd as the best cowmputer scientist in all of Bovinia. Kevin knows his submission time for each problem, the number of wrong submissions that he made on each problem, and his total numbers of successful and unsuccessful hacks. Because Codeforces scoring is complicated, Kevin wants you to write a program to compute his final score.
Codeforces scores are computed as follows: If the maximum point value of a problem is *x*, and Kevin submitted correctly at minute *m* but made *w* wrong submissions, then his score on that problem is . His total score is equal to the sum of his scores for each problem. In addition, Kevin's total score gets increased by 100 points for each successful hack, but gets decreased by 50 points for each unsuccessful hack.
All arithmetic operations are performed with absolute precision and no rounding. It is guaranteed that Kevin's final score is an integer.
Input Specification:
The first line of the input contains five space-separated integers *m*1, *m*2, *m*3, *m*4, *m*5, where *m**i* (0<=≤<=*m**i*<=≤<=119) is the time of Kevin's last submission for problem *i*. His last submission is always correct and gets accepted.
The second line contains five space-separated integers *w*1, *w*2, *w*3, *w*4, *w*5, where *w**i* (0<=≤<=*w**i*<=≤<=10) is Kevin's number of wrong submissions on problem *i*.
The last line contains two space-separated integers *h**s* and *h**u* (0<=≤<=*h**s*,<=*h**u*<=≤<=20), denoting the Kevin's numbers of successful and unsuccessful hacks, respectively.
Output Specification:
Print a single integer, the value of Kevin's final score.
Demo Input:
['20 40 60 80 100\n0 1 2 3 4\n1 0\n', '119 119 119 119 119\n0 0 0 0 0\n10 0\n']
Demo Output:
['4900\n', '4930\n']
Note:
In the second sample, Kevin takes 119 minutes on all of the problems. Therefore, he gets <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/42158dc2bc78cd21fa679530ae9ef8b9ea298d15.png" style="max-width: 100.0%;max-height: 100.0%;"/> of the points on each problem. So his score from solving problems is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/fdf392d8508500b57f8057ac0c4c892ab5f925a2.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Adding in 10·100 = 1000 points from hacks, his total score becomes 3930 + 1000 = 4930.
|
```python
import math
import os
import random
import re
import sys
import functools
from operator import itemgetter, attrgetter
from collections import Counter
if __name__ == '__main__':
Y = lambda: list(map(int, input().split()))
P = lambda: map(int, input().split())
N = lambda: int(input())
m = Y()
w = Y()
hs, hu = P()
pt, ans = [500, 1000, 1500, 2000, 2500], 0
mx_pt = lambda x, m, w: max((30 * x) / 100, (1 - m / 250) * x - 50 * w)
for i in range(5):
ans += mx_pt(pt[i], m[i], w[i])
ans = ans + (hs * 100 - hu * 50)
print(int(ans))
```
| 3
|
|
689
|
A
|
Mike and Cellphone
|
PROGRAMMING
| 1,400
|
[
"brute force",
"constructive algorithms",
"implementation"
] | null | null |
While swimming at the beach, Mike has accidentally dropped his cellphone into the water. There was no worry as he bought a cheap replacement phone with an old-fashioned keyboard. The keyboard has only ten digital equal-sized keys, located in the following way:
Together with his old phone, he lost all his contacts and now he can only remember the way his fingers moved when he put some number in. One can formally consider finger movements as a sequence of vectors connecting centers of keys pressed consecutively to put in a number. For example, the finger movements for number "586" are the same as finger movements for number "253":
Mike has already put in a number by his "finger memory" and started calling it, so he is now worrying, can he be sure that he is calling the correct number? In other words, is there any other number, that has the same finger movements?
|
The first line of the input contains the only integer *n* (1<=≤<=*n*<=≤<=9) — the number of digits in the phone number that Mike put in.
The second line contains the string consisting of *n* digits (characters from '0' to '9') representing the number that Mike put in.
|
If there is no other phone number with the same finger movements and Mike can be sure he is calling the correct number, print "YES" (without quotes) in the only line.
Otherwise print "NO" (without quotes) in the first line.
|
[
"3\n586\n",
"2\n09\n",
"9\n123456789\n",
"3\n911\n"
] |
[
"NO\n",
"NO\n",
"YES\n",
"YES\n"
] |
You can find the picture clarifying the first sample case in the statement above.
| 500
|
[
{
"input": "3\n586",
"output": "NO"
},
{
"input": "2\n09",
"output": "NO"
},
{
"input": "9\n123456789",
"output": "YES"
},
{
"input": "3\n911",
"output": "YES"
},
{
"input": "3\n089",
"output": "NO"
},
{
"input": "3\n159",
"output": "YES"
},
{
"input": "9\n000000000",
"output": "NO"
},
{
"input": "4\n0874",
"output": "NO"
},
{
"input": "6\n235689",
"output": "NO"
},
{
"input": "2\n10",
"output": "YES"
},
{
"input": "3\n358",
"output": "NO"
},
{
"input": "6\n123456",
"output": "NO"
},
{
"input": "1\n0",
"output": "NO"
},
{
"input": "4\n0068",
"output": "NO"
},
{
"input": "6\n021149",
"output": "YES"
},
{
"input": "5\n04918",
"output": "YES"
},
{
"input": "2\n05",
"output": "NO"
},
{
"input": "4\n0585",
"output": "NO"
},
{
"input": "4\n0755",
"output": "NO"
},
{
"input": "2\n08",
"output": "NO"
},
{
"input": "4\n0840",
"output": "NO"
},
{
"input": "9\n103481226",
"output": "YES"
},
{
"input": "4\n1468",
"output": "NO"
},
{
"input": "7\n1588216",
"output": "NO"
},
{
"input": "9\n188758557",
"output": "NO"
},
{
"input": "1\n2",
"output": "NO"
},
{
"input": "2\n22",
"output": "NO"
},
{
"input": "8\n23482375",
"output": "YES"
},
{
"input": "9\n246112056",
"output": "YES"
},
{
"input": "9\n256859223",
"output": "NO"
},
{
"input": "6\n287245",
"output": "NO"
},
{
"input": "8\n28959869",
"output": "NO"
},
{
"input": "9\n289887167",
"output": "YES"
},
{
"input": "4\n3418",
"output": "NO"
},
{
"input": "4\n3553",
"output": "NO"
},
{
"input": "2\n38",
"output": "NO"
},
{
"input": "6\n386126",
"output": "NO"
},
{
"input": "6\n392965",
"output": "NO"
},
{
"input": "1\n4",
"output": "NO"
},
{
"input": "6\n423463",
"output": "NO"
},
{
"input": "4\n4256",
"output": "NO"
},
{
"input": "8\n42937903",
"output": "YES"
},
{
"input": "1\n5",
"output": "NO"
},
{
"input": "8\n50725390",
"output": "YES"
},
{
"input": "9\n515821866",
"output": "NO"
},
{
"input": "2\n56",
"output": "NO"
},
{
"input": "2\n57",
"output": "NO"
},
{
"input": "7\n5740799",
"output": "NO"
},
{
"input": "9\n582526521",
"output": "NO"
},
{
"input": "9\n585284126",
"output": "NO"
},
{
"input": "1\n6",
"output": "NO"
},
{
"input": "3\n609",
"output": "NO"
},
{
"input": "2\n63",
"output": "NO"
},
{
"input": "3\n633",
"output": "NO"
},
{
"input": "7\n6668940",
"output": "NO"
},
{
"input": "5\n66883",
"output": "NO"
},
{
"input": "2\n68",
"output": "NO"
},
{
"input": "5\n69873",
"output": "YES"
},
{
"input": "1\n7",
"output": "NO"
},
{
"input": "4\n7191",
"output": "YES"
},
{
"input": "9\n722403540",
"output": "YES"
},
{
"input": "9\n769554547",
"output": "NO"
},
{
"input": "3\n780",
"output": "NO"
},
{
"input": "5\n78248",
"output": "NO"
},
{
"input": "4\n7844",
"output": "NO"
},
{
"input": "4\n7868",
"output": "NO"
},
{
"input": "1\n8",
"output": "NO"
},
{
"input": "6\n817332",
"output": "YES"
},
{
"input": "7\n8465393",
"output": "YES"
},
{
"input": "7\n8526828",
"output": "NO"
},
{
"input": "8\n85812664",
"output": "NO"
},
{
"input": "8\n93008225",
"output": "YES"
},
{
"input": "7\n9454566",
"output": "NO"
},
{
"input": "4\n9625",
"output": "NO"
},
{
"input": "8\n97862407",
"output": "YES"
},
{
"input": "3\n993",
"output": "NO"
},
{
"input": "3\n267",
"output": "YES"
},
{
"input": "3\n249",
"output": "YES"
},
{
"input": "3\n672",
"output": "YES"
},
{
"input": "3\n176",
"output": "YES"
},
{
"input": "3\n123",
"output": "NO"
},
{
"input": "3\n367",
"output": "YES"
},
{
"input": "2\n12",
"output": "NO"
},
{
"input": "4\n2580",
"output": "YES"
},
{
"input": "2\n20",
"output": "YES"
},
{
"input": "3\n492",
"output": "YES"
},
{
"input": "3\n167",
"output": "YES"
},
{
"input": "3\n970",
"output": "NO"
},
{
"input": "3\n460",
"output": "NO"
},
{
"input": "4\n4268",
"output": "NO"
},
{
"input": "4\n9394",
"output": "YES"
},
{
"input": "2\n13",
"output": "NO"
},
{
"input": "3\n729",
"output": "YES"
},
{
"input": "6\n456893",
"output": "YES"
}
] | 1,593,075,790
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 4
| 155
| 20,172,800
|
t=[[1,2,3],[4,5,6],[7,8,9],['x',0,'x']]
a= int(input())
f=[]
s = input()
for j in s:
if len(f)==0:
for u in range(4):
if int(j) in t[u]:
f.append([u,t[u].index(int(j))])
break
else:
for u in range(4):
if int(j) in t[u]:
f.append([u-f[-1][0],t[u].index(int(j))-f[-1][1]])
break
#print(f)
fdw=0
for k in range(4):
for y in range(3):
if k!=f[0][0] and y!=f[0][1]:
jh=0
de=0
for l in range(1,len(f)):
if l==1:
ds=k+f[l][0]
vf=y+f[l][1]
if 0<=ds<4 and 0<=vf<3:
if t[ds][vf]!='x':
de=([ds,vf])
pass
else:
jh+=1
break
else:
jh+=1
break
else:
ds=de[0]+f[l][0]
vf=de[1]+f[l][1]
if 0<=ds <4 and 0<=vf <3:
if t[ds][vf]!='x':
de=([ds,vf])
pass
else:
jh+=1
break
else:
jh+=1
break
#print(de,k,y)
if jh==0:
print('NO')
fdw+=1
break
else:
pass
if fdw>0:
break
else:
pass
if fdw>0:
break
else:
pass
if fdw==0:
print('YES')
|
Title: Mike and Cellphone
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
While swimming at the beach, Mike has accidentally dropped his cellphone into the water. There was no worry as he bought a cheap replacement phone with an old-fashioned keyboard. The keyboard has only ten digital equal-sized keys, located in the following way:
Together with his old phone, he lost all his contacts and now he can only remember the way his fingers moved when he put some number in. One can formally consider finger movements as a sequence of vectors connecting centers of keys pressed consecutively to put in a number. For example, the finger movements for number "586" are the same as finger movements for number "253":
Mike has already put in a number by his "finger memory" and started calling it, so he is now worrying, can he be sure that he is calling the correct number? In other words, is there any other number, that has the same finger movements?
Input Specification:
The first line of the input contains the only integer *n* (1<=≤<=*n*<=≤<=9) — the number of digits in the phone number that Mike put in.
The second line contains the string consisting of *n* digits (characters from '0' to '9') representing the number that Mike put in.
Output Specification:
If there is no other phone number with the same finger movements and Mike can be sure he is calling the correct number, print "YES" (without quotes) in the only line.
Otherwise print "NO" (without quotes) in the first line.
Demo Input:
['3\n586\n', '2\n09\n', '9\n123456789\n', '3\n911\n']
Demo Output:
['NO\n', 'NO\n', 'YES\n', 'YES\n']
Note:
You can find the picture clarifying the first sample case in the statement above.
|
```python
t=[[1,2,3],[4,5,6],[7,8,9],['x',0,'x']]
a= int(input())
f=[]
s = input()
for j in s:
if len(f)==0:
for u in range(4):
if int(j) in t[u]:
f.append([u,t[u].index(int(j))])
break
else:
for u in range(4):
if int(j) in t[u]:
f.append([u-f[-1][0],t[u].index(int(j))-f[-1][1]])
break
#print(f)
fdw=0
for k in range(4):
for y in range(3):
if k!=f[0][0] and y!=f[0][1]:
jh=0
de=0
for l in range(1,len(f)):
if l==1:
ds=k+f[l][0]
vf=y+f[l][1]
if 0<=ds<4 and 0<=vf<3:
if t[ds][vf]!='x':
de=([ds,vf])
pass
else:
jh+=1
break
else:
jh+=1
break
else:
ds=de[0]+f[l][0]
vf=de[1]+f[l][1]
if 0<=ds <4 and 0<=vf <3:
if t[ds][vf]!='x':
de=([ds,vf])
pass
else:
jh+=1
break
else:
jh+=1
break
#print(de,k,y)
if jh==0:
print('NO')
fdw+=1
break
else:
pass
if fdw>0:
break
else:
pass
if fdw>0:
break
else:
pass
if fdw==0:
print('YES')
```
| 0
|
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,679,735,533
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 46
| 0
|
for _ in range(int(input())):
s= input()
n= len(s)
if n> 10:
print(s[0] + str(n- 2) + s[-1])
else:
print(s)
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
for _ in range(int(input())):
s= input()
n= len(s)
if n> 10:
print(s[0] + str(n- 2) + s[-1])
else:
print(s)
```
| 3.977
|
637
|
B
|
Chat Order
|
PROGRAMMING
| 1,200
|
[
"*special",
"binary search",
"constructive algorithms",
"data structures",
"sortings"
] | null | null |
Polycarp is a big lover of killing time in social networks. A page with a chatlist in his favourite network is made so that when a message is sent to some friend, his friend's chat rises to the very top of the page. The relative order of the other chats doesn't change. If there was no chat with this friend before, then a new chat is simply inserted to the top of the list.
Assuming that the chat list is initially empty, given the sequence of Polycaprus' messages make a list of chats after all of his messages are processed. Assume that no friend wrote any message to Polycarpus.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Polycarpus' messages. Next *n* lines enlist the message recipients in the order in which the messages were sent. The name of each participant is a non-empty sequence of lowercase English letters of length at most 10.
|
Print all the recipients to who Polycarp talked to in the order of chats with them, from top to bottom.
|
[
"4\nalex\nivan\nroman\nivan\n",
"8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina\n"
] |
[
"ivan\nroman\nalex\n",
"alina\nmaria\nekaterina\ndarya\n"
] |
In the first test case Polycarpus first writes to friend by name "alex", and the list looks as follows:
1. alex
Then Polycarpus writes to friend by name "ivan" and the list looks as follows:
1. ivan 1. alex
Polycarpus writes the third message to friend by name "roman" and the list looks as follows:
1. roman 1. ivan 1. alex
Polycarpus writes the fourth message to friend by name "ivan", to who he has already sent a message, so the list of chats changes as follows:
1. ivan 1. roman 1. alex
| 1,000
|
[
{
"input": "4\nalex\nivan\nroman\nivan",
"output": "ivan\nroman\nalex"
},
{
"input": "8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina",
"output": "alina\nmaria\nekaterina\ndarya"
},
{
"input": "1\nwdi",
"output": "wdi"
},
{
"input": "2\nypg\nypg",
"output": "ypg"
},
{
"input": "3\nexhll\nexhll\narruapexj",
"output": "arruapexj\nexhll"
},
{
"input": "3\nfv\nle\nle",
"output": "le\nfv"
},
{
"input": "8\nm\nm\nm\nm\nm\nm\nm\nm",
"output": "m"
},
{
"input": "10\nr\nr\ni\nw\nk\nr\nb\nu\nu\nr",
"output": "r\nu\nb\nk\nw\ni"
},
{
"input": "7\ne\nfau\ncmk\nnzs\nby\nwx\ntjmok",
"output": "tjmok\nwx\nby\nnzs\ncmk\nfau\ne"
},
{
"input": "6\nklrj\nwe\nklrj\nwe\nwe\nwe",
"output": "we\nklrj"
},
{
"input": "8\nzncybqmh\naeebef\nzncybqmh\nn\naeebef\nzncybqmh\nzncybqmh\nzncybqmh",
"output": "zncybqmh\naeebef\nn"
},
{
"input": "30\nkqqcbs\nvap\nkymomn\nj\nkqqcbs\nfuzlzoum\nkymomn\ndbh\nfuzlzoum\nkymomn\nvap\nvlgzs\ndbh\nvlgzs\nbvy\ndbh\nkymomn\nkymomn\neoqql\nkymomn\nkymomn\nkqqcbs\nvlgzs\nkqqcbs\nkqqcbs\nfuzlzoum\nvlgzs\nrylgdoo\nvlgzs\nrylgdoo",
"output": "rylgdoo\nvlgzs\nfuzlzoum\nkqqcbs\nkymomn\neoqql\ndbh\nbvy\nvap\nj"
},
{
"input": "40\nji\nv\nv\nns\nji\nn\nji\nv\nfvy\nvje\nns\nvje\nv\nhas\nv\nusm\nhas\nfvy\nvje\nkdb\nn\nv\nji\nji\nn\nhas\nv\nji\nkdb\nr\nvje\nns\nv\nusm\nn\nvje\nhas\nns\nhas\nn",
"output": "n\nhas\nns\nvje\nusm\nv\nr\nkdb\nji\nfvy"
},
{
"input": "50\njcg\nvle\njopb\nepdb\nnkef\nfv\nxj\nufe\nfuy\noqta\ngbc\nyuz\nec\nyji\nkuux\ncwm\ntq\nnno\nhp\nzry\nxxpp\ntjvo\ngyz\nkwo\nvwqz\nyaqc\njnj\nwoav\nqcv\ndcu\ngc\nhovn\nop\nevy\ndc\ntrpu\nyb\nuzfa\npca\noq\nnhxy\nsiqu\nde\nhphy\nc\nwovu\nf\nbvv\ndsik\nlwyg",
"output": "lwyg\ndsik\nbvv\nf\nwovu\nc\nhphy\nde\nsiqu\nnhxy\noq\npca\nuzfa\nyb\ntrpu\ndc\nevy\nop\nhovn\ngc\ndcu\nqcv\nwoav\njnj\nyaqc\nvwqz\nkwo\ngyz\ntjvo\nxxpp\nzry\nhp\nnno\ntq\ncwm\nkuux\nyji\nec\nyuz\ngbc\noqta\nfuy\nufe\nxj\nfv\nnkef\nepdb\njopb\nvle\njcg"
},
{
"input": "100\nvhh\nvhh\nvhh\nfa\nfa\nvhh\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nfa\nfa\nfa\nfa\nfa\nfa\nvhh\nfa\nfa\nvhh\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nvhh\nfa\nvhh\nvhh\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nfa\nfa\nfa\nfa\nfa\nfa\nvhh\nvhh\nfa\nvhh\nfa\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nvhh\nfa\nvhh",
"output": "vhh\nfa"
},
{
"input": "2\naa\nbb",
"output": "bb\naa"
},
{
"input": "2\naa\na",
"output": "a\naa"
},
{
"input": "3\naa\naa\naa",
"output": "aa"
},
{
"input": "5\naa\na\naa\na\naa",
"output": "aa\na"
},
{
"input": "7\naaaa\naaaa\naaa\na\naa\naaaaaaa\naaa",
"output": "aaa\naaaaaaa\naa\na\naaaa"
},
{
"input": "5\na\naa\naaa\naaaa\na",
"output": "a\naaaa\naaa\naa"
},
{
"input": "12\naaaaa\naaaaaa\naaaa\naaaaaa\naa\naaaa\naaaa\naaaaaa\na\naaa\naaaaaaaa\naa",
"output": "aa\naaaaaaaa\naaa\na\naaaaaa\naaaa\naaaaa"
},
{
"input": "3\na\naa\naaa",
"output": "aaa\naa\na"
},
{
"input": "9\nzzz\nzzzzz\nzzz\nzzzz\nzz\nzzzz\nzzzzz\nzzzz\nzzzzzzz",
"output": "zzzzzzz\nzzzz\nzzzzz\nzz\nzzz"
}
] | 1,458,420,584
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 12
| 3,000
| 13,516,800
|
N = int(input())
L = []
L_in = []
for i in range(N):
L.append(input())
for i in reversed(range(len(L))):
if L[i] not in L_in:
L_in.append(L[i])
print(L[i])
|
Title: Chat Order
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is a big lover of killing time in social networks. A page with a chatlist in his favourite network is made so that when a message is sent to some friend, his friend's chat rises to the very top of the page. The relative order of the other chats doesn't change. If there was no chat with this friend before, then a new chat is simply inserted to the top of the list.
Assuming that the chat list is initially empty, given the sequence of Polycaprus' messages make a list of chats after all of his messages are processed. Assume that no friend wrote any message to Polycarpus.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Polycarpus' messages. Next *n* lines enlist the message recipients in the order in which the messages were sent. The name of each participant is a non-empty sequence of lowercase English letters of length at most 10.
Output Specification:
Print all the recipients to who Polycarp talked to in the order of chats with them, from top to bottom.
Demo Input:
['4\nalex\nivan\nroman\nivan\n', '8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina\n']
Demo Output:
['ivan\nroman\nalex\n', 'alina\nmaria\nekaterina\ndarya\n']
Note:
In the first test case Polycarpus first writes to friend by name "alex", and the list looks as follows:
1. alex
Then Polycarpus writes to friend by name "ivan" and the list looks as follows:
1. ivan 1. alex
Polycarpus writes the third message to friend by name "roman" and the list looks as follows:
1. roman 1. ivan 1. alex
Polycarpus writes the fourth message to friend by name "ivan", to who he has already sent a message, so the list of chats changes as follows:
1. ivan 1. roman 1. alex
|
```python
N = int(input())
L = []
L_in = []
for i in range(N):
L.append(input())
for i in reversed(range(len(L))):
if L[i] not in L_in:
L_in.append(L[i])
print(L[i])
```
| 0
|
|
116
|
A
|
Tram
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty.
Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
|
The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops.
Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement.
- The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
|
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
|
[
"4\n0 3\n2 5\n4 2\n4 0\n"
] |
[
"6\n"
] |
For the first example, a capacity of 6 is sufficient:
- At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints.
Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
| 500
|
[
{
"input": "4\n0 3\n2 5\n4 2\n4 0",
"output": "6"
},
{
"input": "5\n0 4\n4 6\n6 5\n5 4\n4 0",
"output": "6"
},
{
"input": "10\n0 5\n1 7\n10 8\n5 3\n0 5\n3 3\n8 8\n0 6\n10 1\n9 0",
"output": "18"
},
{
"input": "3\n0 1\n1 1\n1 0",
"output": "1"
},
{
"input": "4\n0 1\n0 1\n1 0\n1 0",
"output": "2"
},
{
"input": "3\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "3\n0 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "5\n0 73\n73 189\n189 766\n766 0\n0 0",
"output": "766"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 1\n1 0",
"output": "1"
},
{
"input": "5\n0 917\n917 923\n904 992\n1000 0\n11 0",
"output": "1011"
},
{
"input": "5\n0 1\n1 2\n2 1\n1 2\n2 0",
"output": "2"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "20\n0 7\n2 1\n2 2\n5 7\n2 6\n6 10\n2 4\n0 4\n7 4\n8 0\n10 6\n2 1\n6 1\n1 7\n0 3\n8 7\n6 3\n6 3\n1 1\n3 0",
"output": "22"
},
{
"input": "5\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "10\n0 592\n258 598\n389 203\n249 836\n196 635\n478 482\n994 987\n1000 0\n769 0\n0 0",
"output": "1776"
},
{
"input": "10\n0 1\n1 0\n0 0\n0 0\n0 0\n0 1\n1 1\n0 1\n1 0\n1 0",
"output": "2"
},
{
"input": "10\n0 926\n926 938\n938 931\n931 964\n937 989\n983 936\n908 949\n997 932\n945 988\n988 0",
"output": "1016"
},
{
"input": "10\n0 1\n1 2\n1 2\n2 2\n2 2\n2 2\n1 1\n1 1\n2 1\n2 0",
"output": "3"
},
{
"input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "10\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "50\n0 332\n332 268\n268 56\n56 711\n420 180\n160 834\n149 341\n373 777\n763 93\n994 407\n86 803\n700 132\n471 608\n429 467\n75 5\n638 305\n405 853\n316 478\n643 163\n18 131\n648 241\n241 766\n316 847\n640 380\n923 759\n789 41\n125 421\n421 9\n9 388\n388 829\n408 108\n462 856\n816 411\n518 688\n290 7\n405 912\n397 772\n396 652\n394 146\n27 648\n462 617\n514 433\n780 35\n710 705\n460 390\n194 508\n643 56\n172 469\n1000 0\n194 0",
"output": "2071"
},
{
"input": "50\n0 0\n0 1\n1 1\n0 1\n0 0\n1 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 1\n1 0\n0 1\n0 0\n1 1\n1 0\n0 1\n0 0\n1 1\n0 1\n1 0\n1 1\n1 0\n0 0\n1 1\n1 0\n0 1\n0 0\n0 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 0\n0 1\n1 0\n0 0\n0 1\n1 1\n1 1\n0 1\n0 0\n1 0\n1 0",
"output": "3"
},
{
"input": "50\n0 926\n926 971\n915 980\n920 965\n954 944\n928 952\n955 980\n916 980\n906 935\n944 913\n905 923\n912 922\n965 934\n912 900\n946 930\n931 983\n979 905\n925 969\n924 926\n910 914\n921 977\n934 979\n962 986\n942 909\n976 903\n982 982\n991 941\n954 929\n902 980\n947 983\n919 924\n917 943\n916 905\n907 913\n964 977\n984 904\n905 999\n950 970\n986 906\n993 970\n960 994\n963 983\n918 986\n980 900\n931 986\n993 997\n941 909\n907 909\n1000 0\n278 0",
"output": "1329"
},
{
"input": "2\n0 863\n863 0",
"output": "863"
},
{
"input": "50\n0 1\n1 2\n2 2\n1 1\n1 1\n1 2\n1 2\n1 1\n1 2\n1 1\n1 1\n1 2\n1 2\n1 1\n2 1\n2 2\n1 2\n2 2\n1 2\n2 1\n2 1\n2 2\n2 1\n1 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n2 2\n2 1\n1 2\n2 2\n1 2\n1 1\n1 1\n2 1\n2 1\n2 2\n2 1\n2 1\n1 2\n1 2\n1 2\n1 2\n2 0\n2 0\n2 0\n0 0",
"output": "8"
},
{
"input": "50\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "100\n0 1\n0 0\n0 0\n1 0\n0 0\n0 1\n0 1\n1 1\n0 0\n0 0\n1 1\n0 0\n1 1\n0 1\n1 1\n0 1\n1 1\n1 0\n1 0\n0 0\n1 0\n0 1\n1 0\n0 0\n0 0\n1 1\n1 1\n0 1\n0 0\n1 0\n1 1\n0 1\n1 0\n1 1\n0 1\n1 1\n1 0\n0 0\n0 0\n0 1\n0 0\n0 1\n1 1\n0 0\n1 1\n1 1\n0 0\n0 1\n1 0\n0 1\n0 0\n0 1\n0 1\n1 1\n1 1\n1 1\n0 0\n0 0\n1 1\n0 1\n0 1\n1 0\n0 0\n0 0\n1 1\n0 1\n0 1\n1 1\n1 1\n0 1\n1 1\n1 1\n0 0\n1 0\n0 1\n0 0\n0 0\n1 1\n1 1\n1 1\n1 1\n0 1\n1 0\n1 0\n1 0\n1 0\n1 0\n0 0\n1 0\n1 0\n0 0\n1 0\n0 0\n0 1\n1 0\n0 1\n1 0\n1 0\n1 0\n1 0",
"output": "11"
},
{
"input": "100\n0 2\n1 2\n2 1\n1 2\n1 2\n2 1\n2 2\n1 1\n1 1\n2 1\n1 2\n2 1\n1 2\n2 2\n2 2\n2 2\n1 2\n2 2\n2 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 2\n1 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n1 1\n2 2\n2 1\n1 2\n1 1\n1 2\n2 1\n2 2\n1 1\n2 1\n1 1\n2 1\n1 1\n1 2\n2 2\n2 2\n1 1\n2 2\n1 2\n2 1\n2 1\n1 1\n1 1\n1 2\n1 2\n1 1\n1 1\n2 1\n1 2\n1 2\n2 1\n2 2\n2 2\n2 2\n2 1\n2 2\n1 1\n1 2\n1 2\n1 1\n2 2\n2 2\n1 1\n2 1\n1 1\n1 2\n1 2\n1 2\n1 1\n1 1\n2 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 1\n2 2\n1 2\n2 0\n2 0\n2 0\n1 0",
"output": "7"
},
{
"input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "2\n0 1\n1 0",
"output": "1"
},
{
"input": "2\n0 900\n900 0",
"output": "900"
},
{
"input": "2\n0 1\n1 0",
"output": "1"
},
{
"input": "2\n0 0\n0 0",
"output": "0"
},
{
"input": "2\n0 1000\n1000 0",
"output": "1000"
},
{
"input": "3\n0 802\n175 188\n815 0",
"output": "815"
},
{
"input": "3\n0 910\n910 976\n976 0",
"output": "976"
},
{
"input": "3\n0 2\n2 1\n1 0",
"output": "2"
}
] | 1,697,987,403
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 71
| 92
| 0
|
a = int(input())
sm = 0
mx = 0
for i in range(a):
a, b = map(int, input().split())
sm += b
sm -= a
if mx < sm:
mx = sm
print(mx)
|
Title: Tram
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty.
Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
Input Specification:
The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops.
Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement.
- The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
Output Specification:
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
Demo Input:
['4\n0 3\n2 5\n4 2\n4 0\n']
Demo Output:
['6\n']
Note:
For the first example, a capacity of 6 is sufficient:
- At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints.
Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
|
```python
a = int(input())
sm = 0
mx = 0
for i in range(a):
a, b = map(int, input().split())
sm += b
sm -= a
if mx < sm:
mx = sm
print(mx)
```
| 3
|
|
894
|
A
|
QAQ
|
PROGRAMMING
| 800
|
[
"brute force",
"dp"
] | null | null |
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
|
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
|
Print a single integer — the number of subsequences "QAQ" in the string.
|
[
"QAQAQYSYIOIWIN\n",
"QAQQQZZYNOIWIN\n"
] |
[
"4\n",
"3\n"
] |
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
| 500
|
[
{
"input": "QAQAQYSYIOIWIN",
"output": "4"
},
{
"input": "QAQQQZZYNOIWIN",
"output": "3"
},
{
"input": "QA",
"output": "0"
},
{
"input": "IAQVAQZLQBQVQFTQQQADAQJA",
"output": "24"
},
{
"input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ",
"output": "378"
},
{
"input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ",
"output": "1077"
},
{
"input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA",
"output": "568"
},
{
"input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA",
"output": "70"
},
{
"input": "W",
"output": "0"
},
{
"input": "DBA",
"output": "0"
},
{
"input": "RQAWNACASAAKAGAAAAQ",
"output": "10"
},
{
"input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA",
"output": "111"
},
{
"input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA",
"output": "411"
},
{
"input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ",
"output": "625"
},
{
"input": "QORZOYAQ",
"output": "1"
},
{
"input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA",
"output": "13174"
},
{
"input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT",
"output": "10420"
},
{
"input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ",
"output": "12488"
},
{
"input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA",
"output": "9114"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "35937"
},
{
"input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE",
"output": "254"
},
{
"input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE",
"output": "2174"
},
{
"input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ",
"output": "2962"
},
{
"input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA",
"output": "2482"
},
{
"input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ",
"output": "7768"
},
{
"input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA",
"output": "5422"
},
{
"input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ",
"output": "3024"
},
{
"input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ",
"output": "4527"
},
{
"input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH",
"output": "6416"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ",
"output": "13136"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA",
"output": "14231"
},
{
"input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "15296"
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA",
"output": "20825"
},
{
"input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ",
"output": "20825"
},
{
"input": "Q",
"output": "0"
},
{
"input": "A",
"output": "0"
},
{
"input": "FFF",
"output": "0"
},
{
"input": "AAAAAA",
"output": "0"
}
] | 1,596,789,536
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 108
| 7,065,600
|
from collections import defaultdict
n=int(input())
a=list(map(int,input().split()))
d=defaultdict(lambda:0)
for i in a:
d[i]+=1
dp=[-1 for i in range(100001)]
dp[0]=0
dp[1]=d[1]
for i in range(2,100001):
dp[i]=max(dp[i-1],dp[i-2]+d[i]*i)
print(dp[100000])
|
Title: QAQ
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
Input Specification:
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
Output Specification:
Print a single integer — the number of subsequences "QAQ" in the string.
Demo Input:
['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n']
Demo Output:
['4\n', '3\n']
Note:
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
|
```python
from collections import defaultdict
n=int(input())
a=list(map(int,input().split()))
d=defaultdict(lambda:0)
for i in a:
d[i]+=1
dp=[-1 for i in range(100001)]
dp[0]=0
dp[1]=d[1]
for i in range(2,100001):
dp[i]=max(dp[i-1],dp[i-2]+d[i]*i)
print(dp[100000])
```
| -1
|
|
471
|
A
|
MUH and Sticks
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
Two polar bears Menshykov and Uslada from the St.Petersburg zoo and elephant Horace from the Kiev zoo got six sticks to play with and assess the animals' creativity. Menshykov, Uslada and Horace decided to make either an elephant or a bear from those sticks. They can make an animal from sticks in the following way:
- Four sticks represent the animal's legs, these sticks should have the same length. - Two remaining sticks represent the animal's head and body. The bear's head stick must be shorter than the body stick. The elephant, however, has a long trunk, so his head stick must be as long as the body stick. Note that there are no limits on the relations between the leg sticks and the head and body sticks.
Your task is to find out which animal can be made from the given stick set. The zoo keeper wants the sticks back after the game, so they must never be broken, even bears understand it.
|
The single line contains six space-separated integers *l**i* (1<=≤<=*l**i*<=≤<=9) — the lengths of the six sticks. It is guaranteed that the input is such that you cannot make both animals from the sticks.
|
If you can make a bear from the given set, print string "Bear" (without the quotes). If you can make an elephant, print string "Elephant" (wıthout the quotes). If you can make neither a bear nor an elephant, print string "Alien" (without the quotes).
|
[
"4 2 5 4 4 4\n",
"4 4 5 4 4 5\n",
"1 2 3 4 5 6\n"
] |
[
"Bear",
"Elephant",
"Alien"
] |
If you're out of creative ideas, see instructions below which show how to make a bear and an elephant in the first two samples. The stick of length 2 is in red, the sticks of length 4 are in green, the sticks of length 5 are in blue.
| 500
|
[
{
"input": "4 2 5 4 4 4",
"output": "Bear"
},
{
"input": "4 4 5 4 4 5",
"output": "Elephant"
},
{
"input": "1 2 3 4 5 6",
"output": "Alien"
},
{
"input": "5 5 5 5 5 5",
"output": "Elephant"
},
{
"input": "1 1 1 2 3 5",
"output": "Alien"
},
{
"input": "1 1 1 1 1 1",
"output": "Elephant"
},
{
"input": "9 9 9 9 9 9",
"output": "Elephant"
},
{
"input": "1 8 9 1 1 1",
"output": "Bear"
},
{
"input": "9 9 9 1 9 9",
"output": "Bear"
},
{
"input": "1 2 3 8 9 7",
"output": "Alien"
},
{
"input": "5 5 5 6 6 6",
"output": "Alien"
},
{
"input": "1 1 2 2 3 4",
"output": "Alien"
},
{
"input": "4 4 4 4 4 2",
"output": "Bear"
},
{
"input": "2 2 3 3 4 4",
"output": "Alien"
},
{
"input": "4 4 4 4 4 5",
"output": "Bear"
},
{
"input": "1 1 2 2 2 2",
"output": "Elephant"
},
{
"input": "1 2 5 5 5 5",
"output": "Bear"
},
{
"input": "4 4 2 2 2 2",
"output": "Elephant"
},
{
"input": "1 1 1 1 1 2",
"output": "Bear"
},
{
"input": "2 2 4 4 4 4",
"output": "Elephant"
},
{
"input": "4 4 4 4 4 3",
"output": "Bear"
},
{
"input": "4 4 5 6 7 8",
"output": "Alien"
},
{
"input": "4 4 4 4 2 2",
"output": "Elephant"
},
{
"input": "1 1 1 1 2 2",
"output": "Elephant"
},
{
"input": "1 1 3 3 3 5",
"output": "Alien"
},
{
"input": "1 2 2 3 3 3",
"output": "Alien"
},
{
"input": "1 2 2 2 2 2",
"output": "Bear"
},
{
"input": "1 3 3 3 4 5",
"output": "Alien"
},
{
"input": "5 1 1 1 1 1",
"output": "Bear"
}
] | 1,498,320,577
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 8
| 46
| 4,608,000
|
l=list(map(int,input().split(" ")))
s=set(l)
total=0
if len(s)==1:
print("Elephant")
elif len(s)==2:
for i in s:
if l.count(i)==4:
total=total+1
if l.count(i)==2:
total=total+1
if total==2:
print("Elephant")
else:
print("Alien")
elif len(s)==3:
for i in s:
if l.count(i)==4:
total=total+1
if l.count(i)==1:
total=total+1
if total==3:
print("Bear")
else:
print("Alien")
else:
print("Alien")
|
Title: MUH and Sticks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two polar bears Menshykov and Uslada from the St.Petersburg zoo and elephant Horace from the Kiev zoo got six sticks to play with and assess the animals' creativity. Menshykov, Uslada and Horace decided to make either an elephant or a bear from those sticks. They can make an animal from sticks in the following way:
- Four sticks represent the animal's legs, these sticks should have the same length. - Two remaining sticks represent the animal's head and body. The bear's head stick must be shorter than the body stick. The elephant, however, has a long trunk, so his head stick must be as long as the body stick. Note that there are no limits on the relations between the leg sticks and the head and body sticks.
Your task is to find out which animal can be made from the given stick set. The zoo keeper wants the sticks back after the game, so they must never be broken, even bears understand it.
Input Specification:
The single line contains six space-separated integers *l**i* (1<=≤<=*l**i*<=≤<=9) — the lengths of the six sticks. It is guaranteed that the input is such that you cannot make both animals from the sticks.
Output Specification:
If you can make a bear from the given set, print string "Bear" (without the quotes). If you can make an elephant, print string "Elephant" (wıthout the quotes). If you can make neither a bear nor an elephant, print string "Alien" (without the quotes).
Demo Input:
['4 2 5 4 4 4\n', '4 4 5 4 4 5\n', '1 2 3 4 5 6\n']
Demo Output:
['Bear', 'Elephant', 'Alien']
Note:
If you're out of creative ideas, see instructions below which show how to make a bear and an elephant in the first two samples. The stick of length 2 is in red, the sticks of length 4 are in green, the sticks of length 5 are in blue.
|
```python
l=list(map(int,input().split(" ")))
s=set(l)
total=0
if len(s)==1:
print("Elephant")
elif len(s)==2:
for i in s:
if l.count(i)==4:
total=total+1
if l.count(i)==2:
total=total+1
if total==2:
print("Elephant")
else:
print("Alien")
elif len(s)==3:
for i in s:
if l.count(i)==4:
total=total+1
if l.count(i)==1:
total=total+1
if total==3:
print("Bear")
else:
print("Alien")
else:
print("Alien")
```
| 0
|
|
864
|
C
|
Bus
|
PROGRAMMING
| 1,500
|
[
"greedy",
"implementation",
"math"
] | null | null |
A bus moves along the coordinate line *Ox* from the point *x*<==<=0 to the point *x*<==<=*a*. After starting from the point *x*<==<=0, it reaches the point *x*<==<=*a*, immediately turns back and then moves to the point *x*<==<=0. After returning to the point *x*<==<=0 it immediately goes back to the point *x*<==<=*a* and so on. Thus, the bus moves from *x*<==<=0 to *x*<==<=*a* and back. Moving from the point *x*<==<=0 to *x*<==<=*a* or from the point *x*<==<=*a* to *x*<==<=0 is called a bus journey. In total, the bus must make *k* journeys.
The petrol tank of the bus can hold *b* liters of gasoline. To pass a single unit of distance the bus needs to spend exactly one liter of gasoline. The bus starts its first journey with a full petrol tank.
There is a gas station in point *x*<==<=*f*. This point is between points *x*<==<=0 and *x*<==<=*a*. There are no other gas stations on the bus route. While passing by a gas station in either direction the bus can stop and completely refuel its tank. Thus, after stopping to refuel the tank will contain *b* liters of gasoline.
What is the minimum number of times the bus needs to refuel at the point *x*<==<=*f* to make *k* journeys? The first journey starts in the point *x*<==<=0.
|
The first line contains four integers *a*, *b*, *f*, *k* (0<=<<=*f*<=<<=*a*<=≤<=106, 1<=≤<=*b*<=≤<=109, 1<=≤<=*k*<=≤<=104) — the endpoint of the first bus journey, the capacity of the fuel tank of the bus, the point where the gas station is located, and the required number of journeys.
|
Print the minimum number of times the bus needs to refuel to make *k* journeys. If it is impossible for the bus to make *k* journeys, print -1.
|
[
"6 9 2 4\n",
"6 10 2 4\n",
"6 5 4 3\n"
] |
[
"4\n",
"2\n",
"-1\n"
] |
In the first example the bus needs to refuel during each journey.
In the second example the bus can pass 10 units of distance without refueling. So the bus makes the whole first journey, passes 4 units of the distance of the second journey and arrives at the point with the gas station. Then it can refuel its tank, finish the second journey and pass 2 units of distance from the third journey. In this case, it will again arrive at the point with the gas station. Further, he can refill the tank up to 10 liters to finish the third journey and ride all the way of the fourth journey. At the end of the journey the tank will be empty.
In the third example the bus can not make all 3 journeys because if it refuels during the second journey, the tanks will contain only 5 liters of gasoline, but the bus needs to pass 8 units of distance until next refueling.
| 1,500
|
[
{
"input": "6 9 2 4",
"output": "4"
},
{
"input": "6 10 2 4",
"output": "2"
},
{
"input": "6 5 4 3",
"output": "-1"
},
{
"input": "2 2 1 1",
"output": "0"
},
{
"input": "10 4 6 10",
"output": "-1"
},
{
"input": "3 1 1 1",
"output": "-1"
},
{
"input": "2 1 1 1",
"output": "1"
},
{
"input": "1000000 51923215 2302 10000",
"output": "199"
},
{
"input": "10 11 3 2",
"output": "-1"
},
{
"input": "20 50 10 25",
"output": "11"
},
{
"input": "10 10 5 20",
"output": "20"
},
{
"input": "15 65 5 50",
"output": "12"
},
{
"input": "10 19 1 5",
"output": "3"
},
{
"input": "10 19 9 5",
"output": "3"
},
{
"input": "23 46 12 2",
"output": "0"
},
{
"input": "23 46 12 3",
"output": "1"
},
{
"input": "20 20 19 1",
"output": "0"
},
{
"input": "20 23 17 2",
"output": "1"
},
{
"input": "100 70 50 1",
"output": "1"
},
{
"input": "100 70 70 2",
"output": "2"
},
{
"input": "140 480 139 40",
"output": "18"
},
{
"input": "1000000 1000000000 1 1000",
"output": "0"
},
{
"input": "100000 1000000 50000 1000",
"output": "100"
},
{
"input": "1000000 1000000 500000 1000",
"output": "1000"
},
{
"input": "1000000 1000000 500000 10000",
"output": "10000"
},
{
"input": "1000000 2500000 500000 9999",
"output": "4998"
},
{
"input": "1000000 1500000 500000 9999",
"output": "9997"
},
{
"input": "1000000 1500000 500000 10000",
"output": "9998"
},
{
"input": "1000000 1 1 1",
"output": "-1"
},
{
"input": "2 1000000000 1 1",
"output": "0"
},
{
"input": "1000000 1000000000 1 1",
"output": "0"
},
{
"input": "1000000 1 999999 1",
"output": "-1"
},
{
"input": "1000000 1000000000 999999 1",
"output": "0"
},
{
"input": "2 1 1 10000",
"output": "-1"
},
{
"input": "1000000 1 1 10000",
"output": "-1"
},
{
"input": "1000000 1000000000 1 10000",
"output": "10"
},
{
"input": "1000000 1 999999 10000",
"output": "-1"
},
{
"input": "2 1000000000 1 10000",
"output": "0"
},
{
"input": "1000000 1000000000 999999 10000",
"output": "10"
},
{
"input": "10000 78393 3000 9999",
"output": "1428"
},
{
"input": "1000000 8839233 302200 9999",
"output": "1249"
},
{
"input": "900005 3333333 210000 9999",
"output": "3332"
},
{
"input": "6 7 4 2",
"output": "2"
},
{
"input": "3 1 2 1",
"output": "-1"
},
{
"input": "150 100 1 1",
"output": "-1"
},
{
"input": "10 5 6 1",
"output": "-1"
},
{
"input": "51 81 36 38",
"output": "36"
},
{
"input": "100 159 80 2",
"output": "1"
}
] | 1,512,648,136
| 2,896
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 46
| 5,529,600
|
a,b,f,k=map(int,input().split())
if k==1:
if b<f:print(-1)
elif b<a-f:print(-1)
else:print(b<a-f)
if f>b or (a-f)*2>b or f*2>b:exit(print(-1))
t,tt=0,0
odd=0
tb=b-f
if b-f<(a-f)*2:t+=1;b-=f+(a-f)*2
if b<f:t+=1
if tb-f<(a-f)*2:
if k&1 and tb<a:odd+=1
tt+=1
tb-=f+(a-f)*2
if tb<f:tt+=1
print(t+tt*(k//2-1)-odd)
|
Title: Bus
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A bus moves along the coordinate line *Ox* from the point *x*<==<=0 to the point *x*<==<=*a*. After starting from the point *x*<==<=0, it reaches the point *x*<==<=*a*, immediately turns back and then moves to the point *x*<==<=0. After returning to the point *x*<==<=0 it immediately goes back to the point *x*<==<=*a* and so on. Thus, the bus moves from *x*<==<=0 to *x*<==<=*a* and back. Moving from the point *x*<==<=0 to *x*<==<=*a* or from the point *x*<==<=*a* to *x*<==<=0 is called a bus journey. In total, the bus must make *k* journeys.
The petrol tank of the bus can hold *b* liters of gasoline. To pass a single unit of distance the bus needs to spend exactly one liter of gasoline. The bus starts its first journey with a full petrol tank.
There is a gas station in point *x*<==<=*f*. This point is between points *x*<==<=0 and *x*<==<=*a*. There are no other gas stations on the bus route. While passing by a gas station in either direction the bus can stop and completely refuel its tank. Thus, after stopping to refuel the tank will contain *b* liters of gasoline.
What is the minimum number of times the bus needs to refuel at the point *x*<==<=*f* to make *k* journeys? The first journey starts in the point *x*<==<=0.
Input Specification:
The first line contains four integers *a*, *b*, *f*, *k* (0<=<<=*f*<=<<=*a*<=≤<=106, 1<=≤<=*b*<=≤<=109, 1<=≤<=*k*<=≤<=104) — the endpoint of the first bus journey, the capacity of the fuel tank of the bus, the point where the gas station is located, and the required number of journeys.
Output Specification:
Print the minimum number of times the bus needs to refuel to make *k* journeys. If it is impossible for the bus to make *k* journeys, print -1.
Demo Input:
['6 9 2 4\n', '6 10 2 4\n', '6 5 4 3\n']
Demo Output:
['4\n', '2\n', '-1\n']
Note:
In the first example the bus needs to refuel during each journey.
In the second example the bus can pass 10 units of distance without refueling. So the bus makes the whole first journey, passes 4 units of the distance of the second journey and arrives at the point with the gas station. Then it can refuel its tank, finish the second journey and pass 2 units of distance from the third journey. In this case, it will again arrive at the point with the gas station. Further, he can refill the tank up to 10 liters to finish the third journey and ride all the way of the fourth journey. At the end of the journey the tank will be empty.
In the third example the bus can not make all 3 journeys because if it refuels during the second journey, the tanks will contain only 5 liters of gasoline, but the bus needs to pass 8 units of distance until next refueling.
|
```python
a,b,f,k=map(int,input().split())
if k==1:
if b<f:print(-1)
elif b<a-f:print(-1)
else:print(b<a-f)
if f>b or (a-f)*2>b or f*2>b:exit(print(-1))
t,tt=0,0
odd=0
tb=b-f
if b-f<(a-f)*2:t+=1;b-=f+(a-f)*2
if b<f:t+=1
if tb-f<(a-f)*2:
if k&1 and tb<a:odd+=1
tt+=1
tb-=f+(a-f)*2
if tb<f:tt+=1
print(t+tt*(k//2-1)-odd)
```
| 0
|
|
440
|
A
|
Forgotten Episode
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Polycarpus adores TV series. Right now he is ready to finish watching a season of a popular sitcom "Graph Theory". In total, the season has *n* episodes, numbered with integers from 1 to *n*.
Polycarpus watches episodes not one by one but in a random order. He has already watched all the episodes except for one. Which episode has Polycaprus forgotten to watch?
|
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=100000) — the number of episodes in a season. Assume that the episodes are numbered by integers from 1 to *n*.
The second line contains *n*<=-<=1 integer *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the numbers of episodes that Polycarpus has watched. All values of *a**i* are distinct.
|
Print the number of the episode that Polycarpus hasn't watched.
|
[
"10\n3 8 10 1 7 9 6 5 2\n"
] |
[
"4\n"
] |
none
| 500
|
[
{
"input": "10\n3 8 10 1 7 9 6 5 2",
"output": "4"
},
{
"input": "5\n4 3 2 1",
"output": "5"
},
{
"input": "2\n1",
"output": "2"
},
{
"input": "2\n2",
"output": "1"
},
{
"input": "3\n1 2",
"output": "3"
},
{
"input": "3\n1 3",
"output": "2"
},
{
"input": "3\n2 3",
"output": "1"
},
{
"input": "3\n2 1",
"output": "3"
},
{
"input": "3\n3 1",
"output": "2"
},
{
"input": "3\n3 2",
"output": "1"
},
{
"input": "5\n2 3 4 5",
"output": "1"
},
{
"input": "5\n5 4 3 2",
"output": "1"
},
{
"input": "5\n5 2 4 3",
"output": "1"
},
{
"input": "5\n1 2 3 4",
"output": "5"
},
{
"input": "5\n2 1 3 4",
"output": "5"
},
{
"input": "5\n1 5 3 4",
"output": "2"
},
{
"input": "5\n1 4 5 2",
"output": "3"
},
{
"input": "5\n2 1 5 3",
"output": "4"
},
{
"input": "5\n2 3 4 5",
"output": "1"
}
] | 1,622,302,885
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 108
| 9,216,000
|
n=int(input())
l=set(map(int,input().split()))
k=set(range(1,n+1))
k1=k-l
print(*k1)
|
Title: Forgotten Episode
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus adores TV series. Right now he is ready to finish watching a season of a popular sitcom "Graph Theory". In total, the season has *n* episodes, numbered with integers from 1 to *n*.
Polycarpus watches episodes not one by one but in a random order. He has already watched all the episodes except for one. Which episode has Polycaprus forgotten to watch?
Input Specification:
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=100000) — the number of episodes in a season. Assume that the episodes are numbered by integers from 1 to *n*.
The second line contains *n*<=-<=1 integer *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the numbers of episodes that Polycarpus has watched. All values of *a**i* are distinct.
Output Specification:
Print the number of the episode that Polycarpus hasn't watched.
Demo Input:
['10\n3 8 10 1 7 9 6 5 2\n']
Demo Output:
['4\n']
Note:
none
|
```python
n=int(input())
l=set(map(int,input().split()))
k=set(range(1,n+1))
k1=k-l
print(*k1)
```
| 3
|
|
609
|
B
|
The Best Gift
|
PROGRAMMING
| 1,100
|
[
"constructive algorithms",
"implementation"
] | null | null |
Emily's birthday is next week and Jack has decided to buy a present for her. He knows she loves books so he goes to the local bookshop, where there are *n* books on sale from one of *m* genres.
In the bookshop, Jack decides to buy two books of different genres.
Based on the genre of books on sale in the shop, find the number of options available to Jack for choosing two books of different genres for Emily. Options are considered different if they differ in at least one book.
The books are given by indices of their genres. The genres are numbered from 1 to *m*.
|
The first line contains two positive integers *n* and *m* (2<=≤<=*n*<=≤<=2·105,<=2<=≤<=*m*<=≤<=10) — the number of books in the bookstore and the number of genres.
The second line contains a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (1<=≤<=*a**i*<=≤<=*m*) equals the genre of the *i*-th book.
It is guaranteed that for each genre there is at least one book of that genre.
|
Print the only integer — the number of ways in which Jack can choose books.
It is guaranteed that the answer doesn't exceed the value 2·109.
|
[
"4 3\n2 1 3 1\n",
"7 4\n4 2 3 1 2 4 3\n"
] |
[
"5\n",
"18\n"
] |
The answer to the first test sample equals 5 as Sasha can choose:
1. the first and second books, 1. the first and third books, 1. the first and fourth books, 1. the second and third books, 1. the third and fourth books.
| 0
|
[
{
"input": "4 3\n2 1 3 1",
"output": "5"
},
{
"input": "7 4\n4 2 3 1 2 4 3",
"output": "18"
},
{
"input": "2 2\n1 2",
"output": "1"
},
{
"input": "3 2\n1 2 2",
"output": "2"
},
{
"input": "10 10\n1 2 3 4 5 6 7 8 9 10",
"output": "45"
},
{
"input": "9 2\n1 1 1 1 2 1 1 1 1",
"output": "8"
},
{
"input": "12 3\n1 2 3 1 2 3 1 2 3 1 2 3",
"output": "48"
},
{
"input": "100 3\n2 1 1 1 3 2 3 3 2 3 3 1 3 3 1 3 3 1 1 1 2 3 1 2 3 1 2 3 3 1 3 1 1 2 3 2 3 3 2 3 3 1 2 2 1 2 3 2 3 2 2 1 1 3 1 3 2 1 3 1 3 1 3 1 1 3 3 3 2 3 2 2 2 2 1 3 3 3 1 2 1 2 3 2 1 3 1 3 2 1 3 1 2 1 2 3 1 3 2 3",
"output": "3296"
},
{
"input": "100 5\n5 5 2 4 5 4 4 4 4 2 5 3 4 2 4 4 1 1 5 3 2 2 1 3 3 2 5 3 4 5 1 3 5 4 4 4 3 1 4 4 3 4 5 2 5 4 2 1 2 2 3 5 5 5 1 4 5 3 1 4 2 2 5 1 5 3 4 1 5 1 2 2 3 5 1 3 2 4 2 4 2 2 4 1 3 5 2 2 2 3 3 4 3 2 2 5 5 4 2 5",
"output": "3953"
},
{
"input": "100 10\n7 4 5 5 10 10 5 8 5 7 4 5 4 6 8 8 2 6 3 3 10 7 10 8 6 2 7 3 9 7 7 2 4 5 2 4 9 5 10 1 10 5 10 4 1 3 4 2 6 9 9 9 10 6 2 5 6 1 8 10 4 10 3 4 10 5 5 4 10 4 5 3 7 10 2 7 3 6 9 6 1 6 5 5 4 6 6 4 4 1 5 1 6 6 6 8 8 6 2 6",
"output": "4428"
}
] | 1,686,791,258
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 42
| 93
| 15,974,400
|
from collections import Counter
t=1
n,m = map(int,input().split())
a = Counter(map(int,input().split()))
ans = n*(n-1)//2
for i in range(1,m+1):
ans -= a[i]*(a[i]-1)//2
print(ans)
|
Title: The Best Gift
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Emily's birthday is next week and Jack has decided to buy a present for her. He knows she loves books so he goes to the local bookshop, where there are *n* books on sale from one of *m* genres.
In the bookshop, Jack decides to buy two books of different genres.
Based on the genre of books on sale in the shop, find the number of options available to Jack for choosing two books of different genres for Emily. Options are considered different if they differ in at least one book.
The books are given by indices of their genres. The genres are numbered from 1 to *m*.
Input Specification:
The first line contains two positive integers *n* and *m* (2<=≤<=*n*<=≤<=2·105,<=2<=≤<=*m*<=≤<=10) — the number of books in the bookstore and the number of genres.
The second line contains a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (1<=≤<=*a**i*<=≤<=*m*) equals the genre of the *i*-th book.
It is guaranteed that for each genre there is at least one book of that genre.
Output Specification:
Print the only integer — the number of ways in which Jack can choose books.
It is guaranteed that the answer doesn't exceed the value 2·109.
Demo Input:
['4 3\n2 1 3 1\n', '7 4\n4 2 3 1 2 4 3\n']
Demo Output:
['5\n', '18\n']
Note:
The answer to the first test sample equals 5 as Sasha can choose:
1. the first and second books, 1. the first and third books, 1. the first and fourth books, 1. the second and third books, 1. the third and fourth books.
|
```python
from collections import Counter
t=1
n,m = map(int,input().split())
a = Counter(map(int,input().split()))
ans = n*(n-1)//2
for i in range(1,m+1):
ans -= a[i]*(a[i]-1)//2
print(ans)
```
| 3
|
|
246
|
B
|
Increase and Decrease
|
PROGRAMMING
| 1,300
|
[
"greedy",
"math"
] | null | null |
Polycarpus has an array, consisting of *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Polycarpus likes it when numbers in an array match. That's why he wants the array to have as many equal numbers as possible. For that Polycarpus performs the following operation multiple times:
- he chooses two elements of the array *a**i*, *a**j* (*i*<=≠<=*j*); - he simultaneously increases number *a**i* by 1 and decreases number *a**j* by 1, that is, executes *a**i*<==<=*a**i*<=+<=1 and *a**j*<==<=*a**j*<=-<=1.
The given operation changes exactly two distinct array elements. Polycarpus can apply the described operation an infinite number of times.
Now he wants to know what maximum number of equal array elements he can get if he performs an arbitrary number of such operation. Help Polycarpus.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the array size. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=104) — the original array.
|
Print a single integer — the maximum number of equal array elements he can get if he performs an arbitrary number of the given operation.
|
[
"2\n2 1\n",
"3\n1 4 1\n"
] |
[
"1\n",
"3\n"
] |
none
| 1,000
|
[
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n1 4 1",
"output": "3"
},
{
"input": "4\n2 -7 -2 -6",
"output": "3"
},
{
"input": "4\n2 0 -2 -1",
"output": "3"
},
{
"input": "6\n-1 1 0 0 -1 -1",
"output": "5"
},
{
"input": "5\n0 0 0 0 0",
"output": "5"
},
{
"input": "100\n968 793 -628 -416 942 -308 977 168 728 -879 952 781 -425 -475 -480 738 -740 142 -319 -116 -701 -183 41 324 -918 -391 -176 781 763 888 475 -617 134 -802 -133 -211 855 -869 -236 503 550 387 137 -221 -957 -800 -56 -673 440 -791 -217 -959 -892 886 -593 427 890 223 -425 -342 -262 693 -137 924 860 156 -110 444 -12 703 421 -638 725 -551 597 -206 -80 393 -441 -759 617 424 -506 209 579 -685 -861 507 312 597 -81 -491 424 222 -892 629 512 743 -452 -504",
"output": "99"
}
] | 1,694,789,603
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
import java.util.Scanner;
public class IncreaseAndDecrease {
public static void main(String[] args) {
Scanner s=new Scanner(System.in);
int n = s.nextInt();
int sum=0;
for (int i=0;i<n;i++) sum+=s.nextInt();
if (sum%n==0) System.out.println(n);
else System.out.println(n-1);
}}
|
Title: Increase and Decrease
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus has an array, consisting of *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Polycarpus likes it when numbers in an array match. That's why he wants the array to have as many equal numbers as possible. For that Polycarpus performs the following operation multiple times:
- he chooses two elements of the array *a**i*, *a**j* (*i*<=≠<=*j*); - he simultaneously increases number *a**i* by 1 and decreases number *a**j* by 1, that is, executes *a**i*<==<=*a**i*<=+<=1 and *a**j*<==<=*a**j*<=-<=1.
The given operation changes exactly two distinct array elements. Polycarpus can apply the described operation an infinite number of times.
Now he wants to know what maximum number of equal array elements he can get if he performs an arbitrary number of such operation. Help Polycarpus.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the array size. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=104) — the original array.
Output Specification:
Print a single integer — the maximum number of equal array elements he can get if he performs an arbitrary number of the given operation.
Demo Input:
['2\n2 1\n', '3\n1 4 1\n']
Demo Output:
['1\n', '3\n']
Note:
none
|
```python
import java.util.Scanner;
public class IncreaseAndDecrease {
public static void main(String[] args) {
Scanner s=new Scanner(System.in);
int n = s.nextInt();
int sum=0;
for (int i=0;i<n;i++) sum+=s.nextInt();
if (sum%n==0) System.out.println(n);
else System.out.println(n-1);
}}
```
| -1
|
|
378
|
A
|
Playing with Dice
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
|
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
|
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
|
[
"2 5\n",
"2 4\n"
] |
[
"3 0 3\n",
"2 1 3\n"
] |
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|.
| 500
|
[
{
"input": "2 5",
"output": "3 0 3"
},
{
"input": "2 4",
"output": "2 1 3"
},
{
"input": "5 3",
"output": "2 1 3"
},
{
"input": "1 6",
"output": "3 0 3"
},
{
"input": "5 1",
"output": "3 1 2"
},
{
"input": "6 3",
"output": "2 0 4"
},
{
"input": "2 3",
"output": "2 0 4"
},
{
"input": "5 6",
"output": "5 0 1"
},
{
"input": "4 4",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
},
{
"input": "6 4",
"output": "1 1 4"
},
{
"input": "1 4",
"output": "2 0 4"
},
{
"input": "5 5",
"output": "0 6 0"
},
{
"input": "4 5",
"output": "4 0 2"
},
{
"input": "4 3",
"output": "3 0 3"
},
{
"input": "1 5",
"output": "2 1 3"
},
{
"input": "6 5",
"output": "1 0 5"
},
{
"input": "2 2",
"output": "0 6 0"
},
{
"input": "1 3",
"output": "1 1 4"
},
{
"input": "3 6",
"output": "4 0 2"
},
{
"input": "3 1",
"output": "4 1 1"
},
{
"input": "3 2",
"output": "4 0 2"
},
{
"input": "3 5",
"output": "3 1 2"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "6 2",
"output": "2 1 3"
},
{
"input": "4 1",
"output": "4 0 2"
},
{
"input": "5 2",
"output": "3 0 3"
},
{
"input": "4 2",
"output": "3 1 2"
},
{
"input": "2 1",
"output": "5 0 1"
},
{
"input": "6 1",
"output": "3 0 3"
},
{
"input": "4 6",
"output": "4 1 1"
},
{
"input": "2 6",
"output": "3 1 2"
},
{
"input": "3 4",
"output": "3 0 3"
},
{
"input": "1 2",
"output": "1 0 5"
},
{
"input": "6 6",
"output": "0 6 0"
},
{
"input": "5 4",
"output": "2 0 4"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
}
] | 1,567,807,878
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 202
| 2,560,000
|
a=int(input())
b=int(input())
def win_ways(a,b):
a_win=0
b_win=0
draw=0
for i in range(1,7):
if abs(a-i)<abs(b-i):
a_win+=1
elif abs(a-i)>abs(b-i):
b_win+=1
else:
draw+=1
output=[a_win,draw,b_win]
return output
print(win_ways(a,b))
|
Title: Playing with Dice
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
Input Specification:
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
Output Specification:
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
Demo Input:
['2 5\n', '2 4\n']
Demo Output:
['3 0 3\n', '2 1 3\n']
Note:
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|.
|
```python
a=int(input())
b=int(input())
def win_ways(a,b):
a_win=0
b_win=0
draw=0
for i in range(1,7):
if abs(a-i)<abs(b-i):
a_win+=1
elif abs(a-i)>abs(b-i):
b_win+=1
else:
draw+=1
output=[a_win,draw,b_win]
return output
print(win_ways(a,b))
```
| -1
|
|
129
|
A
|
Cookies
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
|
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
|
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
|
[
"1\n1\n",
"10\n1 2 2 3 4 4 4 2 2 2\n",
"11\n2 2 2 2 2 2 2 2 2 2 99\n"
] |
[
"1\n",
"8\n",
"1\n"
] |
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
| 500
|
[
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 2 2 3 4 4 4 2 2 2",
"output": "8"
},
{
"input": "11\n2 2 2 2 2 2 2 2 2 2 99",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n2 2",
"output": "2"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "7\n7 7 7 7 7 7 7",
"output": "7"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "4"
},
{
"input": "100\n1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99",
"output": "49"
},
{
"input": "82\n43 44 96 33 23 42 33 66 53 87 8 90 43 91 40 88 51 18 48 62 59 10 22 20 54 6 13 63 2 56 31 52 98 42 54 32 26 77 9 24 33 91 16 30 39 34 78 82 73 90 12 15 67 76 30 18 44 86 84 98 65 54 100 79 28 34 40 56 11 43 72 35 86 59 89 40 30 33 7 19 44 15",
"output": "50"
},
{
"input": "17\n50 14 17 77 74 74 38 76 41 27 45 29 66 98 38 73 38",
"output": "7"
},
{
"input": "94\n81 19 90 99 26 11 86 44 78 36 80 59 99 90 78 72 71 20 94 56 42 40 71 84 10 85 10 70 52 27 39 55 90 16 48 25 7 79 99 100 38 10 99 56 3 4 78 9 16 57 14 40 52 54 57 70 30 86 56 84 97 60 59 69 49 66 23 92 90 46 86 73 53 47 1 83 14 20 24 66 13 45 41 14 86 75 55 88 48 95 82 24 47 87",
"output": "39"
},
{
"input": "88\n64 95 12 90 40 65 98 45 52 54 79 7 81 25 98 19 68 82 41 53 35 50 5 22 32 21 8 39 8 6 72 27 81 30 12 79 21 42 60 2 66 87 46 93 62 78 52 71 76 32 78 94 86 85 55 15 34 76 41 20 32 26 94 81 89 45 74 49 11 40 40 39 49 46 80 85 90 23 80 40 86 58 70 26 48 93 23 53",
"output": "37"
},
{
"input": "84\n95 9 43 43 13 84 60 90 1 8 97 99 54 34 59 83 33 15 51 26 40 12 66 65 19 30 29 78 92 60 25 13 19 84 71 73 12 24 54 49 16 41 11 40 57 59 34 40 39 9 71 83 1 77 79 53 94 47 78 55 77 85 29 52 80 90 53 77 97 97 27 79 28 23 83 25 26 22 49 86 63 56 3 32",
"output": "51"
},
{
"input": "47\n61 97 76 94 91 22 2 68 62 73 90 47 16 79 44 71 98 68 43 6 53 52 40 27 68 67 43 96 14 91 60 61 96 24 97 13 32 65 85 96 81 77 34 18 23 14 80",
"output": "21"
},
{
"input": "69\n71 1 78 74 58 89 30 6 100 90 22 61 11 59 14 74 27 25 78 61 45 19 25 33 37 4 52 43 53 38 9 100 56 67 69 38 76 91 63 60 93 52 28 61 9 98 8 14 57 63 89 64 98 51 36 66 36 86 13 82 50 91 52 64 86 78 78 83 81",
"output": "37"
},
{
"input": "52\n38 78 36 75 19 3 56 1 39 97 24 79 84 16 93 55 96 64 12 24 1 86 80 29 12 32 36 36 73 39 76 65 53 98 30 20 28 8 86 43 70 22 75 69 62 65 81 25 53 40 71 59",
"output": "28"
},
{
"input": "74\n81 31 67 97 26 75 69 81 11 13 13 74 77 88 52 20 52 64 66 75 72 28 41 54 26 75 41 91 75 15 18 36 13 83 63 61 14 48 53 63 19 67 35 48 23 65 73 100 44 55 92 88 99 17 73 25 83 7 31 89 12 80 98 39 42 75 14 29 81 35 77 87 33 94",
"output": "47"
},
{
"input": "44\n46 56 31 31 37 71 94 2 14 100 45 72 36 72 80 3 38 54 42 98 50 32 31 42 62 31 45 50 95 100 18 17 64 22 18 25 52 56 70 57 43 40 81 28",
"output": "15"
},
{
"input": "22\n28 57 40 74 51 4 45 84 99 12 95 14 92 60 47 81 84 51 31 91 59 42",
"output": "11"
},
{
"input": "59\n73 45 94 76 41 49 65 13 74 66 36 25 47 75 40 23 92 72 11 32 32 8 81 26 68 56 41 8 76 47 96 55 70 11 84 14 83 18 70 22 30 39 28 100 48 11 92 45 78 69 86 1 54 90 98 91 13 17 35",
"output": "33"
},
{
"input": "63\n20 18 44 94 68 57 16 43 74 55 68 24 21 95 76 84 50 50 47 86 86 12 58 55 28 72 86 18 34 45 81 88 3 72 41 9 60 90 81 93 12 6 9 6 2 41 1 7 9 29 81 14 64 80 20 36 67 54 7 5 35 81 22",
"output": "37"
},
{
"input": "28\n49 84 48 19 44 91 11 82 96 95 88 90 71 82 87 25 31 23 18 13 98 45 26 65 35 12 31 14",
"output": "15"
},
{
"input": "61\n34 18 28 64 28 45 9 77 77 20 63 92 79 16 16 100 86 2 91 91 57 15 31 95 10 88 84 5 82 83 53 98 59 17 97 80 76 80 81 3 91 81 87 93 61 46 10 49 6 22 21 75 63 89 21 81 30 19 67 38 77",
"output": "35"
},
{
"input": "90\n41 90 43 1 28 75 90 50 3 70 76 64 81 63 25 69 83 82 29 91 59 66 21 61 7 55 72 49 38 69 72 20 64 58 30 81 61 29 96 14 39 5 100 20 29 98 75 29 44 78 97 45 26 77 73 59 22 99 41 6 3 96 71 20 9 18 96 18 90 62 34 78 54 5 41 6 73 33 2 54 26 21 18 6 45 57 43 73 95 75",
"output": "42"
},
{
"input": "45\n93 69 4 27 20 14 71 48 79 3 32 26 49 30 57 88 13 56 49 61 37 32 47 41 41 70 45 68 82 18 8 6 25 20 15 13 71 99 28 6 52 34 19 59 26",
"output": "23"
},
{
"input": "33\n29 95 48 49 91 10 83 71 47 25 66 36 51 12 34 10 54 74 41 96 89 26 89 1 42 33 1 62 9 32 49 65 78",
"output": "15"
},
{
"input": "34\n98 24 42 36 41 82 28 58 89 34 77 70 76 44 74 54 66 100 13 79 4 88 21 1 11 45 91 29 87 100 29 54 82 78",
"output": "13"
},
{
"input": "29\n91 84 26 84 9 63 52 9 65 56 90 2 36 7 67 33 91 14 65 38 53 36 81 83 85 14 33 95 51",
"output": "17"
},
{
"input": "100\n2 88 92 82 87 100 78 28 84 43 78 32 43 33 97 19 15 52 29 84 57 72 54 13 99 28 82 79 40 70 34 92 91 53 9 88 27 43 14 92 72 37 26 37 20 95 19 34 49 64 33 37 34 27 80 79 9 54 99 68 25 4 68 73 46 66 24 78 3 87 26 52 50 84 4 95 23 83 39 58 86 36 33 16 98 2 84 19 53 12 69 60 10 11 78 17 79 92 77 59",
"output": "45"
},
{
"input": "100\n2 95 45 73 9 54 20 97 57 82 88 26 18 71 25 27 75 54 31 11 58 85 69 75 72 91 76 5 25 80 45 49 4 73 8 81 81 38 5 12 53 77 7 96 90 35 28 80 73 94 19 69 96 17 94 49 69 9 32 19 5 12 46 29 26 40 59 59 6 95 82 50 72 2 45 69 12 5 72 29 39 72 23 96 81 28 28 56 68 58 37 41 30 1 90 84 15 24 96 43",
"output": "53"
},
{
"input": "100\n27 72 35 91 13 10 35 45 24 55 83 84 63 96 29 79 34 67 63 92 48 83 18 77 28 27 49 66 29 88 55 15 6 58 14 67 94 36 77 7 7 64 61 52 71 18 36 99 76 6 50 67 16 13 41 7 89 73 61 51 78 22 78 32 76 100 3 31 89 71 63 53 15 85 77 54 89 33 68 74 3 23 57 5 43 89 75 35 9 86 90 11 31 46 48 37 74 17 77 8",
"output": "40"
},
{
"input": "100\n69 98 69 88 11 49 55 8 25 91 17 81 47 26 15 73 96 71 18 42 42 61 48 14 92 78 35 72 4 27 62 75 83 79 17 16 46 80 96 90 82 54 37 69 85 21 67 70 96 10 46 63 21 59 56 92 54 88 77 30 75 45 44 29 86 100 51 11 65 69 66 56 82 63 27 1 51 51 13 10 3 55 26 85 34 16 87 72 13 100 81 71 90 95 86 50 83 55 55 54",
"output": "53"
},
{
"input": "100\n34 35 99 64 2 66 78 93 20 48 12 79 19 10 87 7 42 92 60 79 5 2 24 89 57 48 63 92 74 4 16 51 7 12 90 48 87 17 18 73 51 58 97 97 25 38 15 97 96 73 67 91 6 75 14 13 87 79 75 3 15 55 35 95 71 45 10 13 20 37 82 26 2 22 13 83 97 84 39 79 43 100 54 59 98 8 61 34 7 65 75 44 24 77 73 88 34 95 44 77",
"output": "55"
},
{
"input": "100\n15 86 3 1 51 26 74 85 37 87 64 58 10 6 57 26 30 47 85 65 24 72 50 40 12 35 91 47 91 60 47 87 95 34 80 91 26 3 36 39 14 86 28 70 51 44 28 21 72 79 57 61 16 71 100 94 57 67 36 74 24 21 89 85 25 2 97 67 76 53 76 80 97 64 35 13 8 32 21 52 62 61 67 14 74 73 66 44 55 76 24 3 43 42 99 61 36 80 38 66",
"output": "52"
},
{
"input": "100\n45 16 54 54 80 94 74 93 75 85 58 95 79 30 81 2 84 4 57 23 92 64 78 1 50 36 13 27 56 54 10 77 87 1 5 38 85 74 94 82 30 45 72 83 82 30 81 82 82 3 69 82 7 92 39 60 94 42 41 5 3 17 67 21 79 44 79 96 28 3 53 68 79 89 63 83 1 44 4 31 84 15 73 77 19 66 54 6 73 1 67 24 91 11 86 45 96 82 20 89",
"output": "51"
},
{
"input": "100\n84 23 50 32 90 71 92 43 58 70 6 82 7 55 85 19 70 89 12 26 29 56 74 30 2 27 4 39 63 67 91 81 11 33 75 10 82 88 39 43 43 80 68 35 55 67 53 62 73 65 86 74 43 51 14 48 42 92 83 57 22 33 24 99 5 27 78 96 7 28 11 15 8 38 85 67 5 92 24 96 57 59 14 95 91 4 9 18 45 33 74 83 64 85 14 51 51 94 29 2",
"output": "53"
},
{
"input": "100\n77 56 56 45 73 55 32 37 39 50 30 95 79 21 44 34 51 43 86 91 39 30 85 15 35 93 100 14 57 31 80 79 38 40 88 4 91 54 7 95 76 26 62 84 17 33 67 47 6 82 69 51 17 2 59 24 11 12 31 90 12 11 55 38 72 49 30 50 42 46 5 97 9 9 30 45 86 23 19 82 40 42 5 40 35 98 35 32 60 60 5 28 84 35 21 49 68 53 68 23",
"output": "48"
},
{
"input": "100\n78 38 79 61 45 86 83 83 86 90 74 69 2 84 73 39 2 5 20 71 24 80 54 89 58 34 77 40 39 62 2 47 28 53 97 75 88 98 94 96 33 71 44 90 47 36 19 89 87 98 90 87 5 85 34 79 82 3 42 88 89 63 35 7 89 30 40 48 12 41 56 76 83 60 80 80 39 56 77 4 72 96 30 55 57 51 7 19 11 1 66 1 91 87 11 62 95 85 79 25",
"output": "48"
},
{
"input": "100\n5 34 23 20 76 75 19 51 17 82 60 13 83 6 65 16 20 43 66 54 87 10 87 73 50 24 16 98 33 28 80 52 54 82 26 92 14 13 84 92 94 29 61 21 60 20 48 94 24 20 75 70 58 27 68 45 86 89 29 8 67 38 83 48 18 100 11 22 46 84 52 97 70 19 50 75 3 7 52 53 72 41 18 31 1 38 49 53 11 64 99 76 9 87 48 12 100 32 44 71",
"output": "58"
},
{
"input": "100\n76 89 68 78 24 72 73 95 98 72 58 15 2 5 56 32 9 65 50 70 94 31 29 54 89 52 31 93 43 56 26 35 72 95 51 55 78 70 11 92 17 5 54 94 81 31 78 95 73 91 95 37 59 9 53 48 65 55 84 8 45 97 64 37 96 34 36 53 66 17 72 48 99 23 27 18 92 84 44 73 60 78 53 29 68 99 19 39 61 40 69 6 77 12 47 29 15 4 8 45",
"output": "53"
},
{
"input": "100\n82 40 31 53 8 50 85 93 3 84 54 17 96 59 51 42 18 19 35 84 79 31 17 46 54 82 72 49 35 73 26 89 61 73 3 50 12 29 25 77 88 21 58 24 22 89 96 54 82 29 96 56 77 16 1 68 90 93 20 23 57 22 31 18 92 90 51 14 50 72 31 54 12 50 66 62 2 34 17 45 68 50 87 97 23 71 1 72 17 82 42 15 20 78 4 49 66 59 10 17",
"output": "54"
},
{
"input": "100\n32 82 82 24 39 53 48 5 29 24 9 37 91 37 91 95 1 97 84 52 12 56 93 47 22 20 14 17 40 22 79 34 24 2 69 30 69 29 3 89 21 46 60 92 39 29 18 24 49 18 40 22 60 13 77 50 39 64 50 70 99 8 66 31 90 38 20 54 7 21 5 56 41 68 69 20 54 89 69 62 9 53 43 89 81 97 15 2 52 78 89 65 16 61 59 42 56 25 32 52",
"output": "49"
},
{
"input": "100\n72 54 23 24 97 14 99 87 15 25 7 23 17 87 72 31 71 87 34 82 51 77 74 85 62 38 24 7 84 48 98 21 29 71 70 84 25 58 67 92 18 44 32 9 81 15 53 29 63 18 86 16 7 31 38 99 70 32 89 16 23 11 66 96 69 82 97 59 6 9 49 80 85 19 6 9 52 51 85 74 53 46 73 55 31 63 78 61 34 80 77 65 87 77 92 52 89 8 52 31",
"output": "44"
},
{
"input": "100\n56 88 8 19 7 15 11 54 35 50 19 57 63 72 51 43 50 19 57 90 40 100 8 92 11 96 30 32 59 65 93 47 62 3 50 41 30 50 72 83 61 46 83 60 20 46 33 1 5 18 83 22 34 16 41 95 63 63 7 59 55 95 91 29 64 60 64 81 45 45 10 9 88 37 69 85 21 82 41 76 42 34 47 78 51 83 65 100 13 22 59 76 63 1 26 86 36 94 99 74",
"output": "46"
},
{
"input": "100\n27 89 67 60 62 80 43 50 28 88 72 5 94 11 63 91 18 78 99 3 71 26 12 97 74 62 23 24 22 3 100 72 98 7 94 32 12 75 61 88 42 48 10 14 45 9 48 56 73 76 70 70 79 90 35 39 96 37 81 11 19 65 99 39 23 79 34 61 35 74 90 37 73 23 46 21 94 84 73 58 11 89 13 9 10 85 42 78 73 32 53 39 49 90 43 5 28 31 97 75",
"output": "53"
},
{
"input": "100\n33 24 97 96 1 14 99 51 13 65 67 20 46 88 42 44 20 49 5 89 98 83 15 40 74 83 58 3 10 79 34 2 69 28 37 100 55 52 14 8 44 94 97 89 6 42 11 28 30 33 55 56 20 57 52 25 75 1 87 42 62 41 37 12 54 85 95 80 42 36 94 96 28 76 54 36 4 17 26 24 62 15 17 79 84 36 92 78 74 91 96 77 54 92 81 91 62 98 37 37",
"output": "43"
},
{
"input": "100\n86 24 61 15 11 85 1 31 47 36 23 36 59 34 3 27 16 29 82 28 58 52 52 66 71 61 98 39 60 20 67 41 67 90 73 29 92 17 70 95 58 98 58 32 21 73 46 56 87 72 80 75 40 27 94 31 59 92 93 37 14 99 96 21 97 23 81 91 52 52 96 94 92 28 38 29 52 16 57 27 17 24 91 21 79 55 96 98 95 94 23 78 79 12 77 35 32 75 100 82",
"output": "51"
},
{
"input": "100\n88 85 41 37 69 21 7 69 36 5 92 26 64 75 22 46 67 20 70 22 62 66 38 24 47 49 68 30 90 31 67 86 86 82 9 51 43 45 48 42 73 44 31 94 45 60 54 66 20 87 11 94 34 32 87 66 56 28 75 39 37 90 72 93 55 72 31 42 30 71 87 61 4 12 12 81 23 61 56 98 71 32 30 33 96 63 92 16 8 78 47 91 47 54 49 3 81 82 41 5",
"output": "47"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 1 3 2 2",
"output": "3"
}
] | 1,510,420,039
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 52
| 124
| 0
|
n = int(input())
li = [int(num) for num in input().split(' ')]
total, ans = 0, 0
for num in li: total += num
for num in li:
if (total-num) % 2 == 0: ans += 1
print(ans)
|
Title: Cookies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
Input Specification:
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
Output Specification:
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
Demo Input:
['1\n1\n', '10\n1 2 2 3 4 4 4 2 2 2\n', '11\n2 2 2 2 2 2 2 2 2 2 99\n']
Demo Output:
['1\n', '8\n', '1\n']
Note:
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
|
```python
n = int(input())
li = [int(num) for num in input().split(' ')]
total, ans = 0, 0
for num in li: total += num
for num in li:
if (total-num) % 2 == 0: ans += 1
print(ans)
```
| 3
|
|
8
|
A
|
Train and Peter
|
PROGRAMMING
| 1,200
|
[
"strings"
] |
A. Train and Peter
|
1
|
64
|
Peter likes to travel by train. He likes it so much that on the train he falls asleep.
Once in summer Peter was going by train from city A to city B, and as usual, was sleeping. Then he woke up, started to look through the window and noticed that every railway station has a flag of a particular colour.
The boy started to memorize the order of the flags' colours that he had seen. But soon he fell asleep again. Unfortunately, he didn't sleep long, he woke up and went on memorizing the colours. Then he fell asleep again, and that time he slept till the end of the journey.
At the station he told his parents about what he was doing, and wrote two sequences of the colours that he had seen before and after his sleep, respectively.
Peter's parents know that their son likes to fantasize. They give you the list of the flags' colours at the stations that the train passes sequentially on the way from A to B, and ask you to find out if Peter could see those sequences on the way from A to B, or from B to A. Remember, please, that Peter had two periods of wakefulness.
Peter's parents put lowercase Latin letters for colours. The same letter stands for the same colour, different letters — for different colours.
|
The input data contains three lines. The first line contains a non-empty string, whose length does not exceed 105, the string consists of lowercase Latin letters — the flags' colours at the stations on the way from A to B. On the way from B to A the train passes the same stations, but in reverse order.
The second line contains the sequence, written by Peter during the first period of wakefulness. The third line contains the sequence, written during the second period of wakefulness. Both sequences are non-empty, consist of lowercase Latin letters, and the length of each does not exceed 100 letters. Each of the sequences is written in chronological order.
|
Output one of the four words without inverted commas:
- «forward» — if Peter could see such sequences only on the way from A to B; - «backward» — if Peter could see such sequences on the way from B to A; - «both» — if Peter could see such sequences both on the way from A to B, and on the way from B to A; - «fantasy» — if Peter could not see such sequences.
|
[
"atob\na\nb\n",
"aaacaaa\naca\naa\n"
] |
[
"forward\n",
"both\n"
] |
It is assumed that the train moves all the time, so one flag cannot be seen twice. There are no flags at stations A and B.
| 0
|
[
{
"input": "atob\na\nb",
"output": "forward"
},
{
"input": "aaacaaa\naca\naa",
"output": "both"
},
{
"input": "aaa\naa\naa",
"output": "fantasy"
},
{
"input": "astalavista\nastla\nlavista",
"output": "fantasy"
},
{
"input": "abacabadabacaba\nabacaba\nabacaba",
"output": "both"
},
{
"input": "a\na\na",
"output": "fantasy"
},
{
"input": "ab\nb\na",
"output": "backward"
},
{
"input": "aaa\naaaa\naaaa",
"output": "fantasy"
},
{
"input": "bbabbbbababbaabaabaa\nabb\nbaab",
"output": "forward"
},
{
"input": "bbbbbbbbbbbbbbbbbbbbbbbbb\nbbbb\nbbbbb",
"output": "both"
},
{
"input": "babaabababaaaababaabababaabababababababbababbbabbaabababaababbaabbababaababaaabababaabbaababaaababaa\nabaabababaa\nabaabbaa",
"output": "forward"
},
{
"input": "bbbbbbbbbbbbbbbbbbbbbbbbb\nbbbb\nbbbbb",
"output": "both"
},
{
"input": "aababaaababaabbaabababaaababaabababbaabbabaabababaabbabbbababbababababababaabababaababaaaabababaabab\nabaabababaa\nabaabbaa",
"output": "backward"
},
{
"input": "aaaa\naaa\naa",
"output": "fantasy"
},
{
"input": "zzzz\nzz\nzzz",
"output": "fantasy"
},
{
"input": "zzzz\nzzzz\nzzzz",
"output": "fantasy"
},
{
"input": "zzzz\nzz\nzz",
"output": "both"
},
{
"input": "aabaa\naab\nbaa",
"output": "fantasy"
},
{
"input": "aabaab\naba\nab",
"output": "forward"
},
{
"input": "aab\nb\naa",
"output": "backward"
},
{
"input": "abacaba\naca\nba",
"output": "both"
}
] | 1,664,263,903
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 92
| 0
|
all = str(input(""))
w1 = str(input(""))
w2 = str(input(""))
def prob(all, w1, w2):
if all.find(w1) < all.find(w2):
if all[::-1].find(w1) < all[::-1].find(w2):
return "both"
return "forward"
if all.find(w1) > all.find(w2):
if all[::-1].find(w1) > all[::-1].find(w2):
return "both"
return "backwards"
return "fantasy"
print(prob(all, w1, w2))
|
Title: Train and Peter
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Peter likes to travel by train. He likes it so much that on the train he falls asleep.
Once in summer Peter was going by train from city A to city B, and as usual, was sleeping. Then he woke up, started to look through the window and noticed that every railway station has a flag of a particular colour.
The boy started to memorize the order of the flags' colours that he had seen. But soon he fell asleep again. Unfortunately, he didn't sleep long, he woke up and went on memorizing the colours. Then he fell asleep again, and that time he slept till the end of the journey.
At the station he told his parents about what he was doing, and wrote two sequences of the colours that he had seen before and after his sleep, respectively.
Peter's parents know that their son likes to fantasize. They give you the list of the flags' colours at the stations that the train passes sequentially on the way from A to B, and ask you to find out if Peter could see those sequences on the way from A to B, or from B to A. Remember, please, that Peter had two periods of wakefulness.
Peter's parents put lowercase Latin letters for colours. The same letter stands for the same colour, different letters — for different colours.
Input Specification:
The input data contains three lines. The first line contains a non-empty string, whose length does not exceed 105, the string consists of lowercase Latin letters — the flags' colours at the stations on the way from A to B. On the way from B to A the train passes the same stations, but in reverse order.
The second line contains the sequence, written by Peter during the first period of wakefulness. The third line contains the sequence, written during the second period of wakefulness. Both sequences are non-empty, consist of lowercase Latin letters, and the length of each does not exceed 100 letters. Each of the sequences is written in chronological order.
Output Specification:
Output one of the four words without inverted commas:
- «forward» — if Peter could see such sequences only on the way from A to B; - «backward» — if Peter could see such sequences on the way from B to A; - «both» — if Peter could see such sequences both on the way from A to B, and on the way from B to A; - «fantasy» — if Peter could not see such sequences.
Demo Input:
['atob\na\nb\n', 'aaacaaa\naca\naa\n']
Demo Output:
['forward\n', 'both\n']
Note:
It is assumed that the train moves all the time, so one flag cannot be seen twice. There are no flags at stations A and B.
|
```python
all = str(input(""))
w1 = str(input(""))
w2 = str(input(""))
def prob(all, w1, w2):
if all.find(w1) < all.find(w2):
if all[::-1].find(w1) < all[::-1].find(w2):
return "both"
return "forward"
if all.find(w1) > all.find(w2):
if all[::-1].find(w1) > all[::-1].find(w2):
return "both"
return "backwards"
return "fantasy"
print(prob(all, w1, w2))
```
| 0
|
381
|
A
|
Sereja and Dima
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"two pointers"
] | null | null |
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
|
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
|
[
"4\n4 1 2 10\n",
"7\n1 2 3 4 5 6 7\n"
] |
[
"12 5\n",
"16 12\n"
] |
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
| 500
|
[
{
"input": "4\n4 1 2 10",
"output": "12 5"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "16 12"
},
{
"input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13",
"output": "613 418"
},
{
"input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24",
"output": "644 500"
},
{
"input": "1\n3",
"output": "3 0"
},
{
"input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646",
"output": "6848 6568"
},
{
"input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727",
"output": "9562 9561"
},
{
"input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12",
"output": "315 315"
},
{
"input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304",
"output": "3238 2222"
},
{
"input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325",
"output": "5246 4864"
},
{
"input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71",
"output": "8147 7807"
},
{
"input": "1\n1",
"output": "1 0"
}
] | 1,698,044,657
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 31
| 0
|
a=int(input())
b=list(map(int,input().split()))
s=0
s1=0
r=0
p=1
l=0
for x in range(a//2):
if r==0:
if b[len(b)-p]>b[l]:
s+=b[len(b)-p]
r=1
p+=1
else:
s+=b[l]
r=1
l+=1
if r==1:
if b[len(b)-p]>b[l]:
s1+=b[len(b)-p]
r=0
p+=1
else:
s1+=b[l]
r=0
l+=1
if a%2==0:
print(s,s1)
else:
s+=b[0]
print(s,s1)
|
Title: Sereja and Dima
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
Output Specification:
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
Demo Input:
['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n']
Demo Output:
['12 5\n', '16 12\n']
Note:
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
|
```python
a=int(input())
b=list(map(int,input().split()))
s=0
s1=0
r=0
p=1
l=0
for x in range(a//2):
if r==0:
if b[len(b)-p]>b[l]:
s+=b[len(b)-p]
r=1
p+=1
else:
s+=b[l]
r=1
l+=1
if r==1:
if b[len(b)-p]>b[l]:
s1+=b[len(b)-p]
r=0
p+=1
else:
s1+=b[l]
r=0
l+=1
if a%2==0:
print(s,s1)
else:
s+=b[0]
print(s,s1)
```
| 0
|
|
387
|
A
|
George and Sleep
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
George woke up and saw the current time *s* on the digital clock. Besides, George knows that he has slept for time *t*.
Help George! Write a program that will, given time *s* and *t*, determine the time *p* when George went to bed. Note that George could have gone to bed yesterday relatively to the current time (see the second test sample).
|
The first line contains current time *s* as a string in the format "hh:mm". The second line contains time *t* in the format "hh:mm" — the duration of George's sleep. It is guaranteed that the input contains the correct time in the 24-hour format, that is, 00<=≤<=*hh*<=≤<=23, 00<=≤<=*mm*<=≤<=59.
|
In the single line print time *p* — the time George went to bed in the format similar to the format of the time in the input.
|
[
"05:50\n05:44\n",
"00:00\n01:00\n",
"00:01\n00:00\n"
] |
[
"00:06\n",
"23:00\n",
"00:01\n"
] |
In the first sample George went to bed at "00:06". Note that you should print the time only in the format "00:06". That's why answers "0:06", "00:6" and others will be considered incorrect.
In the second sample, George went to bed yesterday.
In the third sample, George didn't do to bed at all.
| 500
|
[
{
"input": "05:50\n05:44",
"output": "00:06"
},
{
"input": "00:00\n01:00",
"output": "23:00"
},
{
"input": "00:01\n00:00",
"output": "00:01"
},
{
"input": "23:59\n23:59",
"output": "00:00"
},
{
"input": "23:44\n23:55",
"output": "23:49"
},
{
"input": "00:00\n13:12",
"output": "10:48"
},
{
"input": "12:00\n23:59",
"output": "12:01"
},
{
"input": "12:44\n12:44",
"output": "00:00"
},
{
"input": "05:55\n07:12",
"output": "22:43"
},
{
"input": "07:12\n05:55",
"output": "01:17"
},
{
"input": "22:22\n22:22",
"output": "00:00"
},
{
"input": "22:22\n22:23",
"output": "23:59"
},
{
"input": "23:24\n23:23",
"output": "00:01"
},
{
"input": "00:00\n00:00",
"output": "00:00"
},
{
"input": "23:30\n00:00",
"output": "23:30"
},
{
"input": "01:00\n00:00",
"output": "01:00"
},
{
"input": "05:44\n06:00",
"output": "23:44"
},
{
"input": "00:00\n23:59",
"output": "00:01"
},
{
"input": "21:00\n01:00",
"output": "20:00"
},
{
"input": "21:21\n12:21",
"output": "09:00"
},
{
"input": "12:21\n21:12",
"output": "15:09"
},
{
"input": "12:33\n23:33",
"output": "13:00"
},
{
"input": "07:55\n05:53",
"output": "02:02"
},
{
"input": "19:30\n02:00",
"output": "17:30"
},
{
"input": "21:30\n02:00",
"output": "19:30"
},
{
"input": "19:30\n09:30",
"output": "10:00"
},
{
"input": "13:08\n00:42",
"output": "12:26"
},
{
"input": "13:04\n09:58",
"output": "03:06"
},
{
"input": "21:21\n23:06",
"output": "22:15"
},
{
"input": "20:53\n10:23",
"output": "10:30"
},
{
"input": "12:59\n00:45",
"output": "12:14"
},
{
"input": "12:39\n22:21",
"output": "14:18"
},
{
"input": "21:10\n13:50",
"output": "07:20"
},
{
"input": "03:38\n23:46",
"output": "03:52"
},
{
"input": "03:48\n00:41",
"output": "03:07"
},
{
"input": "07:43\n12:27",
"output": "19:16"
},
{
"input": "03:23\n08:52",
"output": "18:31"
},
{
"input": "16:04\n10:28",
"output": "05:36"
},
{
"input": "12:53\n08:37",
"output": "04:16"
},
{
"input": "13:43\n17:23",
"output": "20:20"
},
{
"input": "00:00\n00:01",
"output": "23:59"
},
{
"input": "10:10\n01:01",
"output": "09:09"
},
{
"input": "10:05\n00:00",
"output": "10:05"
},
{
"input": "09:09\n00:00",
"output": "09:09"
},
{
"input": "09:10\n00:01",
"output": "09:09"
},
{
"input": "23:24\n00:28",
"output": "22:56"
},
{
"input": "10:00\n01:00",
"output": "09:00"
}
] | 1,536,154,776
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 124
| 307,200
|
n = [int(k) for k in input().split(':')]
m = [int(k) for k in input().split(':')]
k = n[0]*60 + n[1]
j = m[0]*60 + m[1]
def h(x):
for s in range(2 - len(x)):
x = str(0) + x
return x
def f(x):
a = int(x/60)
b = x%60
c = h(str(a))+':'+h(str(b))
return c
if k >= j:
print(f(k-j))
else:
print(f(k+24*60-j))
|
Title: George and Sleep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
George woke up and saw the current time *s* on the digital clock. Besides, George knows that he has slept for time *t*.
Help George! Write a program that will, given time *s* and *t*, determine the time *p* when George went to bed. Note that George could have gone to bed yesterday relatively to the current time (see the second test sample).
Input Specification:
The first line contains current time *s* as a string in the format "hh:mm". The second line contains time *t* in the format "hh:mm" — the duration of George's sleep. It is guaranteed that the input contains the correct time in the 24-hour format, that is, 00<=≤<=*hh*<=≤<=23, 00<=≤<=*mm*<=≤<=59.
Output Specification:
In the single line print time *p* — the time George went to bed in the format similar to the format of the time in the input.
Demo Input:
['05:50\n05:44\n', '00:00\n01:00\n', '00:01\n00:00\n']
Demo Output:
['00:06\n', '23:00\n', '00:01\n']
Note:
In the first sample George went to bed at "00:06". Note that you should print the time only in the format "00:06". That's why answers "0:06", "00:6" and others will be considered incorrect.
In the second sample, George went to bed yesterday.
In the third sample, George didn't do to bed at all.
|
```python
n = [int(k) for k in input().split(':')]
m = [int(k) for k in input().split(':')]
k = n[0]*60 + n[1]
j = m[0]*60 + m[1]
def h(x):
for s in range(2 - len(x)):
x = str(0) + x
return x
def f(x):
a = int(x/60)
b = x%60
c = h(str(a))+':'+h(str(b))
return c
if k >= j:
print(f(k-j))
else:
print(f(k+24*60-j))
```
| 3
|
|
791
|
A
|
Bear and Big Brother
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob.
Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight.
Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year.
After how many full years will Limak become strictly larger (strictly heavier) than Bob?
|
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10) — the weight of Limak and the weight of Bob respectively.
|
Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob.
|
[
"4 7\n",
"4 9\n",
"1 1\n"
] |
[
"2\n",
"3\n",
"1\n"
] |
In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4·3 = 12 and 7·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2.
In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights.
In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then.
| 500
|
[
{
"input": "4 7",
"output": "2"
},
{
"input": "4 9",
"output": "3"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "4 6",
"output": "2"
},
{
"input": "1 10",
"output": "6"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 2",
"output": "2"
},
{
"input": "1 3",
"output": "3"
},
{
"input": "1 4",
"output": "4"
},
{
"input": "1 5",
"output": "4"
},
{
"input": "1 6",
"output": "5"
},
{
"input": "1 7",
"output": "5"
},
{
"input": "1 8",
"output": "6"
},
{
"input": "1 9",
"output": "6"
},
{
"input": "1 10",
"output": "6"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "2 4",
"output": "2"
},
{
"input": "2 5",
"output": "3"
},
{
"input": "2 6",
"output": "3"
},
{
"input": "2 7",
"output": "4"
},
{
"input": "2 8",
"output": "4"
},
{
"input": "2 9",
"output": "4"
},
{
"input": "2 10",
"output": "4"
},
{
"input": "3 3",
"output": "1"
},
{
"input": "3 4",
"output": "1"
},
{
"input": "3 5",
"output": "2"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "3 7",
"output": "3"
},
{
"input": "3 8",
"output": "3"
},
{
"input": "3 9",
"output": "3"
},
{
"input": "3 10",
"output": "3"
},
{
"input": "4 4",
"output": "1"
},
{
"input": "4 5",
"output": "1"
},
{
"input": "4 6",
"output": "2"
},
{
"input": "4 7",
"output": "2"
},
{
"input": "4 8",
"output": "2"
},
{
"input": "4 9",
"output": "3"
},
{
"input": "4 10",
"output": "3"
},
{
"input": "5 5",
"output": "1"
},
{
"input": "5 6",
"output": "1"
},
{
"input": "5 7",
"output": "1"
},
{
"input": "5 8",
"output": "2"
},
{
"input": "5 9",
"output": "2"
},
{
"input": "5 10",
"output": "2"
},
{
"input": "6 6",
"output": "1"
},
{
"input": "6 7",
"output": "1"
},
{
"input": "6 8",
"output": "1"
},
{
"input": "6 9",
"output": "2"
},
{
"input": "6 10",
"output": "2"
},
{
"input": "7 7",
"output": "1"
},
{
"input": "7 8",
"output": "1"
},
{
"input": "7 9",
"output": "1"
},
{
"input": "7 10",
"output": "1"
},
{
"input": "8 8",
"output": "1"
},
{
"input": "8 9",
"output": "1"
},
{
"input": "8 10",
"output": "1"
},
{
"input": "9 9",
"output": "1"
},
{
"input": "9 10",
"output": "1"
},
{
"input": "10 10",
"output": "1"
},
{
"input": "10 10",
"output": "1"
},
{
"input": "1 2",
"output": "2"
}
] | 1,698,325,222
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 62
| 62
| 0
|
Limak, Bob = map(int, input().split())
years = 0
while Limak <= Bob:
years, Limak, Bob = years + 1, Limak * 3, Bob * 2
print(years)
|
Title: Bear and Big Brother
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob.
Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight.
Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year.
After how many full years will Limak become strictly larger (strictly heavier) than Bob?
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10) — the weight of Limak and the weight of Bob respectively.
Output Specification:
Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob.
Demo Input:
['4 7\n', '4 9\n', '1 1\n']
Demo Output:
['2\n', '3\n', '1\n']
Note:
In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4·3 = 12 and 7·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2.
In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights.
In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then.
|
```python
Limak, Bob = map(int, input().split())
years = 0
while Limak <= Bob:
years, Limak, Bob = years + 1, Limak * 3, Bob * 2
print(years)
```
| 3
|
|
570
|
B
|
Simple Game
|
PROGRAMMING
| 1,300
|
[
"constructive algorithms",
"games",
"greedy",
"implementation",
"math"
] | null | null |
One day Misha and Andrew were playing a very simple game. First, each player chooses an integer in the range from 1 to *n*. Let's assume that Misha chose number *m*, and Andrew chose number *a*.
Then, by using a random generator they choose a random integer *c* in the range between 1 and *n* (any integer from 1 to *n* is chosen with the same probability), after which the winner is the player, whose number was closer to *c*. The boys agreed that if *m* and *a* are located on the same distance from *c*, Misha wins.
Andrew wants to win very much, so he asks you to help him. You know the number selected by Misha, and number *n*. You need to determine which value of *a* Andrew must choose, so that the probability of his victory is the highest possible.
More formally, you need to find such integer *a* (1<=≤<=*a*<=≤<=*n*), that the probability that is maximal, where *c* is the equiprobably chosen integer from 1 to *n* (inclusive).
|
The first line contains two integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the range of numbers in the game, and the number selected by Misha respectively.
|
Print a single number — such value *a*, that probability that Andrew wins is the highest. If there are multiple such values, print the minimum of them.
|
[
"3 1\n",
"4 3\n"
] |
[
"2",
"2"
] |
In the first sample test: Andrew wins if *c* is equal to 2 or 3. The probability that Andrew wins is 2 / 3. If Andrew chooses *a* = 3, the probability of winning will be 1 / 3. If *a* = 1, the probability of winning is 0.
In the second sample test: Andrew wins if *c* is equal to 1 and 2. The probability that Andrew wins is 1 / 2. For other choices of *a* the probability of winning is less.
| 1,000
|
[
{
"input": "3 1",
"output": "2"
},
{
"input": "4 3",
"output": "2"
},
{
"input": "5 5",
"output": "4"
},
{
"input": "10 5",
"output": "6"
},
{
"input": "20 13",
"output": "12"
},
{
"input": "51 1",
"output": "2"
},
{
"input": "100 50",
"output": "51"
},
{
"input": "100 51",
"output": "50"
},
{
"input": "100 49",
"output": "50"
},
{
"input": "1000000000 1000000000",
"output": "999999999"
},
{
"input": "1000000000 1",
"output": "2"
},
{
"input": "1000000000 100000000",
"output": "100000001"
},
{
"input": "1000000000 500000000",
"output": "500000001"
},
{
"input": "1000000000 123124",
"output": "123125"
},
{
"input": "12412523 125123",
"output": "125124"
},
{
"input": "54645723 432423",
"output": "432424"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "262833325 131416663",
"output": "131416662"
},
{
"input": "477667530 238833766",
"output": "238833765"
},
{
"input": "692501734 346250868",
"output": "346250867"
},
{
"input": "907335939 453667970",
"output": "453667969"
},
{
"input": "746085224 373042613",
"output": "373042612"
},
{
"input": "189520699 94760350",
"output": "94760349"
},
{
"input": "404354904 202177453",
"output": "202177452"
},
{
"input": "619189108 309594555",
"output": "309594554"
},
{
"input": "81813292 40906647",
"output": "40906646"
},
{
"input": "296647497 148323750",
"output": "148323749"
},
{
"input": "511481701 255740851",
"output": "255740850"
},
{
"input": "726315905 363157953",
"output": "363157952"
},
{
"input": "496110970 201868357",
"output": "201868358"
},
{
"input": "710945175 173165570",
"output": "173165571"
},
{
"input": "925779379 720443954",
"output": "720443953"
},
{
"input": "140613583 93171580",
"output": "93171579"
},
{
"input": "355447788 85890184",
"output": "85890185"
},
{
"input": "570281992 291648263",
"output": "291648262"
},
{
"input": "541904957 459371829",
"output": "459371828"
},
{
"input": "756739161 125332525",
"output": "125332526"
},
{
"input": "971573366 216791157",
"output": "216791158"
},
{
"input": "186407570 160453970",
"output": "160453969"
},
{
"input": "401241775 170032078",
"output": "170032079"
},
{
"input": "616075979 207073797",
"output": "207073798"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2 1",
"output": "2"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "3 1",
"output": "2"
},
{
"input": "3 2",
"output": "1"
},
{
"input": "3 3",
"output": "2"
},
{
"input": "4 1",
"output": "2"
},
{
"input": "4 2",
"output": "3"
},
{
"input": "4 3",
"output": "2"
},
{
"input": "4 4",
"output": "3"
},
{
"input": "5 1",
"output": "2"
},
{
"input": "5 2",
"output": "3"
},
{
"input": "5 3",
"output": "2"
},
{
"input": "5 4",
"output": "3"
},
{
"input": "5 5",
"output": "4"
},
{
"input": "3 2",
"output": "1"
},
{
"input": "7 4",
"output": "3"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "7 3",
"output": "4"
}
] | 1,638,250,778
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 2
| 92
| 0
|
from sys import stdin, stdout
rd = lambda: list(map(int, stdin.readline().split()))
rds = lambda: stdin.readline().rstrip()
ii = lambda: int(stdin.readline())
n, m = rd()
d1 = m - 1
d2 = n - m
if d2 > d1:
x = (n+m) // 2
if x == m and x != n:
x += 1
else:
x = (m+1) // 2
if x == m and x != n:
x -= 1
print(x)
|
Title: Simple Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Misha and Andrew were playing a very simple game. First, each player chooses an integer in the range from 1 to *n*. Let's assume that Misha chose number *m*, and Andrew chose number *a*.
Then, by using a random generator they choose a random integer *c* in the range between 1 and *n* (any integer from 1 to *n* is chosen with the same probability), after which the winner is the player, whose number was closer to *c*. The boys agreed that if *m* and *a* are located on the same distance from *c*, Misha wins.
Andrew wants to win very much, so he asks you to help him. You know the number selected by Misha, and number *n*. You need to determine which value of *a* Andrew must choose, so that the probability of his victory is the highest possible.
More formally, you need to find such integer *a* (1<=≤<=*a*<=≤<=*n*), that the probability that is maximal, where *c* is the equiprobably chosen integer from 1 to *n* (inclusive).
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the range of numbers in the game, and the number selected by Misha respectively.
Output Specification:
Print a single number — such value *a*, that probability that Andrew wins is the highest. If there are multiple such values, print the minimum of them.
Demo Input:
['3 1\n', '4 3\n']
Demo Output:
['2', '2']
Note:
In the first sample test: Andrew wins if *c* is equal to 2 or 3. The probability that Andrew wins is 2 / 3. If Andrew chooses *a* = 3, the probability of winning will be 1 / 3. If *a* = 1, the probability of winning is 0.
In the second sample test: Andrew wins if *c* is equal to 1 and 2. The probability that Andrew wins is 1 / 2. For other choices of *a* the probability of winning is less.
|
```python
from sys import stdin, stdout
rd = lambda: list(map(int, stdin.readline().split()))
rds = lambda: stdin.readline().rstrip()
ii = lambda: int(stdin.readline())
n, m = rd()
d1 = m - 1
d2 = n - m
if d2 > d1:
x = (n+m) // 2
if x == m and x != n:
x += 1
else:
x = (m+1) // 2
if x == m and x != n:
x -= 1
print(x)
```
| 0
|
|
450
|
B
|
Jzzhu and Sequences
|
PROGRAMMING
| 1,300
|
[
"implementation",
"math"
] | null | null |
Jzzhu has invented a kind of sequences, they meet the following property:
You are given *x* and *y*, please calculate *f**n* modulo 1000000007 (109<=+<=7).
|
The first line contains two integers *x* and *y* (|*x*|,<=|*y*|<=≤<=109). The second line contains a single integer *n* (1<=≤<=*n*<=≤<=2·109).
|
Output a single integer representing *f**n* modulo 1000000007 (109<=+<=7).
|
[
"2 3\n3\n",
"0 -1\n2\n"
] |
[
"1\n",
"1000000006\n"
] |
In the first sample, *f*<sub class="lower-index">2</sub> = *f*<sub class="lower-index">1</sub> + *f*<sub class="lower-index">3</sub>, 3 = 2 + *f*<sub class="lower-index">3</sub>, *f*<sub class="lower-index">3</sub> = 1.
In the second sample, *f*<sub class="lower-index">2</sub> = - 1; - 1 modulo (10<sup class="upper-index">9</sup> + 7) equals (10<sup class="upper-index">9</sup> + 6).
| 1,000
|
[
{
"input": "2 3\n3",
"output": "1"
},
{
"input": "0 -1\n2",
"output": "1000000006"
},
{
"input": "-9 -11\n12345",
"output": "1000000005"
},
{
"input": "0 0\n1000000000",
"output": "0"
},
{
"input": "-1000000000 1000000000\n2000000000",
"output": "1000000000"
},
{
"input": "-12345678 12345678\n1912345678",
"output": "12345678"
},
{
"input": "728374857 678374857\n1928374839",
"output": "950000007"
},
{
"input": "278374837 992837483\n1000000000",
"output": "721625170"
},
{
"input": "-693849384 502938493\n982838498",
"output": "502938493"
},
{
"input": "-783928374 983738273\n992837483",
"output": "16261734"
},
{
"input": "-872837483 -682738473\n999999999",
"output": "190099010"
},
{
"input": "-892837483 -998273847\n999283948",
"output": "892837483"
},
{
"input": "-283938494 738473848\n1999999999",
"output": "716061513"
},
{
"input": "-278374857 819283838\n1",
"output": "721625150"
},
{
"input": "-1000000000 123456789\n1",
"output": "7"
},
{
"input": "-529529529 -524524524\n2",
"output": "475475483"
},
{
"input": "1 2\n2000000000",
"output": "2"
},
{
"input": "-1 -2\n2000000000",
"output": "1000000005"
},
{
"input": "1 2\n1999999999",
"output": "1"
},
{
"input": "1 2\n1999999998",
"output": "1000000006"
},
{
"input": "1 2\n1999999997",
"output": "1000000005"
},
{
"input": "1 2\n1999999996",
"output": "1000000006"
},
{
"input": "69975122 366233206\n1189460676",
"output": "703741923"
},
{
"input": "812229413 904420051\n806905621",
"output": "812229413"
},
{
"input": "872099024 962697902\n1505821695",
"output": "90598878"
},
{
"input": "887387283 909670917\n754835014",
"output": "112612724"
},
{
"input": "37759824 131342932\n854621399",
"output": "868657075"
},
{
"input": "-246822123 800496170\n626323615",
"output": "753177884"
},
{
"input": "-861439463 974126967\n349411083",
"output": "835566423"
},
{
"input": "-69811049 258093841\n1412447",
"output": "741906166"
},
{
"input": "844509330 -887335829\n123329059",
"output": "844509330"
},
{
"input": "83712471 -876177148\n1213284777",
"output": "40110388"
},
{
"input": "598730524 -718984219\n1282749880",
"output": "401269483"
},
{
"input": "-474244697 -745885656\n1517883612",
"output": "271640959"
},
{
"input": "-502583588 -894906953\n1154189557",
"output": "497416419"
},
{
"input": "-636523651 -873305815\n154879215",
"output": "763217843"
},
{
"input": "721765550 594845720\n78862386",
"output": "126919830"
},
{
"input": "364141461 158854993\n1337196589",
"output": "364141461"
},
{
"input": "878985260 677031952\n394707801",
"output": "798046699"
},
{
"input": "439527072 -24854079\n1129147002",
"output": "464381151"
},
{
"input": "840435009 -612103127\n565968986",
"output": "387896880"
},
{
"input": "875035447 -826471373\n561914518",
"output": "124964560"
},
{
"input": "-342526698 305357084\n70776744",
"output": "352116225"
},
{
"input": "-903244186 899202229\n1527859274",
"output": "899202229"
},
{
"input": "-839482546 815166320\n1127472130",
"output": "839482546"
},
{
"input": "-976992569 -958313041\n1686580818",
"output": "981320479"
},
{
"input": "-497338894 -51069176\n737081851",
"output": "502661113"
},
{
"input": "-697962643 -143148799\n1287886520",
"output": "856851208"
},
{
"input": "-982572938 -482658433\n1259858332",
"output": "982572938"
},
{
"input": "123123 78817\n2000000000",
"output": "78817"
},
{
"input": "1000000000 -1000000000\n3",
"output": "14"
},
{
"input": "-1000000000 1000000000\n6",
"output": "14"
},
{
"input": "2 3\n6",
"output": "1000000006"
},
{
"input": "0 -1\n6",
"output": "1"
},
{
"input": "500000000 -1000000000\n600000003",
"output": "500000014"
},
{
"input": "-1000000000 1000000000\n3",
"output": "999999993"
},
{
"input": "1 3\n6",
"output": "1000000005"
},
{
"input": "1 2\n12",
"output": "1000000006"
},
{
"input": "7 -1000000000\n3",
"output": "0"
},
{
"input": "-999999997 999999997\n6",
"output": "20"
},
{
"input": "3 4\n6",
"output": "1000000006"
},
{
"input": "-1 2\n6",
"output": "1000000004"
},
{
"input": "2 3\n12",
"output": "1000000006"
},
{
"input": "4 18\n6",
"output": "999999993"
},
{
"input": "1 2\n6",
"output": "1000000006"
},
{
"input": "1000000000 -1000000000\n6",
"output": "999999993"
},
{
"input": "999999999 -999999999\n3",
"output": "16"
},
{
"input": "-1 0\n1",
"output": "1000000006"
},
{
"input": "1000000000 -1000000000\n9",
"output": "14"
},
{
"input": "999999999 -1000000000\n12",
"output": "999999992"
},
{
"input": "1000000000 -7\n3",
"output": "0"
},
{
"input": "-5 5\n6",
"output": "999999997"
},
{
"input": "5 9\n6",
"output": "1000000003"
},
{
"input": "-15 -10\n1",
"output": "999999992"
}
] | 1,652,690,662
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 0
| 171
| 41,984,000
|
from statistics import multimode
def multiply(a, b):
d = 2 #Dimensions
mul = [[0 for x in range(d)]
for y in range(d)]
for i in range(d):
for j in range(d):
mul[i][j] = 0
for k in range(d):
mul[i][j] += a[i][k] * b[k][j]
for i in range(d):
for j in range(d):
a[i][j] = mul[i][j]
return a
# Function to compute F raise to power n-2.
def power(F, n):
M = [[0, 1], [-1, 1]]
if (n == 1):
return F[0][0] + F[0][1]
power(F, int(n / 2))
F = multiply(F, F)
if (n % 2 != 0):
F = multiply(F, M)
return F
x, y = list(map(int, input().split()))
n = int(input())
A = [[0, 1], [-1, 1]]
if n == 2:
print(y % (10**9 + 7))
elif n == 1:
print(x % (10**9 + 7))
else:
if n - 3 > 0:
F = power(A, n - 2)
else:
F = A
r = F[1][0] * x + F[1][1] * y
print(r % (10**9 + 7))
|
Title: Jzzhu and Sequences
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Jzzhu has invented a kind of sequences, they meet the following property:
You are given *x* and *y*, please calculate *f**n* modulo 1000000007 (109<=+<=7).
Input Specification:
The first line contains two integers *x* and *y* (|*x*|,<=|*y*|<=≤<=109). The second line contains a single integer *n* (1<=≤<=*n*<=≤<=2·109).
Output Specification:
Output a single integer representing *f**n* modulo 1000000007 (109<=+<=7).
Demo Input:
['2 3\n3\n', '0 -1\n2\n']
Demo Output:
['1\n', '1000000006\n']
Note:
In the first sample, *f*<sub class="lower-index">2</sub> = *f*<sub class="lower-index">1</sub> + *f*<sub class="lower-index">3</sub>, 3 = 2 + *f*<sub class="lower-index">3</sub>, *f*<sub class="lower-index">3</sub> = 1.
In the second sample, *f*<sub class="lower-index">2</sub> = - 1; - 1 modulo (10<sup class="upper-index">9</sup> + 7) equals (10<sup class="upper-index">9</sup> + 6).
|
```python
from statistics import multimode
def multiply(a, b):
d = 2 #Dimensions
mul = [[0 for x in range(d)]
for y in range(d)]
for i in range(d):
for j in range(d):
mul[i][j] = 0
for k in range(d):
mul[i][j] += a[i][k] * b[k][j]
for i in range(d):
for j in range(d):
a[i][j] = mul[i][j]
return a
# Function to compute F raise to power n-2.
def power(F, n):
M = [[0, 1], [-1, 1]]
if (n == 1):
return F[0][0] + F[0][1]
power(F, int(n / 2))
F = multiply(F, F)
if (n % 2 != 0):
F = multiply(F, M)
return F
x, y = list(map(int, input().split()))
n = int(input())
A = [[0, 1], [-1, 1]]
if n == 2:
print(y % (10**9 + 7))
elif n == 1:
print(x % (10**9 + 7))
else:
if n - 3 > 0:
F = power(A, n - 2)
else:
F = A
r = F[1][0] * x + F[1][1] * y
print(r % (10**9 + 7))
```
| -1
|
|
1,004
|
A
|
Sonya and Hotels
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Sonya decided that having her own hotel business is the best way of earning money because she can profit and rest wherever she wants.
The country where Sonya lives is an endless line. There is a city in each integer coordinate on this line. She has $n$ hotels, where the $i$-th hotel is located in the city with coordinate $x_i$. Sonya is a smart girl, so she does not open two or more hotels in the same city.
Sonya understands that her business needs to be expanded by opening new hotels, so she decides to build one more. She wants to make the minimum distance from this hotel to all others to be equal to $d$. The girl understands that there are many possible locations to construct such a hotel. Thus she wants to know the number of possible coordinates of the cities where she can build a new hotel.
Because Sonya is lounging in a jacuzzi in one of her hotels, she is asking you to find the number of cities where she can build a new hotel so that the minimum distance from the original $n$ hotels to the new one is equal to $d$.
|
The first line contains two integers $n$ and $d$ ($1\leq n\leq 100$, $1\leq d\leq 10^9$) — the number of Sonya's hotels and the needed minimum distance from a new hotel to all others.
The second line contains $n$ different integers in strictly increasing order $x_1, x_2, \ldots, x_n$ ($-10^9\leq x_i\leq 10^9$) — coordinates of Sonya's hotels.
|
Print the number of cities where Sonya can build a new hotel so that the minimum distance from this hotel to all others is equal to $d$.
|
[
"4 3\n-3 2 9 16\n",
"5 2\n4 8 11 18 19\n"
] |
[
"6\n",
"5\n"
] |
In the first example, there are $6$ possible cities where Sonya can build a hotel. These cities have coordinates $-6$, $5$, $6$, $12$, $13$, and $19$.
In the second example, there are $5$ possible cities where Sonya can build a hotel. These cities have coordinates $2$, $6$, $13$, $16$, and $21$.
| 500
|
[
{
"input": "4 3\n-3 2 9 16",
"output": "6"
},
{
"input": "5 2\n4 8 11 18 19",
"output": "5"
},
{
"input": "10 10\n-67 -59 -49 -38 -8 20 41 59 74 83",
"output": "8"
},
{
"input": "10 10\n0 20 48 58 81 95 111 137 147 159",
"output": "9"
},
{
"input": "100 1\n0 1 2 3 4 5 7 8 10 11 12 13 14 15 16 17 19 21 22 23 24 25 26 27 28 30 32 33 36 39 40 41 42 46 48 53 54 55 59 60 61 63 65 68 70 71 74 75 76 79 80 81 82 84 88 89 90 91 93 94 96 97 98 100 101 102 105 106 107 108 109 110 111 113 114 115 116 117 118 120 121 122 125 126 128 131 132 133 134 135 137 138 139 140 143 144 146 147 148 149",
"output": "47"
},
{
"input": "1 1000000000\n-1000000000",
"output": "2"
},
{
"input": "2 1000000000\n-1000000000 1000000000",
"output": "3"
},
{
"input": "100 2\n1 3 5 6 8 9 12 13 14 17 18 21 22 23 24 25 26 27 29 30 34 35 36 39 41 44 46 48 52 53 55 56 57 59 61 63 64 66 68 69 70 71 72 73 75 76 77 79 80 81 82 87 88 91 92 93 94 95 96 97 99 100 102 103 104 106 109 110 111 112 113 114 115 117 118 119 120 122 124 125 127 128 129 130 131 132 133 134 136 137 139 140 141 142 143 145 146 148 149 150",
"output": "6"
},
{
"input": "100 3\n0 1 3 6 7 8 9 10 13 14 16 17 18 20 21 22 24 26 27 30 33 34 35 36 37 39 42 43 44 45 46 48 53 54 55 56 57 58 61 63 64 65 67 69 70 72 73 76 77 78 79 81 82 83 85 86 87 88 90 92 93 95 96 97 98 99 100 101 104 105 108 109 110 113 114 115 116 118 120 121 123 124 125 128 130 131 132 133 134 135 136 137 139 140 141 142 146 147 148 150",
"output": "2"
},
{
"input": "1 1000000000\n1000000000",
"output": "2"
},
{
"input": "10 2\n-93 -62 -53 -42 -38 11 57 58 87 94",
"output": "17"
},
{
"input": "2 500000000\n-1000000000 1000000000",
"output": "4"
},
{
"input": "100 10\n-489 -476 -445 -432 -430 -421 -420 -418 -412 -411 -404 -383 -356 -300 -295 -293 -287 -276 -265 -263 -258 -251 -249 -246 -220 -219 -205 -186 -166 -157 -143 -137 -136 -130 -103 -86 -80 -69 -67 -55 -43 -41 -40 -26 -19 -9 16 29 41 42 54 76 84 97 98 99 101 115 134 151 157 167 169 185 197 204 208 226 227 232 234 249 259 266 281 282 293 298 300 306 308 313 319 328 331 340 341 344 356 362 366 380 390 399 409 411 419 444 455 498",
"output": "23"
},
{
"input": "1 1000000000\n999999999",
"output": "2"
},
{
"input": "1 1\n-5",
"output": "2"
},
{
"input": "2 1\n-1000000000 1000000000",
"output": "4"
},
{
"input": "1 2\n1",
"output": "2"
},
{
"input": "4 5\n0 20 40 60",
"output": "8"
},
{
"input": "1 1\n-10",
"output": "2"
},
{
"input": "1 1\n-1000000000",
"output": "2"
},
{
"input": "1 1000000000\n0",
"output": "2"
},
{
"input": "1 2\n-10",
"output": "2"
},
{
"input": "1 1\n2",
"output": "2"
},
{
"input": "1 5\n-100",
"output": "2"
},
{
"input": "2 1000000000\n999999999 1000000000",
"output": "2"
},
{
"input": "2 2\n0 5",
"output": "4"
},
{
"input": "1 2\n-5",
"output": "2"
},
{
"input": "1 1\n1",
"output": "2"
},
{
"input": "1 5\n-20",
"output": "2"
},
{
"input": "2 100000000\n-1000000000 1000000000",
"output": "4"
},
{
"input": "1 1000000000\n147483641",
"output": "2"
},
{
"input": "3 3\n1 8 9",
"output": "4"
},
{
"input": "2 1\n1 1000000000",
"output": "4"
},
{
"input": "1 2\n-4",
"output": "2"
},
{
"input": "2 1\n-1000000000 -1",
"output": "4"
}
] | 1,530,809,379
| 879
|
Python 3
|
OK
|
TESTS
| 45
| 124
| 0
|
n, d = map(int, input().split())
arr = list(map(int, input().split()))
if n == 1:
ans = 2
else:
s = set()
s.add(arr[0] - d)
s.add(arr[-1] + d)
for i in range(n):
if i == 0:
if arr[i + 1] - arr[i] - d >= d:
s.add(arr[i] + d)
elif i == n - 1:
if arr[i] - d - arr[i - 1] >= d:
s.add(arr[i] - d)
else:
if arr[i + 1] - arr[i] - d >= d:
s.add(arr[i] + d)
if arr[i] - d - arr[i - 1] >= d:
s.add(arr[i] - d)
ans = len(s)
print(ans)
|
Title: Sonya and Hotels
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sonya decided that having her own hotel business is the best way of earning money because she can profit and rest wherever she wants.
The country where Sonya lives is an endless line. There is a city in each integer coordinate on this line. She has $n$ hotels, where the $i$-th hotel is located in the city with coordinate $x_i$. Sonya is a smart girl, so she does not open two or more hotels in the same city.
Sonya understands that her business needs to be expanded by opening new hotels, so she decides to build one more. She wants to make the minimum distance from this hotel to all others to be equal to $d$. The girl understands that there are many possible locations to construct such a hotel. Thus she wants to know the number of possible coordinates of the cities where she can build a new hotel.
Because Sonya is lounging in a jacuzzi in one of her hotels, she is asking you to find the number of cities where she can build a new hotel so that the minimum distance from the original $n$ hotels to the new one is equal to $d$.
Input Specification:
The first line contains two integers $n$ and $d$ ($1\leq n\leq 100$, $1\leq d\leq 10^9$) — the number of Sonya's hotels and the needed minimum distance from a new hotel to all others.
The second line contains $n$ different integers in strictly increasing order $x_1, x_2, \ldots, x_n$ ($-10^9\leq x_i\leq 10^9$) — coordinates of Sonya's hotels.
Output Specification:
Print the number of cities where Sonya can build a new hotel so that the minimum distance from this hotel to all others is equal to $d$.
Demo Input:
['4 3\n-3 2 9 16\n', '5 2\n4 8 11 18 19\n']
Demo Output:
['6\n', '5\n']
Note:
In the first example, there are $6$ possible cities where Sonya can build a hotel. These cities have coordinates $-6$, $5$, $6$, $12$, $13$, and $19$.
In the second example, there are $5$ possible cities where Sonya can build a hotel. These cities have coordinates $2$, $6$, $13$, $16$, and $21$.
|
```python
n, d = map(int, input().split())
arr = list(map(int, input().split()))
if n == 1:
ans = 2
else:
s = set()
s.add(arr[0] - d)
s.add(arr[-1] + d)
for i in range(n):
if i == 0:
if arr[i + 1] - arr[i] - d >= d:
s.add(arr[i] + d)
elif i == n - 1:
if arr[i] - d - arr[i - 1] >= d:
s.add(arr[i] - d)
else:
if arr[i + 1] - arr[i] - d >= d:
s.add(arr[i] + d)
if arr[i] - d - arr[i - 1] >= d:
s.add(arr[i] - d)
ans = len(s)
print(ans)
```
| 3
|
|
742
|
A
|
Arpa’s hard exam and Mehrdad’s naive cheat
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math",
"number theory"
] | null | null |
There exists an island called Arpa’s land, some beautiful girls live there, as ugly ones do.
Mehrdad wants to become minister of Arpa’s land. Arpa has prepared an exam. Exam has only one question, given *n*, print the last digit of 1378*n*.
Mehrdad has become quite confused and wants you to help him. Please help, although it's a naive cheat.
|
The single line of input contains one integer *n* (0<=<=≤<=<=*n*<=<=≤<=<=109).
|
Print single integer — the last digit of 1378*n*.
|
[
"1\n",
"2\n"
] |
[
"8",
"4"
] |
In the first example, last digit of 1378<sup class="upper-index">1</sup> = 1378 is 8.
In the second example, last digit of 1378<sup class="upper-index">2</sup> = 1378·1378 = 1898884 is 4.
| 500
|
[
{
"input": "1",
"output": "8"
},
{
"input": "2",
"output": "4"
},
{
"input": "1000",
"output": "6"
},
{
"input": "3",
"output": "2"
},
{
"input": "4",
"output": "6"
},
{
"input": "1000000000",
"output": "6"
},
{
"input": "5",
"output": "8"
},
{
"input": "6",
"output": "4"
},
{
"input": "999999999",
"output": "2"
},
{
"input": "1378",
"output": "4"
},
{
"input": "13781378",
"output": "4"
},
{
"input": "51202278",
"output": "4"
},
{
"input": "999999998",
"output": "4"
},
{
"input": "999999997",
"output": "8"
},
{
"input": "12193721",
"output": "8"
},
{
"input": "0",
"output": "1"
},
{
"input": "989898989",
"output": "8"
},
{
"input": "7",
"output": "2"
},
{
"input": "8",
"output": "6"
},
{
"input": "9",
"output": "8"
},
{
"input": "10",
"output": "4"
},
{
"input": "11",
"output": "2"
},
{
"input": "12",
"output": "6"
},
{
"input": "13",
"output": "8"
},
{
"input": "14",
"output": "4"
},
{
"input": "15",
"output": "2"
},
{
"input": "16",
"output": "6"
},
{
"input": "999999996",
"output": "6"
},
{
"input": "999999995",
"output": "2"
},
{
"input": "999999994",
"output": "4"
}
] | 1,661,153,813
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 5
| 1,000
| 0
|
from sys import stdin,stdout
def solve():
n = int(stdin.readline())
ans = 1
for i in range(n):
ans = (ans*8)%10
return ans
res = solve()
stdout.write(str(res))
|
Title: Arpa’s hard exam and Mehrdad’s naive cheat
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There exists an island called Arpa’s land, some beautiful girls live there, as ugly ones do.
Mehrdad wants to become minister of Arpa’s land. Arpa has prepared an exam. Exam has only one question, given *n*, print the last digit of 1378*n*.
Mehrdad has become quite confused and wants you to help him. Please help, although it's a naive cheat.
Input Specification:
The single line of input contains one integer *n* (0<=<=≤<=<=*n*<=<=≤<=<=109).
Output Specification:
Print single integer — the last digit of 1378*n*.
Demo Input:
['1\n', '2\n']
Demo Output:
['8', '4']
Note:
In the first example, last digit of 1378<sup class="upper-index">1</sup> = 1378 is 8.
In the second example, last digit of 1378<sup class="upper-index">2</sup> = 1378·1378 = 1898884 is 4.
|
```python
from sys import stdin,stdout
def solve():
n = int(stdin.readline())
ans = 1
for i in range(n):
ans = (ans*8)%10
return ans
res = solve()
stdout.write(str(res))
```
| 0
|
|
61
|
A
|
Ultra-Fast Mathematician
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Ultra-Fast Mathematician
|
2
|
256
|
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
|
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
|
Write one line — the corresponding answer. Do not omit the leading 0s.
|
[
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] |
[
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] |
none
| 500
|
[
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,529,943,279
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 102
| 93
| 0
|
from sys import stdin
a = stdin.readline()
b = stdin.readline()
r =''
for i in range(len(a)-1):
r+=str(int(bool(int(a[i])) != bool(int(b[i]))))
print(r)
|
Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none
|
```python
from sys import stdin
a = stdin.readline()
b = stdin.readline()
r =''
for i in range(len(a)-1):
r+=str(int(bool(int(a[i])) != bool(int(b[i]))))
print(r)
```
| 3.97675
|
858
|
B
|
Which floor?
|
PROGRAMMING
| 1,500
|
[
"brute force",
"implementation"
] | null | null |
In a building where Polycarp lives there are equal number of flats on each floor. Unfortunately, Polycarp don't remember how many flats are on each floor, but he remembers that the flats are numbered from 1 from lower to upper floors. That is, the first several flats are on the first floor, the next several flats are on the second and so on. Polycarp don't remember the total number of flats in the building, so you can consider the building to be infinitely high (i.e. there are infinitely many floors). Note that the floors are numbered from 1.
Polycarp remembers on which floors several flats are located. It is guaranteed that this information is not self-contradictory. It means that there exists a building with equal number of flats on each floor so that the flats from Polycarp's memory have the floors Polycarp remembers.
Given this information, is it possible to restore the exact floor for flat *n*?
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100, 0<=≤<=*m*<=≤<=100), where *n* is the number of the flat you need to restore floor for, and *m* is the number of flats in Polycarp's memory.
*m* lines follow, describing the Polycarp's memory: each of these lines contains a pair of integers *k**i*,<=*f**i* (1<=≤<=*k**i*<=≤<=100, 1<=≤<=*f**i*<=≤<=100), which means that the flat *k**i* is on the *f**i*-th floor. All values *k**i* are distinct.
It is guaranteed that the given information is not self-contradictory.
|
Print the number of the floor in which the *n*-th flat is located, if it is possible to determine it in a unique way. Print -1 if it is not possible to uniquely restore this floor.
|
[
"10 3\n6 2\n2 1\n7 3\n",
"8 4\n3 1\n6 2\n5 2\n2 1\n"
] |
[
"4\n",
"-1\n"
] |
In the first example the 6-th flat is on the 2-nd floor, while the 7-th flat is on the 3-rd, so, the 6-th flat is the last on its floor and there are 3 flats on each floor. Thus, the 10-th flat is on the 4-th floor.
In the second example there can be 3 or 4 flats on each floor, so we can't restore the floor for the 8-th flat.
| 750
|
[
{
"input": "10 3\n6 2\n2 1\n7 3",
"output": "4"
},
{
"input": "8 4\n3 1\n6 2\n5 2\n2 1",
"output": "-1"
},
{
"input": "8 3\n7 2\n6 2\n1 1",
"output": "2"
},
{
"input": "4 2\n8 3\n3 1",
"output": "2"
},
{
"input": "11 4\n16 4\n11 3\n10 3\n15 4",
"output": "3"
},
{
"input": "16 6\n3 1\n16 4\n10 3\n9 3\n19 5\n8 2",
"output": "4"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "1 1\n1 1",
"output": "1"
},
{
"input": "1 1\n1 1",
"output": "1"
},
{
"input": "1 2\n1 1\n2 2",
"output": "1"
},
{
"input": "2 2\n2 1\n1 1",
"output": "1"
},
{
"input": "2 0",
"output": "-1"
},
{
"input": "2 1\n3 3",
"output": "2"
},
{
"input": "3 2\n1 1\n3 3",
"output": "3"
},
{
"input": "3 3\n1 1\n3 3\n2 2",
"output": "3"
},
{
"input": "3 0",
"output": "-1"
},
{
"input": "1 1\n2 1",
"output": "1"
},
{
"input": "2 2\n2 1\n1 1",
"output": "1"
},
{
"input": "2 3\n3 2\n1 1\n2 1",
"output": "1"
},
{
"input": "3 0",
"output": "-1"
},
{
"input": "3 1\n1 1",
"output": "-1"
},
{
"input": "2 2\n1 1\n3 1",
"output": "1"
},
{
"input": "1 3\n1 1\n2 1\n3 1",
"output": "1"
},
{
"input": "81 0",
"output": "-1"
},
{
"input": "22 1\n73 73",
"output": "22"
},
{
"input": "63 2\n10 10\n64 64",
"output": "63"
},
{
"input": "88 3\n37 37\n15 15\n12 12",
"output": "88"
},
{
"input": "29 4\n66 66\n47 47\n62 62\n2 2",
"output": "29"
},
{
"input": "9 40\n72 72\n47 47\n63 63\n66 66\n21 21\n94 94\n28 28\n45 45\n93 93\n25 25\n100 100\n43 43\n49 49\n9 9\n74 74\n26 26\n42 42\n50 50\n2 2\n92 92\n76 76\n3 3\n78 78\n44 44\n69 69\n36 36\n65 65\n81 81\n13 13\n46 46\n24 24\n96 96\n73 73\n82 82\n68 68\n64 64\n41 41\n31 31\n29 29\n10 10",
"output": "9"
},
{
"input": "50 70\n3 3\n80 80\n23 23\n11 11\n87 87\n7 7\n63 63\n61 61\n67 67\n53 53\n9 9\n43 43\n55 55\n27 27\n5 5\n1 1\n99 99\n65 65\n37 37\n60 60\n32 32\n38 38\n81 81\n2 2\n34 34\n17 17\n82 82\n26 26\n71 71\n4 4\n16 16\n19 19\n39 39\n51 51\n6 6\n49 49\n64 64\n83 83\n10 10\n56 56\n30 30\n76 76\n90 90\n42 42\n47 47\n91 91\n21 21\n52 52\n40 40\n77 77\n35 35\n88 88\n75 75\n95 95\n28 28\n15 15\n69 69\n22 22\n48 48\n66 66\n31 31\n98 98\n73 73\n25 25\n97 97\n18 18\n13 13\n54 54\n72 72\n29 29",
"output": "50"
},
{
"input": "6 0",
"output": "-1"
},
{
"input": "32 1\n9 5",
"output": "16"
},
{
"input": "73 2\n17 9\n21 11",
"output": "37"
},
{
"input": "6 3\n48 24\n51 26\n62 31",
"output": "3"
},
{
"input": "43 4\n82 41\n52 26\n88 44\n41 21",
"output": "22"
},
{
"input": "28 40\n85 43\n19 10\n71 36\n39 20\n57 29\n6 3\n15 8\n11 6\n99 50\n77 39\n79 40\n31 16\n35 18\n24 12\n54 27\n93 47\n90 45\n72 36\n63 32\n22 11\n83 42\n5 3\n12 6\n56 28\n94 47\n25 13\n41 21\n29 15\n36 18\n23 12\n1 1\n84 42\n55 28\n58 29\n9 5\n68 34\n86 43\n3 2\n48 24\n98 49",
"output": "14"
},
{
"input": "81 70\n55 28\n85 43\n58 29\n20 10\n4 2\n47 24\n42 21\n28 14\n26 13\n38 19\n9 5\n83 42\n7 4\n72 36\n18 9\n61 31\n41 21\n64 32\n90 45\n46 23\n67 34\n2 1\n6 3\n27 14\n87 44\n39 20\n11 6\n21 11\n35 18\n48 24\n44 22\n3 2\n71 36\n62 31\n34 17\n16 8\n99 50\n57 29\n13 7\n79 40\n100 50\n53 27\n89 45\n36 18\n43 22\n92 46\n98 49\n75 38\n40 20\n97 49\n37 19\n68 34\n30 15\n96 48\n17 9\n12 6\n45 23\n65 33\n76 38\n84 42\n23 12\n91 46\n52 26\n8 4\n32 16\n77 39\n88 44\n86 43\n70 35\n51 26",
"output": "41"
},
{
"input": "34 0",
"output": "-1"
},
{
"input": "63 1\n94 24",
"output": "16"
},
{
"input": "4 2\n38 10\n48 12",
"output": "1"
},
{
"input": "37 3\n66 17\n89 23\n60 15",
"output": "10"
},
{
"input": "71 4\n15 4\n13 4\n4 1\n70 18",
"output": "18"
},
{
"input": "77 40\n49 13\n66 17\n73 19\n15 4\n36 9\n1 1\n41 11\n91 23\n51 13\n46 12\n39 10\n42 11\n56 14\n61 16\n70 18\n92 23\n65 17\n54 14\n97 25\n8 2\n87 22\n33 9\n28 7\n38 10\n50 13\n26 7\n7 2\n31 8\n84 21\n47 12\n27 7\n53 14\n19 5\n93 24\n29 8\n3 1\n77 20\n62 16\n9 3\n44 11",
"output": "20"
},
{
"input": "18 70\n51 13\n55 14\n12 3\n43 11\n42 11\n95 24\n96 24\n29 8\n65 17\n71 18\n18 5\n62 16\n31 8\n100 25\n4 1\n77 20\n56 14\n24 6\n93 24\n97 25\n79 20\n40 10\n49 13\n86 22\n21 6\n46 12\n6 2\n14 4\n23 6\n20 5\n52 13\n88 22\n39 10\n70 18\n94 24\n13 4\n37 10\n41 11\n91 23\n85 22\n83 21\n89 23\n33 9\n64 16\n67 17\n57 15\n47 12\n36 9\n72 18\n81 21\n76 19\n35 9\n80 20\n34 9\n5 2\n22 6\n84 21\n63 16\n74 19\n90 23\n68 17\n98 25\n87 22\n2 1\n92 23\n50 13\n38 10\n28 7\n8 2\n60 15",
"output": "5"
},
{
"input": "89 0",
"output": "-1"
},
{
"input": "30 1\n3 1",
"output": "-1"
},
{
"input": "63 2\n48 6\n17 3",
"output": "8"
},
{
"input": "96 3\n45 6\n25 4\n35 5",
"output": "12"
},
{
"input": "37 4\n2 1\n29 4\n27 4\n47 6",
"output": "5"
},
{
"input": "64 40\n40 5\n92 12\n23 3\n75 10\n71 9\n2 1\n54 7\n18 3\n9 2\n74 10\n87 11\n11 2\n90 12\n30 4\n48 6\n12 2\n91 12\n60 8\n35 5\n13 2\n53 7\n46 6\n38 5\n59 8\n97 13\n32 4\n6 1\n36 5\n43 6\n83 11\n81 11\n99 13\n69 9\n10 2\n21 3\n78 10\n31 4\n27 4\n57 8\n1 1",
"output": "8"
},
{
"input": "17 70\n63 8\n26 4\n68 9\n30 4\n61 8\n84 11\n39 5\n53 7\n4 1\n81 11\n50 7\n91 12\n59 8\n90 12\n20 3\n21 3\n83 11\n94 12\n37 5\n8 1\n49 7\n34 5\n19 3\n44 6\n74 10\n2 1\n73 10\n88 11\n43 6\n36 5\n57 8\n64 8\n76 10\n40 5\n71 9\n95 12\n15 2\n41 6\n89 12\n42 6\n96 12\n1 1\n52 7\n38 5\n45 6\n78 10\n82 11\n16 2\n48 6\n51 7\n56 7\n28 4\n87 11\n93 12\n46 6\n29 4\n97 13\n54 7\n35 5\n3 1\n79 10\n99 13\n13 2\n55 7\n100 13\n11 2\n75 10\n24 3\n33 5\n22 3",
"output": "3"
},
{
"input": "9 0",
"output": "-1"
},
{
"input": "50 1\n31 2",
"output": "-1"
},
{
"input": "79 2\n11 1\n22 2",
"output": "-1"
},
{
"input": "16 3\n100 7\n94 6\n3 1",
"output": "1"
},
{
"input": "58 4\n73 5\n52 4\n69 5\n3 1",
"output": "4"
},
{
"input": "25 40\n70 5\n28 2\n60 4\n54 4\n33 3\n21 2\n51 4\n20 2\n44 3\n79 5\n65 5\n1 1\n52 4\n23 2\n38 3\n92 6\n63 4\n3 1\n91 6\n5 1\n64 4\n34 3\n25 2\n97 7\n89 6\n61 4\n71 5\n88 6\n29 2\n56 4\n45 3\n6 1\n53 4\n57 4\n90 6\n76 5\n8 1\n46 3\n73 5\n87 6",
"output": "2"
},
{
"input": "78 70\n89 6\n52 4\n87 6\n99 7\n3 1\n25 2\n46 3\n78 5\n35 3\n68 5\n85 6\n23 2\n60 4\n88 6\n17 2\n8 1\n15 1\n67 5\n95 6\n59 4\n94 6\n31 2\n4 1\n16 1\n10 1\n97 7\n42 3\n2 1\n24 2\n34 3\n37 3\n70 5\n18 2\n41 3\n48 3\n58 4\n20 2\n38 3\n72 5\n50 4\n49 4\n40 3\n61 4\n6 1\n45 3\n28 2\n13 1\n27 2\n96 6\n56 4\n91 6\n77 5\n12 1\n11 1\n53 4\n76 5\n74 5\n82 6\n55 4\n80 5\n14 1\n44 3\n7 1\n83 6\n79 5\n92 6\n66 5\n36 3\n73 5\n100 7",
"output": "5"
},
{
"input": "95 0",
"output": "-1"
},
{
"input": "33 1\n30 1",
"output": "-1"
},
{
"input": "62 2\n14 1\n15 1",
"output": "-1"
},
{
"input": "3 3\n6 1\n25 1\n38 2",
"output": "1"
},
{
"input": "44 4\n72 3\n80 3\n15 1\n36 2",
"output": "2"
},
{
"input": "34 40\n25 1\n28 1\n78 3\n5 1\n13 1\n75 3\n15 1\n67 3\n57 2\n23 1\n26 1\n61 2\n22 1\n48 2\n85 3\n24 1\n82 3\n83 3\n53 2\n38 2\n19 1\n33 2\n69 3\n17 1\n79 3\n54 2\n77 3\n97 4\n20 1\n35 2\n14 1\n18 1\n71 3\n21 1\n36 2\n56 2\n44 2\n63 2\n72 3\n32 1",
"output": "2"
},
{
"input": "83 70\n79 3\n49 2\n2 1\n44 2\n38 2\n77 3\n86 3\n31 1\n83 3\n82 3\n35 2\n7 1\n78 3\n23 1\n39 2\n58 2\n1 1\n87 3\n72 3\n20 1\n48 2\n14 1\n13 1\n6 1\n70 3\n55 2\n52 2\n25 1\n11 1\n61 2\n76 3\n95 3\n32 1\n66 3\n29 1\n9 1\n5 1\n3 1\n88 3\n59 2\n96 3\n10 1\n63 2\n40 2\n42 2\n34 2\n43 2\n19 1\n89 3\n94 3\n24 1\n98 4\n12 1\n30 1\n69 3\n17 1\n50 2\n8 1\n93 3\n16 1\n97 4\n54 2\n71 3\n18 1\n33 2\n80 3\n15 1\n99 4\n75 3\n4 1",
"output": "3"
},
{
"input": "2 0",
"output": "-1"
},
{
"input": "36 1\n96 1",
"output": "1"
},
{
"input": "73 2\n34 1\n4 1",
"output": "-1"
},
{
"input": "6 3\n37 1\n22 1\n70 1",
"output": "1"
},
{
"input": "47 4\n66 1\n57 1\n85 1\n47 1",
"output": "1"
},
{
"input": "9 40\n73 1\n21 1\n37 1\n87 1\n33 1\n69 1\n49 1\n19 1\n35 1\n93 1\n71 1\n43 1\n79 1\n85 1\n29 1\n72 1\n76 1\n47 1\n17 1\n67 1\n95 1\n41 1\n54 1\n88 1\n42 1\n80 1\n98 1\n96 1\n10 1\n24 1\n78 1\n18 1\n3 1\n91 1\n2 1\n15 1\n5 1\n60 1\n36 1\n46 1",
"output": "1"
},
{
"input": "63 70\n82 1\n53 1\n57 1\n46 1\n97 1\n19 1\n36 1\n90 1\n23 1\n88 1\n68 1\n45 1\n2 1\n70 1\n86 1\n8 1\n83 1\n40 1\n99 1\n42 1\n32 1\n52 1\n81 1\n50 1\n77 1\n37 1\n54 1\n75 1\n4 1\n49 1\n73 1\n22 1\n21 1\n98 1\n18 1\n51 1\n14 1\n76 1\n92 1\n80 1\n78 1\n33 1\n79 1\n89 1\n67 1\n9 1\n44 1\n60 1\n64 1\n55 1\n29 1\n100 1\n16 1\n87 1\n10 1\n12 1\n25 1\n85 1\n30 1\n63 1\n39 1\n38 1\n31 1\n5 1\n26 1\n91 1\n43 1\n72 1\n48 1\n94 1",
"output": "1"
},
{
"input": "2 0",
"output": "-1"
}
] | 1,505,656,285
| 2,785
|
Python 3
|
RUNTIME_ERROR
|
PRETESTS
| 2
| 46
| 0
|
import math
def f(m):
global h
f = True
for i in range(len(h)):
for j in h[i]:
if not(j <= i * m and j > (i - 1) * m ):
f = False
return f
def binary_search():
left, right = 0, 1000
while right - left > 1:
middle = (right + left) // 2
if not f(middle):
right = middle
else:
left = middle
return left
n, m = map(int, input().split())
h = [[] for i in range(10 ** 3)]
for i in range(m):
a, b = map(int, input().split())
h[b].append(a)
ans = binary_search()
if f(ans - 1) or f(ans + 1):
print(-1)
else:
print(math.ceil(n / ans))
|
Title: Which floor?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In a building where Polycarp lives there are equal number of flats on each floor. Unfortunately, Polycarp don't remember how many flats are on each floor, but he remembers that the flats are numbered from 1 from lower to upper floors. That is, the first several flats are on the first floor, the next several flats are on the second and so on. Polycarp don't remember the total number of flats in the building, so you can consider the building to be infinitely high (i.e. there are infinitely many floors). Note that the floors are numbered from 1.
Polycarp remembers on which floors several flats are located. It is guaranteed that this information is not self-contradictory. It means that there exists a building with equal number of flats on each floor so that the flats from Polycarp's memory have the floors Polycarp remembers.
Given this information, is it possible to restore the exact floor for flat *n*?
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100, 0<=≤<=*m*<=≤<=100), where *n* is the number of the flat you need to restore floor for, and *m* is the number of flats in Polycarp's memory.
*m* lines follow, describing the Polycarp's memory: each of these lines contains a pair of integers *k**i*,<=*f**i* (1<=≤<=*k**i*<=≤<=100, 1<=≤<=*f**i*<=≤<=100), which means that the flat *k**i* is on the *f**i*-th floor. All values *k**i* are distinct.
It is guaranteed that the given information is not self-contradictory.
Output Specification:
Print the number of the floor in which the *n*-th flat is located, if it is possible to determine it in a unique way. Print -1 if it is not possible to uniquely restore this floor.
Demo Input:
['10 3\n6 2\n2 1\n7 3\n', '8 4\n3 1\n6 2\n5 2\n2 1\n']
Demo Output:
['4\n', '-1\n']
Note:
In the first example the 6-th flat is on the 2-nd floor, while the 7-th flat is on the 3-rd, so, the 6-th flat is the last on its floor and there are 3 flats on each floor. Thus, the 10-th flat is on the 4-th floor.
In the second example there can be 3 or 4 flats on each floor, so we can't restore the floor for the 8-th flat.
|
```python
import math
def f(m):
global h
f = True
for i in range(len(h)):
for j in h[i]:
if not(j <= i * m and j > (i - 1) * m ):
f = False
return f
def binary_search():
left, right = 0, 1000
while right - left > 1:
middle = (right + left) // 2
if not f(middle):
right = middle
else:
left = middle
return left
n, m = map(int, input().split())
h = [[] for i in range(10 ** 3)]
for i in range(m):
a, b = map(int, input().split())
h[b].append(a)
ans = binary_search()
if f(ans - 1) or f(ans + 1):
print(-1)
else:
print(math.ceil(n / ans))
```
| -1
|
|
34
|
B
|
Sale
|
PROGRAMMING
| 900
|
[
"greedy",
"sortings"
] |
B. Sale
|
2
|
256
|
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
|
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
|
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
|
[
"5 3\n-6 0 35 -2 4\n",
"4 2\n7 0 0 -7\n"
] |
[
"8\n",
"7\n"
] |
none
| 1,000
|
[
{
"input": "5 3\n-6 0 35 -2 4",
"output": "8"
},
{
"input": "4 2\n7 0 0 -7",
"output": "7"
},
{
"input": "6 6\n756 -611 251 -66 572 -818",
"output": "1495"
},
{
"input": "5 5\n976 437 937 788 518",
"output": "0"
},
{
"input": "5 3\n-2 -2 -2 -2 -2",
"output": "6"
},
{
"input": "5 1\n998 997 985 937 998",
"output": "0"
},
{
"input": "2 2\n-742 -187",
"output": "929"
},
{
"input": "3 3\n522 597 384",
"output": "0"
},
{
"input": "4 2\n-215 -620 192 647",
"output": "835"
},
{
"input": "10 6\n557 605 685 231 910 633 130 838 -564 -85",
"output": "649"
},
{
"input": "20 14\n932 442 960 943 624 624 955 998 631 910 850 517 715 123 1000 155 -10 961 966 59",
"output": "10"
},
{
"input": "30 5\n991 997 996 967 977 999 991 986 1000 965 984 997 998 1000 958 983 974 1000 991 999 1000 978 961 992 990 998 998 978 998 1000",
"output": "0"
},
{
"input": "50 20\n-815 -947 -946 -993 -992 -846 -884 -954 -963 -733 -940 -746 -766 -930 -821 -937 -937 -999 -914 -938 -936 -975 -939 -981 -977 -952 -925 -901 -952 -978 -994 -957 -946 -896 -905 -836 -994 -951 -887 -939 -859 -953 -985 -988 -946 -829 -956 -842 -799 -886",
"output": "19441"
},
{
"input": "88 64\n999 999 1000 1000 999 996 995 1000 1000 999 1000 997 998 1000 999 1000 997 1000 993 998 994 999 998 996 1000 997 1000 1000 1000 997 1000 998 997 1000 1000 998 1000 998 999 1000 996 999 999 999 996 995 999 1000 998 999 1000 999 999 1000 1000 1000 996 1000 1000 1000 997 1000 1000 997 999 1000 1000 1000 1000 1000 999 999 1000 1000 996 999 1000 1000 995 999 1000 996 1000 998 999 999 1000 999",
"output": "0"
},
{
"input": "99 17\n-993 -994 -959 -989 -991 -995 -976 -997 -990 -1000 -996 -994 -999 -995 -1000 -983 -979 -1000 -989 -968 -994 -992 -962 -993 -999 -983 -991 -979 -995 -993 -973 -999 -995 -995 -999 -993 -995 -992 -947 -1000 -999 -998 -982 -988 -979 -993 -963 -988 -980 -990 -979 -976 -995 -999 -981 -988 -998 -999 -970 -1000 -983 -994 -943 -975 -998 -977 -973 -997 -959 -999 -983 -985 -950 -977 -977 -991 -998 -973 -987 -985 -985 -986 -984 -994 -978 -998 -989 -989 -988 -970 -985 -974 -997 -981 -962 -972 -995 -988 -993",
"output": "16984"
},
{
"input": "100 37\n205 19 -501 404 912 -435 -322 -469 -655 880 -804 -470 793 312 -108 586 -642 -928 906 605 -353 -800 745 -440 -207 752 -50 -28 498 -800 -62 -195 602 -833 489 352 536 404 -775 23 145 -512 524 759 651 -461 -427 -557 684 -366 62 592 -563 -811 64 418 -881 -308 591 -318 -145 -261 -321 -216 -18 595 -202 960 -4 219 226 -238 -882 -963 425 970 -434 -160 243 -672 -4 873 8 -633 904 -298 -151 -377 -61 -72 -677 -66 197 -716 3 -870 -30 152 -469 981",
"output": "21743"
},
{
"input": "100 99\n-931 -806 -830 -828 -916 -962 -660 -867 -952 -966 -820 -906 -724 -982 -680 -717 -488 -741 -897 -613 -986 -797 -964 -939 -808 -932 -810 -860 -641 -916 -858 -628 -821 -929 -917 -976 -664 -985 -778 -665 -624 -928 -940 -958 -884 -757 -878 -896 -634 -526 -514 -873 -990 -919 -988 -878 -650 -973 -774 -783 -733 -648 -756 -895 -833 -974 -832 -725 -841 -748 -806 -613 -924 -867 -881 -943 -864 -991 -809 -926 -777 -817 -998 -682 -910 -996 -241 -722 -964 -904 -821 -920 -835 -699 -805 -632 -779 -317 -915 -654",
"output": "81283"
},
{
"input": "100 14\n995 994 745 684 510 737 984 690 979 977 542 933 871 603 758 653 962 997 747 974 773 766 975 770 527 960 841 989 963 865 974 967 950 984 757 685 986 809 982 959 931 880 978 867 805 562 970 900 834 782 616 885 910 608 974 918 576 700 871 980 656 941 978 759 767 840 573 859 841 928 693 853 716 927 976 851 962 962 627 797 707 873 869 988 993 533 665 887 962 880 929 980 877 887 572 790 721 883 848 782",
"output": "0"
},
{
"input": "100 84\n768 946 998 752 931 912 826 1000 991 910 875 962 901 952 958 733 959 908 872 840 923 826 952 980 974 980 947 955 959 822 997 963 966 933 829 923 971 999 926 932 865 984 974 858 994 855 949 941 992 861 951 949 991 711 763 728 935 485 716 907 869 952 960 859 909 963 978 942 968 933 923 909 997 962 687 764 924 774 875 1000 961 951 987 974 848 921 966 859 995 997 974 931 886 941 974 986 906 978 998 823",
"output": "0"
},
{
"input": "100 80\n-795 -994 -833 -930 -974 -980 -950 -940 -788 -927 -583 -956 -945 -949 -809 -974 -957 -736 -967 -908 -975 -961 -986 -983 -963 -771 -952 -847 -751 -741 -982 -959 -925 -931 -839 -937 -880 -914 -858 -998 -812 -911 -862 -965 -943 -984 -738 -920 -950 -998 -909 -998 -781 -901 -677 -940 -985 -951 -675 -952 -967 -949 -882 -641 -969 -937 -975 -993 -913 -941 -807 -851 -832 -960 -939 -943 -895 -929 -528 -880 -823 -930 -888 -862 -948 -966 -962 -857 -799 -969 -833 -998 -952 -878 -946 -971 -976 -974 -723 -992",
"output": "75068"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 1\n555",
"output": "0"
},
{
"input": "1 1\n-1",
"output": "1"
},
{
"input": "1 1\n-24",
"output": "24"
}
] | 1,690,882,512
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 62
| 0
|
n,m = map(int,input().split())
a = sorted(map(int,input().split()),reverse=True)
s = sum(a[:m])
i=m-1
while i>=0:
if a[i]<0:
s-=a[i]
else:
break
print(s)
|
Title: Sale
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
Output Specification:
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
Demo Input:
['5 3\n-6 0 35 -2 4\n', '4 2\n7 0 0 -7\n']
Demo Output:
['8\n', '7\n']
Note:
none
|
```python
n,m = map(int,input().split())
a = sorted(map(int,input().split()),reverse=True)
s = sum(a[:m])
i=m-1
while i>=0:
if a[i]<0:
s-=a[i]
else:
break
print(s)
```
| 0
|
216
|
A
|
Tiling with Hexagons
|
PROGRAMMING
| 1,200
|
[
"implementation",
"math"
] | null | null |
Several ages ago Berland was a kingdom. The King of Berland adored math. That's why, when he first visited one of his many palaces, he first of all paid attention to the floor in one hall. The floor was tiled with hexagonal tiles.
The hall also turned out hexagonal in its shape. The King walked along the perimeter of the hall and concluded that each of the six sides has *a*, *b*, *c*, *a*, *b* and *c* adjacent tiles, correspondingly.
To better visualize the situation, look at the picture showing a similar hexagon for *a*<==<=2, *b*<==<=3 and *c*<==<=4.
According to the legend, as the King of Berland obtained the values *a*, *b* and *c*, he almost immediately calculated the total number of tiles on the hall floor. Can you do the same?
|
The first line contains three integers: *a*, *b* and *c* (2<=≤<=*a*,<=*b*,<=*c*<=≤<=1000).
|
Print a single number — the total number of tiles on the hall floor.
|
[
"2 3 4\n"
] |
[
"18"
] |
none
| 500
|
[
{
"input": "2 3 4",
"output": "18"
},
{
"input": "2 2 2",
"output": "7"
},
{
"input": "7 8 13",
"output": "224"
},
{
"input": "14 7 75",
"output": "1578"
},
{
"input": "201 108 304",
"output": "115032"
},
{
"input": "999 998 996",
"output": "2983022"
},
{
"input": "2 2 3",
"output": "10"
},
{
"input": "2 3 2",
"output": "10"
},
{
"input": "3 2 2",
"output": "10"
},
{
"input": "2 3 3",
"output": "14"
},
{
"input": "3 2 3",
"output": "14"
},
{
"input": "3 3 2",
"output": "14"
},
{
"input": "3 3 3",
"output": "19"
},
{
"input": "4 5 3",
"output": "36"
},
{
"input": "2 2 856",
"output": "2569"
},
{
"input": "2 986 2",
"output": "2959"
},
{
"input": "985 2 2",
"output": "2956"
},
{
"input": "2 958 983",
"output": "943654"
},
{
"input": "992 2 912",
"output": "906607"
},
{
"input": "789 894 2",
"output": "707048"
},
{
"input": "1000 1000 1000",
"output": "2997001"
},
{
"input": "384 458 284",
"output": "413875"
},
{
"input": "709 14 290",
"output": "218584"
},
{
"input": "485 117 521",
"output": "369265"
},
{
"input": "849 333 102",
"output": "401998"
},
{
"input": "998 999 1000",
"output": "2991006"
},
{
"input": "2 2 1000",
"output": "3001"
},
{
"input": "2 1000 2",
"output": "3001"
},
{
"input": "1000 2 2",
"output": "3001"
},
{
"input": "1000 2 1000",
"output": "1001999"
},
{
"input": "865 291 383",
"output": "692925"
},
{
"input": "41 49 28",
"output": "4412"
},
{
"input": "34 86 90",
"output": "13515"
},
{
"input": "39 23 56",
"output": "4252"
},
{
"input": "14 99 81",
"output": "10346"
},
{
"input": "48 38 193",
"output": "18144"
},
{
"input": "395 85 22",
"output": "43634"
},
{
"input": "38 291 89",
"output": "39922"
},
{
"input": "7 23 595",
"output": "17387"
},
{
"input": "948 48 3",
"output": "47494"
}
] | 1,483,934,419
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 92
| 4,608,000
|
a,b,c = input().split()
a,b,c = int(a), int(b), int(c)
tiles = 0
while (a!=0 and b!=0 and c!=0):
tiles += 2*(a+b+c) - 6
a -= 1
b -= 1
c -= 1
print(tiles)
|
Title: Tiling with Hexagons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Several ages ago Berland was a kingdom. The King of Berland adored math. That's why, when he first visited one of his many palaces, he first of all paid attention to the floor in one hall. The floor was tiled with hexagonal tiles.
The hall also turned out hexagonal in its shape. The King walked along the perimeter of the hall and concluded that each of the six sides has *a*, *b*, *c*, *a*, *b* and *c* adjacent tiles, correspondingly.
To better visualize the situation, look at the picture showing a similar hexagon for *a*<==<=2, *b*<==<=3 and *c*<==<=4.
According to the legend, as the King of Berland obtained the values *a*, *b* and *c*, he almost immediately calculated the total number of tiles on the hall floor. Can you do the same?
Input Specification:
The first line contains three integers: *a*, *b* and *c* (2<=≤<=*a*,<=*b*,<=*c*<=≤<=1000).
Output Specification:
Print a single number — the total number of tiles on the hall floor.
Demo Input:
['2 3 4\n']
Demo Output:
['18']
Note:
none
|
```python
a,b,c = input().split()
a,b,c = int(a), int(b), int(c)
tiles = 0
while (a!=0 and b!=0 and c!=0):
tiles += 2*(a+b+c) - 6
a -= 1
b -= 1
c -= 1
print(tiles)
```
| 0
|
|
2
|
B
|
The least round way
|
PROGRAMMING
| 2,000
|
[
"dp",
"math"
] |
B. The least round way
|
2
|
64
|
There is a square matrix *n*<=×<=*n*, consisting of non-negative integer numbers. You should find such a way on it that
- starts in the upper left cell of the matrix; - each following cell is to the right or down from the current cell; - the way ends in the bottom right cell.
Moreover, if we multiply together all the numbers along the way, the result should be the least "round". In other words, it should end in the least possible number of zeros.
|
The first line contains an integer number *n* (2<=≤<=*n*<=≤<=1000), *n* is the size of the matrix. Then follow *n* lines containing the matrix elements (non-negative integer numbers not exceeding 109).
|
In the first line print the least number of trailing zeros. In the second line print the correspondent way itself.
|
[
"3\n1 2 3\n4 5 6\n7 8 9\n"
] |
[
"0\nDDRR\n"
] |
none
| 0
|
[
{
"input": "3\n1 2 3\n4 5 6\n7 8 9",
"output": "0\nDDRR"
},
{
"input": "2\n7 6\n3 8",
"output": "0\nDR"
},
{
"input": "3\n4 10 5\n10 9 4\n6 5 3",
"output": "1\nDRRD"
},
{
"input": "4\n1 1 9 9\n3 4 7 3\n7 9 1 7\n1 7 1 5",
"output": "0\nDDDRRR"
},
{
"input": "5\n8 3 2 1 4\n3 7 2 4 8\n9 2 8 9 10\n2 3 6 10 1\n8 2 2 8 4",
"output": "0\nDDDDRRRR"
},
{
"input": "6\n5 5 4 10 5 5\n7 10 8 7 6 6\n7 1 7 9 7 8\n5 5 3 3 10 9\n5 8 10 6 3 8\n3 10 5 4 3 4",
"output": "1\nDDRRDRDDRR"
},
{
"input": "7\n2 9 8 2 7 4 8\n9 5 4 4 8 5 3\n5 7 2 10 8 1 8\n2 7 10 7 5 7 7\n9 2 7 6 4 8 4\n7 2 4 7 4 1 8\n9 5 3 10 1 6 2",
"output": "0\nRRDRRDRDDDDR"
},
{
"input": "8\n1 1 10 1 8 4 8 7\n9 3 3 2 2 6 2 4\n7 4 3 5 10 3 5 1\n8 4 4 10 4 5 9 4\n5 5 5 2 6 7 1 8\n4 10 1 3 2 4 8 3\n8 1 10 2 8 2 2 4\n2 10 6 8 10 2 8 4",
"output": "0\nDRRRRRRRDDDDDD"
},
{
"input": "9\n8 3 3 3 10 3 10 5 6\n2 1 6 1 8 1 9 1 6\n6 1 5 4 2 2 10 4 9\n1 9 1 3 10 6 10 5 5\n1 10 5 4 7 2 5 9 10\n6 6 1 3 1 9 4 9 9\n5 3 7 6 4 6 2 10 2\n9 3 3 10 5 6 7 6 4\n4 9 6 7 4 3 7 6 5",
"output": "1\nDDDDDRDDDRRRRRRR"
},
{
"input": "10\n10 8 6 5 9 8 2 5 3 2\n3 1 8 6 8 10 5 5 7 8\n5 9 7 7 4 9 7 2 5 2\n5 9 9 5 4 2 6 6 8 1\n10 6 9 9 10 5 6 3 5 9\n6 7 10 3 1 4 3 6 7 6\n10 10 4 7 4 4 8 6 7 4\n10 5 8 2 2 7 4 4 1 4\n8 4 6 10 10 6 1 3 3 1\n9 9 7 2 9 5 1 8 6 3",
"output": "1\nDRDDDRRDDDRRDRDRRR"
}
] | 1,646,773,837
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 512,000
|
import sys
lines = iter(sys.stdin)
n = [int(x) for x in next(lines).split()][0]
matrix = [[int(x) for x in next(lines).split()] for _ in range(n)]
dp = [[(0, 0) for _ in range(n)] for _ in range(n)]
backtrack = [["N" for _ in range(n)] for _ in range(n)]
# f(i, j) - the minimum number of zeroes to get from (0, 0) <exclusive>
# to (i, j) <inclulsive>
# i, j = i * 10^j
# up should be first and left second
def minTuple(num1, num2):
# tuples in (base, exponent) form
len1 = 0
len2 = 0
base1 = num1[0]
base2 = num2[0]
while base1 > 0:
len1 += 1
base1 = base1 // 10
while base2 > 0:
len2 += 1
base2 = base2 // 10
# if (num1[1] != num2[1]):
return (num1, "D") if num1[1] < num2[1] else (num2, "R")
# elif (len1 + num1[1] == len2 + num2[1]):
# return (num1, "D") if num1[0] >= num2[0] else (num2, "R")
# else:
# return (num1, "D") if len1 + num1[1] > len2 + num2[1] else (num2, "R")
for i in range(n):
for j in range(n):
up = (1, 0) if i-1 < 0 else dp[i-1][j]
left = (1, 0) if j-1 < 0 else dp[i][j-1]
(minVal, direction) = minTuple(up, left)
currNum = matrix[i][j]
newBase = currNum * minVal[0]
newExp = minVal[1]
while newBase % 10 == 0:
newBase = newBase // 10
newExp += 1
dp[i][j] = (newBase, newExp)
backtrack[i][j] = direction
backtrack_list = []
i = n-1
j = n-1
while i > 0 or j > 0:
if i == 0:
backtrack_list.append("R")
j -= 1
elif j == 0:
backtrack_list.append("D")
i -= 1
else:
char = backtrack[i][j]
backtrack_list.append(char)
if char == "D":
i -= 1
else:
j -= 1
# print(dp)
# print(backtrack)
print(dp)
print(backtrack)
print(dp[n-1][n-1][1])
backtrack_list.reverse()
print("".join(backtrack_list))
|
Title: The least round way
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
There is a square matrix *n*<=×<=*n*, consisting of non-negative integer numbers. You should find such a way on it that
- starts in the upper left cell of the matrix; - each following cell is to the right or down from the current cell; - the way ends in the bottom right cell.
Moreover, if we multiply together all the numbers along the way, the result should be the least "round". In other words, it should end in the least possible number of zeros.
Input Specification:
The first line contains an integer number *n* (2<=≤<=*n*<=≤<=1000), *n* is the size of the matrix. Then follow *n* lines containing the matrix elements (non-negative integer numbers not exceeding 109).
Output Specification:
In the first line print the least number of trailing zeros. In the second line print the correspondent way itself.
Demo Input:
['3\n1 2 3\n4 5 6\n7 8 9\n']
Demo Output:
['0\nDDRR\n']
Note:
none
|
```python
import sys
lines = iter(sys.stdin)
n = [int(x) for x in next(lines).split()][0]
matrix = [[int(x) for x in next(lines).split()] for _ in range(n)]
dp = [[(0, 0) for _ in range(n)] for _ in range(n)]
backtrack = [["N" for _ in range(n)] for _ in range(n)]
# f(i, j) - the minimum number of zeroes to get from (0, 0) <exclusive>
# to (i, j) <inclulsive>
# i, j = i * 10^j
# up should be first and left second
def minTuple(num1, num2):
# tuples in (base, exponent) form
len1 = 0
len2 = 0
base1 = num1[0]
base2 = num2[0]
while base1 > 0:
len1 += 1
base1 = base1 // 10
while base2 > 0:
len2 += 1
base2 = base2 // 10
# if (num1[1] != num2[1]):
return (num1, "D") if num1[1] < num2[1] else (num2, "R")
# elif (len1 + num1[1] == len2 + num2[1]):
# return (num1, "D") if num1[0] >= num2[0] else (num2, "R")
# else:
# return (num1, "D") if len1 + num1[1] > len2 + num2[1] else (num2, "R")
for i in range(n):
for j in range(n):
up = (1, 0) if i-1 < 0 else dp[i-1][j]
left = (1, 0) if j-1 < 0 else dp[i][j-1]
(minVal, direction) = minTuple(up, left)
currNum = matrix[i][j]
newBase = currNum * minVal[0]
newExp = minVal[1]
while newBase % 10 == 0:
newBase = newBase // 10
newExp += 1
dp[i][j] = (newBase, newExp)
backtrack[i][j] = direction
backtrack_list = []
i = n-1
j = n-1
while i > 0 or j > 0:
if i == 0:
backtrack_list.append("R")
j -= 1
elif j == 0:
backtrack_list.append("D")
i -= 1
else:
char = backtrack[i][j]
backtrack_list.append(char)
if char == "D":
i -= 1
else:
j -= 1
# print(dp)
# print(backtrack)
print(dp)
print(backtrack)
print(dp[n-1][n-1][1])
backtrack_list.reverse()
print("".join(backtrack_list))
```
| 0
|
615
|
A
|
Bulbs
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Vasya wants to turn on Christmas lights consisting of *m* bulbs. Initially, all bulbs are turned off. There are *n* buttons, each of them is connected to some set of bulbs. Vasya can press any of these buttons. When the button is pressed, it turns on all the bulbs it's connected to. Can Vasya light up all the bulbs?
If Vasya presses the button such that some bulbs connected to it are already turned on, they do not change their state, i.e. remain turned on.
|
The first line of the input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of buttons and the number of bulbs respectively.
Each of the next *n* lines contains *x**i* (0<=≤<=*x**i*<=≤<=*m*) — the number of bulbs that are turned on by the *i*-th button, and then *x**i* numbers *y**ij* (1<=≤<=*y**ij*<=≤<=*m*) — the numbers of these bulbs.
|
If it's possible to turn on all *m* bulbs print "YES", otherwise print "NO".
|
[
"3 4\n2 1 4\n3 1 3 1\n1 2\n",
"3 3\n1 1\n1 2\n1 1\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample you can press each button once and turn on all the bulbs. In the 2 sample it is impossible to turn on the 3-rd lamp.
| 500
|
[
{
"input": "3 4\n2 1 4\n3 1 3 1\n1 2",
"output": "YES"
},
{
"input": "3 3\n1 1\n1 2\n1 1",
"output": "NO"
},
{
"input": "3 4\n1 1\n1 2\n1 3",
"output": "NO"
},
{
"input": "1 5\n5 1 2 3 4 5",
"output": "YES"
},
{
"input": "1 5\n5 4 4 1 2 3",
"output": "NO"
},
{
"input": "1 5\n5 1 1 1 1 5",
"output": "NO"
},
{
"input": "2 5\n4 3 1 4 2\n4 2 3 4 5",
"output": "YES"
},
{
"input": "5 7\n2 6 7\n5 1 1 1 1 1\n3 6 5 4\n0\n4 4 3 2 1",
"output": "YES"
},
{
"input": "100 100\n0\n0\n0\n1 53\n0\n0\n1 34\n1 54\n0\n1 14\n0\n1 33\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 82\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 34\n0\n0\n1 26\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 34\n0\n0\n0\n0\n0\n1 3\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 40\n0\n0\n0\n1 26\n0\n0\n0\n0\n0\n1 97\n0\n1 5\n0\n0\n0\n0\n0",
"output": "NO"
},
{
"input": "100 100\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "NO"
},
{
"input": "5 6\n3 1 2 6\n3 1 2 6\n1 1\n2 3 4\n3 1 5 6",
"output": "YES"
},
{
"input": "5 2\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "NO"
},
{
"input": "1 4\n3 1 2 3",
"output": "NO"
},
{
"input": "1 4\n3 2 3 4",
"output": "NO"
},
{
"input": "2 4\n3 2 3 4\n1 1",
"output": "YES"
},
{
"input": "2 4\n3 1 2 3\n1 4",
"output": "YES"
},
{
"input": "5 1\n0\n0\n0\n0\n0",
"output": "NO"
},
{
"input": "1 1\n0",
"output": "NO"
},
{
"input": "1 10\n10 1 2 3 4 5 6 7 8 9 10",
"output": "YES"
},
{
"input": "1 1\n1 1",
"output": "YES"
},
{
"input": "1 100\n99 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99",
"output": "NO"
},
{
"input": "1 3\n3 1 2 1",
"output": "NO"
},
{
"input": "1 100\n100 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "YES"
}
] | 1,647,081,278
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 31
| 0
|
n,m=map(int,input().split());s=set()
for _ in [0]*n:
for i in [*map(int,input().split())]:s.add(i)
print('YNEOS'[len(s)<m::2])
|
Title: Bulbs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya wants to turn on Christmas lights consisting of *m* bulbs. Initially, all bulbs are turned off. There are *n* buttons, each of them is connected to some set of bulbs. Vasya can press any of these buttons. When the button is pressed, it turns on all the bulbs it's connected to. Can Vasya light up all the bulbs?
If Vasya presses the button such that some bulbs connected to it are already turned on, they do not change their state, i.e. remain turned on.
Input Specification:
The first line of the input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of buttons and the number of bulbs respectively.
Each of the next *n* lines contains *x**i* (0<=≤<=*x**i*<=≤<=*m*) — the number of bulbs that are turned on by the *i*-th button, and then *x**i* numbers *y**ij* (1<=≤<=*y**ij*<=≤<=*m*) — the numbers of these bulbs.
Output Specification:
If it's possible to turn on all *m* bulbs print "YES", otherwise print "NO".
Demo Input:
['3 4\n2 1 4\n3 1 3 1\n1 2\n', '3 3\n1 1\n1 2\n1 1\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample you can press each button once and turn on all the bulbs. In the 2 sample it is impossible to turn on the 3-rd lamp.
|
```python
n,m=map(int,input().split());s=set()
for _ in [0]*n:
for i in [*map(int,input().split())]:s.add(i)
print('YNEOS'[len(s)<m::2])
```
| 0
|
|
572
|
A
|
Arrays
|
PROGRAMMING
| 900
|
[
"sortings"
] | null | null |
You are given two arrays *A* and *B* consisting of integers, sorted in non-decreasing order. Check whether it is possible to choose *k* numbers in array *A* and choose *m* numbers in array *B* so that any number chosen in the first array is strictly less than any number chosen in the second array.
|
The first line contains two integers *n**A*,<=*n**B* (1<=≤<=*n**A*,<=*n**B*<=≤<=105), separated by a space — the sizes of arrays *A* and *B*, correspondingly.
The second line contains two integers *k* and *m* (1<=≤<=*k*<=≤<=*n**A*,<=1<=≤<=*m*<=≤<=*n**B*), separated by a space.
The third line contains *n**A* numbers *a*1,<=*a*2,<=... *a**n**A* (<=-<=109<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n**A*<=≤<=109), separated by spaces — elements of array *A*.
The fourth line contains *n**B* integers *b*1,<=*b*2,<=... *b**n**B* (<=-<=109<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**n**B*<=≤<=109), separated by spaces — elements of array *B*.
|
Print "YES" (without the quotes), if you can choose *k* numbers in array *A* and *m* numbers in array *B* so that any number chosen in array *A* was strictly less than any number chosen in array *B*. Otherwise, print "NO" (without the quotes).
|
[
"3 3\n2 1\n1 2 3\n3 4 5\n",
"3 3\n3 3\n1 2 3\n3 4 5\n",
"5 2\n3 1\n1 1 1 1 1\n2 2\n"
] |
[
"YES\n",
"NO\n",
"YES\n"
] |
In the first sample test you can, for example, choose numbers 1 and 2 from array *A* and number 3 from array *B* (1 < 3 and 2 < 3).
In the second sample test the only way to choose *k* elements in the first array and *m* elements in the second one is to choose all numbers in both arrays, but then not all the numbers chosen in *A* will be less than all the numbers chosen in *B*: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7280148ed5eab0a7d418d4f92b32061243a8ca58.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
| 500
|
[
{
"input": "3 3\n2 1\n1 2 3\n3 4 5",
"output": "YES"
},
{
"input": "3 3\n3 3\n1 2 3\n3 4 5",
"output": "NO"
},
{
"input": "5 2\n3 1\n1 1 1 1 1\n2 2",
"output": "YES"
},
{
"input": "3 5\n1 1\n5 5 5\n5 5 5 5 5",
"output": "NO"
},
{
"input": "1 1\n1 1\n1\n1",
"output": "NO"
},
{
"input": "3 3\n1 1\n1 2 3\n1 2 3",
"output": "YES"
},
{
"input": "3 3\n1 2\n1 2 3\n1 2 3",
"output": "YES"
},
{
"input": "3 3\n2 2\n1 2 3\n1 2 3",
"output": "NO"
},
{
"input": "10 15\n10 1\n1 1 5 17 22 29 32 36 39 48\n9 10 20 23 26 26 32 32 33 39 43 45 47 49 49",
"output": "YES"
},
{
"input": "10 15\n1 15\n91 91 91 92 92 94 94 95 98 100\n92 92 93 93 93 94 95 96 97 98 98 99 99 100 100",
"output": "YES"
},
{
"input": "15 10\n12 5\n9 25 25 32 32 38 40 41 46 46 48 51 64 64 73\n5 14 30 35 50 52 67 79 89 99",
"output": "YES"
},
{
"input": "15 10\n4 10\n22 32 35 45 45 50 51 55 79 80 83 88 90 92 93\n46 48 52 55 60 60 68 75 80 81",
"output": "YES"
},
{
"input": "20 30\n2 8\n6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 10 10 10 10 10\n1 1 2 2 2 2 2 2 2 3 3 4 5 5 5 5 6 6 6 6 6 6 7 7 7 8 8 9 10 10",
"output": "NO"
},
{
"input": "20 30\n19 29\n1 1 2 2 2 3 4 4 7 7 7 8 8 8 8 8 9 9 9 9\n6 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "NO"
},
{
"input": "1 1\n1 1\n-1000000000\n30",
"output": "YES"
},
{
"input": "3 3\n1 3\n1 3 3\n3 3 3",
"output": "YES"
},
{
"input": "3 3\n1 1\n3 3 3\n2 2 2",
"output": "NO"
},
{
"input": "5 5\n3 3\n1 5 6 7 8\n1 2 5 6 7",
"output": "NO"
},
{
"input": "3 4\n2 2\n5 6 7\n1 2 3 4",
"output": "NO"
},
{
"input": "3 3\n3 3\n1 2 3\n4 5 6",
"output": "YES"
},
{
"input": "5 5\n4 5\n2 2 3 4 5\n5 6 7 8 9",
"output": "YES"
}
] | 1,470,112,855
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include <bits/stdc++.h>
using namespace std;
int main() {
long long nA, nB, m, k, a[100001], b[100001];
cin >> nA >> nB;
cin >> k >> m;
for (int i = 1; i <= nA; i++) {
cin >> a[i];
} for (int i = 1; i <= nB; i++) {
cin >> b[i];
}
if (a[k] < b[nB - m]) {
cout << "YES";
} else {
cout << "NO";
}
}
|
Title: Arrays
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two arrays *A* and *B* consisting of integers, sorted in non-decreasing order. Check whether it is possible to choose *k* numbers in array *A* and choose *m* numbers in array *B* so that any number chosen in the first array is strictly less than any number chosen in the second array.
Input Specification:
The first line contains two integers *n**A*,<=*n**B* (1<=≤<=*n**A*,<=*n**B*<=≤<=105), separated by a space — the sizes of arrays *A* and *B*, correspondingly.
The second line contains two integers *k* and *m* (1<=≤<=*k*<=≤<=*n**A*,<=1<=≤<=*m*<=≤<=*n**B*), separated by a space.
The third line contains *n**A* numbers *a*1,<=*a*2,<=... *a**n**A* (<=-<=109<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n**A*<=≤<=109), separated by spaces — elements of array *A*.
The fourth line contains *n**B* integers *b*1,<=*b*2,<=... *b**n**B* (<=-<=109<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**n**B*<=≤<=109), separated by spaces — elements of array *B*.
Output Specification:
Print "YES" (without the quotes), if you can choose *k* numbers in array *A* and *m* numbers in array *B* so that any number chosen in array *A* was strictly less than any number chosen in array *B*. Otherwise, print "NO" (without the quotes).
Demo Input:
['3 3\n2 1\n1 2 3\n3 4 5\n', '3 3\n3 3\n1 2 3\n3 4 5\n', '5 2\n3 1\n1 1 1 1 1\n2 2\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
In the first sample test you can, for example, choose numbers 1 and 2 from array *A* and number 3 from array *B* (1 < 3 and 2 < 3).
In the second sample test the only way to choose *k* elements in the first array and *m* elements in the second one is to choose all numbers in both arrays, but then not all the numbers chosen in *A* will be less than all the numbers chosen in *B*: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7280148ed5eab0a7d418d4f92b32061243a8ca58.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
|
```python
#include <bits/stdc++.h>
using namespace std;
int main() {
long long nA, nB, m, k, a[100001], b[100001];
cin >> nA >> nB;
cin >> k >> m;
for (int i = 1; i <= nA; i++) {
cin >> a[i];
} for (int i = 1; i <= nB; i++) {
cin >> b[i];
}
if (a[k] < b[nB - m]) {
cout << "YES";
} else {
cout << "NO";
}
}
```
| -1
|
|
802
|
G
|
Fake News (easy)
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
|
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
|
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
|
[
"abcheaibcdi\n",
"hiedi\n"
] |
[
"YES",
"NO"
] |
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
| 0
|
[
{
"input": "abcheaibcdi",
"output": "YES"
},
{
"input": "hiedi",
"output": "NO"
},
{
"input": "ihied",
"output": "NO"
},
{
"input": "diehi",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "iheid",
"output": "NO"
},
{
"input": "eihdi",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "edhii",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "eufyajkssayhjhqcwxmctecaeepjwmfoscqprpcxsqfwnlgzsmmuwuoruantipholrauvxydfvftwfzhnckxswussvlidcojiciflpvkcxkkcmmvtfvxrkwcpeelwsuzqgamamdtdgzscmikvojfvqehblmjczkvtdeymgertgkwfwfukafqlfdhtedcctixhyetdypswgagrpyto",
"output": "YES"
},
{
"input": "arfbvxgdvqzuloojjrwoyqqbxamxybaqltfimofulusfebodjkwwrgwcppkwiodtpjaraglyplgerrpqjkpoggjmfxhwtqrijpijrcyxnoodvwpyjfpvqaoazllbrpzananbrvvybboedidtuvqquklkpeflfaltukjhzjgiofombhbmqbihgtapswykfvlgdoapjqntvqsaohmbvnphvyyhvhavslamczuqifxnwknkaenqmlvetrqogqxmlptgrmqvxzdxdmwobjesmgxckpmawtioavwdngyiwkzypfnxcovwzdohshwlavwsthdssiadhiwmhpvgkrbezm",
"output": "YES"
},
{
"input": "zcectngbqnejjjtsfrluummmqabzqbyccshjqbrjthzhlbmzjfxugvjouwhumsgrnopiyakfadjnbsesamhynsbfbfunupwbxvohfmpwlcpxhovwpfpciclatgmiufwdvtsqrsdcymvkldpnhfeisrzhyhhlkwdzthgprvkpyldeysvbmcibqkpudyrraqdlxpjecvwcvuiklcrsbgvqasmxmtxqzmawcjtozioqlfflinnxpeexbzloaeqjvglbdeufultpjqexvjjjkzemtzuzmxvawilcqdrcjzpqyhtwfphuonzwkotthsaxrmwtnlmcdylxqcfffyndqeouztluqwlhnkkvzwcfiscikv",
"output": "YES"
},
{
"input": "plqaykgovxkvsiahdbglktdlhcqwelxxmtlyymrsyubxdskvyjkrowvcbpdofpjqspsrgpakdczletxujzlsegepzleipiyycpinzxgwjsgslnxsotouddgfcybozfpjhhocpybfjbaywsehbcfrayvancbrumdfngqytnhihyxnlvilrqyhnxeckprqafofelospffhtwguzjbbjlzbqrtiielbvzutzgpqxosiaqznndgobcluuqlhmffiowkjdlkokehtjdyjvmxsiyxureflmdomerfekxdvtitvwzmdsdzplkpbtafxqfpudnhfqpoiwvjnylanunmagoweobdvfjgepbsymfutrjarlxclhgavpytiiqwvojrptofuvlohzeguxdsrihsbucelhhuedltnnjgzxwyblbqvnoliiydfinzlogbvucwykryzcyibnniggbkdkdcdgcsbvvnavtyhtkanrblpvomvjs",
"output": "YES"
},
{
"input": "fbldqzggeunkpwcfirxanmntbfrudijltoertsdvcvcmbwodbibsrxendzebvxwydpasaqnisrijctsuatihxxygbeovhxjdptdcppkvfytdpjspvrannxavmkmisqtygntxkdlousdypyfkrpzapysfpdbyprufwzhunlsfugojddkmxzinatiwfxdqmgyrnjnxvrclhxyuwxtshoqdjptmeecvgmrlvuwqtmnfnfeeiwcavwnqmyustawbjodzwsqmnjxhpqmgpysierlwbbdzcwprpsexyvreewcmlbvaiytjlxdqdaqftefdlmtmmjcwvfejshymhnouoshdzqcwzxpzupkbcievodzqkqvyjuuxxwepxjalvkzufnveji",
"output": "YES"
},
{
"input": "htsyljgoelbbuipivuzrhmfpkgderqpoprlxdpasxhpmxvaztccldtmujjzjmcpdvsdghzpretlsyyiljhjznseaacruriufswuvizwwuvdioazophhyytvbiogttnnouauxllbdn",
"output": "YES"
},
{
"input": "ikmxzqdzxqlvgeojsnhqzciujslwjyzzexnregabdqztpplosdakimjxmuqccbnwvzbajoiqgdobccwnrwmixohrbdarhoeeelzbpigiybtesybwefpcfx",
"output": "YES"
},
{
"input": "bpvbpjvbdfiodsmahxpcubjxdykesubnypalhypantshkjffmxjmelblqnjdmtaltneuyudyevkgedkqrdmrfeemgpghwrifcwincfixokfgurhqbcfzeajrgkgpwqwsepudxulywowwxzdxkumsicsvnzfxspmjpaixgejeaoyoibegosqoyoydmphfpbutrrewyjecowjckvpcceoamtfbitdneuwqfvnagswlskmsmkhmxyfsrpqwhxzocyffiumcy",
"output": "YES"
},
{
"input": "vllsexwrazvlfvhvrtqeohvzzresjdiuhomfpgqcxpqdevplecuaepixhlijatxzegciizpvyvxuembiplwklahlqibykfideysjygagjbgqkbhdhkatddcwlxboinfuomnpc",
"output": "YES"
},
{
"input": "pnjdwpxmvfoqkjtbhquqcuredrkwqzzfjmdvpnbqtypzdovemhhclkvigjvtprrpzbrbcbatkucaqteuciuozytsptvsskkeplaxdaqmjkmef",
"output": "NO"
},
{
"input": "jpwfhvlxvsdhtuozvlmnfiotrgapgjxtcsgcjnodcztupysvvvmjpzqkpommadppdrykuqkcpzojcwvlogvkddedwbggkrhuvtsvdiokehlkdlnukcufjvqxnikcdawvexxwffxtriqbdmkahxdtygodzohwtdmmuvmatdkvweqvaehaxiefpevkvqpyxsrhtmgjsdfcwzqobibeduooldrmglbinrepmunizheqzvgqvpdskhxfidxfnbisyizhepwyrcykcmjxnkyfjgrqlkixcvysa",
"output": "YES"
},
{
"input": "aftcrvuumeqbfvaqlltscnuhkpcifrrhnutjinxdhhdbzvizlrapzjdatuaynoplgjketupgaejciosofuhcgcjdcucarfvtsofgubtphijciswsvidnvpztlaarydkeqxzwdhfbmullkimerukusbrdnnujviydldrwhdfllsjtziwfeaiqotbiprespmxjulnyunkdtcghrzvhtcychkwatqqmladxpvmvlkzscthylbzkpgwlzfjqwarqvdeyngekqvrhrftpxnkfcibbowvnqdkulcdydspcubwlgoyinpnzgidbgunparnueddzwtzdiavbprbbg",
"output": "YES"
},
{
"input": "oagjghsidigeh",
"output": "NO"
},
{
"input": "chdhzpfzabupskiusjoefrwmjmqkbmdgboicnszkhdrlegeqjsldurmbshijadlwsycselhlnudndpdhcnhruhhvsgbthpruiqfirxkhpqhzhqdfpyozolbionodypfcqfeqbkcgmqkizgeyyelzeoothexcoaahedgrvoemqcwccbvoeqawqeuusyjxmgjkpfwcdttfmwunzuwvsihliexlzygqcgpbdiawfvqukikhbjerjkyhpcknlndaystrgsinghlmekbvhntcpypmchcwoglsmwwdulqneuabuuuvtyrnjxfcgoothalwkzzfxakneusezgnnepkpipzromqubraiggqndliz",
"output": "YES"
},
{
"input": "lgirxqkrkgjcutpqitmffvbujcljkqardlalyigxorscczuzikoylcxenryhskoavymexysvmhbsvhtycjlmzhijpuvcjshyfeycvvcfyzytzoyvxajpqdjtfiatnvxnyeqtfcagfftafllhhjhplbdsrfpctkqpinpdfrtlzyjllfbeffputywcckupyslkbbzpgcnxgbmhtqeqqehpdaokkjtatrhyiuusjhwgiiiikxpzdueasemosmmccoakafgvxduwiuflovhhfhffgnnjhoperhhjtvocpqytjxkmrknnknqeglffhfuplopmktykxuvcmbwpoeisrlyyhdpxfvzseucofyhziuiikihpqheqdyzwigeaqzhxzvporgisxgvhyicqyejovqloibhbunsvsunpvmdckkbuokitdzleilfwutcvuuytpupizinfjrzhxudsmjcjyfcpfgthujjowdwtgbvi",
"output": "YES"
},
{
"input": "uuehrvufgerqbzyzksmqnewacotuimawhlbycdbsmhshrsbqwybbkwjwsrkwptvlbbwjiivqugzrxxwgidrcrhrwsmwgeoleptfamzefgaeyxouxocrpvomjrazmxrnffdwrrmblgdiabdncvfougtmjgvvazasnygdrigbsrieoonirlivfyodvulouslxosswgpdexuldmkdbpdlgutiotvxjyecbrsvbmqxrlcpcipjjncduyqtohlzybvlemmfdeubihwlwqglkgjvnwrbgydcpwklmjeewqklmqdbajqgrpnynaxfvxjzgibqerxyhnxenrmcdqaaeksbzyrcaepozqpetaurlhjuxxhwppuhgoihxdxbmxeiahyaqkbknktlzkheaarjoqqrsyeducvoygwalgarldcdlqogfvsncejssmx",
"output": "YES"
},
{
"input": "iiopulfjxoitgiusqrhgbkiyzinphjtclodbkkydetylvuimkhdkklmyoacmekdvjpuxcrvqnjhqhhbfenlpzpwijtykqziocilvtpqhxuyrphdlamawjuzgjwiebkqyrzyqgtkcrhntjxqmcgkrqcslogjegfrivzidfedeegwbbsopvxvdoididlpypjogxaodtueebbwuwilacunqpozczcgrpaxxrtogpxgfkudtxchoravrrdtimhenwmnafxaruuojduxxglefejycfcyxllfimkszmbrhcwpnwjqgwvzysmlaaifdxfjjpgjmcksiigpanappjdloiolojmcqbnpnjjzaufdpjaknylmyvolhwypygwepmqwpiglpcnpypnudhdzpdvgzosyjthzcwtytxq",
"output": "YES"
}
] | 1,619,584,632
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
str1 = input()
str2 = "heidi"
if str1==str2
print("YES")
else:
print("NO")
|
Title: Fake News (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
Input Specification:
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
Output Specification:
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
Demo Input:
['abcheaibcdi\n', 'hiedi\n']
Demo Output:
['YES', 'NO']
Note:
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
|
```python
str1 = input()
str2 = "heidi"
if str1==str2
print("YES")
else:
print("NO")
```
| -1
|
|
727
|
A
|
Transformation: from A to B
|
PROGRAMMING
| 1,000
|
[
"brute force",
"dfs and similar",
"math"
] | null | null |
Vasily has a number *a*, which he wants to turn into a number *b*. For this purpose, he can do two types of operations:
- multiply the current number by 2 (that is, replace the number *x* by 2·*x*); - append the digit 1 to the right of current number (that is, replace the number *x* by 10·*x*<=+<=1).
You need to help Vasily to transform the number *a* into the number *b* using only the operations described above, or find that it is impossible.
Note that in this task you are not required to minimize the number of operations. It suffices to find any way to transform *a* into *b*.
|
The first line contains two positive integers *a* and *b* (1<=≤<=*a*<=<<=*b*<=≤<=109) — the number which Vasily has and the number he wants to have.
|
If there is no way to get *b* from *a*, print "NO" (without quotes).
Otherwise print three lines. On the first line print "YES" (without quotes). The second line should contain single integer *k* — the length of the transformation sequence. On the third line print the sequence of transformations *x*1,<=*x*2,<=...,<=*x**k*, where:
- *x*1 should be equal to *a*, - *x**k* should be equal to *b*, - *x**i* should be obtained from *x**i*<=-<=1 using any of two described operations (1<=<<=*i*<=≤<=*k*).
If there are multiple answers, print any of them.
|
[
"2 162\n",
"4 42\n",
"100 40021\n"
] |
[
"YES\n5\n2 4 8 81 162 \n",
"NO\n",
"YES\n5\n100 200 2001 4002 40021 \n"
] |
none
| 1,000
|
[
{
"input": "2 162",
"output": "YES\n5\n2 4 8 81 162 "
},
{
"input": "4 42",
"output": "NO"
},
{
"input": "100 40021",
"output": "YES\n5\n100 200 2001 4002 40021 "
},
{
"input": "1 111111111",
"output": "YES\n9\n1 11 111 1111 11111 111111 1111111 11111111 111111111 "
},
{
"input": "1 1000000000",
"output": "NO"
},
{
"input": "999999999 1000000000",
"output": "NO"
},
{
"input": "1 2",
"output": "YES\n2\n1 2 "
},
{
"input": "1 536870912",
"output": "YES\n30\n1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 65536 131072 262144 524288 1048576 2097152 4194304 8388608 16777216 33554432 67108864 134217728 268435456 536870912 "
},
{
"input": "11111 11111111",
"output": "YES\n4\n11111 111111 1111111 11111111 "
},
{
"input": "59139 946224",
"output": "YES\n5\n59139 118278 236556 473112 946224 "
},
{
"input": "9859 19718",
"output": "YES\n2\n9859 19718 "
},
{
"input": "25987 51974222",
"output": "YES\n5\n25987 259871 2598711 25987111 51974222 "
},
{
"input": "9411 188222222",
"output": "YES\n6\n9411 94111 941111 9411111 94111111 188222222 "
},
{
"input": "25539 510782222",
"output": "YES\n6\n25539 255391 2553911 25539111 255391111 510782222 "
},
{
"input": "76259 610072",
"output": "YES\n4\n76259 152518 305036 610072 "
},
{
"input": "92387 184774",
"output": "YES\n2\n92387 184774 "
},
{
"input": "8515 85151111",
"output": "YES\n5\n8515 85151 851511 8515111 85151111 "
},
{
"input": "91939 9193911",
"output": "YES\n3\n91939 919391 9193911 "
},
{
"input": "30518 610361",
"output": "YES\n3\n30518 61036 610361 "
},
{
"input": "46646 373168844",
"output": "YES\n7\n46646 466461 932922 9329221 93292211 186584422 373168844 "
},
{
"input": "30070 300701",
"output": "YES\n2\n30070 300701 "
},
{
"input": "13494 1079528",
"output": "YES\n5\n13494 134941 269882 539764 1079528 "
},
{
"input": "96918 775344422",
"output": "YES\n7\n96918 193836 1938361 3876722 38767221 387672211 775344422 "
},
{
"input": "13046 260921",
"output": "YES\n3\n13046 26092 260921 "
},
{
"input": "29174 5834811",
"output": "YES\n4\n29174 58348 583481 5834811 "
},
{
"input": "79894 319576421",
"output": "YES\n6\n79894 798941 1597882 15978821 31957642 319576421 "
},
{
"input": "96022 1920442",
"output": "YES\n3\n96022 960221 1920442 "
},
{
"input": "79446 6355681",
"output": "YES\n5\n79446 158892 317784 635568 6355681 "
},
{
"input": "5440 27853056",
"output": "YES\n11\n5440 10880 108801 217602 435204 870408 1740816 3481632 6963264 13926528 27853056 "
},
{
"input": "250000000 705032705",
"output": "NO"
},
{
"input": "17 35",
"output": "NO"
},
{
"input": "1 3",
"output": "NO"
},
{
"input": "2 11",
"output": "NO"
}
] | 1,582,105,869
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 33
| 155
| 0
|
a,b=input().split()
a=int(a)
b=int(b)
f=0
l=[]
while(b>a):
if (b%2==1):
if (b-1)%10==0:
l.append(b)
b=(b-1)//10
else:
print("NO")
f=1
break
else:
l.append(b)
b=b//2
if (f==0):
if a==b:
print("YES")
l.append(a)
print(len(l))
for i in range (len(l)):
print(l[len(l)-i-1],end=' ')
else:
print("NO")
|
Title: Transformation: from A to B
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasily has a number *a*, which he wants to turn into a number *b*. For this purpose, he can do two types of operations:
- multiply the current number by 2 (that is, replace the number *x* by 2·*x*); - append the digit 1 to the right of current number (that is, replace the number *x* by 10·*x*<=+<=1).
You need to help Vasily to transform the number *a* into the number *b* using only the operations described above, or find that it is impossible.
Note that in this task you are not required to minimize the number of operations. It suffices to find any way to transform *a* into *b*.
Input Specification:
The first line contains two positive integers *a* and *b* (1<=≤<=*a*<=<<=*b*<=≤<=109) — the number which Vasily has and the number he wants to have.
Output Specification:
If there is no way to get *b* from *a*, print "NO" (without quotes).
Otherwise print three lines. On the first line print "YES" (without quotes). The second line should contain single integer *k* — the length of the transformation sequence. On the third line print the sequence of transformations *x*1,<=*x*2,<=...,<=*x**k*, where:
- *x*1 should be equal to *a*, - *x**k* should be equal to *b*, - *x**i* should be obtained from *x**i*<=-<=1 using any of two described operations (1<=<<=*i*<=≤<=*k*).
If there are multiple answers, print any of them.
Demo Input:
['2 162\n', '4 42\n', '100 40021\n']
Demo Output:
['YES\n5\n2 4 8 81 162 \n', 'NO\n', 'YES\n5\n100 200 2001 4002 40021 \n']
Note:
none
|
```python
a,b=input().split()
a=int(a)
b=int(b)
f=0
l=[]
while(b>a):
if (b%2==1):
if (b-1)%10==0:
l.append(b)
b=(b-1)//10
else:
print("NO")
f=1
break
else:
l.append(b)
b=b//2
if (f==0):
if a==b:
print("YES")
l.append(a)
print(len(l))
for i in range (len(l)):
print(l[len(l)-i-1],end=' ')
else:
print("NO")
```
| 3
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,636,641,226
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 32
| 124
| 28,467,200
|
int(input())
b = list(map(int, input().split()))
kch = 0
knch = 0
for i in b[0], b[1], b[2]:
if i % 2 == 0:
kch += 1
else:
knch += 1
if knch > kch:
for i in range(len(b)):
if b[i] % 2 == 0:
print(i + 1)
exit(0)
else:
for i in range(len(b)):
if b[i] % 2 != 0:
print(i + 1)
exit(0)
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
int(input())
b = list(map(int, input().split()))
kch = 0
knch = 0
for i in b[0], b[1], b[2]:
if i % 2 == 0:
kch += 1
else:
knch += 1
if knch > kch:
for i in range(len(b)):
if b[i] % 2 == 0:
print(i + 1)
exit(0)
else:
for i in range(len(b)):
if b[i] % 2 != 0:
print(i + 1)
exit(0)
```
| 3.915976
|
680
|
B
|
Bear and Finding Criminals
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms",
"implementation"
] | null | null |
There are *n* cities in Bearland, numbered 1 through *n*. Cities are arranged in one long row. The distance between cities *i* and *j* is equal to |*i*<=-<=*j*|.
Limak is a police officer. He lives in a city *a*. His job is to catch criminals. It's hard because he doesn't know in which cities criminals are. Though, he knows that there is at most one criminal in each city.
Limak is going to use a BCD (Bear Criminal Detector). The BCD will tell Limak how many criminals there are for every distance from a city *a*. After that, Limak can catch a criminal in each city for which he is sure that there must be a criminal.
You know in which cities criminals are. Count the number of criminals Limak will catch, after he uses the BCD.
|
The first line of the input contains two integers *n* and *a* (1<=≤<=*a*<=≤<=*n*<=≤<=100) — the number of cities and the index of city where Limak lives.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (0<=≤<=*t**i*<=≤<=1). There are *t**i* criminals in the *i*-th city.
|
Print the number of criminals Limak will catch.
|
[
"6 3\n1 1 1 0 1 0\n",
"5 2\n0 0 0 1 0\n"
] |
[
"3\n",
"1\n"
] |
In the first sample, there are six cities and Limak lives in the third one (blue arrow below). Criminals are in cities marked red.
Using the BCD gives Limak the following information:
- There is one criminal at distance 0 from the third city — Limak is sure that this criminal is exactly in the third city. - There is one criminal at distance 1 from the third city — Limak doesn't know if a criminal is in the second or fourth city. - There are two criminals at distance 2 from the third city — Limak is sure that there is one criminal in the first city and one in the fifth city. - There are zero criminals for every greater distance.
So, Limak will catch criminals in cities 1, 3 and 5, that is 3 criminals in total.
In the second sample (drawing below), the BCD gives Limak the information that there is one criminal at distance 2 from Limak's city. There is only one city at distance 2 so Limak is sure where a criminal is.
| 1,000
|
[
{
"input": "6 3\n1 1 1 0 1 0",
"output": "3"
},
{
"input": "5 2\n0 0 0 1 0",
"output": "1"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "9 3\n1 1 1 1 1 1 1 1 0",
"output": "8"
},
{
"input": "9 5\n1 0 1 0 1 0 1 0 1",
"output": "5"
},
{
"input": "20 17\n1 1 0 1 1 1 1 0 1 0 1 1 1 0 1 1 0 0 0 0",
"output": "10"
},
{
"input": "100 60\n1 1 1 1 1 1 0 1 0 0 1 1 0 1 1 1 1 1 0 0 1 1 0 0 0 0 0 1 0 1 1 0 1 0 1 0 1 0 1 1 0 0 0 0 0 1 1 1 0 1 1 0 0 0 1 0 0 0 1 1 1 0 1 0 0 1 1 1 0 1 1 1 0 0 1 1 0 1 0 0 0 1 0 0 0 0 0 0 1 1 1 0 0 1 1 1 0 1 0 0",
"output": "27"
},
{
"input": "8 1\n1 0 1 1 0 0 1 0",
"output": "4"
},
{
"input": "11 11\n0 1 0 0 1 1 1 0 0 0 0",
"output": "4"
},
{
"input": "19 10\n0 1 1 0 1 0 0 1 1 0 0 1 0 1 0 0 1 0 1",
"output": "4"
},
{
"input": "100 38\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100 38\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "1"
},
{
"input": "100 38\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "3"
},
{
"input": "99 38\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "25"
},
{
"input": "99 38\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "24"
},
{
"input": "99 38\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "24"
},
{
"input": "98 70\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "41"
},
{
"input": "99 70\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "9"
},
{
"input": "99 60\n0 0 0 1 1 0 1 1 0 0 1 0 0 0 0 0 1 0 1 0 0 0 1 0 1 1 1 0 1 1 1 1 0 0 1 1 1 0 1 1 1 1 1 0 1 1 0 0 0 0 0 1 0 0 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 0 1 0 0 1 0 0 1 1 1 0 0 0 0 1 1 0 1 1 1 1 0 0 0 0 0 0 1 1 1",
"output": "34"
},
{
"input": "98 24\n0 0 0 1 1 0 1 1 0 0 0 0 1 0 0 1 0 0 1 1 1 0 0 1 0 0 1 0 1 0 0 1 1 0 1 1 1 0 1 0 0 1 0 0 0 1 1 1 1 0 1 1 1 0 1 1 1 1 0 0 1 0 0 0 1 0 1 1 0 1 0 1 1 1 0 0 1 0 0 0 1 1 0 0 1 1 1 1 1 1 0 1 0 1 0 0 1 1",
"output": "39"
},
{
"input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "100 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "2 1\n0 1",
"output": "1"
}
] | 1,596,188,650
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 93
| 6,963,200
|
a, n = map(int, input().split())
t = list(map(int, input().split()))
i, j = n-2, n
ans = 1 if t[n-1] == 1 else 0
while i >= 0 or j < a:
if i >=0 and j < a:
if t[i] == t[j] == 1:
ans += 2
else:
if t[i] == 1 or t[j] == 1:
ans += 1
i -= 1
j += 1
print(ans)
|
Title: Bear and Finding Criminals
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* cities in Bearland, numbered 1 through *n*. Cities are arranged in one long row. The distance between cities *i* and *j* is equal to |*i*<=-<=*j*|.
Limak is a police officer. He lives in a city *a*. His job is to catch criminals. It's hard because he doesn't know in which cities criminals are. Though, he knows that there is at most one criminal in each city.
Limak is going to use a BCD (Bear Criminal Detector). The BCD will tell Limak how many criminals there are for every distance from a city *a*. After that, Limak can catch a criminal in each city for which he is sure that there must be a criminal.
You know in which cities criminals are. Count the number of criminals Limak will catch, after he uses the BCD.
Input Specification:
The first line of the input contains two integers *n* and *a* (1<=≤<=*a*<=≤<=*n*<=≤<=100) — the number of cities and the index of city where Limak lives.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (0<=≤<=*t**i*<=≤<=1). There are *t**i* criminals in the *i*-th city.
Output Specification:
Print the number of criminals Limak will catch.
Demo Input:
['6 3\n1 1 1 0 1 0\n', '5 2\n0 0 0 1 0\n']
Demo Output:
['3\n', '1\n']
Note:
In the first sample, there are six cities and Limak lives in the third one (blue arrow below). Criminals are in cities marked red.
Using the BCD gives Limak the following information:
- There is one criminal at distance 0 from the third city — Limak is sure that this criminal is exactly in the third city. - There is one criminal at distance 1 from the third city — Limak doesn't know if a criminal is in the second or fourth city. - There are two criminals at distance 2 from the third city — Limak is sure that there is one criminal in the first city and one in the fifth city. - There are zero criminals for every greater distance.
So, Limak will catch criminals in cities 1, 3 and 5, that is 3 criminals in total.
In the second sample (drawing below), the BCD gives Limak the information that there is one criminal at distance 2 from Limak's city. There is only one city at distance 2 so Limak is sure where a criminal is.
|
```python
a, n = map(int, input().split())
t = list(map(int, input().split()))
i, j = n-2, n
ans = 1 if t[n-1] == 1 else 0
while i >= 0 or j < a:
if i >=0 and j < a:
if t[i] == t[j] == 1:
ans += 2
else:
if t[i] == 1 or t[j] == 1:
ans += 1
i -= 1
j += 1
print(ans)
```
| 0
|
|
87
|
A
|
Trains
|
PROGRAMMING
| 1,500
|
[
"implementation",
"math"
] |
A. Trains
|
2
|
256
|
Vasya the programmer lives in the middle of the Programming subway branch. He has two girlfriends: Dasha and Masha, who live at the different ends of the branch, each one is unaware of the other one's existence.
When Vasya has some free time, he goes to one of his girlfriends. He descends into the subway at some time, waits the first train to come and rides on it to the end of the branch to the corresponding girl. However, the trains run with different frequencies: a train goes to Dasha's direction every *a* minutes, but a train goes to Masha's direction every *b* minutes. If two trains approach at the same time, Vasya goes toward the direction with the lower frequency of going trains, that is, to the girl, to whose directions the trains go less frequently (see the note to the third sample).
We know that the trains begin to go simultaneously before Vasya appears. That is the train schedule is such that there exists a moment of time when the two trains arrive simultaneously.
Help Vasya count to which girlfriend he will go more often.
|
The first line contains two integers *a* and *b* (*a*<=≠<=*b*,<=1<=≤<=*a*,<=*b*<=≤<=106).
|
Print "Dasha" if Vasya will go to Dasha more frequently, "Masha" if he will go to Masha more frequently, or "Equal" if he will go to both girlfriends with the same frequency.
|
[
"3 7\n",
"5 3\n",
"2 3\n"
] |
[
"Dasha\n",
"Masha\n",
"Equal\n"
] |
Let's take a look at the third sample. Let the trains start to go at the zero moment of time. It is clear that the moments of the trains' arrival will be periodic with period 6. That's why it is enough to show that if Vasya descends to the subway at a moment of time inside the interval (0, 6], he will go to both girls equally often.
If he descends to the subway at a moment of time from 0 to 2, he leaves for Dasha on the train that arrives by the second minute.
If he descends to the subway at a moment of time from 2 to 3, he leaves for Masha on the train that arrives by the third minute.
If he descends to the subway at a moment of time from 3 to 4, he leaves for Dasha on the train that arrives by the fourth minute.
If he descends to the subway at a moment of time from 4 to 6, he waits for both trains to arrive by the sixth minute and goes to Masha as trains go less often in Masha's direction.
In sum Masha and Dasha get equal time — three minutes for each one, thus, Vasya will go to both girlfriends equally often.
| 500
|
[
{
"input": "3 7",
"output": "Dasha"
},
{
"input": "5 3",
"output": "Masha"
},
{
"input": "2 3",
"output": "Equal"
},
{
"input": "31 88",
"output": "Dasha"
},
{
"input": "8 75",
"output": "Dasha"
},
{
"input": "32 99",
"output": "Dasha"
},
{
"input": "77 4",
"output": "Masha"
},
{
"input": "27 1",
"output": "Masha"
},
{
"input": "84 11",
"output": "Masha"
},
{
"input": "4 6",
"output": "Equal"
},
{
"input": "52 53",
"output": "Equal"
},
{
"input": "397 568",
"output": "Dasha"
},
{
"input": "22 332",
"output": "Dasha"
},
{
"input": "419 430",
"output": "Dasha"
},
{
"input": "638 619",
"output": "Masha"
},
{
"input": "393 325",
"output": "Masha"
},
{
"input": "876 218",
"output": "Masha"
},
{
"input": "552 551",
"output": "Equal"
},
{
"input": "906 912",
"output": "Equal"
},
{
"input": "999 996",
"output": "Equal"
},
{
"input": "652 653",
"output": "Equal"
},
{
"input": "3647 7698",
"output": "Dasha"
},
{
"input": "2661 8975",
"output": "Dasha"
},
{
"input": "251 9731",
"output": "Dasha"
},
{
"input": "9886 8671",
"output": "Masha"
},
{
"input": "8545 7312",
"output": "Masha"
},
{
"input": "4982 2927",
"output": "Masha"
},
{
"input": "7660 7658",
"output": "Equal"
},
{
"input": "9846 9844",
"output": "Equal"
},
{
"input": "9632 9640",
"output": "Equal"
},
{
"input": "5036 5037",
"output": "Equal"
},
{
"input": "64854 77725",
"output": "Dasha"
},
{
"input": "4965 85708",
"output": "Dasha"
},
{
"input": "20393 86640",
"output": "Dasha"
},
{
"input": "99207 30728",
"output": "Masha"
},
{
"input": "77545 13842",
"output": "Masha"
},
{
"input": "30362 10712",
"output": "Masha"
},
{
"input": "51291 51292",
"output": "Equal"
},
{
"input": "55381 55382",
"output": "Equal"
},
{
"input": "91560 91550",
"output": "Equal"
},
{
"input": "99087 99090",
"output": "Equal"
},
{
"input": "983794 986389",
"output": "Dasha"
},
{
"input": "779183 786727",
"output": "Dasha"
},
{
"input": "450766 610961",
"output": "Dasha"
},
{
"input": "664690 630787",
"output": "Masha"
},
{
"input": "461363 256765",
"output": "Masha"
},
{
"input": "638067 409048",
"output": "Masha"
},
{
"input": "929061 929052",
"output": "Equal"
},
{
"input": "996219 996216",
"output": "Equal"
},
{
"input": "716249 716248",
"output": "Equal"
},
{
"input": "782250 782252",
"output": "Equal"
},
{
"input": "1 2",
"output": "Equal"
},
{
"input": "2 1",
"output": "Equal"
},
{
"input": "999999 1000000",
"output": "Equal"
},
{
"input": "999997 1000000",
"output": "Dasha"
},
{
"input": "1000000 999993",
"output": "Masha"
},
{
"input": "999983 999979",
"output": "Masha"
}
] | 1,598,268,720
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 41
| 2,000
| 151,347,200
|
def hcfnaive(a,b):
if(b==0):
return a
else:
return hcfnaive(b,a%b)
a,b=list(map(int,input().split()))
c=(a*b)//hcfnaive(a,b)
l=[]
for i in range(a,c,a):
l.append([i,'d'])
for i in range(b,c,b):
l.append([i,'m'])
l.sort()
d,m=0,0
for i in range(len(l)):
if l[i][1]=='d':
d=d+1
elif l[i][1]=='m':
m=m+1
if a>b:
d=d+1
else:
m=m+1
if d>m:
print("Dasha")
elif m>d:
print("Masha")
else:
print("Equal")
|
Title: Trains
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya the programmer lives in the middle of the Programming subway branch. He has two girlfriends: Dasha and Masha, who live at the different ends of the branch, each one is unaware of the other one's existence.
When Vasya has some free time, he goes to one of his girlfriends. He descends into the subway at some time, waits the first train to come and rides on it to the end of the branch to the corresponding girl. However, the trains run with different frequencies: a train goes to Dasha's direction every *a* minutes, but a train goes to Masha's direction every *b* minutes. If two trains approach at the same time, Vasya goes toward the direction with the lower frequency of going trains, that is, to the girl, to whose directions the trains go less frequently (see the note to the third sample).
We know that the trains begin to go simultaneously before Vasya appears. That is the train schedule is such that there exists a moment of time when the two trains arrive simultaneously.
Help Vasya count to which girlfriend he will go more often.
Input Specification:
The first line contains two integers *a* and *b* (*a*<=≠<=*b*,<=1<=≤<=*a*,<=*b*<=≤<=106).
Output Specification:
Print "Dasha" if Vasya will go to Dasha more frequently, "Masha" if he will go to Masha more frequently, or "Equal" if he will go to both girlfriends with the same frequency.
Demo Input:
['3 7\n', '5 3\n', '2 3\n']
Demo Output:
['Dasha\n', 'Masha\n', 'Equal\n']
Note:
Let's take a look at the third sample. Let the trains start to go at the zero moment of time. It is clear that the moments of the trains' arrival will be periodic with period 6. That's why it is enough to show that if Vasya descends to the subway at a moment of time inside the interval (0, 6], he will go to both girls equally often.
If he descends to the subway at a moment of time from 0 to 2, he leaves for Dasha on the train that arrives by the second minute.
If he descends to the subway at a moment of time from 2 to 3, he leaves for Masha on the train that arrives by the third minute.
If he descends to the subway at a moment of time from 3 to 4, he leaves for Dasha on the train that arrives by the fourth minute.
If he descends to the subway at a moment of time from 4 to 6, he waits for both trains to arrive by the sixth minute and goes to Masha as trains go less often in Masha's direction.
In sum Masha and Dasha get equal time — three minutes for each one, thus, Vasya will go to both girlfriends equally often.
|
```python
def hcfnaive(a,b):
if(b==0):
return a
else:
return hcfnaive(b,a%b)
a,b=list(map(int,input().split()))
c=(a*b)//hcfnaive(a,b)
l=[]
for i in range(a,c,a):
l.append([i,'d'])
for i in range(b,c,b):
l.append([i,'m'])
l.sort()
d,m=0,0
for i in range(len(l)):
if l[i][1]=='d':
d=d+1
elif l[i][1]=='m':
m=m+1
if a>b:
d=d+1
else:
m=m+1
if d>m:
print("Dasha")
elif m>d:
print("Masha")
else:
print("Equal")
```
| 0
|
732
|
A
|
Buy a Shovel
|
PROGRAMMING
| 800
|
[
"brute force",
"constructive algorithms",
"implementation",
"math"
] | null | null |
Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop.
In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9).
What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel.
|
The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins".
Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels.
|
Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change.
|
[
"117 3\n",
"237 7\n",
"15 2\n"
] |
[
"9\n",
"1\n",
"2\n"
] |
In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change.
In the second example it is enough for Polycarp to buy one shovel.
In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
| 500
|
[
{
"input": "117 3",
"output": "9"
},
{
"input": "237 7",
"output": "1"
},
{
"input": "15 2",
"output": "2"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 9",
"output": "9"
},
{
"input": "1000 3",
"output": "1"
},
{
"input": "1000 1",
"output": "1"
},
{
"input": "1000 9",
"output": "1"
},
{
"input": "1 2",
"output": "2"
},
{
"input": "999 9",
"output": "1"
},
{
"input": "999 8",
"output": "2"
},
{
"input": "105 6",
"output": "2"
},
{
"input": "403 9",
"output": "3"
},
{
"input": "546 4",
"output": "4"
},
{
"input": "228 9",
"output": "5"
},
{
"input": "57 2",
"output": "6"
},
{
"input": "437 9",
"output": "7"
},
{
"input": "997 6",
"output": "8"
},
{
"input": "109 1",
"output": "9"
},
{
"input": "998 9",
"output": "5"
},
{
"input": "4 2",
"output": "3"
},
{
"input": "9 3",
"output": "7"
},
{
"input": "8 2",
"output": "4"
},
{
"input": "1 3",
"output": "3"
},
{
"input": "1 4",
"output": "4"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "1 7",
"output": "7"
},
{
"input": "1 8",
"output": "8"
},
{
"input": "100 3",
"output": "1"
},
{
"input": "1000 2",
"output": "1"
},
{
"input": "1000 4",
"output": "1"
},
{
"input": "1000 5",
"output": "1"
},
{
"input": "1000 6",
"output": "1"
},
{
"input": "1000 7",
"output": "1"
},
{
"input": "1000 8",
"output": "1"
},
{
"input": "23 4",
"output": "8"
},
{
"input": "33 1",
"output": "7"
},
{
"input": "33 2",
"output": "4"
},
{
"input": "666 5",
"output": "5"
},
{
"input": "2 3",
"output": "5"
},
{
"input": "5 5",
"output": "1"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "12 4",
"output": "2"
},
{
"input": "15 5",
"output": "1"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "25 5",
"output": "1"
},
{
"input": "2 9",
"output": "5"
},
{
"input": "6 7",
"output": "5"
},
{
"input": "8 9",
"output": "5"
},
{
"input": "2 7",
"output": "5"
},
{
"input": "4 7",
"output": "5"
},
{
"input": "2 1",
"output": "5"
},
{
"input": "261 1",
"output": "1"
}
] | 1,687,468,311
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 46
| 0
|
k,r=map(int,input().split())
s=1
while (k*s)%10!=r and (k*s)%10!=0:
s+=1
print(s)
|
Title: Buy a Shovel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop.
In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9).
What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel.
Input Specification:
The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins".
Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels.
Output Specification:
Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change.
Demo Input:
['117 3\n', '237 7\n', '15 2\n']
Demo Output:
['9\n', '1\n', '2\n']
Note:
In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change.
In the second example it is enough for Polycarp to buy one shovel.
In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
|
```python
k,r=map(int,input().split())
s=1
while (k*s)%10!=r and (k*s)%10!=0:
s+=1
print(s)
```
| 3
|
|
343
|
C
|
Read Time
|
PROGRAMMING
| 1,900
|
[
"binary search",
"greedy",
"two pointers"
] | null | null |
Mad scientist Mike does not use slow hard disks. His modification of a hard drive has not one, but *n* different heads that can read data in parallel.
When viewed from the side, Mike's hard drive is an endless array of tracks. The tracks of the array are numbered from left to right with integers, starting with 1. In the initial state the *i*-th reading head is above the track number *h**i*. For each of the reading heads, the hard drive's firmware can move the head exactly one track to the right or to the left, or leave it on the current track. During the operation each head's movement does not affect the movement of the other heads: the heads can change their relative order; there can be multiple reading heads above any of the tracks. A track is considered read if at least one head has visited this track. In particular, all of the tracks numbered *h*1, *h*2, ..., *h**n* have been read at the beginning of the operation.
Mike needs to read the data on *m* distinct tracks with numbers *p*1, *p*2, ..., *p**m*. Determine the minimum time the hard drive firmware needs to move the heads and read all the given tracks. Note that an arbitrary number of other tracks can also be read.
|
The first line of the input contains two space-separated integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the number of disk heads and the number of tracks to read, accordingly. The second line contains *n* distinct integers *h**i* in ascending order (1<=≤<=*h**i*<=≤<=1010, *h**i*<=<<=*h**i*<=+<=1) — the initial positions of the heads. The third line contains *m* distinct integers *p**i* in ascending order (1<=≤<=*p**i*<=≤<=1010, *p**i*<=<<=*p**i*<=+<=1) - the numbers of tracks to read.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is recommended to use the cin, cout streams or the %I64d specifier.
|
Print a single number — the minimum time required, in seconds, to read all the needed tracks.
|
[
"3 4\n2 5 6\n1 3 6 8\n",
"3 3\n1 2 3\n1 2 3\n",
"1 2\n165\n142 200\n"
] |
[
"2\n",
"0\n",
"81\n"
] |
The first test coincides with the figure. In this case the given tracks can be read in 2 seconds in the following way:
1. during the first second move the 1-st head to the left and let it stay there; 1. move the second head to the left twice; 1. move the third head to the right twice (note that the 6-th track has already been read at the beginning).
One cannot read the tracks in 1 second as the 3-rd head is at distance 2 from the 8-th track.
| 1,500
|
[
{
"input": "3 4\n2 5 6\n1 3 6 8",
"output": "2"
},
{
"input": "3 3\n1 2 3\n1 2 3",
"output": "0"
},
{
"input": "1 2\n165\n142 200",
"output": "81"
},
{
"input": "1 2\n5000000000\n1 10000000000",
"output": "14999999998"
},
{
"input": "2 4\n3 12\n1 7 8 14",
"output": "8"
},
{
"input": "3 3\n1 2 3\n2 3 4",
"output": "1"
},
{
"input": "2 1\n1 10\n9",
"output": "1"
},
{
"input": "3 19\n7 10 13\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19",
"output": "6"
},
{
"input": "3 3\n2 3 4\n1 3 5",
"output": "1"
},
{
"input": "10 11\n1 909090909 1818181817 2727272725 3636363633 4545454541 5454545449 6363636357 7272727265 8181818173\n454545455 1363636363 2272727271 3181818179 4090909087 4999999995 5909090903 6818181811 7727272719 8636363627 9545454535",
"output": "1363636362"
},
{
"input": "3 10\n4999999999 5000000000 5000000001\n1 1000 100000 1000000 4999999999 5000000000 5000000001 6000000000 8000000000 10000000000",
"output": "4999999999"
},
{
"input": "2 4\n4500000000 5500000000\n5 499999999 5000000001 9999999995",
"output": "5499999993"
},
{
"input": "10 10\n331462447 1369967506 1504296131 2061390288 2309640071 3006707770 4530801731 4544099460 7357049371 9704808257\n754193799 3820869903 4594383880 5685752675 6303322854 6384906441 7863448848 8542634752 9573124462 9665646063",
"output": "1840806981"
},
{
"input": "1 1\n10000000000\n1",
"output": "9999999999"
},
{
"input": "1 1\n1\n10000000000",
"output": "9999999999"
},
{
"input": "10 10\n9999999991 9999999992 9999999993 9999999994 9999999995 9999999996 9999999997 9999999998 9999999999 10000000000\n1 2 3 4 5 6 7 8 9 10",
"output": "9999999990"
},
{
"input": "3 12\n477702277 4717363935 8947981095\n477702276 477702304 477702312 477702317 4717363895 4717363896 4717363920 4717363936 8947981094 8947981111 8947981112 8947981135",
"output": "42"
},
{
"input": "10 10\n389151626 1885767612 2609703695 3054567325 4421751790 5636236054 6336088034 7961001379 8631992167 9836923433\n389144165 389158510 1885760728 1885775073 2609696234 2609710579 3054559864 3054574209 4421744329 4421758674",
"output": "21229"
},
{
"input": "1 1\n10000000000\n1",
"output": "9999999999"
}
] | 1,532,904,249
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 9
| 1,000
| 11,366,400
|
def can(d,a,b):
d1=d
mi=a[-1]
ma=a[-1]
x=len(a)-1
y=len(b)-1
while x>=0 and y>=0:
if b[y]<=mi:
if abs(b[y]-ma)<=d1:
x-=1
if x==-1:
break
ma=a[x]
else:
y-=1
mi=a[x]
ma=a[x]
elif b[y]>=ma:
if abs(b[y]-mi)<=d1:
x-=1
if x==-1:
break
ma=a[x]
else:
y-=1
mi=a[x]
ma=a[x]
else:
if abs(ma-mi)+min(abs(b[y]-mi),abs(b[y]-ma))<=d1:
x-=1
if x==-1:
break
ma=a[x]
else:
y-=1
mi=a[x]
ma=a[x]
return x==-1
n,m=map(int,input().split())
s=list(map(int,input().split()))[::-1]
s1=list(map(int,input().split()))[::-1]
high=(10**10)*3
low=0
while high-low>1:
mid=(high+low)//2
if can(mid,s1,s):
high=mid
else:
low=mid
if can(low,s1,s):
print(low)
else:
print(high)
|
Title: Read Time
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mad scientist Mike does not use slow hard disks. His modification of a hard drive has not one, but *n* different heads that can read data in parallel.
When viewed from the side, Mike's hard drive is an endless array of tracks. The tracks of the array are numbered from left to right with integers, starting with 1. In the initial state the *i*-th reading head is above the track number *h**i*. For each of the reading heads, the hard drive's firmware can move the head exactly one track to the right or to the left, or leave it on the current track. During the operation each head's movement does not affect the movement of the other heads: the heads can change their relative order; there can be multiple reading heads above any of the tracks. A track is considered read if at least one head has visited this track. In particular, all of the tracks numbered *h*1, *h*2, ..., *h**n* have been read at the beginning of the operation.
Mike needs to read the data on *m* distinct tracks with numbers *p*1, *p*2, ..., *p**m*. Determine the minimum time the hard drive firmware needs to move the heads and read all the given tracks. Note that an arbitrary number of other tracks can also be read.
Input Specification:
The first line of the input contains two space-separated integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the number of disk heads and the number of tracks to read, accordingly. The second line contains *n* distinct integers *h**i* in ascending order (1<=≤<=*h**i*<=≤<=1010, *h**i*<=<<=*h**i*<=+<=1) — the initial positions of the heads. The third line contains *m* distinct integers *p**i* in ascending order (1<=≤<=*p**i*<=≤<=1010, *p**i*<=<<=*p**i*<=+<=1) - the numbers of tracks to read.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is recommended to use the cin, cout streams or the %I64d specifier.
Output Specification:
Print a single number — the minimum time required, in seconds, to read all the needed tracks.
Demo Input:
['3 4\n2 5 6\n1 3 6 8\n', '3 3\n1 2 3\n1 2 3\n', '1 2\n165\n142 200\n']
Demo Output:
['2\n', '0\n', '81\n']
Note:
The first test coincides with the figure. In this case the given tracks can be read in 2 seconds in the following way:
1. during the first second move the 1-st head to the left and let it stay there; 1. move the second head to the left twice; 1. move the third head to the right twice (note that the 6-th track has already been read at the beginning).
One cannot read the tracks in 1 second as the 3-rd head is at distance 2 from the 8-th track.
|
```python
def can(d,a,b):
d1=d
mi=a[-1]
ma=a[-1]
x=len(a)-1
y=len(b)-1
while x>=0 and y>=0:
if b[y]<=mi:
if abs(b[y]-ma)<=d1:
x-=1
if x==-1:
break
ma=a[x]
else:
y-=1
mi=a[x]
ma=a[x]
elif b[y]>=ma:
if abs(b[y]-mi)<=d1:
x-=1
if x==-1:
break
ma=a[x]
else:
y-=1
mi=a[x]
ma=a[x]
else:
if abs(ma-mi)+min(abs(b[y]-mi),abs(b[y]-ma))<=d1:
x-=1
if x==-1:
break
ma=a[x]
else:
y-=1
mi=a[x]
ma=a[x]
return x==-1
n,m=map(int,input().split())
s=list(map(int,input().split()))[::-1]
s1=list(map(int,input().split()))[::-1]
high=(10**10)*3
low=0
while high-low>1:
mid=(high+low)//2
if can(mid,s1,s):
high=mid
else:
low=mid
if can(low,s1,s):
print(low)
else:
print(high)
```
| 0
|
|
298
|
A
|
Snow Footprints
|
PROGRAMMING
| 1,300
|
[
"greedy",
"implementation"
] | null | null |
There is a straight snowy road, divided into *n* blocks. The blocks are numbered from 1 to *n* from left to right. If one moves from the *i*-th block to the (*i*<=+<=1)-th block, he will leave a right footprint on the *i*-th block. Similarly, if one moves from the *i*-th block to the (*i*<=-<=1)-th block, he will leave a left footprint on the *i*-th block. If there already is a footprint on the *i*-th block, the new footprint will cover the old one.
At the beginning, there were no footprints. Then polar bear Alice starts from the *s*-th block, makes a sequence of moves and ends in the *t*-th block. It is known that Alice never moves outside of the road.
You are given the description of Alice's footprints. Your task is to find a pair of possible values of *s*,<=*t* by looking at the footprints.
|
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=1000).
The second line contains the description of the road — the string that consists of *n* characters. Each character will be either "." (a block without footprint), or "L" (a block with a left footprint), "R" (a block with a right footprint).
It's guaranteed that the given string contains at least one character not equal to ".". Also, the first and the last character will always be ".". It's guaranteed that a solution exists.
|
Print two space-separated integers — the values of *s* and *t*. If there are several possible solutions you can print any of them.
|
[
"9\n..RRLL...\n",
"11\n.RRRLLLLL..\n"
] |
[
"3 4\n",
"7 5\n"
] |
The first test sample is the one in the picture.
| 500
|
[
{
"input": "11\n.RRRLLLLL..",
"output": "7 5"
},
{
"input": "4\n.RL.",
"output": "3 2"
},
{
"input": "3\n.L.",
"output": "2 1"
},
{
"input": "3\n.R.",
"output": "2 3"
}
] | 1,625,436,924
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 2
| 1,000
| 0
|
n = int(input())
path = input()
s = 0
t = 0
i = 0
while True:
if path[i] == '.':
i += 1
if path[i] == 'R' and path[i-1] == '.':
i += 1
s = i
if path[i] == 'R' and path[i+1] == 'R':
i += 1
if path[i] == 'R' and path[i+1] == 'L':
t = i
break
print(s, t+1, sep=' ')
|
Title: Snow Footprints
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a straight snowy road, divided into *n* blocks. The blocks are numbered from 1 to *n* from left to right. If one moves from the *i*-th block to the (*i*<=+<=1)-th block, he will leave a right footprint on the *i*-th block. Similarly, if one moves from the *i*-th block to the (*i*<=-<=1)-th block, he will leave a left footprint on the *i*-th block. If there already is a footprint on the *i*-th block, the new footprint will cover the old one.
At the beginning, there were no footprints. Then polar bear Alice starts from the *s*-th block, makes a sequence of moves and ends in the *t*-th block. It is known that Alice never moves outside of the road.
You are given the description of Alice's footprints. Your task is to find a pair of possible values of *s*,<=*t* by looking at the footprints.
Input Specification:
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=1000).
The second line contains the description of the road — the string that consists of *n* characters. Each character will be either "." (a block without footprint), or "L" (a block with a left footprint), "R" (a block with a right footprint).
It's guaranteed that the given string contains at least one character not equal to ".". Also, the first and the last character will always be ".". It's guaranteed that a solution exists.
Output Specification:
Print two space-separated integers — the values of *s* and *t*. If there are several possible solutions you can print any of them.
Demo Input:
['9\n..RRLL...\n', '11\n.RRRLLLLL..\n']
Demo Output:
['3 4\n', '7 5\n']
Note:
The first test sample is the one in the picture.
|
```python
n = int(input())
path = input()
s = 0
t = 0
i = 0
while True:
if path[i] == '.':
i += 1
if path[i] == 'R' and path[i-1] == '.':
i += 1
s = i
if path[i] == 'R' and path[i+1] == 'R':
i += 1
if path[i] == 'R' and path[i+1] == 'L':
t = i
break
print(s, t+1, sep=' ')
```
| 0
|
|
784
|
C
|
INTERCALC
|
PROGRAMMING
| 1,800
|
[
"*special",
"implementation"
] | null | null |
DO YOU EXPECT ME TO FIND THIS OUT?
WHAT BASE AND/XOR LANGUAGE INCLUDES string?
DON'T BYTE OF MORE THAN YOU CAN CHEW
YOU CAN ONLY DISTORT THE LARGEST OF MATHEMATICS SO FAR
SAYING "ABRACADABRA" WITHOUT A MAGIC AND WON'T DO YOU ANY GOOD
THE LAST STACK RUPTURES. ALL DIE. OH, THE EMBARRASSMENT!
I HAVE NO ARRAY AND I MUST SCREAM
ELEMENTS MAY NOT BE STORED IN WEST HYPERSPACE
|
The first line of input data contains a single integer *n* (1<=≤<=*n*<=≤<=10).
The second line of input data contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=11).
|
Output a single integer.
|
[
"4\n2 5 3 1\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "4\n2 5 3 1",
"output": "4"
},
{
"input": "2\n1 5",
"output": "0"
},
{
"input": "1\n8",
"output": "0"
},
{
"input": "6\n1 1 1 3 2 9",
"output": "0"
},
{
"input": "5\n8 9 3 1 9",
"output": "0"
},
{
"input": "6\n1 5 2 1 7 11",
"output": "0"
},
{
"input": "8\n1 6 11 8 5 10 7 8",
"output": "3"
},
{
"input": "3\n4 9 6",
"output": "15"
},
{
"input": "2\n4 8",
"output": "0"
},
{
"input": "3\n1 1 5",
"output": "0"
},
{
"input": "5\n4 5 5 2 11",
"output": "0"
},
{
"input": "6\n1 7 2 8 8 2",
"output": "10"
},
{
"input": "5\n3 9 3 2 3",
"output": "10"
},
{
"input": "7\n6 6 1 1 1 2 3",
"output": "5"
},
{
"input": "7\n11 1 2 8 10 5 9",
"output": "2"
},
{
"input": "7\n4 5 1 10 10 4 1",
"output": "11"
},
{
"input": "10\n5 5 10 10 10 2 4 3 4 10",
"output": "0"
},
{
"input": "8\n4 7 11 3 11 3 1 1",
"output": "10"
},
{
"input": "2\n5 9",
"output": "0"
},
{
"input": "6\n2 1 10 2 7 5",
"output": "15"
},
{
"input": "6\n3 5 9 10 5 4",
"output": "14"
},
{
"input": "8\n3 5 8 10 3 4 2 10",
"output": "0"
},
{
"input": "7\n1 6 5 3 9 5 9",
"output": "0"
},
{
"input": "8\n7 2 6 3 6 4 1 8",
"output": "0"
},
{
"input": "10\n8 10 6 10 4 3 4 6 7 4",
"output": "14"
},
{
"input": "2\n1 5",
"output": "0"
},
{
"input": "10\n5 6 4 8 11 4 10 4 8 4",
"output": "15"
},
{
"input": "2\n3 7",
"output": "0"
},
{
"input": "3\n4 10 3",
"output": "9"
},
{
"input": "5\n5 2 2 11 2",
"output": "9"
}
] | 1,522,517,755
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 93
| 7,065,600
|
a=int(input())
b=int(str(input())[-1])
if a>b:
print (a)
else:
print(0)
|
Title: INTERCALC
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DO YOU EXPECT ME TO FIND THIS OUT?
WHAT BASE AND/XOR LANGUAGE INCLUDES string?
DON'T BYTE OF MORE THAN YOU CAN CHEW
YOU CAN ONLY DISTORT THE LARGEST OF MATHEMATICS SO FAR
SAYING "ABRACADABRA" WITHOUT A MAGIC AND WON'T DO YOU ANY GOOD
THE LAST STACK RUPTURES. ALL DIE. OH, THE EMBARRASSMENT!
I HAVE NO ARRAY AND I MUST SCREAM
ELEMENTS MAY NOT BE STORED IN WEST HYPERSPACE
Input Specification:
The first line of input data contains a single integer *n* (1<=≤<=*n*<=≤<=10).
The second line of input data contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=11).
Output Specification:
Output a single integer.
Demo Input:
['4\n2 5 3 1\n']
Demo Output:
['4\n']
Note:
none
|
```python
a=int(input())
b=int(str(input())[-1])
if a>b:
print (a)
else:
print(0)
```
| 0
|
|
432
|
A
|
Choosing Teams
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
|
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
|
Print a single number — the answer to the problem.
|
[
"5 2\n0 4 5 1 0\n",
"6 4\n0 1 2 3 4 5\n",
"6 5\n0 0 0 0 0 0\n"
] |
[
"1\n",
"0\n",
"2\n"
] |
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
| 500
|
[
{
"input": "5 2\n0 4 5 1 0",
"output": "1"
},
{
"input": "6 4\n0 1 2 3 4 5",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "3 4\n0 1 0",
"output": "1"
},
{
"input": "3 4\n0 2 0",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "12 2\n0 1 2 3 4 0 1 2 3 4 0 1",
"output": "3"
},
{
"input": "15 2\n0 1 2 3 4 0 1 2 3 4 0 1 2 3 4",
"output": "4"
},
{
"input": "13 1\n5 0 5 0 1 5 0 4 1 1 1 4 1",
"output": "3"
},
{
"input": "20 1\n5 0 4 2 2 3 2 1 2 4 1 3 5 5 5 4 4 1 3 0",
"output": "5"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "6 3\n4 4 4 4 4 4",
"output": "0"
},
{
"input": "1 4\n1",
"output": "0"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "2 3\n0 0",
"output": "0"
}
] | 1,674,707,337
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 35
| 93
| 1,638,400
|
from sys import stdin
first_line = [int(x) for x in stdin.readline().split()]
n= first_line[0]
k = first_line[1]
listy = [int(x) for x in stdin.readline().split()]
eligible = sum(1 for i in listy if i<6-k)
answer = eligible//3
print(answer)
|
Title: Choosing Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
Input Specification:
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['5 2\n0 4 5 1 0\n', '6 4\n0 1 2 3 4 5\n', '6 5\n0 0 0 0 0 0\n']
Demo Output:
['1\n', '0\n', '2\n']
Note:
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
|
```python
from sys import stdin
first_line = [int(x) for x in stdin.readline().split()]
n= first_line[0]
k = first_line[1]
listy = [int(x) for x in stdin.readline().split()]
eligible = sum(1 for i in listy if i<6-k)
answer = eligible//3
print(answer)
```
| 3
|
|
990
|
A
|
Commentary Boxes
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
Berland Football Cup starts really soon! Commentators from all over the world come to the event.
Organizers have already built $n$ commentary boxes. $m$ regional delegations will come to the Cup. Every delegation should get the same number of the commentary boxes. If any box is left unoccupied then the delegations will be upset. So each box should be occupied by exactly one delegation.
If $n$ is not divisible by $m$, it is impossible to distribute the boxes to the delegations at the moment.
Organizers can build a new commentary box paying $a$ burles and demolish a commentary box paying $b$ burles. They can both build and demolish boxes arbitrary number of times (each time paying a corresponding fee). It is allowed to demolish all the existing boxes.
What is the minimal amount of burles organizers should pay to satisfy all the delegations (i.e. to make the number of the boxes be divisible by $m$)?
|
The only line contains four integer numbers $n$, $m$, $a$ and $b$ ($1 \le n, m \le 10^{12}$, $1 \le a, b \le 100$), where $n$ is the initial number of the commentary boxes, $m$ is the number of delegations to come, $a$ is the fee to build a box and $b$ is the fee to demolish a box.
|
Output the minimal amount of burles organizers should pay to satisfy all the delegations (i.e. to make the number of the boxes be divisible by $m$). It is allowed that the final number of the boxes is equal to $0$.
|
[
"9 7 3 8\n",
"2 7 3 7\n",
"30 6 17 19\n"
] |
[
"15\n",
"14\n",
"0\n"
] |
In the first example organizers can build $5$ boxes to make the total of $14$ paying $3$ burles for the each of them.
In the second example organizers can demolish $2$ boxes to make the total of $0$ paying $7$ burles for the each of them.
In the third example organizers are already able to distribute all the boxes equally among the delegations, each one get $5$ boxes.
| 0
|
[
{
"input": "9 7 3 8",
"output": "15"
},
{
"input": "2 7 3 7",
"output": "14"
},
{
"input": "30 6 17 19",
"output": "0"
},
{
"input": "500000000001 1000000000000 100 100",
"output": "49999999999900"
},
{
"input": "1000000000000 750000000001 10 100",
"output": "5000000000020"
},
{
"input": "1000000000000 750000000001 100 10",
"output": "2499999999990"
},
{
"input": "42 1 1 1",
"output": "0"
},
{
"input": "1 1000000000000 1 100",
"output": "100"
},
{
"input": "7 2 3 7",
"output": "3"
},
{
"input": "999999999 2 1 1",
"output": "1"
},
{
"input": "999999999999 10000000007 100 100",
"output": "70100"
},
{
"input": "10000000001 2 1 1",
"output": "1"
},
{
"input": "29 6 1 2",
"output": "1"
},
{
"input": "99999999999 6 100 100",
"output": "300"
},
{
"input": "1000000000000 7 3 8",
"output": "8"
},
{
"input": "99999999999 2 1 1",
"output": "1"
},
{
"input": "1 2 1 1",
"output": "1"
},
{
"input": "999999999999 2 1 1",
"output": "1"
},
{
"input": "9 2 1 1",
"output": "1"
},
{
"input": "17 4 5 5",
"output": "5"
},
{
"input": "100000000000 3 1 1",
"output": "1"
},
{
"input": "100 7 1 1",
"output": "2"
},
{
"input": "1000000000000 3 100 100",
"output": "100"
},
{
"input": "70 3 10 10",
"output": "10"
},
{
"input": "1 2 5 1",
"output": "1"
},
{
"input": "1000000000000 3 1 1",
"output": "1"
},
{
"input": "804289377 846930887 78 16",
"output": "3326037780"
},
{
"input": "1000000000000 9 55 55",
"output": "55"
},
{
"input": "957747787 424238336 87 93",
"output": "10162213695"
},
{
"input": "25 6 1 2",
"output": "2"
},
{
"input": "22 7 3 8",
"output": "8"
},
{
"input": "10000000000 1 1 1",
"output": "0"
},
{
"input": "999999999999 2 10 10",
"output": "10"
},
{
"input": "999999999999 2 100 100",
"output": "100"
},
{
"input": "100 3 3 8",
"output": "6"
},
{
"input": "99999 2 1 1",
"output": "1"
},
{
"input": "100 3 2 5",
"output": "4"
},
{
"input": "1000000000000 13 10 17",
"output": "17"
},
{
"input": "7 2 1 2",
"output": "1"
},
{
"input": "10 3 1 2",
"output": "2"
},
{
"input": "5 2 2 2",
"output": "2"
},
{
"input": "100 3 5 2",
"output": "2"
},
{
"input": "7 2 1 1",
"output": "1"
},
{
"input": "70 4 1 1",
"output": "2"
},
{
"input": "10 4 1 1",
"output": "2"
},
{
"input": "6 7 41 42",
"output": "41"
},
{
"input": "10 3 10 1",
"output": "1"
},
{
"input": "5 5 2 3",
"output": "0"
},
{
"input": "1000000000000 3 99 99",
"output": "99"
},
{
"input": "7 3 100 1",
"output": "1"
},
{
"input": "7 2 100 5",
"output": "5"
},
{
"input": "1000000000000 1 23 33",
"output": "0"
},
{
"input": "30 7 1 1",
"output": "2"
},
{
"input": "100 3 1 1",
"output": "1"
},
{
"input": "90001 300 100 1",
"output": "1"
},
{
"input": "13 4 1 2",
"output": "2"
},
{
"input": "1000000000000 6 1 3",
"output": "2"
},
{
"input": "50 4 5 100",
"output": "10"
},
{
"input": "999 2 1 1",
"output": "1"
},
{
"input": "5 2 5 5",
"output": "5"
},
{
"input": "20 3 3 3",
"output": "3"
},
{
"input": "3982258181 1589052704 87 20",
"output": "16083055460"
},
{
"input": "100 3 1 3",
"output": "2"
},
{
"input": "7 3 1 1",
"output": "1"
},
{
"input": "19 10 100 100",
"output": "100"
},
{
"input": "23 3 100 1",
"output": "2"
},
{
"input": "25 7 100 1",
"output": "4"
},
{
"input": "100 9 1 2",
"output": "2"
},
{
"input": "9999999999 2 1 100",
"output": "1"
},
{
"input": "1000000000000 2 1 1",
"output": "0"
},
{
"input": "10000 3 1 1",
"output": "1"
},
{
"input": "22 7 1 6",
"output": "6"
},
{
"input": "100000000000 1 1 1",
"output": "0"
},
{
"input": "18 7 100 1",
"output": "4"
},
{
"input": "10003 4 1 100",
"output": "1"
},
{
"input": "3205261341 718648876 58 11",
"output": "3637324207"
},
{
"input": "8 3 100 1",
"output": "2"
},
{
"input": "15 7 1 1",
"output": "1"
},
{
"input": "1000000000000 1 20 20",
"output": "0"
},
{
"input": "16 7 3 2",
"output": "4"
},
{
"input": "1000000000000 1 1 1",
"output": "0"
},
{
"input": "7 3 1 100",
"output": "2"
},
{
"input": "16 3 1 100",
"output": "2"
},
{
"input": "13 4 1 10",
"output": "3"
},
{
"input": "10 4 5 5",
"output": "10"
},
{
"input": "14 3 1 100",
"output": "1"
},
{
"input": "100 33 100 1",
"output": "1"
},
{
"input": "22 7 1 8",
"output": "6"
},
{
"input": "10 4 2 1",
"output": "2"
},
{
"input": "6 4 2 2",
"output": "4"
},
{
"input": "17 4 2 1",
"output": "1"
},
{
"input": "7 3 100 10",
"output": "10"
},
{
"input": "702 7 3 2",
"output": "4"
},
{
"input": "8 3 1 5",
"output": "1"
},
{
"input": "3 2 5 2",
"output": "2"
},
{
"input": "99 19 1 7",
"output": "15"
},
{
"input": "16 3 100 1",
"output": "1"
},
{
"input": "100 34 1 100",
"output": "2"
},
{
"input": "100 33 1 1",
"output": "1"
},
{
"input": "2 3 4 3",
"output": "4"
},
{
"input": "15 4 4 10",
"output": "4"
},
{
"input": "1144108931 470211273 45 79",
"output": "11993619960"
},
{
"input": "2 3 3 4",
"output": "3"
},
{
"input": "29 5 4 9",
"output": "4"
},
{
"input": "15 7 1 5",
"output": "5"
},
{
"input": "1 1 1 1",
"output": "0"
},
{
"input": "1 1 3 4",
"output": "0"
},
{
"input": "10 12 2 1",
"output": "4"
},
{
"input": "1 2 3 4",
"output": "3"
}
] | 1,528,638,659
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 109
| 93
| 0
|
n, m, a, b = map(int, input().split())
r = n % m
print(min(r * b, (m - r) * a))
|
Title: Commentary Boxes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Berland Football Cup starts really soon! Commentators from all over the world come to the event.
Organizers have already built $n$ commentary boxes. $m$ regional delegations will come to the Cup. Every delegation should get the same number of the commentary boxes. If any box is left unoccupied then the delegations will be upset. So each box should be occupied by exactly one delegation.
If $n$ is not divisible by $m$, it is impossible to distribute the boxes to the delegations at the moment.
Organizers can build a new commentary box paying $a$ burles and demolish a commentary box paying $b$ burles. They can both build and demolish boxes arbitrary number of times (each time paying a corresponding fee). It is allowed to demolish all the existing boxes.
What is the minimal amount of burles organizers should pay to satisfy all the delegations (i.e. to make the number of the boxes be divisible by $m$)?
Input Specification:
The only line contains four integer numbers $n$, $m$, $a$ and $b$ ($1 \le n, m \le 10^{12}$, $1 \le a, b \le 100$), where $n$ is the initial number of the commentary boxes, $m$ is the number of delegations to come, $a$ is the fee to build a box and $b$ is the fee to demolish a box.
Output Specification:
Output the minimal amount of burles organizers should pay to satisfy all the delegations (i.e. to make the number of the boxes be divisible by $m$). It is allowed that the final number of the boxes is equal to $0$.
Demo Input:
['9 7 3 8\n', '2 7 3 7\n', '30 6 17 19\n']
Demo Output:
['15\n', '14\n', '0\n']
Note:
In the first example organizers can build $5$ boxes to make the total of $14$ paying $3$ burles for the each of them.
In the second example organizers can demolish $2$ boxes to make the total of $0$ paying $7$ burles for the each of them.
In the third example organizers are already able to distribute all the boxes equally among the delegations, each one get $5$ boxes.
|
```python
n, m, a, b = map(int, input().split())
r = n % m
print(min(r * b, (m - r) * a))
```
| 3
|
|
710
|
A
|
King Moves
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
The only king stands on the standard chess board. You are given his position in format "cd", where *c* is the column from 'a' to 'h' and *d* is the row from '1' to '8'. Find the number of moves permitted for the king.
Check the king's moves here [https://en.wikipedia.org/wiki/King_(chess)](https://en.wikipedia.org/wiki/King_(chess)).
|
The only line contains the king's position in the format "cd", where 'c' is the column from 'a' to 'h' and 'd' is the row from '1' to '8'.
|
Print the only integer *x* — the number of moves permitted for the king.
|
[
"e4\n"
] |
[
"8\n"
] |
none
| 0
|
[
{
"input": "e4",
"output": "8"
},
{
"input": "a1",
"output": "3"
},
{
"input": "h8",
"output": "3"
},
{
"input": "a4",
"output": "5"
},
{
"input": "g7",
"output": "8"
},
{
"input": "e1",
"output": "5"
},
{
"input": "b2",
"output": "8"
},
{
"input": "c7",
"output": "8"
},
{
"input": "h6",
"output": "5"
},
{
"input": "c8",
"output": "5"
},
{
"input": "h2",
"output": "5"
},
{
"input": "h5",
"output": "5"
},
{
"input": "a8",
"output": "3"
},
{
"input": "f8",
"output": "5"
},
{
"input": "h1",
"output": "3"
},
{
"input": "f2",
"output": "8"
},
{
"input": "e8",
"output": "5"
},
{
"input": "h3",
"output": "5"
},
{
"input": "b8",
"output": "5"
},
{
"input": "g8",
"output": "5"
},
{
"input": "d8",
"output": "5"
},
{
"input": "h4",
"output": "5"
},
{
"input": "b1",
"output": "5"
},
{
"input": "a2",
"output": "5"
}
] | 1,528,565,398
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
s = str(input())
if s =='a1' || s =='a8' || a=='h1' || a =='h8':print('3')
elif s[0] =='a' || s[0] == 'h':print('5')
elif s[1] =='8' || s[1] =='1':print('5')
else:print('8')
|
Title: King Moves
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The only king stands on the standard chess board. You are given his position in format "cd", where *c* is the column from 'a' to 'h' and *d* is the row from '1' to '8'. Find the number of moves permitted for the king.
Check the king's moves here [https://en.wikipedia.org/wiki/King_(chess)](https://en.wikipedia.org/wiki/King_(chess)).
Input Specification:
The only line contains the king's position in the format "cd", where 'c' is the column from 'a' to 'h' and 'd' is the row from '1' to '8'.
Output Specification:
Print the only integer *x* — the number of moves permitted for the king.
Demo Input:
['e4\n']
Demo Output:
['8\n']
Note:
none
|
```python
s = str(input())
if s =='a1' || s =='a8' || a=='h1' || a =='h8':print('3')
elif s[0] =='a' || s[0] == 'h':print('5')
elif s[1] =='8' || s[1] =='1':print('5')
else:print('8')
```
| -1
|
|
525
|
A
|
Vitaliy and Pie
|
PROGRAMMING
| 1,100
|
[
"greedy",
"hashing",
"strings"
] | null | null |
After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1.
The potato pie is located in the *n*-th room and Vitaly needs to go there.
Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key.
In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F.
Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door.
Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*.
Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number.
|
The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house.
The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one.
The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2.
The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1.
|
Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*.
|
[
"3\naAbB\n",
"4\naBaCaB\n",
"5\nxYyXzZaZ\n"
] |
[
"0\n",
"3\n",
"2\n"
] |
none
| 250
|
[
{
"input": "3\naAbB",
"output": "0"
},
{
"input": "4\naBaCaB",
"output": "3"
},
{
"input": "5\nxYyXzZaZ",
"output": "2"
},
{
"input": "26\naAbBcCdDeEfFgGhHiIjJkKlLmMnNoOpPqQrRsStTuUvVwWxXyY",
"output": "0"
},
{
"input": "26\nzAyBxCwDvEuFtGsHrIqJpKoLnMmNlOkPjQiRhSgTfUeVdWcXbY",
"output": "13"
},
{
"input": "5\naArRaRaR",
"output": "2"
},
{
"input": "2\ndA",
"output": "1"
},
{
"input": "2\ncB",
"output": "1"
},
{
"input": "10\nhNcMeXsSlHsUwYeMcA",
"output": "7"
},
{
"input": "100\nqDpInBmCrFwXpDbFgOzVvOcEmJrUcToAdEwEgTvBvBfWwRpGyEaXgDdRwVlQnYgWmWhMrHaIzPyXvGaFlRsVzHhZrOuVpXrKxFzAmWwPlFtNfPtJxVmLuHjKfYyArHrEnSwSzOvDpQhCgCqLlAcNpGhXrEeFuCmAqIkXyYtSsQwIxJzNiIuTgEbVuWrMwPrAlLyKaZ",
"output": "42"
},
{
"input": "2\ndD",
"output": "0"
},
{
"input": "2\ndE",
"output": "1"
},
{
"input": "3\ndDdD",
"output": "0"
},
{
"input": "3\ndEdD",
"output": "1"
},
{
"input": "3\ndEeD",
"output": "1"
},
{
"input": "3\ndEeF",
"output": "2"
}
] | 1,430,891,382
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 46
| 202
| 409,600
|
# print ("Enter number of rooms")
n = int(input())
# print ("Enter the configuration")
a = input()
dic = {}
tobuy = 0
for i in range((n-1)*2):
if (i%2 == 0): # A key (small letter)
ch = a[i]
dic[ch] = dic.get(ch, 0)+1 # Clever way to either increment or add
else: # A door--either open with a key, or add one to the count
ch = a[i].lower()
if ch in dic and dic[ch] > 0:
dic[ch] = dic[ch] - 1 # Use the key
else:
tobuy = tobuy + 1
print (tobuy)
|
Title: Vitaliy and Pie
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1.
The potato pie is located in the *n*-th room and Vitaly needs to go there.
Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key.
In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F.
Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door.
Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*.
Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number.
Input Specification:
The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house.
The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one.
The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2.
The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1.
Output Specification:
Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*.
Demo Input:
['3\naAbB\n', '4\naBaCaB\n', '5\nxYyXzZaZ\n']
Demo Output:
['0\n', '3\n', '2\n']
Note:
none
|
```python
# print ("Enter number of rooms")
n = int(input())
# print ("Enter the configuration")
a = input()
dic = {}
tobuy = 0
for i in range((n-1)*2):
if (i%2 == 0): # A key (small letter)
ch = a[i]
dic[ch] = dic.get(ch, 0)+1 # Clever way to either increment or add
else: # A door--either open with a key, or add one to the count
ch = a[i].lower()
if ch in dic and dic[ch] > 0:
dic[ch] = dic[ch] - 1 # Use the key
else:
tobuy = tobuy + 1
print (tobuy)
```
| 3
|
|
893
|
C
|
Rumor
|
PROGRAMMING
| 1,300
|
[
"dfs and similar",
"graphs",
"greedy"
] | null | null |
Vova promised himself that he would never play computer games... But recently Firestorm — a well-known game developing company — published their newest game, World of Farcraft, and it became really popular. Of course, Vova started playing it.
Now he tries to solve a quest. The task is to come to a settlement named Overcity and spread a rumor in it.
Vova knows that there are *n* characters in Overcity. Some characters are friends to each other, and they share information they got. Also Vova knows that he can bribe each character so he or she starts spreading the rumor; *i*-th character wants *c**i* gold in exchange for spreading the rumor. When a character hears the rumor, he tells it to all his friends, and they start spreading the rumor to their friends (for free), and so on.
The quest is finished when all *n* characters know the rumor. What is the minimum amount of gold Vova needs to spend in order to finish the quest?
Take a look at the notes if you think you haven't understood the problem completely.
|
The first line contains two integer numbers *n* and *m* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105) — the number of characters in Overcity and the number of pairs of friends.
The second line contains *n* integer numbers *c**i* (0<=≤<=*c**i*<=≤<=109) — the amount of gold *i*-th character asks to start spreading the rumor.
Then *m* lines follow, each containing a pair of numbers (*x**i*,<=*y**i*) which represent that characters *x**i* and *y**i* are friends (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, *x**i*<=≠<=*y**i*). It is guaranteed that each pair is listed at most once.
|
Print one number — the minimum amount of gold Vova has to spend in order to finish the quest.
|
[
"5 2\n2 5 3 4 8\n1 4\n4 5\n",
"10 0\n1 2 3 4 5 6 7 8 9 10\n",
"10 5\n1 6 2 7 3 8 4 9 5 10\n1 2\n3 4\n5 6\n7 8\n9 10\n"
] |
[
"10\n",
"55\n",
"15\n"
] |
In the first example the best decision is to bribe the first character (he will spread the rumor to fourth character, and the fourth one will spread it to fifth). Also Vova has to bribe the second and the third characters, so they know the rumor.
In the second example Vova has to bribe everyone.
In the third example the optimal decision is to bribe the first, the third, the fifth, the seventh and the ninth characters.
| 0
|
[
{
"input": "5 2\n2 5 3 4 8\n1 4\n4 5",
"output": "10"
},
{
"input": "10 0\n1 2 3 4 5 6 7 8 9 10",
"output": "55"
},
{
"input": "10 5\n1 6 2 7 3 8 4 9 5 10\n1 2\n3 4\n5 6\n7 8\n9 10",
"output": "15"
},
{
"input": "1 0\n0",
"output": "0"
},
{
"input": "1 0\n1000000000",
"output": "1000000000"
},
{
"input": "2 0\n0 0",
"output": "0"
},
{
"input": "2 0\n1000000000 0",
"output": "1000000000"
},
{
"input": "2 0\n0 1000000000",
"output": "1000000000"
},
{
"input": "2 0\n1000000000 1000000000",
"output": "2000000000"
},
{
"input": "2 1\n0 0\n1 2",
"output": "0"
}
] | 1,687,968,001
| 2,147,483,647
|
PyPy 3-64
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include <iostream>
#include <vector>
#include <unordered_map>
#include <limits>
std::vector<long long> visited;
long long mn = std::numeric_limits<long long>::max();
long long dfs(int i, const std::vector<long long>& c, const std::unordered_map<long long, std::vector<long long>>& d) {
mn = std::min(c[i - 1], mn);
visited[i] = 1;
for (long long j : d.at(i)) {
if (!visited[j]) {
dfs(j, c, d);
}
}
return mn;
}
int main() {
long long n, m;
std::cin >> n >> m;
std::vector<long long> c(n);
for (long long i = 0; i < n; ++i) {
std::cin >> c[i];
}
std::unordered_map<int, std::vector<long long>> d;
for (long long i = 0; i < m; ++i) {
long long x, y;
std::cin >> x >> y;
d[x].push_back(y);
d[y].push_back(x);
}
visited.resize(n + 1, 0);
long long cost = 0;
for (const auto& entry : d) {
if (!visited[entry.first]) {
cost += dfs(entry.first, c, d);
}
}
for (long long i = 1; i <= n; ++i) {
if (!visited[i]) {
cost += c[i - 1];
}
}
std::cout << cost << std::endl;
return 0;
}
|
Title: Rumor
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vova promised himself that he would never play computer games... But recently Firestorm — a well-known game developing company — published their newest game, World of Farcraft, and it became really popular. Of course, Vova started playing it.
Now he tries to solve a quest. The task is to come to a settlement named Overcity and spread a rumor in it.
Vova knows that there are *n* characters in Overcity. Some characters are friends to each other, and they share information they got. Also Vova knows that he can bribe each character so he or she starts spreading the rumor; *i*-th character wants *c**i* gold in exchange for spreading the rumor. When a character hears the rumor, he tells it to all his friends, and they start spreading the rumor to their friends (for free), and so on.
The quest is finished when all *n* characters know the rumor. What is the minimum amount of gold Vova needs to spend in order to finish the quest?
Take a look at the notes if you think you haven't understood the problem completely.
Input Specification:
The first line contains two integer numbers *n* and *m* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105) — the number of characters in Overcity and the number of pairs of friends.
The second line contains *n* integer numbers *c**i* (0<=≤<=*c**i*<=≤<=109) — the amount of gold *i*-th character asks to start spreading the rumor.
Then *m* lines follow, each containing a pair of numbers (*x**i*,<=*y**i*) which represent that characters *x**i* and *y**i* are friends (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, *x**i*<=≠<=*y**i*). It is guaranteed that each pair is listed at most once.
Output Specification:
Print one number — the minimum amount of gold Vova has to spend in order to finish the quest.
Demo Input:
['5 2\n2 5 3 4 8\n1 4\n4 5\n', '10 0\n1 2 3 4 5 6 7 8 9 10\n', '10 5\n1 6 2 7 3 8 4 9 5 10\n1 2\n3 4\n5 6\n7 8\n9 10\n']
Demo Output:
['10\n', '55\n', '15\n']
Note:
In the first example the best decision is to bribe the first character (he will spread the rumor to fourth character, and the fourth one will spread it to fifth). Also Vova has to bribe the second and the third characters, so they know the rumor.
In the second example Vova has to bribe everyone.
In the third example the optimal decision is to bribe the first, the third, the fifth, the seventh and the ninth characters.
|
```python
#include <iostream>
#include <vector>
#include <unordered_map>
#include <limits>
std::vector<long long> visited;
long long mn = std::numeric_limits<long long>::max();
long long dfs(int i, const std::vector<long long>& c, const std::unordered_map<long long, std::vector<long long>>& d) {
mn = std::min(c[i - 1], mn);
visited[i] = 1;
for (long long j : d.at(i)) {
if (!visited[j]) {
dfs(j, c, d);
}
}
return mn;
}
int main() {
long long n, m;
std::cin >> n >> m;
std::vector<long long> c(n);
for (long long i = 0; i < n; ++i) {
std::cin >> c[i];
}
std::unordered_map<int, std::vector<long long>> d;
for (long long i = 0; i < m; ++i) {
long long x, y;
std::cin >> x >> y;
d[x].push_back(y);
d[y].push_back(x);
}
visited.resize(n + 1, 0);
long long cost = 0;
for (const auto& entry : d) {
if (!visited[entry.first]) {
cost += dfs(entry.first, c, d);
}
}
for (long long i = 1; i <= n; ++i) {
if (!visited[i]) {
cost += c[i - 1];
}
}
std::cout << cost << std::endl;
return 0;
}
```
| -1
|
|
479
|
A
|
Expression
|
PROGRAMMING
| 1,000
|
[
"brute force",
"math"
] | null | null |
Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets:
- 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9
Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2.
It's easy to see that the maximum value that you can obtain is 9.
Your task is: given *a*, *b* and *c* print the maximum value that you can get.
|
The input contains three integers *a*, *b* and *c*, each on a single line (1<=≤<=*a*,<=*b*,<=*c*<=≤<=10).
|
Print the maximum value of the expression that you can obtain.
|
[
"1\n2\n3\n",
"2\n10\n3\n"
] |
[
"9\n",
"60\n"
] |
none
| 500
|
[
{
"input": "1\n2\n3",
"output": "9"
},
{
"input": "2\n10\n3",
"output": "60"
},
{
"input": "1\n1\n1",
"output": "3"
},
{
"input": "1\n2\n1",
"output": "4"
},
{
"input": "10\n10\n10",
"output": "1000"
},
{
"input": "5\n1\n3",
"output": "20"
},
{
"input": "3\n1\n5",
"output": "20"
},
{
"input": "6\n7\n1",
"output": "48"
},
{
"input": "1\n8\n3",
"output": "27"
},
{
"input": "9\n7\n2",
"output": "126"
},
{
"input": "1\n1\n10",
"output": "20"
},
{
"input": "9\n1\n1",
"output": "18"
},
{
"input": "10\n5\n6",
"output": "300"
},
{
"input": "8\n9\n7",
"output": "504"
},
{
"input": "4\n2\n10",
"output": "80"
},
{
"input": "2\n8\n3",
"output": "48"
},
{
"input": "3\n5\n7",
"output": "105"
},
{
"input": "1\n10\n1",
"output": "12"
},
{
"input": "2\n2\n2",
"output": "8"
},
{
"input": "5\n6\n1",
"output": "35"
},
{
"input": "10\n1\n1",
"output": "20"
},
{
"input": "1\n6\n1",
"output": "8"
},
{
"input": "1\n9\n1",
"output": "11"
},
{
"input": "2\n1\n2",
"output": "6"
},
{
"input": "2\n6\n1",
"output": "14"
},
{
"input": "9\n2\n1",
"output": "27"
},
{
"input": "1\n9\n2",
"output": "20"
},
{
"input": "1\n3\n1",
"output": "5"
},
{
"input": "2\n1\n1",
"output": "4"
}
] | 1,694,505,663
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 7
| 46
| 0
|
a = int(input())
b = int(input())
c = int(input())
num = [a,b,c]
d = max(num)
answer = max((a+b+c-d)*d , a*b*c , a+b+c)
print(answer)
|
Title: Expression
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets:
- 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9
Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2.
It's easy to see that the maximum value that you can obtain is 9.
Your task is: given *a*, *b* and *c* print the maximum value that you can get.
Input Specification:
The input contains three integers *a*, *b* and *c*, each on a single line (1<=≤<=*a*,<=*b*,<=*c*<=≤<=10).
Output Specification:
Print the maximum value of the expression that you can obtain.
Demo Input:
['1\n2\n3\n', '2\n10\n3\n']
Demo Output:
['9\n', '60\n']
Note:
none
|
```python
a = int(input())
b = int(input())
c = int(input())
num = [a,b,c]
d = max(num)
answer = max((a+b+c-d)*d , a*b*c , a+b+c)
print(answer)
```
| 0
|
|
596
|
A
|
Wilbur and Swimming Pool
|
PROGRAMMING
| 1,100
|
[
"geometry",
"implementation"
] | null | null |
After making bad dives into swimming pools, Wilbur wants to build a swimming pool in the shape of a rectangle in his backyard. He has set up coordinate axes, and he wants the sides of the rectangle to be parallel to them. Of course, the area of the rectangle must be positive. Wilbur had all four vertices of the planned pool written on a paper, until his friend came along and erased some of the vertices.
Now Wilbur is wondering, if the remaining *n* vertices of the initial rectangle give enough information to restore the area of the planned swimming pool.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=4) — the number of vertices that were not erased by Wilbur's friend.
Each of the following *n* lines contains two integers *x**i* and *y**i* (<=-<=1000<=≤<=*x**i*,<=*y**i*<=≤<=1000) —the coordinates of the *i*-th vertex that remains. Vertices are given in an arbitrary order.
It's guaranteed that these points are distinct vertices of some rectangle, that has positive area and which sides are parallel to the coordinate axes.
|
Print the area of the initial rectangle if it could be uniquely determined by the points remaining. Otherwise, print <=-<=1.
|
[
"2\n0 0\n1 1\n",
"1\n1 1\n"
] |
[
"1\n",
"-1\n"
] |
In the first sample, two opposite corners of the initial rectangle are given, and that gives enough information to say that the rectangle is actually a unit square.
In the second sample there is only one vertex left and this is definitely not enough to uniquely define the area.
| 500
|
[
{
"input": "2\n0 0\n1 1",
"output": "1"
},
{
"input": "1\n1 1",
"output": "-1"
},
{
"input": "1\n-188 17",
"output": "-1"
},
{
"input": "1\n71 -740",
"output": "-1"
},
{
"input": "4\n-56 -858\n-56 -174\n778 -858\n778 -174",
"output": "570456"
},
{
"input": "2\n14 153\n566 -13",
"output": "91632"
},
{
"input": "2\n-559 894\n314 127",
"output": "669591"
},
{
"input": "1\n-227 -825",
"output": "-1"
},
{
"input": "2\n-187 583\n25 13",
"output": "120840"
},
{
"input": "2\n-337 451\n32 -395",
"output": "312174"
},
{
"input": "4\n-64 -509\n-64 960\n634 -509\n634 960",
"output": "1025362"
},
{
"input": "2\n-922 -505\n712 -683",
"output": "290852"
},
{
"input": "2\n-1000 -1000\n-1000 0",
"output": "-1"
},
{
"input": "2\n-1000 -1000\n0 -1000",
"output": "-1"
},
{
"input": "4\n-414 -891\n-414 896\n346 -891\n346 896",
"output": "1358120"
},
{
"input": "2\n56 31\n704 -121",
"output": "98496"
},
{
"input": "4\n-152 198\n-152 366\n458 198\n458 366",
"output": "102480"
},
{
"input": "3\n-890 778\n-418 296\n-890 296",
"output": "227504"
},
{
"input": "4\n852 -184\n852 724\n970 -184\n970 724",
"output": "107144"
},
{
"input": "1\n858 -279",
"output": "-1"
},
{
"input": "2\n-823 358\n446 358",
"output": "-1"
},
{
"input": "2\n-739 -724\n-739 443",
"output": "-1"
},
{
"input": "2\n686 664\n686 -590",
"output": "-1"
},
{
"input": "3\n-679 301\n240 -23\n-679 -23",
"output": "297756"
},
{
"input": "2\n-259 -978\n978 -978",
"output": "-1"
},
{
"input": "1\n627 -250",
"output": "-1"
},
{
"input": "3\n-281 598\n679 -990\n-281 -990",
"output": "1524480"
},
{
"input": "2\n-414 -431\n-377 -688",
"output": "9509"
},
{
"input": "3\n-406 566\n428 426\n-406 426",
"output": "116760"
},
{
"input": "3\n-686 695\n-547 308\n-686 308",
"output": "53793"
},
{
"input": "1\n-164 -730",
"output": "-1"
},
{
"input": "2\n980 -230\n980 592",
"output": "-1"
},
{
"input": "4\n-925 306\n-925 602\n398 306\n398 602",
"output": "391608"
},
{
"input": "3\n576 -659\n917 -739\n576 -739",
"output": "27280"
},
{
"input": "1\n720 -200",
"output": "-1"
},
{
"input": "4\n-796 -330\n-796 758\n171 -330\n171 758",
"output": "1052096"
},
{
"input": "2\n541 611\n-26 611",
"output": "-1"
},
{
"input": "3\n-487 838\n134 691\n-487 691",
"output": "91287"
},
{
"input": "2\n-862 -181\n-525 -181",
"output": "-1"
},
{
"input": "1\n-717 916",
"output": "-1"
},
{
"input": "1\n-841 -121",
"output": "-1"
},
{
"input": "4\n259 153\n259 999\n266 153\n266 999",
"output": "5922"
},
{
"input": "2\n295 710\n295 254",
"output": "-1"
},
{
"input": "4\n137 -184\n137 700\n712 -184\n712 700",
"output": "508300"
},
{
"input": "2\n157 994\n377 136",
"output": "188760"
},
{
"input": "1\n193 304",
"output": "-1"
},
{
"input": "4\n5 -952\n5 292\n553 -952\n553 292",
"output": "681712"
},
{
"input": "2\n-748 697\n671 575",
"output": "173118"
},
{
"input": "2\n-457 82\n260 -662",
"output": "533448"
},
{
"input": "2\n-761 907\n967 907",
"output": "-1"
},
{
"input": "3\n-639 51\n-321 -539\n-639 -539",
"output": "187620"
},
{
"input": "2\n-480 51\n89 -763",
"output": "463166"
},
{
"input": "4\n459 -440\n459 -94\n872 -440\n872 -94",
"output": "142898"
},
{
"input": "2\n380 -849\n68 -849",
"output": "-1"
},
{
"input": "2\n-257 715\n102 715",
"output": "-1"
},
{
"input": "2\n247 -457\n434 -921",
"output": "86768"
},
{
"input": "4\n-474 -894\n-474 -833\n-446 -894\n-446 -833",
"output": "1708"
},
{
"input": "3\n-318 831\n450 31\n-318 31",
"output": "614400"
},
{
"input": "3\n-282 584\n696 488\n-282 488",
"output": "93888"
},
{
"input": "3\n258 937\n395 856\n258 856",
"output": "11097"
},
{
"input": "1\n-271 -499",
"output": "-1"
},
{
"input": "2\n-612 208\n326 -559",
"output": "719446"
},
{
"input": "2\n115 730\n562 -546",
"output": "570372"
},
{
"input": "2\n-386 95\n-386 750",
"output": "-1"
},
{
"input": "3\n0 0\n0 1\n1 0",
"output": "1"
},
{
"input": "3\n0 4\n3 4\n3 1",
"output": "9"
},
{
"input": "3\n1 1\n1 2\n2 1",
"output": "1"
},
{
"input": "3\n1 4\n4 4\n4 1",
"output": "9"
},
{
"input": "3\n1 1\n2 1\n1 2",
"output": "1"
},
{
"input": "3\n0 0\n1 0\n1 1",
"output": "1"
},
{
"input": "3\n0 0\n0 5\n5 0",
"output": "25"
},
{
"input": "3\n0 0\n0 1\n1 1",
"output": "1"
},
{
"input": "4\n0 0\n1 0\n1 1\n0 1",
"output": "1"
},
{
"input": "3\n4 4\n1 4\n4 1",
"output": "9"
},
{
"input": "3\n0 0\n2 0\n2 1",
"output": "2"
},
{
"input": "3\n0 0\n2 0\n0 2",
"output": "4"
},
{
"input": "3\n0 0\n0 1\n5 0",
"output": "5"
},
{
"input": "3\n1 1\n1 3\n3 1",
"output": "4"
},
{
"input": "4\n0 0\n1 0\n0 1\n1 1",
"output": "1"
},
{
"input": "2\n1 0\n2 1",
"output": "1"
},
{
"input": "3\n0 0\n1 0\n0 1",
"output": "1"
},
{
"input": "3\n1 0\n0 0\n0 1",
"output": "1"
},
{
"input": "3\n0 0\n0 5\n5 5",
"output": "25"
},
{
"input": "3\n1 0\n5 0\n5 10",
"output": "40"
},
{
"input": "3\n0 0\n1 0\n1 2",
"output": "2"
},
{
"input": "4\n0 1\n0 0\n1 0\n1 1",
"output": "1"
},
{
"input": "3\n0 0\n2 0\n0 1",
"output": "2"
},
{
"input": "3\n-2 -1\n-1 -1\n-1 -2",
"output": "1"
},
{
"input": "2\n1 0\n0 1",
"output": "1"
},
{
"input": "4\n1 1\n3 3\n3 1\n1 3",
"output": "4"
},
{
"input": "3\n2 1\n1 2\n2 2",
"output": "1"
},
{
"input": "3\n0 0\n0 3\n3 0",
"output": "9"
},
{
"input": "2\n0 3\n3 3",
"output": "-1"
},
{
"input": "4\n2 0\n2 8\n5 8\n5 0",
"output": "24"
},
{
"input": "2\n0 999\n100 250",
"output": "74900"
},
{
"input": "3\n1 1\n1 5\n5 1",
"output": "16"
},
{
"input": "3\n0 1\n0 0\n1 1",
"output": "1"
},
{
"input": "3\n0 0\n10 0\n0 10",
"output": "100"
},
{
"input": "2\n0 0\n-1 -1",
"output": "1"
},
{
"input": "3\n1 5\n2 2\n2 5",
"output": "3"
},
{
"input": "3\n0 0\n0 1\n2 0",
"output": "2"
},
{
"input": "3\n0 1\n1 0\n0 0",
"output": "1"
},
{
"input": "3\n0 0\n0 -1\n1 -1",
"output": "1"
},
{
"input": "3\n0 1\n1 0\n1 1",
"output": "1"
},
{
"input": "3\n3 5\n3 2\n7 2",
"output": "12"
},
{
"input": "3\n1 2\n1 3\n2 2",
"output": "1"
},
{
"input": "3\n5 0\n0 0\n0 5",
"output": "25"
},
{
"input": "3\n1 0\n1 3\n5 0",
"output": "12"
},
{
"input": "3\n0 0\n0 2\n2 0",
"output": "4"
},
{
"input": "3\n1 1\n0 0\n1 0",
"output": "1"
},
{
"input": "3\n1 2\n1 3\n2 3",
"output": "1"
},
{
"input": "4\n0 0\n0 1\n1 1\n1 0",
"output": "1"
},
{
"input": "2\n-3 0\n3 3",
"output": "18"
},
{
"input": "3\n1 1\n0 1\n1 0",
"output": "1"
},
{
"input": "3\n0 0\n5 0\n5 5",
"output": "25"
},
{
"input": "3\n79 79\n79 158\n158 79",
"output": "6241"
},
{
"input": "3\n1 0\n1 -1\n0 0",
"output": "1"
},
{
"input": "3\n1 1\n1 2\n2 2",
"output": "1"
},
{
"input": "3\n0 1\n0 0\n1 0",
"output": "1"
},
{
"input": "3\n2 1\n2 4\n6 1",
"output": "12"
},
{
"input": "3\n5 0\n0 0\n5 5",
"output": "25"
}
] | 1,615,000,736
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 46
| 307,200
|
def solve():
n = int(input())
pairs = []
for _ in range(n):
pairs.append(tuple(map(int, input().split())))
pairs.sort()
left = min(pairs, key=lambda x: x[0])[0]
right = max(pairs, key=lambda x: x[0])[0]
top = max(pairs, key=lambda x: x[1])[1]
bot = min(pairs, key=lambda x: x[1])[1]
area = (right - left) * (top - bot)
if area == 0:
print(area)
else:
print(area)
solve()
|
Title: Wilbur and Swimming Pool
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After making bad dives into swimming pools, Wilbur wants to build a swimming pool in the shape of a rectangle in his backyard. He has set up coordinate axes, and he wants the sides of the rectangle to be parallel to them. Of course, the area of the rectangle must be positive. Wilbur had all four vertices of the planned pool written on a paper, until his friend came along and erased some of the vertices.
Now Wilbur is wondering, if the remaining *n* vertices of the initial rectangle give enough information to restore the area of the planned swimming pool.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=4) — the number of vertices that were not erased by Wilbur's friend.
Each of the following *n* lines contains two integers *x**i* and *y**i* (<=-<=1000<=≤<=*x**i*,<=*y**i*<=≤<=1000) —the coordinates of the *i*-th vertex that remains. Vertices are given in an arbitrary order.
It's guaranteed that these points are distinct vertices of some rectangle, that has positive area and which sides are parallel to the coordinate axes.
Output Specification:
Print the area of the initial rectangle if it could be uniquely determined by the points remaining. Otherwise, print <=-<=1.
Demo Input:
['2\n0 0\n1 1\n', '1\n1 1\n']
Demo Output:
['1\n', '-1\n']
Note:
In the first sample, two opposite corners of the initial rectangle are given, and that gives enough information to say that the rectangle is actually a unit square.
In the second sample there is only one vertex left and this is definitely not enough to uniquely define the area.
|
```python
def solve():
n = int(input())
pairs = []
for _ in range(n):
pairs.append(tuple(map(int, input().split())))
pairs.sort()
left = min(pairs, key=lambda x: x[0])[0]
right = max(pairs, key=lambda x: x[0])[0]
top = max(pairs, key=lambda x: x[1])[1]
bot = min(pairs, key=lambda x: x[1])[1]
area = (right - left) * (top - bot)
if area == 0:
print(area)
else:
print(area)
solve()
```
| 0
|
|
1,004
|
B
|
Sonya and Exhibition
|
PROGRAMMING
| 1,300
|
[
"constructive algorithms",
"greedy",
"implementation",
"math"
] | null | null |
Sonya decided to organize an exhibition of flowers. Since the girl likes only roses and lilies, she decided that only these two kinds of flowers should be in this exhibition.
There are $n$ flowers in a row in the exhibition. Sonya can put either a rose or a lily in the $i$-th position. Thus each of $n$ positions should contain exactly one flower: a rose or a lily.
She knows that exactly $m$ people will visit this exhibition. The $i$-th visitor will visit all flowers from $l_i$ to $r_i$ inclusive. The girl knows that each segment has its own beauty that is equal to the product of the number of roses and the number of lilies.
Sonya wants her exhibition to be liked by a lot of people. That is why she wants to put the flowers in such way that the sum of beauties of all segments would be maximum possible.
|
The first line contains two integers $n$ and $m$ ($1\leq n, m\leq 10^3$) — the number of flowers and visitors respectively.
Each of the next $m$ lines contains two integers $l_i$ and $r_i$ ($1\leq l_i\leq r_i\leq n$), meaning that $i$-th visitor will visit all flowers from $l_i$ to $r_i$ inclusive.
|
Print the string of $n$ characters. The $i$-th symbol should be «0» if you want to put a rose in the $i$-th position, otherwise «1» if you want to put a lily.
If there are multiple answers, print any.
|
[
"5 3\n1 3\n2 4\n2 5\n",
"6 3\n5 6\n1 4\n4 6\n"
] |
[
"01100",
"110010"
] |
In the first example, Sonya can put roses in the first, fourth, and fifth positions, and lilies in the second and third positions;
- in the segment $[1\ldots3]$, there are one rose and two lilies, so the beauty is equal to $1\cdot 2=2$; - in the segment $[2\ldots4]$, there are one rose and two lilies, so the beauty is equal to $1\cdot 2=2$; - in the segment $[2\ldots5]$, there are two roses and two lilies, so the beauty is equal to $2\cdot 2=4$.
The total beauty is equal to $2+2+4=8$.
In the second example, Sonya can put roses in the third, fourth, and sixth positions, and lilies in the first, second, and fifth positions;
- in the segment $[5\ldots6]$, there are one rose and one lily, so the beauty is equal to $1\cdot 1=1$; - in the segment $[1\ldots4]$, there are two roses and two lilies, so the beauty is equal to $2\cdot 2=4$; - in the segment $[4\ldots6]$, there are two roses and one lily, so the beauty is equal to $2\cdot 1=2$.
The total beauty is equal to $1+4+2=7$.
| 1,000
|
[
{
"input": "5 3\n1 3\n2 4\n2 5",
"output": "01010"
},
{
"input": "6 3\n5 6\n1 4\n4 6",
"output": "010101"
},
{
"input": "10 4\n3 3\n1 6\n9 9\n10 10",
"output": "0101010101"
},
{
"input": "1 1\n1 1",
"output": "0"
},
{
"input": "1000 10\n3 998\n2 1000\n1 999\n2 1000\n3 998\n2 1000\n3 998\n1 1000\n2 1000\n3 999",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "1000 20\n50 109\n317 370\n710 770\n440 488\n711 757\n236 278\n314 355\n131 190\n115 162\n784 834\n16 56\n677 730\n802 844\n632 689\n23 74\n647 702\n930 986\n926 983\n769 822\n508 558",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "1000 10\n138 238\n160 260\n716 816\n504 604\n98 198\n26 126\n114 214\n217 317\n121 221\n489 589",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "1000 5\n167 296\n613 753\n650 769\n298 439\n71 209",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "1000 5\n349 415\n714 773\n125 179\n1 80\n148 242",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "914 10\n587 646\n770 843\n825 875\n439 485\n465 521\n330 387\n405 480\n477 521\n336 376\n715 771",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "571 10\n13 94\n450 510\n230 293\n302 375\n304 354\n421 504\n24 87\n122 181\n221 296\n257 307",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "6 2\n1 6\n1 4",
"output": "010101"
},
{
"input": "2 1\n1 2",
"output": "01"
}
] | 1,530,815,451
| 6,951
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 0
| 93
| 0
|
n, m = [int(i) for i in input().split()]
a = [0] * (n + 1)
for i in range(m):
p, q = [int(i) for i in input().split()]
cnt = 0
for i in range(p, q + 1):
cnt += a[i]
if cnt > 0:
if a[p] == 0 and a[q] == 0:
a[p] = -1
a[q] = -1
if cnt < 0:
if a[p] == 0 and a[q] == 0:
a[p] = 1
a[q] = 1
else:
if a[p] == 0 and a[q] == 0:
a[p] = 1
a[q] = -1
t = 1
for value in range(1, n + 1):
if a[value] == 0 and t == 1:
print('1', end='')
t = 0
continue
if a[value] == 0 and t == 0:
print('0', end='')
t = 1
if a[value] == 1:
print('1', end='')
elif a[value] == -1:
print('0', end='')
|
Title: Sonya and Exhibition
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sonya decided to organize an exhibition of flowers. Since the girl likes only roses and lilies, she decided that only these two kinds of flowers should be in this exhibition.
There are $n$ flowers in a row in the exhibition. Sonya can put either a rose or a lily in the $i$-th position. Thus each of $n$ positions should contain exactly one flower: a rose or a lily.
She knows that exactly $m$ people will visit this exhibition. The $i$-th visitor will visit all flowers from $l_i$ to $r_i$ inclusive. The girl knows that each segment has its own beauty that is equal to the product of the number of roses and the number of lilies.
Sonya wants her exhibition to be liked by a lot of people. That is why she wants to put the flowers in such way that the sum of beauties of all segments would be maximum possible.
Input Specification:
The first line contains two integers $n$ and $m$ ($1\leq n, m\leq 10^3$) — the number of flowers and visitors respectively.
Each of the next $m$ lines contains two integers $l_i$ and $r_i$ ($1\leq l_i\leq r_i\leq n$), meaning that $i$-th visitor will visit all flowers from $l_i$ to $r_i$ inclusive.
Output Specification:
Print the string of $n$ characters. The $i$-th symbol should be «0» if you want to put a rose in the $i$-th position, otherwise «1» if you want to put a lily.
If there are multiple answers, print any.
Demo Input:
['5 3\n1 3\n2 4\n2 5\n', '6 3\n5 6\n1 4\n4 6\n']
Demo Output:
['01100', '110010']
Note:
In the first example, Sonya can put roses in the first, fourth, and fifth positions, and lilies in the second and third positions;
- in the segment $[1\ldots3]$, there are one rose and two lilies, so the beauty is equal to $1\cdot 2=2$; - in the segment $[2\ldots4]$, there are one rose and two lilies, so the beauty is equal to $1\cdot 2=2$; - in the segment $[2\ldots5]$, there are two roses and two lilies, so the beauty is equal to $2\cdot 2=4$.
The total beauty is equal to $2+2+4=8$.
In the second example, Sonya can put roses in the third, fourth, and sixth positions, and lilies in the first, second, and fifth positions;
- in the segment $[5\ldots6]$, there are one rose and one lily, so the beauty is equal to $1\cdot 1=1$; - in the segment $[1\ldots4]$, there are two roses and two lilies, so the beauty is equal to $2\cdot 2=4$; - in the segment $[4\ldots6]$, there are two roses and one lily, so the beauty is equal to $2\cdot 1=2$.
The total beauty is equal to $1+4+2=7$.
|
```python
n, m = [int(i) for i in input().split()]
a = [0] * (n + 1)
for i in range(m):
p, q = [int(i) for i in input().split()]
cnt = 0
for i in range(p, q + 1):
cnt += a[i]
if cnt > 0:
if a[p] == 0 and a[q] == 0:
a[p] = -1
a[q] = -1
if cnt < 0:
if a[p] == 0 and a[q] == 0:
a[p] = 1
a[q] = 1
else:
if a[p] == 0 and a[q] == 0:
a[p] = 1
a[q] = -1
t = 1
for value in range(1, n + 1):
if a[value] == 0 and t == 1:
print('1', end='')
t = 0
continue
if a[value] == 0 and t == 0:
print('0', end='')
t = 1
if a[value] == 1:
print('1', end='')
elif a[value] == -1:
print('0', end='')
```
| 0
|
|
876
|
A
|
Trip For Meal
|
PROGRAMMING
| 900
|
[
"math"
] | null | null |
Winnie-the-Pooh likes honey very much! That is why he decided to visit his friends. Winnie has got three best friends: Rabbit, Owl and Eeyore, each of them lives in his own house. There are winding paths between each pair of houses. The length of a path between Rabbit's and Owl's houses is *a* meters, between Rabbit's and Eeyore's house is *b* meters, between Owl's and Eeyore's house is *c* meters.
For enjoying his life and singing merry songs Winnie-the-Pooh should have a meal *n* times a day. Now he is in the Rabbit's house and has a meal for the first time. Each time when in the friend's house where Winnie is now the supply of honey is about to end, Winnie leaves that house. If Winnie has not had a meal the required amount of times, he comes out from the house and goes to someone else of his two friends. For this he chooses one of two adjacent paths, arrives to the house on the other end and visits his friend. You may assume that when Winnie is eating in one of his friend's house, the supply of honey in other friend's houses recover (most probably, they go to the supply store).
Winnie-the-Pooh does not like physical activity. He wants to have a meal *n* times, traveling minimum possible distance. Help him to find this distance.
|
First line contains an integer *n* (1<=≤<=*n*<=≤<=100) — number of visits.
Second line contains an integer *a* (1<=≤<=*a*<=≤<=100) — distance between Rabbit's and Owl's houses.
Third line contains an integer *b* (1<=≤<=*b*<=≤<=100) — distance between Rabbit's and Eeyore's houses.
Fourth line contains an integer *c* (1<=≤<=*c*<=≤<=100) — distance between Owl's and Eeyore's houses.
|
Output one number — minimum distance in meters Winnie must go through to have a meal *n* times.
|
[
"3\n2\n3\n1\n",
"1\n2\n3\n5\n"
] |
[
"3\n",
"0\n"
] |
In the first test case the optimal path for Winnie is the following: first have a meal in Rabbit's house, then in Owl's house, then in Eeyore's house. Thus he will pass the distance 2 + 1 = 3.
In the second test case Winnie has a meal in Rabbit's house and that is for him. So he doesn't have to walk anywhere at all.
| 500
|
[
{
"input": "3\n2\n3\n1",
"output": "3"
},
{
"input": "1\n2\n3\n5",
"output": "0"
},
{
"input": "10\n1\n8\n3",
"output": "9"
},
{
"input": "7\n10\n5\n6",
"output": "30"
},
{
"input": "9\n9\n7\n5",
"output": "42"
},
{
"input": "9\n37\n85\n76",
"output": "296"
},
{
"input": "76\n46\n77\n11",
"output": "860"
},
{
"input": "80\n42\n1\n37",
"output": "79"
},
{
"input": "8\n80\n55\n1",
"output": "61"
},
{
"input": "10\n13\n72\n17",
"output": "117"
},
{
"input": "9\n24\n1\n63",
"output": "8"
},
{
"input": "65\n5\n8\n7",
"output": "320"
},
{
"input": "56\n8\n9\n3",
"output": "170"
},
{
"input": "59\n8\n1\n2",
"output": "58"
},
{
"input": "75\n50\n50\n5",
"output": "415"
},
{
"input": "75\n54\n76\n66",
"output": "3996"
},
{
"input": "73\n71\n69\n66",
"output": "4755"
},
{
"input": "83\n58\n88\n16",
"output": "1354"
},
{
"input": "74\n31\n11\n79",
"output": "803"
},
{
"input": "62\n27\n16\n72",
"output": "976"
},
{
"input": "72\n95\n27\n9",
"output": "657"
},
{
"input": "1\n2\n2\n1",
"output": "0"
},
{
"input": "1\n1\n1\n1",
"output": "0"
},
{
"input": "1\n1\n1\n99",
"output": "0"
},
{
"input": "100\n100\n100\n100",
"output": "9900"
},
{
"input": "2\n1\n1\n3",
"output": "1"
},
{
"input": "1\n3\n2\n1",
"output": "0"
},
{
"input": "1\n5\n6\n1",
"output": "0"
},
{
"input": "1\n2\n6\n1",
"output": "0"
},
{
"input": "1\n30\n20\n1",
"output": "0"
},
{
"input": "1\n15\n13\n11",
"output": "0"
},
{
"input": "1\n100\n50\n1",
"output": "0"
},
{
"input": "1\n2\n3\n1",
"output": "0"
},
{
"input": "5\n5\n5\n5",
"output": "20"
},
{
"input": "1\n100\n50\n5",
"output": "0"
},
{
"input": "1\n5\n7\n3",
"output": "0"
},
{
"input": "1\n3\n4\n2",
"output": "0"
},
{
"input": "3\n3\n3\n3",
"output": "6"
},
{
"input": "1\n99\n98\n1",
"output": "0"
},
{
"input": "5\n3\n3\n1",
"output": "6"
},
{
"input": "2\n1\n1\n1",
"output": "1"
},
{
"input": "2\n1\n7\n8",
"output": "1"
},
{
"input": "2\n2\n2\n1",
"output": "2"
},
{
"input": "2\n2\n3\n1",
"output": "2"
},
{
"input": "1\n5\n6\n2",
"output": "0"
},
{
"input": "100\n1\n1\n100",
"output": "99"
},
{
"input": "2\n3\n2\n1",
"output": "2"
},
{
"input": "1\n99\n98\n97",
"output": "0"
}
] | 1,508,265,360
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 21
| 62
| 5,529,600
|
n=int(input())
a=int(input())
b=int(input())
c=int(input())
if (a==min(a,b,c) or b==min(a,b,c)):
print((n-1)*min(a,b,c))
else:
print(min(a,b)+(n-2)*min(a,b,c))
|
Title: Trip For Meal
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Winnie-the-Pooh likes honey very much! That is why he decided to visit his friends. Winnie has got three best friends: Rabbit, Owl and Eeyore, each of them lives in his own house. There are winding paths between each pair of houses. The length of a path between Rabbit's and Owl's houses is *a* meters, between Rabbit's and Eeyore's house is *b* meters, between Owl's and Eeyore's house is *c* meters.
For enjoying his life and singing merry songs Winnie-the-Pooh should have a meal *n* times a day. Now he is in the Rabbit's house and has a meal for the first time. Each time when in the friend's house where Winnie is now the supply of honey is about to end, Winnie leaves that house. If Winnie has not had a meal the required amount of times, he comes out from the house and goes to someone else of his two friends. For this he chooses one of two adjacent paths, arrives to the house on the other end and visits his friend. You may assume that when Winnie is eating in one of his friend's house, the supply of honey in other friend's houses recover (most probably, they go to the supply store).
Winnie-the-Pooh does not like physical activity. He wants to have a meal *n* times, traveling minimum possible distance. Help him to find this distance.
Input Specification:
First line contains an integer *n* (1<=≤<=*n*<=≤<=100) — number of visits.
Second line contains an integer *a* (1<=≤<=*a*<=≤<=100) — distance between Rabbit's and Owl's houses.
Third line contains an integer *b* (1<=≤<=*b*<=≤<=100) — distance between Rabbit's and Eeyore's houses.
Fourth line contains an integer *c* (1<=≤<=*c*<=≤<=100) — distance between Owl's and Eeyore's houses.
Output Specification:
Output one number — minimum distance in meters Winnie must go through to have a meal *n* times.
Demo Input:
['3\n2\n3\n1\n', '1\n2\n3\n5\n']
Demo Output:
['3\n', '0\n']
Note:
In the first test case the optimal path for Winnie is the following: first have a meal in Rabbit's house, then in Owl's house, then in Eeyore's house. Thus he will pass the distance 2 + 1 = 3.
In the second test case Winnie has a meal in Rabbit's house and that is for him. So he doesn't have to walk anywhere at all.
|
```python
n=int(input())
a=int(input())
b=int(input())
c=int(input())
if (a==min(a,b,c) or b==min(a,b,c)):
print((n-1)*min(a,b,c))
else:
print(min(a,b)+(n-2)*min(a,b,c))
```
| 0
|
|
796
|
A
|
Buying A House
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
Zane the wizard had never loved anyone before, until he fell in love with a girl, whose name remains unknown to us.
The girl lives in house *m* of a village. There are *n* houses in that village, lining in a straight line from left to right: house 1, house 2, ..., house *n*. The village is also well-structured: house *i* and house *i*<=+<=1 (1<=≤<=*i*<=<<=*n*) are exactly 10 meters away. In this village, some houses are occupied, and some are not. Indeed, unoccupied houses can be purchased.
You will be given *n* integers *a*1,<=*a*2,<=...,<=*a**n* that denote the availability and the prices of the houses. If house *i* is occupied, and therefore cannot be bought, then *a**i* equals 0. Otherwise, house *i* can be bought, and *a**i* represents the money required to buy it, in dollars.
As Zane has only *k* dollars to spare, it becomes a challenge for him to choose the house to purchase, so that he could live as near as possible to his crush. Help Zane determine the minimum distance from his crush's house to some house he can afford, to help him succeed in his love.
|
The first line contains three integers *n*, *m*, and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*m*<=≤<=*n*, 1<=≤<=*k*<=≤<=100) — the number of houses in the village, the house where the girl lives, and the amount of money Zane has (in dollars), respectively.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=100) — denoting the availability and the prices of the houses.
It is guaranteed that *a**m*<==<=0 and that it is possible to purchase some house with no more than *k* dollars.
|
Print one integer — the minimum distance, in meters, from the house where the girl Zane likes lives to the house Zane can buy.
|
[
"5 1 20\n0 27 32 21 19\n",
"7 3 50\n62 0 0 0 99 33 22\n",
"10 5 100\n1 0 1 0 0 0 0 0 1 1\n"
] |
[
"40",
"30",
"20"
] |
In the first sample, with *k* = 20 dollars, Zane can buy only house 5. The distance from house *m* = 1 to house 5 is 10 + 10 + 10 + 10 = 40 meters.
In the second sample, Zane can buy houses 6 and 7. It is better to buy house 6 than house 7, since house *m* = 3 and house 6 are only 30 meters away, while house *m* = 3 and house 7 are 40 meters away.
| 500
|
[
{
"input": "5 1 20\n0 27 32 21 19",
"output": "40"
},
{
"input": "7 3 50\n62 0 0 0 99 33 22",
"output": "30"
},
{
"input": "10 5 100\n1 0 1 0 0 0 0 0 1 1",
"output": "20"
},
{
"input": "5 3 1\n1 1 0 0 1",
"output": "10"
},
{
"input": "5 5 5\n1 0 5 6 0",
"output": "20"
},
{
"input": "15 10 50\n20 0 49 50 50 50 50 50 50 0 50 50 49 0 20",
"output": "10"
},
{
"input": "7 5 1\n0 100 2 2 0 2 1",
"output": "20"
},
{
"input": "100 50 100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 0 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "10"
},
{
"input": "100 50 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 0 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "490"
},
{
"input": "100 77 50\n50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 0 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0",
"output": "10"
},
{
"input": "100 1 1\n0 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0",
"output": "980"
},
{
"input": "100 1 100\n0 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "10"
},
{
"input": "100 10 99\n0 0 0 0 0 0 0 0 0 0 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99 98",
"output": "890"
},
{
"input": "7 4 5\n1 0 6 0 5 6 0",
"output": "10"
},
{
"input": "7 4 5\n1 6 5 0 0 6 0",
"output": "10"
},
{
"input": "100 42 59\n50 50 50 50 50 50 50 50 50 50 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 60 60 60 60 60 60 60 60 0 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 0",
"output": "90"
},
{
"input": "2 1 100\n0 1",
"output": "10"
},
{
"input": "2 2 100\n1 0",
"output": "10"
},
{
"input": "10 1 88\n0 95 0 0 0 0 0 94 0 85",
"output": "90"
},
{
"input": "10 2 14\n2 0 1 26 77 39 41 100 13 32",
"output": "10"
},
{
"input": "10 3 11\n0 0 0 0 0 62 0 52 1 35",
"output": "60"
},
{
"input": "20 12 44\n27 40 58 69 53 38 31 39 75 95 8 0 28 81 77 90 38 61 21 88",
"output": "10"
},
{
"input": "30 29 10\n59 79 34 12 100 6 1 58 18 73 54 11 37 46 89 90 80 85 73 45 64 5 31 0 89 19 0 74 0 82",
"output": "70"
},
{
"input": "40 22 1\n7 95 44 53 0 0 19 93 0 68 65 0 24 91 10 58 17 0 71 0 100 0 94 90 79 73 0 73 4 61 54 81 7 13 21 84 5 41 0 1",
"output": "180"
},
{
"input": "40 22 99\n60 0 100 0 0 100 100 0 0 0 0 100 100 0 0 100 100 0 100 100 100 0 100 100 100 0 100 100 0 0 100 100 100 0 0 100 0 100 0 0",
"output": "210"
},
{
"input": "50 10 82\n56 54 0 0 0 0 88 93 0 0 83 93 0 0 91 89 0 30 62 52 24 84 80 8 38 13 92 78 16 87 23 30 71 55 16 63 15 99 4 93 24 6 3 35 4 42 73 27 86 37",
"output": "80"
},
{
"input": "63 49 22\n18 3 97 52 75 2 12 24 58 75 80 97 22 10 79 51 30 60 68 99 75 2 35 3 97 88 9 7 18 5 0 0 0 91 0 91 56 36 76 0 0 0 52 27 35 0 51 72 0 96 57 0 0 0 0 92 55 28 0 30 0 78 77",
"output": "190"
},
{
"input": "74 38 51\n53 36 55 42 64 5 87 9 0 16 86 78 9 22 19 1 25 72 1 0 0 0 79 0 0 0 77 58 70 0 0 100 64 0 99 59 0 0 0 0 65 74 0 96 0 58 89 93 61 88 0 0 82 89 0 0 49 24 7 77 89 87 94 61 100 31 93 70 39 49 39 14 20 84",
"output": "190"
},
{
"input": "89 22 11\n36 0 68 89 0 85 72 0 38 56 0 44 0 94 0 28 71 0 0 18 0 0 0 89 0 0 0 75 0 0 0 32 66 0 0 0 0 0 0 48 63 0 64 58 0 23 48 0 0 52 93 61 57 0 18 0 0 34 62 17 0 41 0 0 53 59 44 0 0 51 40 0 0 100 100 54 0 88 0 5 45 56 57 67 24 16 88 86 15",
"output": "580"
},
{
"input": "97 44 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 51 19",
"output": "520"
},
{
"input": "100 1 1\n0 0 0 0 10 54 84 6 17 94 65 82 34 0 61 46 42 0 2 16 56 0 100 0 82 0 0 0 89 78 96 56 0 0 0 0 0 0 0 0 77 70 0 96 67 0 0 32 44 1 72 50 14 11 24 61 100 64 19 5 67 69 44 82 93 22 67 93 22 61 53 64 79 41 84 48 43 97 7 24 8 49 23 16 72 52 97 29 69 47 29 49 64 91 4 73 17 18 51 67",
"output": "490"
},
{
"input": "100 1 50\n0 0 0 60 0 0 54 0 80 0 0 0 97 0 68 97 84 0 0 93 0 0 0 0 68 0 0 62 0 0 55 68 65 87 0 69 0 0 0 0 0 52 61 100 0 71 0 82 88 78 0 81 0 95 0 57 0 67 0 0 0 55 86 0 60 72 0 0 73 0 83 0 0 60 64 0 56 0 0 77 84 0 58 63 84 0 0 67 0 16 3 88 0 98 31 52 40 35 85 23",
"output": "890"
},
{
"input": "100 1 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 91 70 14",
"output": "970"
},
{
"input": "100 1 29\n0 0 0 0 64 0 89 97 0 0 0 59 0 67 62 0 59 0 0 80 0 0 0 0 0 97 0 57 0 64 32 0 44 0 0 48 0 47 38 0 42 0 0 0 0 0 0 46 74 0 86 33 33 0 44 0 79 0 0 0 0 91 59 0 59 65 55 0 0 58 33 95 0 97 76 0 81 0 41 0 38 81 80 0 85 0 31 0 0 92 0 0 45 96 0 85 91 87 0 10",
"output": "990"
},
{
"input": "100 50 20\n3 0 32 0 48 32 64 0 54 26 0 0 0 0 0 28 0 0 54 0 0 45 49 0 38 74 0 0 39 42 62 48 75 96 89 42 0 44 0 0 30 21 76 0 50 0 79 0 0 0 0 99 0 84 62 0 0 0 0 53 80 0 28 0 0 53 0 0 38 0 62 0 0 62 0 0 88 0 44 32 0 81 35 45 49 0 69 73 38 27 72 0 96 72 69 0 0 22 76 10",
"output": "490"
},
{
"input": "100 50 20\n49 0 56 0 87 25 40 0 50 0 0 97 0 0 36 29 0 0 0 0 0 73 29 71 44 0 0 0 91 92 69 0 0 60 81 49 48 38 0 87 0 82 0 32 0 82 46 39 0 0 29 0 0 29 0 79 47 0 0 0 0 0 49 0 24 33 70 0 63 45 97 90 0 0 29 53 55 0 84 0 0 100 26 0 88 0 0 0 0 81 70 0 30 80 0 75 59 98 0 2",
"output": "500"
},
{
"input": "100 2 2\n0 0 43 90 47 5 2 97 52 69 21 48 64 10 34 97 97 74 8 19 68 56 55 24 47 38 43 73 72 72 60 60 51 36 33 44 100 45 13 54 72 52 0 15 3 6 50 8 88 4 78 26 40 27 30 63 67 83 61 91 33 97 54 20 92 27 89 35 10 7 84 50 11 95 74 88 24 44 74 100 18 56 34 91 41 34 51 51 11 91 89 54 19 100 83 89 10 17 76 20",
"output": "50"
},
{
"input": "100 100 34\n5 73 0 0 44 0 0 0 79 55 0 0 0 0 0 0 0 0 83 67 75 0 0 0 0 59 0 74 0 0 47 98 0 0 72 41 0 55 87 0 0 78 84 0 0 39 0 79 72 95 0 0 0 0 0 85 53 84 0 0 0 0 37 75 0 66 0 0 0 0 61 0 70 0 37 60 42 78 92 52 0 0 0 55 77 57 0 63 37 0 0 0 96 70 0 94 97 0 0 0",
"output": "990"
},
{
"input": "100 100 100\n43 79 21 87 84 14 28 69 92 16 3 71 79 37 48 37 72 58 12 72 62 49 37 17 60 54 41 99 15 72 40 89 76 1 99 87 14 56 63 48 69 37 96 64 7 14 1 73 85 33 98 70 97 71 96 28 49 71 56 2 67 22 100 2 98 100 62 77 92 76 98 98 47 26 22 47 50 56 9 16 72 47 5 62 29 78 81 1 0 63 32 65 87 3 40 53 8 80 93 0",
"output": "10"
},
{
"input": "100 38 1\n3 59 12 81 33 95 0 41 36 17 63 76 42 77 85 56 3 96 55 41 24 87 18 9 0 37 0 61 69 0 0 0 67 0 0 0 0 0 0 18 0 0 47 56 74 0 0 80 0 42 0 1 60 59 62 9 19 87 92 48 58 30 98 51 99 10 42 94 51 53 50 89 24 5 52 82 50 39 98 8 95 4 57 21 10 0 44 32 19 14 64 34 79 76 17 3 15 22 71 51",
"output": "140"
},
{
"input": "100 72 1\n56 98 8 27 9 23 16 76 56 1 34 43 96 73 75 49 62 20 18 23 51 55 30 84 4 20 89 40 75 16 69 35 1 0 16 0 80 0 41 17 0 0 76 23 0 92 0 34 0 91 82 54 0 0 0 63 85 59 98 24 29 0 8 77 26 0 34 95 39 0 0 0 74 0 0 0 0 12 0 92 0 0 55 95 66 30 0 0 29 98 0 0 0 47 0 0 80 0 0 4",
"output": "390"
},
{
"input": "100 66 1\n38 50 64 91 37 44 74 21 14 41 80 90 26 51 78 85 80 86 44 14 49 75 93 48 78 89 23 72 35 22 14 48 100 71 62 22 7 95 80 66 32 20 17 47 79 30 41 52 15 62 67 71 1 6 0 9 0 0 0 11 0 0 24 0 31 0 77 0 51 0 0 0 0 0 0 77 0 36 44 19 90 45 6 25 100 87 93 30 4 97 36 88 33 50 26 71 97 71 51 68",
"output": "130"
},
{
"input": "100 55 1\n0 33 45 83 56 96 58 24 45 30 38 60 39 69 21 87 59 21 72 73 27 46 61 61 11 97 77 5 39 3 3 35 76 37 53 84 24 75 9 48 31 90 100 84 74 81 83 83 42 23 29 94 18 1 0 53 52 99 86 37 94 54 28 75 28 80 17 14 98 68 76 20 32 23 42 31 57 79 60 14 18 27 1 98 32 3 96 25 15 38 2 6 3 28 59 54 63 2 43 59",
"output": "10"
},
{
"input": "100 55 1\n24 52 41 6 55 11 58 25 63 12 70 39 23 28 72 17 96 85 7 84 21 13 34 37 97 43 36 32 15 30 58 5 14 71 40 70 9 92 44 73 31 58 96 90 19 35 29 91 25 36 48 95 61 78 0 1 99 61 81 88 42 53 61 57 42 55 74 45 41 92 99 30 20 25 89 50 37 4 17 24 6 65 15 44 40 2 38 43 7 90 38 59 75 87 96 28 12 67 24 32",
"output": "10"
},
{
"input": "100 21 1\n62 5 97 80 81 28 83 0 26 0 0 0 0 23 0 0 90 0 0 0 0 0 0 0 0 54 71 8 0 0 42 0 73 0 17 0 1 31 71 78 58 72 84 39 54 59 13 29 16 41 71 35 88 55 70 50 33 100 100 60 52 90 7 66 44 55 51 42 90 17 86 44 46 8 52 74 8 22 2 92 34 37 58 98 70 74 19 91 74 25 4 38 71 68 50 68 63 14 60 98",
"output": "160"
},
{
"input": "5 2 20\n27 0 32 21 19",
"output": "30"
},
{
"input": "6 4 10\n10 0 0 0 0 10",
"output": "20"
},
{
"input": "8 7 100\n1 0 0 0 0 0 0 1",
"output": "10"
},
{
"input": "5 3 20\n1 21 0 0 1",
"output": "20"
},
{
"input": "4 3 1\n0 0 0 1",
"output": "10"
},
{
"input": "5 2 3\n4 0 5 6 1",
"output": "30"
},
{
"input": "5 3 87\n88 89 0 1 90",
"output": "10"
},
{
"input": "5 3 20\n15 30 0 15 35",
"output": "10"
},
{
"input": "6 3 50\n0 0 0 1 2 0",
"output": "10"
},
{
"input": "6 4 9\n100 9 10 0 0 9",
"output": "20"
},
{
"input": "5 4 20\n0 20 0 0 20",
"output": "10"
},
{
"input": "6 3 3\n1 5 0 2 2 0",
"output": "10"
},
{
"input": "5 4 100\n0 1 0 0 1",
"output": "10"
}
] | 1,554,310,755
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 58
| 109
| 0
|
n,m,k=list(map(int,input().split(" ")))
a=list(map(int,input().split(" ")))
# print(n,k,m,a)
q=1000000000000
for i in range(1,n+1):
if(a[i-1]<=k and a[i-1]!=0):
distance=abs(m-i)
q=min(distance,q)
print(q*10)
|
Title: Buying A House
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Zane the wizard had never loved anyone before, until he fell in love with a girl, whose name remains unknown to us.
The girl lives in house *m* of a village. There are *n* houses in that village, lining in a straight line from left to right: house 1, house 2, ..., house *n*. The village is also well-structured: house *i* and house *i*<=+<=1 (1<=≤<=*i*<=<<=*n*) are exactly 10 meters away. In this village, some houses are occupied, and some are not. Indeed, unoccupied houses can be purchased.
You will be given *n* integers *a*1,<=*a*2,<=...,<=*a**n* that denote the availability and the prices of the houses. If house *i* is occupied, and therefore cannot be bought, then *a**i* equals 0. Otherwise, house *i* can be bought, and *a**i* represents the money required to buy it, in dollars.
As Zane has only *k* dollars to spare, it becomes a challenge for him to choose the house to purchase, so that he could live as near as possible to his crush. Help Zane determine the minimum distance from his crush's house to some house he can afford, to help him succeed in his love.
Input Specification:
The first line contains three integers *n*, *m*, and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*m*<=≤<=*n*, 1<=≤<=*k*<=≤<=100) — the number of houses in the village, the house where the girl lives, and the amount of money Zane has (in dollars), respectively.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=100) — denoting the availability and the prices of the houses.
It is guaranteed that *a**m*<==<=0 and that it is possible to purchase some house with no more than *k* dollars.
Output Specification:
Print one integer — the minimum distance, in meters, from the house where the girl Zane likes lives to the house Zane can buy.
Demo Input:
['5 1 20\n0 27 32 21 19\n', '7 3 50\n62 0 0 0 99 33 22\n', '10 5 100\n1 0 1 0 0 0 0 0 1 1\n']
Demo Output:
['40', '30', '20']
Note:
In the first sample, with *k* = 20 dollars, Zane can buy only house 5. The distance from house *m* = 1 to house 5 is 10 + 10 + 10 + 10 = 40 meters.
In the second sample, Zane can buy houses 6 and 7. It is better to buy house 6 than house 7, since house *m* = 3 and house 6 are only 30 meters away, while house *m* = 3 and house 7 are 40 meters away.
|
```python
n,m,k=list(map(int,input().split(" ")))
a=list(map(int,input().split(" ")))
# print(n,k,m,a)
q=1000000000000
for i in range(1,n+1):
if(a[i-1]<=k and a[i-1]!=0):
distance=abs(m-i)
q=min(distance,q)
print(q*10)
```
| 3
|
|
628
|
A
|
Tennis Tournament
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
A tennis tournament with *n* participants is running. The participants are playing by an olympic system, so the winners move on and the losers drop out.
The tournament takes place in the following way (below, *m* is the number of the participants of the current round):
- let *k* be the maximal power of the number 2 such that *k*<=≤<=*m*, - *k* participants compete in the current round and a half of them passes to the next round, the other *m*<=-<=*k* participants pass to the next round directly, - when only one participant remains, the tournament finishes.
Each match requires *b* bottles of water for each participant and one bottle for the judge. Besides *p* towels are given to each participant for the whole tournament.
Find the number of bottles and towels needed for the tournament.
Note that it's a tennis tournament so in each match two participants compete (one of them will win and the other will lose).
|
The only line contains three integers *n*,<=*b*,<=*p* (1<=≤<=*n*,<=*b*,<=*p*<=≤<=500) — the number of participants and the parameters described in the problem statement.
|
Print two integers *x* and *y* — the number of bottles and towels need for the tournament.
|
[
"5 2 3\n",
"8 2 4\n"
] |
[
"20 15\n",
"35 32\n"
] |
In the first example will be three rounds:
1. in the first round will be two matches and for each match 5 bottles of water are needed (two for each of the participants and one for the judge), 1. in the second round will be only one match, so we need another 5 bottles of water, 1. in the third round will also be only one match, so we need another 5 bottles of water.
So in total we need 20 bottles of water.
In the second example no participant will move on to some round directly.
| 0
|
[
{
"input": "5 2 3",
"output": "20 15"
},
{
"input": "8 2 4",
"output": "35 32"
},
{
"input": "10 1 500",
"output": "27 5000"
},
{
"input": "20 500 1",
"output": "19019 20"
},
{
"input": "100 123 99",
"output": "24453 9900"
},
{
"input": "500 1 1",
"output": "1497 500"
},
{
"input": "500 500 500",
"output": "499499 250000"
},
{
"input": "500 237 474",
"output": "237025 237000"
},
{
"input": "1 2 3",
"output": "0 3"
},
{
"input": "1 2 133",
"output": "0 133"
},
{
"input": "1 2 100",
"output": "0 100"
},
{
"input": "1 3 4",
"output": "0 4"
},
{
"input": "1 10 15",
"output": "0 15"
},
{
"input": "1 1 1",
"output": "0 1"
},
{
"input": "1 2 5",
"output": "0 5"
},
{
"input": "1 500 500",
"output": "0 500"
},
{
"input": "1 3 8",
"output": "0 8"
},
{
"input": "10 10 10",
"output": "189 100"
},
{
"input": "1 3 5",
"output": "0 5"
},
{
"input": "1 2 1",
"output": "0 1"
},
{
"input": "1 2 4",
"output": "0 4"
},
{
"input": "1 10 10",
"output": "0 10"
},
{
"input": "1 345 345",
"output": "0 345"
},
{
"input": "7 12 13",
"output": "150 91"
},
{
"input": "1 500 1",
"output": "0 1"
},
{
"input": "1 12 13",
"output": "0 13"
},
{
"input": "1 500 499",
"output": "0 499"
},
{
"input": "1 100 90",
"output": "0 90"
},
{
"input": "2 100 90",
"output": "201 180"
},
{
"input": "53 1 1",
"output": "156 53"
},
{
"input": "73 73 73",
"output": "10584 5329"
},
{
"input": "67 1 1",
"output": "198 67"
},
{
"input": "63 1 1",
"output": "186 63"
},
{
"input": "59 1 1",
"output": "174 59"
},
{
"input": "57 1 1",
"output": "168 57"
},
{
"input": "13 1 1",
"output": "36 13"
},
{
"input": "349 2 5",
"output": "1740 1745"
},
{
"input": "456 456 456",
"output": "415415 207936"
}
] | 1,455,894,425
| 425
|
Python 3
|
OK
|
TESTS
| 38
| 62
| 0
|
n, b, p = [int(x) for x in input().split()]
b1, p1 = 0, n*p
while n > 1:
n1 = 2 << (n.bit_length()-2)
b1 += (2*b + 1) * n1 // 2
n -= n1//2
print(b1, p1)
|
Title: Tennis Tournament
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A tennis tournament with *n* participants is running. The participants are playing by an olympic system, so the winners move on and the losers drop out.
The tournament takes place in the following way (below, *m* is the number of the participants of the current round):
- let *k* be the maximal power of the number 2 such that *k*<=≤<=*m*, - *k* participants compete in the current round and a half of them passes to the next round, the other *m*<=-<=*k* participants pass to the next round directly, - when only one participant remains, the tournament finishes.
Each match requires *b* bottles of water for each participant and one bottle for the judge. Besides *p* towels are given to each participant for the whole tournament.
Find the number of bottles and towels needed for the tournament.
Note that it's a tennis tournament so in each match two participants compete (one of them will win and the other will lose).
Input Specification:
The only line contains three integers *n*,<=*b*,<=*p* (1<=≤<=*n*,<=*b*,<=*p*<=≤<=500) — the number of participants and the parameters described in the problem statement.
Output Specification:
Print two integers *x* and *y* — the number of bottles and towels need for the tournament.
Demo Input:
['5 2 3\n', '8 2 4\n']
Demo Output:
['20 15\n', '35 32\n']
Note:
In the first example will be three rounds:
1. in the first round will be two matches and for each match 5 bottles of water are needed (two for each of the participants and one for the judge), 1. in the second round will be only one match, so we need another 5 bottles of water, 1. in the third round will also be only one match, so we need another 5 bottles of water.
So in total we need 20 bottles of water.
In the second example no participant will move on to some round directly.
|
```python
n, b, p = [int(x) for x in input().split()]
b1, p1 = 0, n*p
while n > 1:
n1 = 2 << (n.bit_length()-2)
b1 += (2*b + 1) * n1 // 2
n -= n1//2
print(b1, p1)
```
| 3
|
|
577
|
B
|
Modulo Sum
|
PROGRAMMING
| 1,900
|
[
"combinatorics",
"data structures",
"dp",
"two pointers"
] | null | null |
You are given a sequence of numbers *a*1,<=*a*2,<=...,<=*a**n*, and a number *m*.
Check if it is possible to choose a non-empty subsequence *a**i**j* such that the sum of numbers in this subsequence is divisible by *m*.
|
The first line contains two numbers, *n* and *m* (1<=≤<=*n*<=≤<=106, 2<=≤<=*m*<=≤<=103) — the size of the original sequence and the number such that sum should be divisible by it.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109).
|
In the single line print either "YES" (without the quotes) if there exists the sought subsequence, or "NO" (without the quotes), if such subsequence doesn't exist.
|
[
"3 5\n1 2 3\n",
"1 6\n5\n",
"4 6\n3 1 1 3\n",
"6 6\n5 5 5 5 5 5\n"
] |
[
"YES\n",
"NO\n",
"YES\n",
"YES\n"
] |
In the first sample test you can choose numbers 2 and 3, the sum of which is divisible by 5.
In the second sample test the single non-empty subsequence of numbers is a single number 5. Number 5 is not divisible by 6, that is, the sought subsequence doesn't exist.
In the third sample test you need to choose two numbers 3 on the ends.
In the fourth sample test you can take the whole subsequence.
| 1,250
|
[
{
"input": "3 5\n1 2 3",
"output": "YES"
},
{
"input": "1 6\n5",
"output": "NO"
},
{
"input": "4 6\n3 1 1 3",
"output": "YES"
},
{
"input": "6 6\n5 5 5 5 5 5",
"output": "YES"
},
{
"input": "4 5\n1 1 1 1",
"output": "NO"
},
{
"input": "5 5\n1 1 1 1 1",
"output": "YES"
},
{
"input": "4 7\n1 2 3 3",
"output": "YES"
},
{
"input": "1 47\n0",
"output": "YES"
},
{
"input": "2 47\n1 0",
"output": "YES"
},
{
"input": "9 11\n8 8 8 8 8 8 8 8 5",
"output": "NO"
},
{
"input": "10 11\n8 8 8 8 8 8 8 8 7 8",
"output": "YES"
},
{
"input": "3 5\n2 1 3",
"output": "YES"
},
{
"input": "100 968\n966 966 967 966 967 967 967 967 966 966 966 967 966 966 966 967 967 966 966 967 967 967 967 966 967 967 967 967 563 967 967 967 600 967 967 966 967 966 967 966 967 966 967 966 966 966 967 966 967 966 966 967 967 193 966 966 967 966 967 967 967 966 967 966 966 580 966 967 966 966 967 966 966 966 967 967 967 967 966 967 967 966 966 966 967 967 966 966 967 966 966 966 967 966 966 967 966 967 966 966",
"output": "YES"
},
{
"input": "100 951\n950 949 949 949 949 950 950 949 949 950 950 949 949 949 496 949 950 949 950 159 950 949 949 950 950 949 950 949 949 950 949 950 949 949 950 949 950 950 950 950 949 949 949 949 949 950 950 950 950 950 950 950 949 950 949 949 950 949 950 950 949 950 950 950 949 950 949 950 950 950 950 949 949 950 950 949 950 950 950 950 949 950 950 949 949 635 612 949 949 949 949 949 949 949 950 949 949 950 949 950",
"output": "YES"
},
{
"input": "100 940\n1 2 1 1 1 2 1 1 1 1 2 1 1 1 1 1 2 1 1 1 2 2 1 1 1 2 2 2 2 1 1 1 1 2 2 1 403 2 2 1 1 1 2 2 2 1 2 2 1 1 2 2 1 1 1 1 2 1 2 691 1 2 1 1 1 1 1 2 2 2 2 2 1 2 1 1 1 1 1 1 2 2 1 2 2 1 1 1 2 1 2 1 1 2 2 1 1 2 786 1",
"output": "YES"
},
{
"input": "100 917\n2 1 2 2 2 1 1 2 2 2 1 1 1 2 1 2 2 1 2 1 1 1 1 1 1 2 1 1 1 2 1 1 2 1 1 1 1 2 1 2 340 2 399 2 1 2 2 2 2 178 1 1 2 1 1 1 2 2 1 2 2 2 1 2 1 1 1 1 1 1 2 1 1 1 2 2 1 1 2 2 2 1 2 2 2 2 1 2 1 2 2 2 2 2 1 1 2 2 2 2",
"output": "YES"
},
{
"input": "1 2\n1000000000",
"output": "YES"
}
] | 1,644,583,977
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 7
| 77
| 512,000
|
n,m = map(int,input().split())
arr = list(map(int,input().split()))
arr= [i%m for i in arr]
dp = [[0 for i in range(0,m)]for j in range(n+1)]
for i in range(1,n):
dp[i][arr[i-1]] = 1
for i in range(1,len(dp)):
for j in range(0,m):
dp[i][j] = dp[i][j] or dp[i-1][j]
dp[i][j] = dp[i][j] or dp[i-1][(j-arr[i-1]+m)%m]
print("YES" if dp[n][0] else "NO")
|
Title: Modulo Sum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a sequence of numbers *a*1,<=*a*2,<=...,<=*a**n*, and a number *m*.
Check if it is possible to choose a non-empty subsequence *a**i**j* such that the sum of numbers in this subsequence is divisible by *m*.
Input Specification:
The first line contains two numbers, *n* and *m* (1<=≤<=*n*<=≤<=106, 2<=≤<=*m*<=≤<=103) — the size of the original sequence and the number such that sum should be divisible by it.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109).
Output Specification:
In the single line print either "YES" (without the quotes) if there exists the sought subsequence, or "NO" (without the quotes), if such subsequence doesn't exist.
Demo Input:
['3 5\n1 2 3\n', '1 6\n5\n', '4 6\n3 1 1 3\n', '6 6\n5 5 5 5 5 5\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n', 'YES\n']
Note:
In the first sample test you can choose numbers 2 and 3, the sum of which is divisible by 5.
In the second sample test the single non-empty subsequence of numbers is a single number 5. Number 5 is not divisible by 6, that is, the sought subsequence doesn't exist.
In the third sample test you need to choose two numbers 3 on the ends.
In the fourth sample test you can take the whole subsequence.
|
```python
n,m = map(int,input().split())
arr = list(map(int,input().split()))
arr= [i%m for i in arr]
dp = [[0 for i in range(0,m)]for j in range(n+1)]
for i in range(1,n):
dp[i][arr[i-1]] = 1
for i in range(1,len(dp)):
for j in range(0,m):
dp[i][j] = dp[i][j] or dp[i-1][j]
dp[i][j] = dp[i][j] or dp[i-1][(j-arr[i-1]+m)%m]
print("YES" if dp[n][0] else "NO")
```
| 0
|
|
244
|
A
|
Dividing Orange
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
One day Ms Swan bought an orange in a shop. The orange consisted of *n*·*k* segments, numbered with integers from 1 to *n*·*k*.
There were *k* children waiting for Ms Swan at home. The children have recently learned about the orange and they decided to divide it between them. For that each child took a piece of paper and wrote the number of the segment that he would like to get: the *i*-th (1<=≤<=*i*<=≤<=*k*) child wrote the number *a**i* (1<=≤<=*a**i*<=≤<=*n*·*k*). All numbers *a**i* accidentally turned out to be different.
Now the children wonder, how to divide the orange so as to meet these conditions:
- each child gets exactly *n* orange segments; - the *i*-th child gets the segment with number *a**i* for sure; - no segment goes to two children simultaneously.
Help the children, divide the orange and fulfill the requirements, described above.
|
The first line contains two integers *n*, *k* (1<=≤<=*n*,<=*k*<=≤<=30). The second line contains *k* space-separated integers *a*1,<=*a*2,<=...,<=*a**k* (1<=≤<=*a**i*<=≤<=*n*·*k*), where *a**i* is the number of the orange segment that the *i*-th child would like to get.
It is guaranteed that all numbers *a**i* are distinct.
|
Print exactly *n*·*k* distinct integers. The first *n* integers represent the indexes of the segments the first child will get, the second *n* integers represent the indexes of the segments the second child will get, and so on. Separate the printed numbers with whitespaces.
You can print a child's segment indexes in any order. It is guaranteed that the answer always exists. If there are multiple correct answers, print any of them.
|
[
"2 2\n4 1\n",
"3 1\n2\n"
] |
[
"2 4 \n1 3 \n",
"3 2 1 \n"
] |
none
| 500
|
[
{
"input": "2 2\n4 1",
"output": "2 4 \n1 3 "
},
{
"input": "3 1\n2",
"output": "3 2 1 "
},
{
"input": "5 5\n25 24 23 22 21",
"output": "2 3 1 25 4 \n7 6 8 5 24 \n10 12 9 23 11 \n13 15 14 16 22 \n19 21 20 17 18 "
},
{
"input": "1 30\n8 22 13 25 10 30 12 27 6 4 7 2 20 16 26 14 15 17 23 3 24 9 5 11 29 1 19 28 21 18",
"output": "8 \n22 \n13 \n25 \n10 \n30 \n12 \n27 \n6 \n4 \n7 \n2 \n20 \n16 \n26 \n14 \n15 \n17 \n23 \n3 \n24 \n9 \n5 \n11 \n29 \n1 \n19 \n28 \n21 \n18 "
},
{
"input": "30 1\n29",
"output": "8 20 17 12 5 26 13 2 19 22 28 16 10 4 6 11 3 25 1 27 15 9 30 24 21 18 14 23 29 7 "
},
{
"input": "10 10\n13 39 6 75 84 94 96 21 85 71",
"output": "9 3 1 13 5 7 4 2 10 8 \n17 12 19 11 39 14 15 18 16 20 \n22 27 6 24 25 30 26 28 23 29 \n36 33 75 34 38 31 35 40 37 32 \n43 44 49 42 46 48 47 45 84 41 \n51 94 52 56 57 54 50 55 53 58 \n64 60 62 61 66 59 63 96 67 65 \n72 69 76 77 70 78 73 21 74 68 \n81 85 87 88 80 83 89 86 79 82 \n93 91 100 99 98 71 90 95 92 97 "
},
{
"input": "10 15\n106 109 94 50 3 143 147 10 89 145 29 28 87 126 110",
"output": "9 4 1 106 6 7 5 2 11 8 \n17 13 19 12 109 14 15 18 16 20 \n21 26 94 23 24 31 25 27 22 30 \n37 34 50 35 39 32 36 40 38 33 \n43 44 49 42 46 48 47 45 3 41 \n52 143 53 57 58 55 51 56 54 59 \n65 61 63 62 67 60 64 147 68 66 \n72 70 75 76 71 77 73 10 74 69 \n80 89 84 85 79 82 86 83 78 81 \n92 90 98 97 96 145 88 93 91 95 \n100 104 105 103 102 108 99 101 29 107 \n111 114 112 116 119 118 28 113 117 115 \n128 120 122 125 129 127 87 124 123 121 \n133 136 130 134 132 131 135 126 137 138 \n142 141 144 148 146 149 110 140..."
},
{
"input": "15 10\n126 111 12 6 28 47 51 116 53 35",
"output": "9 13 1 14 5 16 15 2 10 8 126 3 11 4 7 \n111 22 21 26 20 30 17 23 18 19 24 31 27 25 29 \n43 40 41 39 42 12 45 44 34 37 32 36 38 33 46 \n59 6 57 56 58 49 62 54 50 52 63 61 48 55 60 \n70 67 71 75 69 77 72 65 68 73 76 74 28 64 66 \n80 89 86 79 87 91 81 78 88 83 85 82 90 84 47 \n95 93 51 99 104 98 103 101 100 102 97 96 94 92 105 \n120 115 113 118 109 119 110 116 114 106 121 117 108 107 112 \n135 133 128 125 123 131 129 122 124 53 134 132 130 127 136 \n148 139 141 143 146 144 147 138 137 145 142 149 140 150 35 \n..."
},
{
"input": "30 30\n455 723 796 90 7 881 40 736 147 718 560 619 468 363 161 767 282 19 111 369 443 850 871 242 713 789 208 435 135 411",
"output": "9 22 18 13 5 28 14 2 21 24 30 17 11 4 6 12 3 27 1 29 16 10 31 26 23 20 15 25 455 8 \n723 52 49 60 45 48 34 59 58 44 32 57 61 56 51 33 42 37 41 38 47 53 36 50 54 55 46 39 43 35 \n89 71 796 74 78 70 88 67 84 85 63 83 82 62 72 79 81 80 73 91 69 66 65 87 77 75 64 68 86 76 \n115 90 102 121 104 106 109 98 112 120 119 105 103 97 113 93 100 118 107 96 117 92 94 116 95 101 110 108 114 99 \n136 133 148 123 144 139 149 142 7 140 138 127 150 129 122 130 143 126 134 152 132 145 131 146 125 151 137 128 124 141 \n154 177..."
},
{
"input": "1 1\n1",
"output": "1 "
},
{
"input": "2 1\n1",
"output": "2 1 "
},
{
"input": "1 2\n2 1",
"output": "2 \n1 "
},
{
"input": "1 3\n2 3 1",
"output": "2 \n3 \n1 "
},
{
"input": "2 3\n3 2 1",
"output": "4 3 \n2 5 \n1 6 "
},
{
"input": "3 3\n6 7 8",
"output": "2 6 1 \n7 4 3 \n5 9 8 "
},
{
"input": "3 1\n3",
"output": "2 3 1 "
},
{
"input": "3 2\n5 4",
"output": "2 5 1 \n4 6 3 "
},
{
"input": "12 13\n149 22 133 146 151 64 45 88 77 126 92 134 143",
"output": "8 11 1 10 5 6 4 2 9 7 149 3 \n14 13 19 12 17 16 22 20 21 23 15 18 \n133 28 34 32 31 25 30 33 24 29 26 27 \n35 42 38 40 43 46 39 41 44 146 36 37 \n56 51 48 49 50 54 53 151 57 52 47 55 \n61 58 65 68 67 59 62 66 69 63 64 60 \n80 70 75 74 76 81 45 72 78 73 79 71 \n94 85 88 83 90 87 86 89 93 82 84 91 \n99 104 98 96 103 105 102 97 77 95 101 100 \n116 109 107 111 115 113 126 108 112 110 114 106 \n127 121 125 118 120 128 123 92 119 122 117 124 \n139 132 136 130 131 140 141 134 137 138 135 129 \n150 142 144 155 154..."
},
{
"input": "30 29\n427 740 444 787 193 268 19 767 46 276 245 468 661 348 402 62 665 425 398 503 89 455 200 772 355 442 863 416 164",
"output": "8 21 17 12 5 27 13 2 20 23 29 16 10 4 6 11 3 26 1 28 15 9 30 25 22 18 14 24 427 7 \n740 51 48 59 43 47 33 58 57 42 31 56 60 55 50 32 40 36 39 37 45 52 35 49 53 54 44 38 41 34 \n90 71 444 74 78 70 88 67 84 85 63 83 82 61 72 79 81 80 73 91 69 66 65 87 77 75 64 68 86 76 \n114 787 102 120 104 106 109 98 111 119 118 105 103 97 112 93 100 117 107 96 116 92 94 115 95 101 110 108 113 99 \n134 132 145 122 142 137 146 140 193 138 136 126 147 128 121 129 141 125 133 149 131 143 130 144 124 148 135 127 123 139 \n151 1..."
},
{
"input": "29 30\n173 601 360 751 194 411 708 598 236 812 855 647 100 106 59 38 822 196 529 417 606 159 384 389 300 172 544 726 702 799",
"output": "8 20 17 12 5 26 13 2 19 22 28 16 10 4 6 11 3 25 1 27 15 9 7 24 21 18 14 23 173 \n47 36 37 35 45 51 49 41 31 33 29 32 46 57 52 48 54 34 55 53 56 30 601 44 43 39 40 42 50 \n77 79 84 86 64 72 75 60 76 78 81 73 80 58 82 69 70 67 83 65 68 62 360 71 61 63 85 66 74 \n90 107 751 110 105 93 98 96 95 97 116 91 109 102 115 87 99 104 114 88 92 113 94 111 101 89 103 112 108 \n140 127 144 134 118 125 141 137 119 133 128 139 124 121 130 126 120 142 136 122 132 117 194 131 129 143 138 123 135 \n147 168 163 154 174 160 146..."
},
{
"input": "29 29\n669 371 637 18 176 724 137 757 407 420 658 737 188 408 185 416 425 293 178 557 8 104 139 819 268 403 255 63 793",
"output": "9 22 19 13 5 28 14 2 21 24 30 17 11 4 6 12 3 27 1 29 16 10 7 26 23 20 15 25 669 \n48 38 39 37 46 52 50 42 33 35 31 34 47 58 53 49 55 36 56 54 57 32 371 45 44 40 41 43 51 \n78 80 85 87 65 73 76 60 77 79 82 74 81 59 83 70 71 68 84 66 69 62 637 72 61 64 86 67 75 \n91 107 18 110 106 94 99 97 96 98 116 92 109 102 115 88 100 105 114 89 93 113 95 111 101 90 103 112 108 \n142 127 146 134 118 125 143 138 119 133 128 141 124 121 130 126 120 144 136 122 132 117 176 131 129 145 140 123 135 \n149 169 164 156 173 161 14..."
},
{
"input": "28 29\n771 736 590 366 135 633 68 789 193 459 137 370 216 692 730 712 537 356 752 757 796 541 804 27 431 162 196 630 684",
"output": "8 20 17 12 5 26 13 2 19 22 771 16 10 4 6 11 3 25 1 28 15 9 7 24 21 18 14 23 \n34 55 49 41 54 45 33 37 35 53 29 40 30 32 43 31 36 51 736 44 39 46 38 50 48 52 47 42 \n77 65 78 73 63 56 72 590 76 62 74 57 83 69 58 80 60 79 66 59 64 82 67 70 81 61 71 75 \n107 104 92 94 106 109 84 88 86 99 98 105 366 93 103 101 89 87 95 90 100 85 91 102 97 108 110 96 \n124 125 113 123 119 120 121 134 127 132 117 129 116 130 138 111 118 131 122 139 128 114 112 126 115 136 133 135 \n141 633 142 153 160 152 149 156 166 158 161 144..."
},
{
"input": "29 29\n669 371 637 18 176 724 137 757 407 420 658 737 188 408 185 416 425 293 178 557 8 104 139 819 268 403 255 63 793",
"output": "9 22 19 13 5 28 14 2 21 24 30 17 11 4 6 12 3 27 1 29 16 10 7 26 23 20 15 25 669 \n48 38 39 37 46 52 50 42 33 35 31 34 47 58 53 49 55 36 56 54 57 32 371 45 44 40 41 43 51 \n78 80 85 87 65 73 76 60 77 79 82 74 81 59 83 70 71 68 84 66 69 62 637 72 61 64 86 67 75 \n91 107 18 110 106 94 99 97 96 98 116 92 109 102 115 88 100 105 114 89 93 113 95 111 101 90 103 112 108 \n142 127 146 134 118 125 143 138 119 133 128 141 124 121 130 126 120 144 136 122 132 117 176 131 129 145 140 123 135 \n149 169 164 156 173 161 14..."
},
{
"input": "27 3\n12 77 80",
"output": "8 21 18 13 5 27 14 2 20 23 12 17 10 4 6 11 3 26 1 24 16 9 7 25 22 19 15 \n43 32 46 48 51 37 41 49 77 30 40 28 34 38 44 35 31 45 52 50 47 29 36 53 42 39 33 \n62 61 78 63 81 55 70 79 67 73 58 69 59 64 80 54 56 57 68 72 65 60 71 66 74 75 76 "
},
{
"input": "3 27\n77 9 32 56 7 65 58 24 64 19 49 62 47 44 28 79 76 71 21 4 18 23 51 53 12 6 20",
"output": "2 77 1 \n9 5 3 \n8 10 32 \n13 56 11 \n15 7 14 \n65 17 16 \n22 58 25 \n24 26 27 \n29 64 30 \n31 33 19 \n35 34 49 \n62 37 36 \n47 38 39 \n44 40 41 \n42 43 28 \n46 45 79 \n48 50 76 \n71 54 52 \n57 21 55 \n60 4 59 \n61 18 63 \n66 23 67 \n68 51 69 \n72 70 53 \n12 73 74 \n75 6 78 \n81 20 80 "
},
{
"input": "10 30\n165 86 241 45 144 43 95 250 28 240 42 15 295 211 48 99 199 156 206 109 100 194 229 224 57 10 220 79 44 203",
"output": "8 3 1 165 5 6 4 2 9 7 \n17 12 19 11 86 13 14 18 16 20 \n21 26 241 23 24 30 25 27 22 29 \n36 33 45 34 38 31 35 39 37 32 \n46 47 53 41 50 52 51 49 144 40 \n55 43 56 61 62 59 54 60 58 63 \n69 65 67 66 71 64 68 95 72 70 \n76 74 80 81 75 82 77 250 78 73 \n85 28 90 91 84 88 92 89 83 87 \n97 94 104 103 102 240 93 98 96 101 \n106 111 112 110 108 114 105 107 42 113 \n115 118 116 120 123 122 15 117 121 119 \n131 124 126 129 132 130 295 128 127 125 \n136 139 133 137 135 134 138 211 140 141 \n146 145 147 149 148 150 4..."
},
{
"input": "30 10\n71 146 274 157 190 85 32 152 25 278",
"output": "8 20 17 12 5 27 13 2 19 22 29 16 10 4 6 11 3 26 1 28 15 9 30 24 21 18 14 23 71 7 \n146 51 48 59 44 47 34 58 57 43 31 56 60 55 50 33 41 37 40 38 46 52 36 49 53 54 45 39 42 35 \n90 70 274 74 78 69 89 66 84 86 62 83 82 61 72 79 81 80 73 91 68 65 64 88 77 75 63 67 87 76 \n114 157 102 120 104 106 109 98 111 119 118 105 103 97 112 93 100 117 107 96 116 92 94 115 95 101 110 108 113 99 \n134 132 145 122 142 137 147 140 190 138 136 126 148 128 121 129 141 125 133 150 131 143 130 144 124 149 135 127 123 139 \n153 17..."
},
{
"input": "7 1\n5",
"output": "2 3 1 5 6 7 4 "
},
{
"input": "6 1\n5",
"output": "2 3 1 5 6 4 "
}
] | 1,608,041,137
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 29
| 372
| 1,740,800
|
inp=list(map(int,input().split()))
n,k=inp
arr=[]
for i in range(k+1):
arr.append([])
from collections import Counter
a=list(map(int,input().split()))
for i in range(len(a)):
arr[i+1].append(a[i])
c=Counter(a)
j=1
for i in range(1,n*k+1):
if c[i]!=0:
continue
if len(arr[j])==n:
j+=1
if j==len(arr):
break
arr[j].append(i)
c[i]+=1
for item in arr:
for k in item:
print (k,end=" ")
print (' ')
|
Title: Dividing Orange
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Ms Swan bought an orange in a shop. The orange consisted of *n*·*k* segments, numbered with integers from 1 to *n*·*k*.
There were *k* children waiting for Ms Swan at home. The children have recently learned about the orange and they decided to divide it between them. For that each child took a piece of paper and wrote the number of the segment that he would like to get: the *i*-th (1<=≤<=*i*<=≤<=*k*) child wrote the number *a**i* (1<=≤<=*a**i*<=≤<=*n*·*k*). All numbers *a**i* accidentally turned out to be different.
Now the children wonder, how to divide the orange so as to meet these conditions:
- each child gets exactly *n* orange segments; - the *i*-th child gets the segment with number *a**i* for sure; - no segment goes to two children simultaneously.
Help the children, divide the orange and fulfill the requirements, described above.
Input Specification:
The first line contains two integers *n*, *k* (1<=≤<=*n*,<=*k*<=≤<=30). The second line contains *k* space-separated integers *a*1,<=*a*2,<=...,<=*a**k* (1<=≤<=*a**i*<=≤<=*n*·*k*), where *a**i* is the number of the orange segment that the *i*-th child would like to get.
It is guaranteed that all numbers *a**i* are distinct.
Output Specification:
Print exactly *n*·*k* distinct integers. The first *n* integers represent the indexes of the segments the first child will get, the second *n* integers represent the indexes of the segments the second child will get, and so on. Separate the printed numbers with whitespaces.
You can print a child's segment indexes in any order. It is guaranteed that the answer always exists. If there are multiple correct answers, print any of them.
Demo Input:
['2 2\n4 1\n', '3 1\n2\n']
Demo Output:
['2 4 \n1 3 \n', '3 2 1 \n']
Note:
none
|
```python
inp=list(map(int,input().split()))
n,k=inp
arr=[]
for i in range(k+1):
arr.append([])
from collections import Counter
a=list(map(int,input().split()))
for i in range(len(a)):
arr[i+1].append(a[i])
c=Counter(a)
j=1
for i in range(1,n*k+1):
if c[i]!=0:
continue
if len(arr[j])==n:
j+=1
if j==len(arr):
break
arr[j].append(i)
c[i]+=1
for item in arr:
for k in item:
print (k,end=" ")
print (' ')
```
| 3
|
|
355
|
B
|
Vasya and Public Transport
|
PROGRAMMING
| 1,100
|
[
"greedy",
"implementation"
] | null | null |
Vasya often uses public transport. The transport in the city is of two types: trolleys and buses. The city has *n* buses and *m* trolleys, the buses are numbered by integers from 1 to *n*, the trolleys are numbered by integers from 1 to *m*.
Public transport is not free. There are 4 types of tickets:
1. A ticket for one ride on some bus or trolley. It costs *c*1 burles; 1. A ticket for an unlimited number of rides on some bus or on some trolley. It costs *c*2 burles; 1. A ticket for an unlimited number of rides on all buses or all trolleys. It costs *c*3 burles; 1. A ticket for an unlimited number of rides on all buses and trolleys. It costs *c*4 burles.
Vasya knows for sure the number of rides he is going to make and the transport he is going to use. He asked you for help to find the minimum sum of burles he will have to spend on the tickets.
|
The first line contains four integers *c*1,<=*c*2,<=*c*3,<=*c*4 (1<=≤<=*c*1,<=*c*2,<=*c*3,<=*c*4<=≤<=1000) — the costs of the tickets.
The second line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of buses and trolleys Vasya is going to use.
The third line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=1000) — the number of times Vasya is going to use the bus number *i*.
The fourth line contains *m* integers *b**i* (0<=≤<=*b**i*<=≤<=1000) — the number of times Vasya is going to use the trolley number *i*.
|
Print a single number — the minimum sum of burles Vasya will have to spend on the tickets.
|
[
"1 3 7 19\n2 3\n2 5\n4 4 4\n",
"4 3 2 1\n1 3\n798\n1 2 3\n",
"100 100 8 100\n3 5\n7 94 12\n100 1 47 0 42\n"
] |
[
"12\n",
"1\n",
"16\n"
] |
In the first sample the profitable strategy is to buy two tickets of the first type (for the first bus), one ticket of the second type (for the second bus) and one ticket of the third type (for all trolleys). It totals to (2·1) + 3 + 7 = 12 burles.
In the second sample the profitable strategy is to buy one ticket of the fourth type.
In the third sample the profitable strategy is to buy two tickets of the third type: for all buses and for all trolleys.
| 1,000
|
[
{
"input": "1 3 7 19\n2 3\n2 5\n4 4 4",
"output": "12"
},
{
"input": "4 3 2 1\n1 3\n798\n1 2 3",
"output": "1"
},
{
"input": "100 100 8 100\n3 5\n7 94 12\n100 1 47 0 42",
"output": "16"
},
{
"input": "3 103 945 1000\n7 9\n34 35 34 35 34 35 34\n0 0 0 0 0 0 0 0 0",
"output": "717"
},
{
"input": "7 11 597 948\n4 1\n5 1 0 11\n7",
"output": "40"
},
{
"input": "7 32 109 645\n1 3\n0\n0 0 0",
"output": "0"
},
{
"input": "680 871 347 800\n10 100\n872 156 571 136 703 201 832 213 15 333\n465 435 870 95 660 237 694 594 423 405 27 866 325 490 255 989 128 345 278 125 708 210 771 848 961 448 871 190 745 343 532 174 103 999 874 221 252 500 886 129 185 208 137 425 800 34 696 39 198 981 91 50 545 885 194 583 475 415 162 712 116 911 313 488 646 189 429 756 728 30 985 114 823 111 106 447 296 430 307 388 345 458 84 156 169 859 274 934 634 62 12 839 323 831 24 907 703 754 251 938",
"output": "694"
},
{
"input": "671 644 748 783\n100 10\n520 363 816 957 635 753 314 210 763 819 27 970 520 164 195 230 708 587 568 707 343 30 217 227 755 277 773 497 900 589 826 666 115 784 494 467 217 892 658 388 764 812 248 447 876 581 94 915 675 967 508 754 768 79 261 934 603 712 20 199 997 501 465 91 897 257 820 645 217 105 564 8 668 171 168 18 565 840 418 42 808 918 409 617 132 268 13 161 194 628 213 199 545 448 113 410 794 261 211 539\n147 3 178 680 701 193 697 666 846 389",
"output": "783"
},
{
"input": "2 7 291 972\n63 92\n7 0 0 6 0 13 0 20 2 8 0 17 7 0 0 0 0 2 2 0 0 8 20 0 0 0 3 0 0 0 4 20 0 0 0 12 0 8 17 9 0 0 0 0 4 0 0 0 17 11 3 0 2 15 0 18 11 19 14 0 0 20 13\n0 0 0 3 7 0 0 0 0 8 13 6 15 0 7 0 0 20 0 0 12 0 12 0 15 0 0 1 11 14 0 11 12 0 0 0 0 0 16 16 0 17 20 0 11 0 0 20 14 0 16 0 3 6 12 0 0 0 0 0 15 3 0 9 17 12 20 17 0 0 0 0 15 9 0 14 10 10 1 20 16 17 20 6 6 0 0 16 4 6 0 7",
"output": "494"
},
{
"input": "4 43 490 945\n63 92\n0 0 0 0 0 0 6 5 18 0 6 4 0 17 0 19 0 19 7 16 0 0 0 9 10 13 7 0 10 16 0 0 0 0 0 14 0 14 9 15 0 0 2 0 0 0 0 5 0 0 0 11 11 0 0 0 0 0 10 12 3 0 0\n0 12 0 18 7 7 0 0 9 0 0 13 17 0 18 12 4 0 0 14 18 20 0 0 12 9 17 1 19 0 11 0 5 0 0 14 0 0 16 0 19 15 9 14 7 10 0 19 19 0 0 1 0 0 0 6 0 0 0 6 0 20 1 9 0 0 10 17 5 2 5 4 16 6 0 11 0 8 13 4 0 2 0 0 13 10 0 13 0 0 8 4",
"output": "945"
},
{
"input": "2 50 258 922\n42 17\n0 2 0 1 0 1 0 11 18 9 0 0 0 0 10 15 17 4 20 0 5 0 0 13 13 0 0 2 0 7 0 20 4 0 19 3 7 0 0 0 0 0\n8 4 19 0 0 19 14 17 6 0 18 0 0 0 0 9 0",
"output": "486"
},
{
"input": "1 1 3 4\n2 3\n1 1\n1 1 1",
"output": "4"
},
{
"input": "4 4 4 1\n1 1\n0\n0",
"output": "0"
},
{
"input": "100 100 1 100\n10 10\n100 100 100 100 100 100 100 100 100 100\n100 100 100 100 100 100 100 100 100 100",
"output": "2"
}
] | 1,381,802,282
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 27
| 46
| 307,200
|
import sys
# input
line_id = 0
for line in sys.stdin:
line_id = line_id + 1
line_data = line.split()
if line_id <= 2:
if line_id == 1:
c1 = int(line_data[0])
c2 = int(line_data[1])
c3 = int(line_data[2])
c4 = int(line_data[3])
else:
cnt_bus = int(line_data[0])
cnt_tro = int(line_data[1])
else:
if line_id == 3:
cnt_bus_took = [0]
for data_str in line_data:
cnt_bus_took.append(int(data_str))
else:
cnt_tro_took = [0]
for data_str in line_data:
cnt_tro_took.append(int(data_str))
# calc min cost for bus
cost_bus = 0
for bus_id in range(cnt_bus + 1):
cost_bus = cost_bus + min(c1 * cnt_bus_took[bus_id], c2)
cost_bus = min(c3, cost_bus)
# calc min cost for tro
cost_tro = 0
for tro_id in range(cnt_tro + 1):
cost_tro = cost_tro + min(c1 * cnt_tro_took[tro_id], c2)
cost_tro = min(c3, cost_tro)
# calc min cost for all (bus and tro)
cost_all = min(c4, cost_bus + cost_tro)
print(cost_all)
|
Title: Vasya and Public Transport
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya often uses public transport. The transport in the city is of two types: trolleys and buses. The city has *n* buses and *m* trolleys, the buses are numbered by integers from 1 to *n*, the trolleys are numbered by integers from 1 to *m*.
Public transport is not free. There are 4 types of tickets:
1. A ticket for one ride on some bus or trolley. It costs *c*1 burles; 1. A ticket for an unlimited number of rides on some bus or on some trolley. It costs *c*2 burles; 1. A ticket for an unlimited number of rides on all buses or all trolleys. It costs *c*3 burles; 1. A ticket for an unlimited number of rides on all buses and trolleys. It costs *c*4 burles.
Vasya knows for sure the number of rides he is going to make and the transport he is going to use. He asked you for help to find the minimum sum of burles he will have to spend on the tickets.
Input Specification:
The first line contains four integers *c*1,<=*c*2,<=*c*3,<=*c*4 (1<=≤<=*c*1,<=*c*2,<=*c*3,<=*c*4<=≤<=1000) — the costs of the tickets.
The second line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of buses and trolleys Vasya is going to use.
The third line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=1000) — the number of times Vasya is going to use the bus number *i*.
The fourth line contains *m* integers *b**i* (0<=≤<=*b**i*<=≤<=1000) — the number of times Vasya is going to use the trolley number *i*.
Output Specification:
Print a single number — the minimum sum of burles Vasya will have to spend on the tickets.
Demo Input:
['1 3 7 19\n2 3\n2 5\n4 4 4\n', '4 3 2 1\n1 3\n798\n1 2 3\n', '100 100 8 100\n3 5\n7 94 12\n100 1 47 0 42\n']
Demo Output:
['12\n', '1\n', '16\n']
Note:
In the first sample the profitable strategy is to buy two tickets of the first type (for the first bus), one ticket of the second type (for the second bus) and one ticket of the third type (for all trolleys). It totals to (2·1) + 3 + 7 = 12 burles.
In the second sample the profitable strategy is to buy one ticket of the fourth type.
In the third sample the profitable strategy is to buy two tickets of the third type: for all buses and for all trolleys.
|
```python
import sys
# input
line_id = 0
for line in sys.stdin:
line_id = line_id + 1
line_data = line.split()
if line_id <= 2:
if line_id == 1:
c1 = int(line_data[0])
c2 = int(line_data[1])
c3 = int(line_data[2])
c4 = int(line_data[3])
else:
cnt_bus = int(line_data[0])
cnt_tro = int(line_data[1])
else:
if line_id == 3:
cnt_bus_took = [0]
for data_str in line_data:
cnt_bus_took.append(int(data_str))
else:
cnt_tro_took = [0]
for data_str in line_data:
cnt_tro_took.append(int(data_str))
# calc min cost for bus
cost_bus = 0
for bus_id in range(cnt_bus + 1):
cost_bus = cost_bus + min(c1 * cnt_bus_took[bus_id], c2)
cost_bus = min(c3, cost_bus)
# calc min cost for tro
cost_tro = 0
for tro_id in range(cnt_tro + 1):
cost_tro = cost_tro + min(c1 * cnt_tro_took[tro_id], c2)
cost_tro = min(c3, cost_tro)
# calc min cost for all (bus and tro)
cost_all = min(c4, cost_bus + cost_tro)
print(cost_all)
```
| 3
|
|
255
|
A
|
Greg's Workout
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises.
|
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous.
|
[
"2\n2 8\n",
"3\n5 1 10\n",
"7\n3 3 2 7 9 6 8\n"
] |
[
"biceps\n",
"back\n",
"chest\n"
] |
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise.
| 500
|
[
{
"input": "2\n2 8",
"output": "biceps"
},
{
"input": "3\n5 1 10",
"output": "back"
},
{
"input": "7\n3 3 2 7 9 6 8",
"output": "chest"
},
{
"input": "4\n5 6 6 2",
"output": "chest"
},
{
"input": "5\n8 2 2 6 3",
"output": "chest"
},
{
"input": "6\n8 7 2 5 3 4",
"output": "chest"
},
{
"input": "8\n7 2 9 10 3 8 10 6",
"output": "chest"
},
{
"input": "9\n5 4 2 3 4 4 5 2 2",
"output": "chest"
},
{
"input": "10\n4 9 8 5 3 8 8 10 4 2",
"output": "biceps"
},
{
"input": "11\n10 9 7 6 1 3 9 7 1 3 5",
"output": "chest"
},
{
"input": "12\n24 22 6 16 5 21 1 7 2 19 24 5",
"output": "chest"
},
{
"input": "13\n24 10 5 7 16 17 2 7 9 20 15 2 24",
"output": "chest"
},
{
"input": "14\n13 14 19 8 5 17 9 16 15 9 5 6 3 7",
"output": "back"
},
{
"input": "15\n24 12 22 21 25 23 21 5 3 24 23 13 12 16 12",
"output": "chest"
},
{
"input": "16\n12 6 18 6 25 7 3 1 1 17 25 17 6 8 17 8",
"output": "biceps"
},
{
"input": "17\n13 8 13 4 9 21 10 10 9 22 14 23 22 7 6 14 19",
"output": "chest"
},
{
"input": "18\n1 17 13 6 11 10 25 13 24 9 21 17 3 1 17 12 25 21",
"output": "back"
},
{
"input": "19\n22 22 24 25 19 10 7 10 4 25 19 14 1 14 3 18 4 19 24",
"output": "chest"
},
{
"input": "20\n9 8 22 11 18 14 15 10 17 11 2 1 25 20 7 24 4 25 9 20",
"output": "chest"
},
{
"input": "1\n10",
"output": "chest"
},
{
"input": "2\n15 3",
"output": "chest"
},
{
"input": "3\n21 11 19",
"output": "chest"
},
{
"input": "4\n19 24 13 15",
"output": "chest"
},
{
"input": "5\n4 24 1 9 19",
"output": "biceps"
},
{
"input": "6\n6 22 24 7 15 24",
"output": "back"
},
{
"input": "7\n10 8 23 23 14 18 14",
"output": "chest"
},
{
"input": "8\n5 16 8 9 17 16 14 7",
"output": "biceps"
},
{
"input": "9\n12 3 10 23 6 4 22 13 12",
"output": "chest"
},
{
"input": "10\n1 9 20 18 20 17 7 24 23 2",
"output": "back"
},
{
"input": "11\n22 25 8 2 18 15 1 13 1 11 4",
"output": "biceps"
},
{
"input": "12\n20 12 14 2 15 6 24 3 11 8 11 14",
"output": "chest"
},
{
"input": "13\n2 18 8 8 8 20 5 22 15 2 5 19 18",
"output": "back"
},
{
"input": "14\n1 6 10 25 17 13 21 11 19 4 15 24 5 22",
"output": "biceps"
},
{
"input": "15\n13 5 25 13 17 25 19 21 23 17 12 6 14 8 6",
"output": "back"
},
{
"input": "16\n10 15 2 17 22 12 14 14 6 11 4 13 9 8 21 14",
"output": "chest"
},
{
"input": "17\n7 22 9 22 8 7 20 22 23 5 12 11 1 24 17 20 10",
"output": "biceps"
},
{
"input": "18\n18 15 4 25 5 11 21 25 12 14 25 23 19 19 13 6 9 17",
"output": "chest"
},
{
"input": "19\n3 1 3 15 15 25 10 25 23 10 9 21 13 23 19 3 24 21 14",
"output": "back"
},
{
"input": "20\n19 18 11 3 6 14 3 3 25 3 1 19 25 24 23 12 7 4 8 6",
"output": "back"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "2\n1 7",
"output": "biceps"
},
{
"input": "3\n18 18 23",
"output": "back"
},
{
"input": "4\n12 15 1 13",
"output": "chest"
},
{
"input": "5\n11 14 25 21 21",
"output": "biceps"
},
{
"input": "6\n11 9 12 11 22 18",
"output": "biceps"
},
{
"input": "7\n11 1 16 20 21 25 20",
"output": "chest"
},
{
"input": "8\n1 2 20 9 3 22 17 4",
"output": "back"
},
{
"input": "9\n19 2 10 19 15 20 3 1 13",
"output": "back"
},
{
"input": "10\n11 2 11 8 21 16 2 3 19 9",
"output": "back"
},
{
"input": "20\n25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 24",
"output": "chest"
},
{
"input": "12\n4 24 21 3 13 24 22 13 12 21 1 15",
"output": "back"
},
{
"input": "13\n14 14 16 2 13 5 1 14 9 4 16 8 3",
"output": "biceps"
},
{
"input": "14\n1 9 15 4 11 8 25 3 9 14 13 2 1 11",
"output": "biceps"
},
{
"input": "15\n4 19 10 6 16 12 5 11 7 23 1 24 11 7 17",
"output": "back"
},
{
"input": "16\n2 8 2 8 13 22 20 12 22 23 18 13 18 22 11 17",
"output": "chest"
},
{
"input": "17\n24 5 5 16 10 8 22 6 4 13 10 10 5 23 8 20 8",
"output": "chest"
},
{
"input": "18\n14 8 9 12 11 18 24 1 14 24 18 5 12 17 1 10 1 22",
"output": "chest"
},
{
"input": "19\n21 2 10 6 9 1 24 5 2 19 10 13 10 7 19 2 6 13 24",
"output": "chest"
},
{
"input": "20\n7 1 14 17 6 6 18 13 12 3 25 4 3 19 22 24 16 14 1 23",
"output": "biceps"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "20\n2 1 2 2 1 2 2 1 2 1 1 1 1 1 1 1 1 1 1 22",
"output": "biceps"
}
] | 1,620,805,993
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 61
| 124
| 6,963,200
|
def f(n,l):
x=["chest","biceps","back"]
if n==1:
return x[n-1]
if n==2:
return x[l.index(max(l))]
l2=[0,0,0]
for i in range(0,n,3):
l2[0]+=l[i]
for i in range(0,n-1,3):
l2[1]+=l[i+1]
for i in range(0,n-2,3):
l2[2]+=l[i+2]
return x[l2.index(max(l2))]
n=int(input())
l=list(map(int,input().split()))
print(f(n,l))
|
Title: Greg's Workout
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises.
Output Specification:
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous.
Demo Input:
['2\n2 8\n', '3\n5 1 10\n', '7\n3 3 2 7 9 6 8\n']
Demo Output:
['biceps\n', 'back\n', 'chest\n']
Note:
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise.
|
```python
def f(n,l):
x=["chest","biceps","back"]
if n==1:
return x[n-1]
if n==2:
return x[l.index(max(l))]
l2=[0,0,0]
for i in range(0,n,3):
l2[0]+=l[i]
for i in range(0,n-1,3):
l2[1]+=l[i+1]
for i in range(0,n-2,3):
l2[2]+=l[i+2]
return x[l2.index(max(l2))]
n=int(input())
l=list(map(int,input().split()))
print(f(n,l))
```
| 3
|
|
146
|
A
|
Lucky Ticket
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Petya loves lucky numbers very much. Everybody knows that lucky numbers are positive integers whose decimal record contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya loves tickets very much. As we know, each ticket has a number that is a positive integer. Its length equals *n* (*n* is always even). Petya calls a ticket lucky if the ticket's number is a lucky number and the sum of digits in the first half (the sum of the first *n*<=/<=2 digits) equals the sum of digits in the second half (the sum of the last *n*<=/<=2 digits). Check if the given ticket is lucky.
|
The first line contains an even integer *n* (2<=≤<=*n*<=≤<=50) — the length of the ticket number that needs to be checked. The second line contains an integer whose length equals exactly *n* — the ticket number. The number may contain leading zeros.
|
On the first line print "YES" if the given ticket number is lucky. Otherwise, print "NO" (without the quotes).
|
[
"2\n47\n",
"4\n4738\n",
"4\n4774\n"
] |
[
"NO\n",
"NO\n",
"YES\n"
] |
In the first sample the sum of digits in the first half does not equal the sum of digits in the second half (4 ≠ 7).
In the second sample the ticket number is not the lucky number.
| 500
|
[
{
"input": "2\n47",
"output": "NO"
},
{
"input": "4\n4738",
"output": "NO"
},
{
"input": "4\n4774",
"output": "YES"
},
{
"input": "4\n4570",
"output": "NO"
},
{
"input": "6\n477477",
"output": "YES"
},
{
"input": "6\n777777",
"output": "YES"
},
{
"input": "20\n44444444444444444444",
"output": "YES"
},
{
"input": "2\n44",
"output": "YES"
},
{
"input": "10\n4745474547",
"output": "NO"
},
{
"input": "14\n77770004444444",
"output": "NO"
},
{
"input": "10\n4747777744",
"output": "YES"
},
{
"input": "10\n1234567890",
"output": "NO"
},
{
"input": "50\n44444444444444444444444444444444444444444444444444",
"output": "YES"
},
{
"input": "50\n44444444444444444444444444444444444444444444444447",
"output": "NO"
},
{
"input": "50\n74444444444444444444444444444444444444444444444444",
"output": "NO"
},
{
"input": "50\n07777777777777777777777777777777777777777777777770",
"output": "NO"
},
{
"input": "50\n77777777777777777777777777777777777777777777777777",
"output": "YES"
},
{
"input": "50\n44747747774474747747747447777447774747447477444474",
"output": "YES"
},
{
"input": "48\n447474444777444474747747744774447444747474774474",
"output": "YES"
},
{
"input": "32\n74474474777444474444747774474774",
"output": "YES"
},
{
"input": "40\n4747777444447747777447447747447474774777",
"output": "YES"
},
{
"input": "10\n4477477444",
"output": "YES"
},
{
"input": "18\n447747474447744747",
"output": "YES"
},
{
"input": "26\n44747744444774744774474447",
"output": "YES"
},
{
"input": "50\n44707747774474747747747447777447774747447477444474",
"output": "NO"
},
{
"input": "40\n4747777444447737777447447747447474774777",
"output": "NO"
},
{
"input": "36\n764477744747444444447747747474744444",
"output": "NO"
},
{
"input": "22\n4477407474777477744447",
"output": "NO"
},
{
"input": "32\n74274474777444474444747774474774",
"output": "NO"
},
{
"input": "16\n4744447974444747",
"output": "NO"
},
{
"input": "2\n11",
"output": "NO"
},
{
"input": "2\n22",
"output": "NO"
},
{
"input": "2\n33",
"output": "NO"
},
{
"input": "2\n74",
"output": "NO"
},
{
"input": "2\n55",
"output": "NO"
},
{
"input": "2\n66",
"output": "NO"
},
{
"input": "2\n77",
"output": "YES"
},
{
"input": "2\n88",
"output": "NO"
},
{
"input": "2\n99",
"output": "NO"
},
{
"input": "4\n4004",
"output": "NO"
},
{
"input": "14\n00077774444444",
"output": "NO"
},
{
"input": "6\n004444",
"output": "NO"
},
{
"input": "4\n0044",
"output": "NO"
},
{
"input": "14\n77771114444444",
"output": "NO"
},
{
"input": "14\n44444447777000",
"output": "NO"
},
{
"input": "6\n004774",
"output": "NO"
}
] | 1,653,761,055
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
length = int(input())
num = int(input())
placehold = num
isLucky = True
strnum = str(num)
if any(c not in '74' for c in strnum):
isLucky = False
firsthalf = strnum[0:length//2]
lasthalf = strnum[length//2:length]
firstlist = list(map(int, list(firsthalf)))
lastlist = list(map(int, list(lasthalf)))
print(firstlist)
print(lastlist)
if sum(firstlist) != sum(lastlist):
isLucky = False
if isLucky:
print("YES")
else:
print("NO")
|
Title: Lucky Ticket
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya loves lucky numbers very much. Everybody knows that lucky numbers are positive integers whose decimal record contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya loves tickets very much. As we know, each ticket has a number that is a positive integer. Its length equals *n* (*n* is always even). Petya calls a ticket lucky if the ticket's number is a lucky number and the sum of digits in the first half (the sum of the first *n*<=/<=2 digits) equals the sum of digits in the second half (the sum of the last *n*<=/<=2 digits). Check if the given ticket is lucky.
Input Specification:
The first line contains an even integer *n* (2<=≤<=*n*<=≤<=50) — the length of the ticket number that needs to be checked. The second line contains an integer whose length equals exactly *n* — the ticket number. The number may contain leading zeros.
Output Specification:
On the first line print "YES" if the given ticket number is lucky. Otherwise, print "NO" (without the quotes).
Demo Input:
['2\n47\n', '4\n4738\n', '4\n4774\n']
Demo Output:
['NO\n', 'NO\n', 'YES\n']
Note:
In the first sample the sum of digits in the first half does not equal the sum of digits in the second half (4 ≠ 7).
In the second sample the ticket number is not the lucky number.
|
```python
length = int(input())
num = int(input())
placehold = num
isLucky = True
strnum = str(num)
if any(c not in '74' for c in strnum):
isLucky = False
firsthalf = strnum[0:length//2]
lasthalf = strnum[length//2:length]
firstlist = list(map(int, list(firsthalf)))
lastlist = list(map(int, list(lasthalf)))
print(firstlist)
print(lastlist)
if sum(firstlist) != sum(lastlist):
isLucky = False
if isLucky:
print("YES")
else:
print("NO")
```
| 0
|
|
476
|
A
|
Dreamoon and Stairs
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
Dreamoon wants to climb up a stair of *n* steps. He can climb 1 or 2 steps at each move. Dreamoon wants the number of moves to be a multiple of an integer *m*.
What is the minimal number of moves making him climb to the top of the stairs that satisfies his condition?
|
The single line contains two space separated integers *n*, *m* (0<=<<=*n*<=≤<=10000,<=1<=<<=*m*<=≤<=10).
|
Print a single integer — the minimal number of moves being a multiple of *m*. If there is no way he can climb satisfying condition print <=-<=1 instead.
|
[
"10 2\n",
"3 5\n"
] |
[
"6\n",
"-1\n"
] |
For the first sample, Dreamoon could climb in 6 moves with following sequence of steps: {2, 2, 2, 2, 1, 1}.
For the second sample, there are only three valid sequence of steps {2, 1}, {1, 2}, {1, 1, 1} with 2, 2, and 3 steps respectively. All these numbers are not multiples of 5.
| 500
|
[
{
"input": "10 2",
"output": "6"
},
{
"input": "3 5",
"output": "-1"
},
{
"input": "29 7",
"output": "21"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "1 2",
"output": "-1"
},
{
"input": "10000 2",
"output": "5000"
},
{
"input": "10000 3",
"output": "5001"
},
{
"input": "10000 10",
"output": "5000"
},
{
"input": "9999 3",
"output": "5001"
},
{
"input": "9999 2",
"output": "5000"
},
{
"input": "9999 10",
"output": "5000"
},
{
"input": "9999 9",
"output": "5004"
},
{
"input": "18 10",
"output": "10"
},
{
"input": "19 10",
"output": "10"
},
{
"input": "20 10",
"output": "10"
},
{
"input": "21 10",
"output": "20"
},
{
"input": "7688 5",
"output": "3845"
},
{
"input": "4608 5",
"output": "2305"
},
{
"input": "3979 2",
"output": "1990"
},
{
"input": "9985 6",
"output": "4998"
},
{
"input": "3230 8",
"output": "1616"
},
{
"input": "24 9",
"output": "18"
},
{
"input": "3275 8",
"output": "1640"
},
{
"input": "6240 7",
"output": "3122"
},
{
"input": "5227 4",
"output": "2616"
},
{
"input": "3832 6",
"output": "1920"
},
{
"input": "4 2",
"output": "2"
},
{
"input": "6 3",
"output": "3"
},
{
"input": "10 5",
"output": "5"
},
{
"input": "3 2",
"output": "2"
},
{
"input": "6 4",
"output": "4"
},
{
"input": "5 2",
"output": "4"
},
{
"input": "8 2",
"output": "4"
},
{
"input": "9 9",
"output": "9"
},
{
"input": "4 5",
"output": "-1"
}
] | 1,688,504,492
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 31
| 0
|
import math
n,m = map(int,input().split())
for i in range(math.ceil(n//2),n+1):
if i % m == 0:
print(i)
break
else:
print(-1)
|
Title: Dreamoon and Stairs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dreamoon wants to climb up a stair of *n* steps. He can climb 1 or 2 steps at each move. Dreamoon wants the number of moves to be a multiple of an integer *m*.
What is the minimal number of moves making him climb to the top of the stairs that satisfies his condition?
Input Specification:
The single line contains two space separated integers *n*, *m* (0<=<<=*n*<=≤<=10000,<=1<=<<=*m*<=≤<=10).
Output Specification:
Print a single integer — the minimal number of moves being a multiple of *m*. If there is no way he can climb satisfying condition print <=-<=1 instead.
Demo Input:
['10 2\n', '3 5\n']
Demo Output:
['6\n', '-1\n']
Note:
For the first sample, Dreamoon could climb in 6 moves with following sequence of steps: {2, 2, 2, 2, 1, 1}.
For the second sample, there are only three valid sequence of steps {2, 1}, {1, 2}, {1, 1, 1} with 2, 2, and 3 steps respectively. All these numbers are not multiples of 5.
|
```python
import math
n,m = map(int,input().split())
for i in range(math.ceil(n//2),n+1):
if i % m == 0:
print(i)
break
else:
print(-1)
```
| 0
|
|
46
|
A
|
Ball Game
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] |
A. Ball Game
|
2
|
256
|
A kindergarten teacher Natalia Pavlovna has invented a new ball game. This game not only develops the children's physique, but also teaches them how to count.
The game goes as follows. Kids stand in circle. Let's agree to think of the children as numbered with numbers from 1 to *n* clockwise and the child number 1 is holding the ball. First the first child throws the ball to the next one clockwise, i.e. to the child number 2. Then the child number 2 throws the ball to the next but one child, i.e. to the child number 4, then the fourth child throws the ball to the child that stands two children away from him, i.e. to the child number 7, then the ball is thrown to the child who stands 3 children away from the child number 7, then the ball is thrown to the child who stands 4 children away from the last one, and so on. It should be mentioned that when a ball is thrown it may pass the beginning of the circle. For example, if *n*<==<=5, then after the third throw the child number 2 has the ball again. Overall, *n*<=-<=1 throws are made, and the game ends.
The problem is that not all the children get the ball during the game. If a child doesn't get the ball, he gets very upset and cries until Natalia Pavlovna gives him a candy. That's why Natalia Pavlovna asks you to help her to identify the numbers of the children who will get the ball after each throw.
|
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) which indicates the number of kids in the circle.
|
In the single line print *n*<=-<=1 numbers which are the numbers of children who will get the ball after each throw. Separate the numbers by spaces.
|
[
"10\n",
"3\n"
] |
[
"2 4 7 1 6 2 9 7 6\n",
"2 1\n"
] |
none
| 0
|
[
{
"input": "10",
"output": "2 4 7 1 6 2 9 7 6"
},
{
"input": "3",
"output": "2 1"
},
{
"input": "4",
"output": "2 4 3"
},
{
"input": "5",
"output": "2 4 2 1"
},
{
"input": "6",
"output": "2 4 1 5 4"
},
{
"input": "7",
"output": "2 4 7 4 2 1"
},
{
"input": "8",
"output": "2 4 7 3 8 6 5"
},
{
"input": "9",
"output": "2 4 7 2 7 4 2 1"
},
{
"input": "2",
"output": "2"
},
{
"input": "11",
"output": "2 4 7 11 5 11 7 4 2 1"
},
{
"input": "12",
"output": "2 4 7 11 4 10 5 1 10 8 7"
},
{
"input": "13",
"output": "2 4 7 11 3 9 3 11 7 4 2 1"
},
{
"input": "20",
"output": "2 4 7 11 16 2 9 17 6 16 7 19 12 6 1 17 14 12 11"
},
{
"input": "25",
"output": "2 4 7 11 16 22 4 12 21 6 17 4 17 6 21 12 4 22 16 11 7 4 2 1"
},
{
"input": "30",
"output": "2 4 7 11 16 22 29 7 16 26 7 19 2 16 1 17 4 22 11 1 22 14 7 1 26 22 19 17 16"
},
{
"input": "35",
"output": "2 4 7 11 16 22 29 2 11 21 32 9 22 1 16 32 14 32 16 1 22 9 32 21 11 2 29 22 16 11 7 4 2 1"
},
{
"input": "40",
"output": "2 4 7 11 16 22 29 37 6 16 27 39 12 26 1 17 34 12 31 11 32 14 37 21 6 32 19 7 36 26 17 9 2 36 31 27 24 22 21"
},
{
"input": "45",
"output": "2 4 7 11 16 22 29 37 1 11 22 34 2 16 31 2 19 37 11 31 7 29 7 31 11 37 19 2 31 16 2 34 22 11 1 37 29 22 16 11 7 4 2 1"
},
{
"input": "50",
"output": "2 4 7 11 16 22 29 37 46 6 17 29 42 6 21 37 4 22 41 11 32 4 27 1 26 2 29 7 36 16 47 29 12 46 31 17 4 42 31 21 12 4 47 41 36 32 29 27 26"
},
{
"input": "55",
"output": "2 4 7 11 16 22 29 37 46 1 12 24 37 51 11 27 44 7 26 46 12 34 2 26 51 22 49 22 51 26 2 34 12 46 26 7 44 27 11 51 37 24 12 1 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "60",
"output": "2 4 7 11 16 22 29 37 46 56 7 19 32 46 1 17 34 52 11 31 52 14 37 1 26 52 19 47 16 46 17 49 22 56 31 7 44 22 1 41 22 4 47 31 16 2 49 37 26 16 7 59 52 46 41 37 34 32 31"
},
{
"input": "65",
"output": "2 4 7 11 16 22 29 37 46 56 2 14 27 41 56 7 24 42 61 16 37 59 17 41 1 27 54 17 46 11 42 9 42 11 46 17 54 27 1 41 17 59 37 16 61 42 24 7 56 41 27 14 2 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "70",
"output": "2 4 7 11 16 22 29 37 46 56 67 9 22 36 51 67 14 32 51 1 22 44 67 21 46 2 29 57 16 46 7 39 2 36 1 37 4 42 11 51 22 64 37 11 56 32 9 57 36 16 67 49 32 16 1 57 44 32 21 11 2 64 57 51 46 42 39 37 36"
},
{
"input": "75",
"output": "2 4 7 11 16 22 29 37 46 56 67 4 17 31 46 62 4 22 41 61 7 29 52 1 26 52 4 32 61 16 47 4 37 71 31 67 29 67 31 71 37 4 47 16 61 32 4 52 26 1 52 29 7 61 41 22 4 62 46 31 17 4 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "80",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 12 26 41 57 74 12 31 51 72 14 37 61 6 32 59 7 36 66 17 49 2 36 71 27 64 22 61 21 62 24 67 31 76 42 9 57 26 76 47 19 72 46 21 77 54 32 11 71 52 34 17 1 66 52 39 27 16 6 77 69 62 56 51 47 44 42 41"
},
{
"input": "85",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 7 21 36 52 69 2 21 41 62 84 22 46 71 12 39 67 11 41 72 19 52 1 36 72 24 62 16 56 12 54 12 56 16 62 24 72 36 1 52 19 72 41 11 67 39 12 71 46 22 84 62 41 21 2 69 52 36 21 7 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "90",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 2 16 31 47 64 82 11 31 52 74 7 31 56 82 19 47 76 16 47 79 22 56 1 37 74 22 61 11 52 4 47 1 46 2 49 7 56 16 67 29 82 46 11 67 34 2 61 31 2 64 37 11 76 52 29 7 76 56 37 19 2 76 61 47 34 22 11 1 82 74 67 61 56 52 49 47 46"
},
{
"input": "95",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 11 26 42 59 77 1 21 42 64 87 16 41 67 94 27 56 86 22 54 87 26 61 2 39 77 21 61 7 49 92 41 86 37 84 37 86 41 92 49 7 61 21 77 39 2 61 26 87 54 22 86 56 27 94 67 41 16 87 64 42 21 1 77 59 42 26 11 92 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "96",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 10 25 41 58 76 95 19 40 62 85 13 38 64 91 23 52 82 17 49 82 20 55 91 32 70 13 53 94 40 83 31 76 26 73 25 74 28 79 35 88 46 5 61 22 80 43 7 68 34 1 65 34 4 71 43 16 86 61 37 14 88 67 47 28 10 89 73 58 44 31 19 8 94 85 77 70 64 59 55 52 50 49"
},
{
"input": "97",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 9 24 40 57 75 94 17 38 60 83 10 35 61 88 19 48 78 12 44 77 14 49 85 25 63 5 45 86 31 74 21 66 15 62 13 62 15 66 21 74 31 86 45 5 63 25 85 49 14 77 44 12 78 48 19 88 61 35 10 83 60 38 17 94 75 57 40 24 9 92 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "98",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 8 23 39 56 74 93 15 36 58 81 7 32 58 85 15 44 74 7 39 72 8 43 79 18 56 95 37 78 22 65 11 56 4 51 1 50 2 53 7 60 16 71 29 86 46 7 67 30 92 57 23 88 56 25 93 64 36 9 81 56 32 9 85 64 44 25 7 88 72 57 43 30 18 7 95 86 78 71 65 60 56 53 51 50"
},
{
"input": "99",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 7 22 38 55 73 92 13 34 56 79 4 29 55 82 11 40 70 2 34 67 2 37 73 11 49 88 29 70 13 56 1 46 92 40 88 38 88 40 92 46 1 56 13 70 29 88 49 11 73 37 2 67 34 2 70 40 11 82 55 29 4 79 56 34 13 92 73 55 38 22 7 92 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "100",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 6 21 37 54 72 91 11 32 54 77 1 26 52 79 7 36 66 97 29 62 96 31 67 4 42 81 21 62 4 47 91 36 82 29 77 26 76 27 79 32 86 41 97 54 12 71 31 92 54 17 81 46 12 79 47 16 86 57 29 2 76 51 27 4 82 61 41 22 4 87 71 56 42 29 17 6 96 87 79 72 66 61 57 54 52 51"
}
] | 1,629,203,815
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 33
| 124
| 6,758,400
|
n = int(input())
a = [i for i in range(1,n+1)]*n
b = []
for i in range(n):
b.append(a[(i*(i+1)//2)])
print(*b[1:])
|
Title: Ball Game
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A kindergarten teacher Natalia Pavlovna has invented a new ball game. This game not only develops the children's physique, but also teaches them how to count.
The game goes as follows. Kids stand in circle. Let's agree to think of the children as numbered with numbers from 1 to *n* clockwise and the child number 1 is holding the ball. First the first child throws the ball to the next one clockwise, i.e. to the child number 2. Then the child number 2 throws the ball to the next but one child, i.e. to the child number 4, then the fourth child throws the ball to the child that stands two children away from him, i.e. to the child number 7, then the ball is thrown to the child who stands 3 children away from the child number 7, then the ball is thrown to the child who stands 4 children away from the last one, and so on. It should be mentioned that when a ball is thrown it may pass the beginning of the circle. For example, if *n*<==<=5, then after the third throw the child number 2 has the ball again. Overall, *n*<=-<=1 throws are made, and the game ends.
The problem is that not all the children get the ball during the game. If a child doesn't get the ball, he gets very upset and cries until Natalia Pavlovna gives him a candy. That's why Natalia Pavlovna asks you to help her to identify the numbers of the children who will get the ball after each throw.
Input Specification:
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) which indicates the number of kids in the circle.
Output Specification:
In the single line print *n*<=-<=1 numbers which are the numbers of children who will get the ball after each throw. Separate the numbers by spaces.
Demo Input:
['10\n', '3\n']
Demo Output:
['2 4 7 1 6 2 9 7 6\n', '2 1\n']
Note:
none
|
```python
n = int(input())
a = [i for i in range(1,n+1)]*n
b = []
for i in range(n):
b.append(a[(i*(i+1)//2)])
print(*b[1:])
```
| 3.956411
|
817
|
A
|
Treasure Hunt
|
PROGRAMMING
| 1,200
|
[
"implementation",
"math",
"number theory"
] | null | null |
Captain Bill the Hummingbird and his crew recieved an interesting challenge offer. Some stranger gave them a map, potion of teleportation and said that only this potion might help them to reach the treasure.
Bottle with potion has two values *x* and *y* written on it. These values define four moves which can be performed using the potion:
- - - -
Map shows that the position of Captain Bill the Hummingbird is (*x*1,<=*y*1) and the position of the treasure is (*x*2,<=*y*2).
You task is to tell Captain Bill the Hummingbird whether he should accept this challenge or decline. If it is possible for Captain to reach the treasure using the potion then output "YES", otherwise "NO" (without quotes).
The potion can be used infinite amount of times.
|
The first line contains four integer numbers *x*1,<=*y*1,<=*x*2,<=*y*2 (<=-<=105<=≤<=*x*1,<=*y*1,<=*x*2,<=*y*2<=≤<=105) — positions of Captain Bill the Hummingbird and treasure respectively.
The second line contains two integer numbers *x*,<=*y* (1<=≤<=*x*,<=*y*<=≤<=105) — values on the potion bottle.
|
Print "YES" if it is possible for Captain to reach the treasure using the potion, otherwise print "NO" (without quotes).
|
[
"0 0 0 6\n2 3\n",
"1 1 3 6\n1 5\n"
] |
[
"YES\n",
"NO\n"
] |
In the first example there exists such sequence of moves:
1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7c939890fb4ed35688177327dac981bfa9216c00.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the first type of move 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/afbfa42fbac4e0641e7466e3aac74cbbb08ed597.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the third type of move
| 0
|
[
{
"input": "0 0 0 6\n2 3",
"output": "YES"
},
{
"input": "1 1 3 6\n1 5",
"output": "NO"
},
{
"input": "5 4 6 -10\n1 1",
"output": "NO"
},
{
"input": "6 -3 -7 -7\n1 2",
"output": "NO"
},
{
"input": "2 -5 -8 8\n2 1",
"output": "YES"
},
{
"input": "70 -81 -17 80\n87 23",
"output": "YES"
},
{
"input": "41 366 218 -240\n3456 1234",
"output": "NO"
},
{
"input": "-61972 -39646 -42371 -24854\n573 238",
"output": "NO"
},
{
"input": "-84870 -42042 94570 98028\n8972 23345",
"output": "YES"
},
{
"input": "-58533 -50999 -1007 -59169\n8972 23345",
"output": "NO"
},
{
"input": "-100000 -100000 100000 100000\n100000 100000",
"output": "YES"
},
{
"input": "-100000 -100000 100000 100000\n1 1",
"output": "YES"
},
{
"input": "5 2 5 3\n1 1",
"output": "NO"
},
{
"input": "5 5 5 5\n5 5",
"output": "YES"
},
{
"input": "0 0 1000 1000\n1 1",
"output": "YES"
},
{
"input": "0 0 0 1\n1 1",
"output": "NO"
},
{
"input": "1 1 4 4\n2 2",
"output": "NO"
},
{
"input": "100000 100000 99999 99999\n100000 100000",
"output": "NO"
},
{
"input": "1 1 1 6\n1 5",
"output": "NO"
},
{
"input": "2 9 4 0\n2 3",
"output": "YES"
},
{
"input": "0 0 0 9\n2 3",
"output": "NO"
},
{
"input": "14 88 14 88\n100 500",
"output": "YES"
},
{
"input": "-1 0 3 0\n4 4",
"output": "NO"
},
{
"input": "0 0 8 9\n2 3",
"output": "NO"
},
{
"input": "-2 5 7 -6\n1 1",
"output": "YES"
},
{
"input": "3 7 -8 8\n2 2",
"output": "NO"
},
{
"input": "-4 -8 -6 -1\n1 3",
"output": "NO"
},
{
"input": "0 8 6 2\n1 1",
"output": "YES"
},
{
"input": "-5 -2 -8 -2\n1 1",
"output": "NO"
},
{
"input": "1 4 -5 0\n1 1",
"output": "YES"
},
{
"input": "8 -4 4 -7\n1 2",
"output": "NO"
},
{
"input": "5 2 2 4\n2 2",
"output": "NO"
},
{
"input": "2 0 -4 6\n1 2",
"output": "NO"
},
{
"input": "-2 6 -5 -4\n1 2",
"output": "YES"
},
{
"input": "-6 5 10 6\n2 4",
"output": "NO"
},
{
"input": "3 -7 1 -8\n1 2",
"output": "NO"
},
{
"input": "4 1 4 -4\n9 4",
"output": "NO"
},
{
"input": "9 -3 -9 -3\n2 2",
"output": "NO"
},
{
"input": "-6 -6 -10 -5\n6 7",
"output": "NO"
},
{
"input": "-5 -2 2 2\n1 7",
"output": "NO"
},
{
"input": "9 0 8 1\n7 10",
"output": "NO"
},
{
"input": "-1 6 -7 -6\n6 4",
"output": "YES"
},
{
"input": "2 2 -3 -3\n3 1",
"output": "NO"
},
{
"input": "2 -6 7 2\n2 1",
"output": "NO"
},
{
"input": "-6 2 -7 -7\n1 2",
"output": "NO"
},
{
"input": "-5 -5 -1 -5\n2 2",
"output": "YES"
},
{
"input": "0 5 3 -6\n2 2",
"output": "NO"
},
{
"input": "0 -6 2 -1\n1 1",
"output": "NO"
},
{
"input": "-6 6 -5 -4\n1 2",
"output": "YES"
},
{
"input": "7 -7 1 -7\n2 2",
"output": "NO"
},
{
"input": "99966 -99952 -99966 99923\n1 1",
"output": "NO"
},
{
"input": "99921 99980 -99956 -99907\n3 4",
"output": "NO"
},
{
"input": "100000 100000 -100000 -100000\n1 1",
"output": "YES"
},
{
"input": "1 0 2 0\n5 1",
"output": "NO"
},
{
"input": "-3 0 -8 0\n7 2",
"output": "NO"
},
{
"input": "-9 4 -5 -1\n8 2",
"output": "NO"
},
{
"input": "-99999 -100000 100000 100000\n1 1",
"output": "NO"
},
{
"input": "0 0 -100 -100\n2 2",
"output": "YES"
},
{
"input": "9 -5 -3 -2\n1 4",
"output": "NO"
},
{
"input": "1 -10 -10 5\n7 5",
"output": "NO"
},
{
"input": "6 -9 -1 -9\n1 9",
"output": "NO"
}
] | 1,664,058,769
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 16
| 46
| 0
|
x1,y1,x2,y2=map(int,input().split())
x,y=map(int,input().split())
aux = abs(x2-x1)
aux2 = abs(y2-y1)
aux3 = aux%x
aux4 = aux2%y
if (aux/x)%2 == (aux2/y)%2:
if aux3 == 0 and aux4 == 0:
print('YES')
else:
print('NO')
|
Title: Treasure Hunt
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Captain Bill the Hummingbird and his crew recieved an interesting challenge offer. Some stranger gave them a map, potion of teleportation and said that only this potion might help them to reach the treasure.
Bottle with potion has two values *x* and *y* written on it. These values define four moves which can be performed using the potion:
- - - -
Map shows that the position of Captain Bill the Hummingbird is (*x*1,<=*y*1) and the position of the treasure is (*x*2,<=*y*2).
You task is to tell Captain Bill the Hummingbird whether he should accept this challenge or decline. If it is possible for Captain to reach the treasure using the potion then output "YES", otherwise "NO" (without quotes).
The potion can be used infinite amount of times.
Input Specification:
The first line contains four integer numbers *x*1,<=*y*1,<=*x*2,<=*y*2 (<=-<=105<=≤<=*x*1,<=*y*1,<=*x*2,<=*y*2<=≤<=105) — positions of Captain Bill the Hummingbird and treasure respectively.
The second line contains two integer numbers *x*,<=*y* (1<=≤<=*x*,<=*y*<=≤<=105) — values on the potion bottle.
Output Specification:
Print "YES" if it is possible for Captain to reach the treasure using the potion, otherwise print "NO" (without quotes).
Demo Input:
['0 0 0 6\n2 3\n', '1 1 3 6\n1 5\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first example there exists such sequence of moves:
1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7c939890fb4ed35688177327dac981bfa9216c00.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the first type of move 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/afbfa42fbac4e0641e7466e3aac74cbbb08ed597.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the third type of move
|
```python
x1,y1,x2,y2=map(int,input().split())
x,y=map(int,input().split())
aux = abs(x2-x1)
aux2 = abs(y2-y1)
aux3 = aux%x
aux4 = aux2%y
if (aux/x)%2 == (aux2/y)%2:
if aux3 == 0 and aux4 == 0:
print('YES')
else:
print('NO')
```
| 0
|
|
439
|
A
|
Devu, the Singer and Churu, the Joker
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
|
The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100).
|
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
|
[
"3 30\n2 2 1\n",
"3 20\n2 1 1\n"
] |
[
"5\n",
"-1\n"
] |
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
| 500
|
[
{
"input": "3 30\n2 2 1",
"output": "5"
},
{
"input": "3 20\n2 1 1",
"output": "-1"
},
{
"input": "50 10000\n5 4 10 9 9 6 7 7 7 3 3 7 7 4 7 4 10 10 1 7 10 3 1 4 5 7 2 10 10 10 2 3 4 7 6 1 8 4 7 3 8 8 4 10 1 1 9 2 6 1",
"output": "1943"
},
{
"input": "50 10000\n4 7 15 9 11 12 20 9 14 14 10 13 6 13 14 17 6 8 20 12 10 15 13 17 5 12 13 11 7 5 5 2 3 15 13 7 14 14 19 2 13 14 5 15 3 19 15 16 4 1",
"output": "1891"
},
{
"input": "100 9000\n5 2 3 1 1 3 4 9 9 6 7 10 10 10 2 10 6 8 8 6 7 9 9 5 6 2 1 10 10 9 4 5 9 2 4 3 8 5 6 1 1 5 3 6 2 6 6 6 5 8 3 6 7 3 1 10 9 1 8 3 10 9 5 6 3 4 1 1 10 10 2 3 4 8 10 10 5 1 5 3 6 8 10 6 10 2 1 8 10 1 7 6 9 10 5 2 3 5 3 2",
"output": "1688"
},
{
"input": "100 8007\n5 19 14 18 9 6 15 8 1 14 11 20 3 17 7 12 2 6 3 17 7 20 1 14 20 17 2 10 13 7 18 18 9 10 16 8 1 11 11 9 13 18 9 20 12 12 7 15 12 17 11 5 11 15 9 2 15 1 18 3 18 16 15 4 10 5 18 13 13 12 3 8 17 2 12 2 13 3 1 13 2 4 9 10 18 10 14 4 4 17 12 19 2 9 6 5 5 20 18 12",
"output": "1391"
},
{
"input": "39 2412\n1 1 1 1 1 1 26 1 1 1 99 1 1 1 1 1 1 1 1 1 1 88 7 1 1 1 1 76 1 1 1 93 40 1 13 1 68 1 32",
"output": "368"
},
{
"input": "39 2617\n47 1 1 1 63 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 70 1 99 63 1 1 1 1 1 1 1 1 64 1 1",
"output": "435"
},
{
"input": "39 3681\n83 77 1 94 85 47 1 98 29 16 1 1 1 71 96 85 31 97 96 93 40 50 98 1 60 51 1 96 100 72 1 1 1 89 1 93 1 92 100",
"output": "326"
},
{
"input": "45 894\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 28 1 1 1 1 1 1 1 1 1 1 1 1 1 1 99 3 1 1",
"output": "139"
},
{
"input": "45 4534\n1 99 65 99 4 46 54 80 51 30 96 1 28 30 44 70 78 1 1 100 1 62 1 1 1 85 1 1 1 61 1 46 75 1 61 77 97 26 67 1 1 63 81 85 86",
"output": "514"
},
{
"input": "72 3538\n52 1 8 1 1 1 7 1 1 1 1 48 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 40 1 1 38 1 1 1 1 1 1 1 1 1 1 1 35 1 93 79 1 1 1 1 1 1 1 1 1 51 1 1 1 1 1 1 1 1 1 1 1 1 96 1",
"output": "586"
},
{
"input": "81 2200\n1 59 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 93 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 50 1 1 1 1 1 1 1 1 1 1 1",
"output": "384"
},
{
"input": "81 2577\n85 91 1 1 2 1 1 100 1 80 1 1 17 86 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 37 1 66 24 1 1 96 49 1 66 1 44 1 1 1 1 98 1 1 1 1 35 1 37 3 35 1 1 87 64 1 24 1 58 1 1 42 83 5 1 1 1 1 1 95 1 94 1 50 1 1",
"output": "174"
},
{
"input": "81 4131\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 16 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "807"
},
{
"input": "81 6315\n1 1 67 100 1 99 36 1 92 5 1 96 42 12 1 57 91 1 1 66 41 30 74 95 1 37 1 39 91 69 1 52 77 47 65 1 1 93 96 74 90 35 85 76 71 92 92 1 1 67 92 74 1 1 86 76 35 1 56 16 27 57 37 95 1 40 20 100 51 1 80 60 45 79 95 1 46 1 25 100 96",
"output": "490"
},
{
"input": "96 1688\n1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 25 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 71 1 1 1 30 1 1 1",
"output": "284"
},
{
"input": "96 8889\n1 1 18 1 1 1 1 1 1 1 1 1 99 1 1 1 1 88 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 96 1 1 1 1 21 1 1 1 1 1 1 1 73 1 1 1 1 1 10 1 1 1 1 1 1 1 46 43 1 1 1 1 1 98 1 1 1 1 1 1 6 1 1 1 1 1 74 1 25 1 55 1 1 1 13 1 1 54 1 1 1",
"output": "1589"
},
{
"input": "10 100\n1 1 1 1 1 1 1 1 1 1",
"output": "18"
},
{
"input": "100 10000\n54 46 72 94 79 83 91 54 73 3 24 55 54 31 28 20 19 6 25 19 47 23 1 70 15 87 51 39 54 77 55 5 60 3 15 99 56 88 22 78 79 21 38 27 28 86 7 88 12 59 55 70 25 1 70 49 1 45 69 72 50 17 4 56 8 100 90 34 35 20 61 76 88 79 4 74 65 68 75 26 40 72 59 94 10 67 96 85 29 90 47 24 44 1 66 93 55 36 1 99",
"output": "1017"
},
{
"input": "100 6000\n41 31 23 17 24 78 26 96 93 48 46 2 49 33 35 9 73 100 34 48 83 36 33 69 43 24 3 74 8 81 27 33 94 38 77 9 76 90 62 90 21 67 22 22 12 2 17 27 61 18 72 85 59 65 71 38 90 75 74 66 60 47 58 50 90 95 75 10 5 100 97 29 83 88 65 26 93 90 22 98 36 55 70 38 50 92 88 72 99 96 25 14 74 16 25 92 67 94 77 96",
"output": "-1"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 6\n1",
"output": "1"
},
{
"input": "1 5\n1",
"output": "0"
},
{
"input": "1 3\n4",
"output": "-1"
},
{
"input": "3 24\n2 1 2",
"output": "-1"
}
] | 1,616,138,372
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 26
| 77
| 0
|
n,m=map(int,input().split())
x=list(map(int,input().split()))
if sum(x)+(n-1)*10>m:
print(-1)
else:
m=(m-sum(x))//5
print(m)
|
Title: Devu, the Singer and Churu, the Joker
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
Input Specification:
The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100).
Output Specification:
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
Demo Input:
['3 30\n2 2 1\n', '3 20\n2 1 1\n']
Demo Output:
['5\n', '-1\n']
Note:
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
|
```python
n,m=map(int,input().split())
x=list(map(int,input().split()))
if sum(x)+(n-1)*10>m:
print(-1)
else:
m=(m-sum(x))//5
print(m)
```
| 3
|
|
839
|
C
|
Journey
|
PROGRAMMING
| 1,500
|
[
"dfs and similar",
"dp",
"graphs",
"probabilities",
"trees"
] | null | null |
There are *n* cities and *n*<=-<=1 roads in the Seven Kingdoms, each road connects two cities and we can reach any city from any other by the roads.
Theon and Yara Greyjoy are on a horse in the first city, they are starting traveling through the roads. But the weather is foggy, so they can’t see where the horse brings them. When the horse reaches a city (including the first one), it goes to one of the cities connected to the current city. But it is a strange horse, it only goes to cities in which they weren't before. In each such city, the horse goes with equal probabilities and it stops when there are no such cities.
Let the length of each road be 1. The journey starts in the city 1. What is the expected length (expected value of length) of their journey? You can read about expected (average) value by the link [https://en.wikipedia.org/wiki/Expected_value](https://en.wikipedia.org/wiki/Expected_value).
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100000) — number of cities.
Then *n*<=-<=1 lines follow. The *i*-th line of these lines contains two integers *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*, *u**i*<=≠<=*v**i*) — the cities connected by the *i*-th road.
It is guaranteed that one can reach any city from any other by the roads.
|
Print a number — the expected length of their journey. The journey starts in the city 1.
Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6.
Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
|
[
"4\n1 2\n1 3\n2 4\n",
"5\n1 2\n1 3\n3 4\n2 5\n"
] |
[
"1.500000000000000\n",
"2.000000000000000\n"
] |
In the first sample, their journey may end in cities 3 or 4 with equal probability. The distance to city 3 is 1 and to city 4 is 2, so the expected length is 1.5.
In the second sample, their journey may end in city 4 or 5. The distance to the both cities is 2, so the expected length is 2.
| 1,500
|
[
{
"input": "4\n1 2\n1 3\n2 4",
"output": "1.500000000000000"
},
{
"input": "5\n1 2\n1 3\n3 4\n2 5",
"output": "2.000000000000000"
},
{
"input": "70\n1 25\n57 1\n18 1\n65 1\n38 1\n1 41\n1 5\n1 69\n1 3\n31 1\n1 8\n1 9\n53 1\n70 1\n45 1\n1 24\n1 42\n1 30\n1 12\n1 37\n64 1\n1 28\n1 58\n1 22\n11 1\n1 4\n1 27\n1 16\n1 21\n54 1\n1 51\n1 43\n29 1\n56 1\n1 39\n32 1\n1 15\n1 17\n1 19\n1 40\n36 1\n48 1\n63 1\n1 7\n1 47\n1 13\n1 46\n60 1\n1 6\n23 1\n20 1\n1 52\n2 1\n26 1\n1 59\n1 66\n10 1\n1 62\n1 68\n1 55\n50 1\n33 1\n44 1\n1 34\n1 35\n1 61\n14 1\n67 1\n49 1",
"output": "1.000000000000000"
},
{
"input": "10\n8 6\n9 10\n8 7\n1 4\n1 8\n9 5\n9 8\n2 5\n3 1",
"output": "1.500000000000000"
},
{
"input": "1",
"output": "0.000000000000000"
}
] | 1,587,408,101
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 576
| 24,678,400
|
#https://codeforces.com/problemset/problem/839/C
from collections import defaultdict
class Graph:
def __init__(self):
self.dict = defaultdict(set)
def main():
n_cities = int(input())
g = Graph()
s = []
visited = set()
for i in range(0,n_cities-1):
u, v = (int(j) for j in input().split())
g.dict[u].add(v)
g.dict[v].add(u)
#dfs
e = 0
s.append((1,0,1))
while s:
city, l, p = s.pop()
neighbors = [c for c in g.dict[city] if c not in visited]
n = len(neighbors)
if n == 0:
e += l*p
else:
new_p = p/n
for neighbor in neighbors:
s.append((neighbor, l+1, new_p))
visited.add(city)
print(e)
if __name__ == "__main__":
main()
|
Title: Journey
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* cities and *n*<=-<=1 roads in the Seven Kingdoms, each road connects two cities and we can reach any city from any other by the roads.
Theon and Yara Greyjoy are on a horse in the first city, they are starting traveling through the roads. But the weather is foggy, so they can’t see where the horse brings them. When the horse reaches a city (including the first one), it goes to one of the cities connected to the current city. But it is a strange horse, it only goes to cities in which they weren't before. In each such city, the horse goes with equal probabilities and it stops when there are no such cities.
Let the length of each road be 1. The journey starts in the city 1. What is the expected length (expected value of length) of their journey? You can read about expected (average) value by the link [https://en.wikipedia.org/wiki/Expected_value](https://en.wikipedia.org/wiki/Expected_value).
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100000) — number of cities.
Then *n*<=-<=1 lines follow. The *i*-th line of these lines contains two integers *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*, *u**i*<=≠<=*v**i*) — the cities connected by the *i*-th road.
It is guaranteed that one can reach any city from any other by the roads.
Output Specification:
Print a number — the expected length of their journey. The journey starts in the city 1.
Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6.
Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
Demo Input:
['4\n1 2\n1 3\n2 4\n', '5\n1 2\n1 3\n3 4\n2 5\n']
Demo Output:
['1.500000000000000\n', '2.000000000000000\n']
Note:
In the first sample, their journey may end in cities 3 or 4 with equal probability. The distance to city 3 is 1 and to city 4 is 2, so the expected length is 1.5.
In the second sample, their journey may end in city 4 or 5. The distance to the both cities is 2, so the expected length is 2.
|
```python
#https://codeforces.com/problemset/problem/839/C
from collections import defaultdict
class Graph:
def __init__(self):
self.dict = defaultdict(set)
def main():
n_cities = int(input())
g = Graph()
s = []
visited = set()
for i in range(0,n_cities-1):
u, v = (int(j) for j in input().split())
g.dict[u].add(v)
g.dict[v].add(u)
#dfs
e = 0
s.append((1,0,1))
while s:
city, l, p = s.pop()
neighbors = [c for c in g.dict[city] if c not in visited]
n = len(neighbors)
if n == 0:
e += l*p
else:
new_p = p/n
for neighbor in neighbors:
s.append((neighbor, l+1, new_p))
visited.add(city)
print(e)
if __name__ == "__main__":
main()
```
| 3
|
|
385
|
A
|
Bear and Raspberry
|
PROGRAMMING
| 1,000
|
[
"brute force",
"greedy",
"implementation"
] | null | null |
The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=≤<=*i*<=≤<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry.
Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=≤<=*d*<=<<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel.
The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan.
|
The first line contains two space-separated integers, *n* and *c* (2<=≤<=*n*<=≤<=100,<=0<=≤<=*c*<=≤<=100), — the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=100), the price of a honey barrel on day *i*.
|
Print a single integer — the answer to the problem.
|
[
"5 1\n5 10 7 3 20\n",
"6 2\n100 1 10 40 10 40\n",
"3 0\n1 2 3\n"
] |
[
"3\n",
"97\n",
"0\n"
] |
In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3.
In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
| 500
|
[
{
"input": "5 1\n5 10 7 3 20",
"output": "3"
},
{
"input": "6 2\n100 1 10 40 10 40",
"output": "97"
},
{
"input": "3 0\n1 2 3",
"output": "0"
},
{
"input": "2 0\n2 1",
"output": "1"
},
{
"input": "10 5\n10 1 11 2 12 3 13 4 14 5",
"output": "4"
},
{
"input": "100 4\n2 57 70 8 44 10 88 67 50 44 93 79 72 50 69 19 21 9 71 47 95 13 46 10 68 72 54 40 15 83 57 92 58 25 4 22 84 9 8 55 87 0 16 46 86 58 5 21 32 28 10 46 11 29 13 33 37 34 78 33 33 21 46 70 77 51 45 97 6 21 68 61 87 54 8 91 37 12 76 61 57 9 100 45 44 88 5 71 98 98 26 45 37 87 34 50 33 60 64 77",
"output": "87"
},
{
"input": "100 5\n15 91 86 53 18 52 26 89 8 4 5 100 11 64 88 91 35 57 67 72 71 71 69 73 97 23 11 1 59 86 37 82 6 67 71 11 7 31 11 68 21 43 89 54 27 10 3 33 8 57 79 26 90 81 6 28 24 7 33 50 24 13 27 85 4 93 14 62 37 67 33 40 7 48 41 4 14 9 95 10 64 62 7 93 23 6 28 27 97 64 26 83 70 0 97 74 11 82 70 93",
"output": "84"
},
{
"input": "6 100\n10 9 8 7 6 5",
"output": "0"
},
{
"input": "100 9\n66 71 37 41 23 38 77 11 74 13 51 26 93 56 81 17 12 70 85 37 54 100 14 99 12 83 44 16 99 65 13 48 92 32 69 33 100 57 58 88 25 45 44 85 5 41 82 15 37 18 21 45 3 68 33 9 52 64 8 73 32 41 87 99 26 26 47 24 79 93 9 44 11 34 85 26 14 61 49 38 25 65 49 81 29 82 28 23 2 64 38 13 77 68 67 23 58 57 83 46",
"output": "78"
},
{
"input": "100 100\n9 72 46 37 26 94 80 1 43 85 26 53 58 18 24 19 67 2 100 52 61 81 48 15 73 41 97 93 45 1 73 54 75 51 28 79 0 14 41 42 24 50 70 18 96 100 67 1 68 48 44 39 63 77 78 18 10 51 32 53 26 60 1 13 66 39 55 27 23 71 75 0 27 88 73 31 16 95 87 84 86 71 37 40 66 70 65 83 19 4 81 99 26 51 67 63 80 54 23 44",
"output": "0"
},
{
"input": "43 65\n32 58 59 75 85 18 57 100 69 0 36 38 79 95 82 47 7 55 28 88 27 88 63 71 80 86 67 53 69 37 99 54 81 19 55 12 2 17 84 77 25 26 62",
"output": "4"
},
{
"input": "12 64\n14 87 40 24 32 36 4 41 38 77 68 71",
"output": "0"
},
{
"input": "75 94\n80 92 25 48 78 17 69 52 79 73 12 15 59 55 25 61 96 27 98 43 30 43 36 94 67 54 86 99 100 61 65 8 65 19 18 21 75 31 2 98 55 87 14 1 17 97 94 11 57 29 34 71 76 67 45 0 78 29 86 82 29 23 77 100 48 43 65 62 88 34 7 28 13 1 1",
"output": "0"
},
{
"input": "59 27\n76 61 24 66 48 18 69 84 21 8 64 90 19 71 36 90 9 36 30 37 99 37 100 56 9 79 55 37 54 63 11 11 49 71 91 70 14 100 10 44 52 23 21 19 96 13 93 66 52 79 76 5 62 6 90 35 94 7 27",
"output": "63"
},
{
"input": "86 54\n41 84 16 5 20 79 73 13 23 24 42 73 70 80 69 71 33 44 62 29 86 88 40 64 61 55 58 19 16 23 84 100 38 91 89 98 47 50 55 87 12 94 2 12 0 1 4 26 50 96 68 34 94 80 8 22 60 3 72 84 65 89 44 52 50 9 24 34 81 28 56 17 38 85 78 90 62 60 1 40 91 2 7 41 84 22",
"output": "38"
},
{
"input": "37 2\n65 36 92 92 92 76 63 56 15 95 75 26 15 4 73 50 41 92 26 20 19 100 63 55 25 75 61 96 35 0 14 6 96 3 28 41 83",
"output": "91"
},
{
"input": "19 4\n85 2 56 70 33 75 89 60 100 81 42 28 18 92 29 96 49 23 14",
"output": "79"
},
{
"input": "89 1\n50 53 97 41 68 27 53 66 93 19 11 78 46 49 38 69 96 9 43 16 1 63 95 64 96 6 34 34 45 40 19 4 53 8 11 18 95 25 50 16 64 33 97 49 23 81 63 10 30 73 76 55 7 70 9 98 6 36 75 78 3 92 85 75 40 75 55 71 9 91 15 17 47 55 44 35 55 88 53 87 61 22 100 56 14 87 36 84 24",
"output": "91"
},
{
"input": "67 0\n40 48 15 46 90 7 65 52 24 15 42 81 2 6 71 94 32 18 97 67 83 98 48 51 10 47 8 68 36 46 65 75 90 30 62 9 5 35 80 60 69 58 62 68 58 73 80 9 22 46 56 64 44 11 93 73 62 54 15 20 17 69 16 33 85 62 49",
"output": "83"
},
{
"input": "96 0\n38 97 82 43 80 40 1 99 50 94 81 63 92 13 57 24 4 10 25 32 79 56 96 19 25 14 69 56 66 22 23 78 87 76 37 30 75 77 61 64 35 64 62 32 44 62 6 84 91 44 99 5 71 19 17 12 35 52 1 14 35 18 8 36 54 42 4 67 80 11 88 44 34 35 12 38 66 42 4 90 45 10 1 44 37 96 23 28 100 90 75 17 27 67 51 70",
"output": "94"
},
{
"input": "14 14\n87 63 62 31 59 47 40 89 92 43 80 30 99 42",
"output": "43"
},
{
"input": "12 0\n100 1 100 2 100 3 100 4 100 5 100 0",
"output": "100"
},
{
"input": "3 1\n1 2 3",
"output": "0"
},
{
"input": "3 2\n3 3 3",
"output": "0"
},
{
"input": "3 3\n3 2 1",
"output": "0"
},
{
"input": "3 100\n1 2 3",
"output": "0"
},
{
"input": "2 100\n0 0",
"output": "0"
},
{
"input": "2 90\n10 5",
"output": "0"
},
{
"input": "2 5\n5 4",
"output": "0"
},
{
"input": "3 1\n19 20 1",
"output": "18"
},
{
"input": "5 1\n5 10 7 4 20",
"output": "2"
},
{
"input": "5 1\n1 2 3 4 5",
"output": "0"
}
] | 1,390,591,882
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 140
| 409,600
|
n, c = map(int, input().split())
pr = list(map(int, input().split()))
maxim = 0
for cont in range(0,n-1,1):
m = pr[cont]-pr[cont+1]-c
if m > maxim:
maxim = m
print(maxim)
|
Title: Bear and Raspberry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=≤<=*i*<=≤<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry.
Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=≤<=*d*<=<<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel.
The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan.
Input Specification:
The first line contains two space-separated integers, *n* and *c* (2<=≤<=*n*<=≤<=100,<=0<=≤<=*c*<=≤<=100), — the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=100), the price of a honey barrel on day *i*.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['5 1\n5 10 7 3 20\n', '6 2\n100 1 10 40 10 40\n', '3 0\n1 2 3\n']
Demo Output:
['3\n', '97\n', '0\n']
Note:
In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3.
In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
|
```python
n, c = map(int, input().split())
pr = list(map(int, input().split()))
maxim = 0
for cont in range(0,n-1,1):
m = pr[cont]-pr[cont+1]-c
if m > maxim:
maxim = m
print(maxim)
```
| 3
|
|
798
|
A
|
Mike and palindrome
|
PROGRAMMING
| 1,000
|
[
"brute force",
"constructive algorithms",
"strings"
] | null | null |
Mike has a string *s* consisting of only lowercase English letters. He wants to change exactly one character from the string so that the resulting one is a palindrome.
A palindrome is a string that reads the same backward as forward, for example strings "z", "aaa", "aba", "abccba" are palindromes, but strings "codeforces", "reality", "ab" are not.
|
The first and single line contains string *s* (1<=≤<=|*s*|<=≤<=15).
|
Print "YES" (without quotes) if Mike can change exactly one character so that the resulting string is palindrome or "NO" (without quotes) otherwise.
|
[
"abccaa\n",
"abbcca\n",
"abcda\n"
] |
[
"YES\n",
"NO\n",
"YES\n"
] |
none
| 500
|
[
{
"input": "abccaa",
"output": "YES"
},
{
"input": "abbcca",
"output": "NO"
},
{
"input": "abcda",
"output": "YES"
},
{
"input": "kyw",
"output": "YES"
},
{
"input": "fccf",
"output": "NO"
},
{
"input": "mnlm",
"output": "YES"
},
{
"input": "gqrk",
"output": "NO"
},
{
"input": "glxlg",
"output": "YES"
},
{
"input": "czhfc",
"output": "YES"
},
{
"input": "broon",
"output": "NO"
},
{
"input": "rmggmr",
"output": "NO"
},
{
"input": "wvxxzw",
"output": "YES"
},
{
"input": "ukvciu",
"output": "NO"
},
{
"input": "vrnwnrv",
"output": "YES"
},
{
"input": "vlkjkav",
"output": "YES"
},
{
"input": "guayhmg",
"output": "NO"
},
{
"input": "lkvhhvkl",
"output": "NO"
},
{
"input": "ffdsslff",
"output": "YES"
},
{
"input": "galjjtyw",
"output": "NO"
},
{
"input": "uosgwgsou",
"output": "YES"
},
{
"input": "qjwmjmljq",
"output": "YES"
},
{
"input": "ustrvrodf",
"output": "NO"
},
{
"input": "a",
"output": "YES"
},
{
"input": "qjfyjjyfjq",
"output": "NO"
},
{
"input": "ysxibbixsq",
"output": "YES"
},
{
"input": "howfslfwmh",
"output": "NO"
},
{
"input": "ekhajrjahke",
"output": "YES"
},
{
"input": "ucnolsloncw",
"output": "YES"
},
{
"input": "jrzsfrrkrtj",
"output": "NO"
},
{
"input": "typayzzyapyt",
"output": "NO"
},
{
"input": "uwdhkzokhdwu",
"output": "YES"
},
{
"input": "xokxpyyuafij",
"output": "NO"
},
{
"input": "eusneioiensue",
"output": "YES"
},
{
"input": "fuxpuajabpxuf",
"output": "YES"
},
{
"input": "guvggtfhlgruy",
"output": "NO"
},
{
"input": "cojhkhxxhkhjoc",
"output": "NO"
},
{
"input": "mhifbmmmmbmihm",
"output": "YES"
},
{
"input": "kxfqqncnebpami",
"output": "NO"
},
{
"input": "scfwrjevejrwfcs",
"output": "YES"
},
{
"input": "thdaonpepdoadht",
"output": "YES"
},
{
"input": "jsfzcbnhsccuqsj",
"output": "NO"
},
{
"input": "nn",
"output": "NO"
},
{
"input": "nm",
"output": "YES"
},
{
"input": "jdj",
"output": "YES"
},
{
"input": "bbcaa",
"output": "NO"
},
{
"input": "abcde",
"output": "NO"
},
{
"input": "abcdf",
"output": "NO"
},
{
"input": "aa",
"output": "NO"
},
{
"input": "abecd",
"output": "NO"
},
{
"input": "abccacb",
"output": "NO"
},
{
"input": "aabc",
"output": "NO"
},
{
"input": "anpqb",
"output": "NO"
},
{
"input": "c",
"output": "YES"
},
{
"input": "abcdefg",
"output": "NO"
},
{
"input": "aanbb",
"output": "NO"
},
{
"input": "aabbb",
"output": "NO"
},
{
"input": "aaabbab",
"output": "NO"
},
{
"input": "ab",
"output": "YES"
},
{
"input": "aabbc",
"output": "NO"
},
{
"input": "ecabd",
"output": "NO"
},
{
"input": "abcdrty",
"output": "NO"
},
{
"input": "abcdmnp",
"output": "NO"
},
{
"input": "bbbbbb",
"output": "NO"
},
{
"input": "abcxuio",
"output": "NO"
},
{
"input": "abcdabcde",
"output": "NO"
},
{
"input": "abcxpoi",
"output": "NO"
},
{
"input": "aba",
"output": "YES"
},
{
"input": "aacbb",
"output": "NO"
},
{
"input": "abcedca",
"output": "NO"
},
{
"input": "abcdd",
"output": "NO"
},
{
"input": "abbcs",
"output": "NO"
},
{
"input": "aaabccc",
"output": "NO"
},
{
"input": "paxkxbq",
"output": "NO"
},
{
"input": "z",
"output": "YES"
},
{
"input": "b",
"output": "YES"
},
{
"input": "abcdefghi",
"output": "NO"
},
{
"input": "abcqr",
"output": "NO"
},
{
"input": "abcdc",
"output": "NO"
},
{
"input": "abcb",
"output": "NO"
},
{
"input": "aabcd",
"output": "NO"
},
{
"input": "abbba",
"output": "YES"
},
{
"input": "aaabbb",
"output": "NO"
},
{
"input": "bb",
"output": "NO"
},
{
"input": "aaacbbb",
"output": "NO"
},
{
"input": "abbzcca",
"output": "NO"
},
{
"input": "abxab",
"output": "NO"
},
{
"input": "bbb",
"output": "YES"
},
{
"input": "abcrtyu",
"output": "NO"
},
{
"input": "cbacb",
"output": "NO"
},
{
"input": "acbb",
"output": "NO"
},
{
"input": "ww",
"output": "NO"
},
{
"input": "aaaaaa",
"output": "NO"
},
{
"input": "jizzz",
"output": "NO"
},
{
"input": "aaakcba",
"output": "NO"
},
{
"input": "acbak",
"output": "NO"
},
{
"input": "bddeffd",
"output": "NO"
},
{
"input": "aaa",
"output": "YES"
},
{
"input": "afghqwe",
"output": "NO"
},
{
"input": "abcdfga",
"output": "NO"
}
] | 1,636,989,548
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 99
| 61
| 0
|
t=input()
count=0
n=len(t)
if t[::1]==t[::-1]:
if n%2==0:
print("NO")
else:
print("YES")
else:
for i in range(0,n//2):
if t[i]!=t[n-1-i]:
count=count+1
else:
continue
if count==1:
print("YES")
else:
print("NO")
|
Title: Mike and palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mike has a string *s* consisting of only lowercase English letters. He wants to change exactly one character from the string so that the resulting one is a palindrome.
A palindrome is a string that reads the same backward as forward, for example strings "z", "aaa", "aba", "abccba" are palindromes, but strings "codeforces", "reality", "ab" are not.
Input Specification:
The first and single line contains string *s* (1<=≤<=|*s*|<=≤<=15).
Output Specification:
Print "YES" (without quotes) if Mike can change exactly one character so that the resulting string is palindrome or "NO" (without quotes) otherwise.
Demo Input:
['abccaa\n', 'abbcca\n', 'abcda\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
none
|
```python
t=input()
count=0
n=len(t)
if t[::1]==t[::-1]:
if n%2==0:
print("NO")
else:
print("YES")
else:
for i in range(0,n//2):
if t[i]!=t[n-1-i]:
count=count+1
else:
continue
if count==1:
print("YES")
else:
print("NO")
```
| 3
|
|
161
|
A
|
Dress'em in Vests!
|
PROGRAMMING
| 1,300
|
[
"binary search",
"brute force",
"greedy",
"two pointers"
] | null | null |
The Two-dimensional kingdom is going through hard times... This morning the Three-Dimensional kingdom declared war on the Two-dimensional one. This (possibly armed) conflict will determine the ultimate owner of the straight line.
The Two-dimensional kingdom has a regular army of *n* people. Each soldier registered himself and indicated the desired size of the bulletproof vest: the *i*-th soldier indicated size *a**i*. The soldiers are known to be unpretentious, so the command staff assumes that the soldiers are comfortable in any vests with sizes from *a**i*<=-<=*x* to *a**i*<=+<=*y*, inclusive (numbers *x*,<=*y*<=≥<=0 are specified).
The Two-dimensional kingdom has *m* vests at its disposal, the *j*-th vest's size equals *b**j*. Help mobilize the Two-dimensional kingdom's army: equip with vests as many soldiers as possible. Each vest can be used only once. The *i*-th soldier can put on the *j*-th vest, if *a**i*<=-<=*x*<=≤<=*b**j*<=≤<=*a**i*<=+<=*y*.
|
The first input line contains four integers *n*, *m*, *x* and *y* (1<=≤<=*n*,<=*m*<=≤<=105, 0<=≤<=*x*,<=*y*<=≤<=109) — the number of soldiers, the number of vests and two numbers that specify the soldiers' unpretentiousness, correspondingly.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) in non-decreasing order, separated by single spaces — the desired sizes of vests.
The third line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**j*<=≤<=109) in non-decreasing order, separated by single spaces — the sizes of the available vests.
|
In the first line print a single integer *k* — the maximum number of soldiers equipped with bulletproof vests.
In the next *k* lines print *k* pairs, one pair per line, as "*u**i* *v**i*" (without the quotes). Pair (*u**i*, *v**i*) means that soldier number *u**i* must wear vest number *v**i*. Soldiers and vests are numbered starting from one in the order in which they are specified in the input. All numbers of soldiers in the pairs should be pairwise different, all numbers of vests in the pairs also should be pairwise different. You can print the pairs in any order.
If there are multiple optimal answers, you are allowed to print any of them.
|
[
"5 3 0 0\n1 2 3 3 4\n1 3 5\n",
"3 3 2 2\n1 5 9\n3 5 7\n"
] |
[
"2\n1 1\n3 2\n",
"3\n1 1\n2 2\n3 3\n"
] |
In the first sample you need the vests' sizes to match perfectly: the first soldier gets the first vest (size 1), the third soldier gets the second vest (size 3). This sample allows another answer, which gives the second vest to the fourth soldier instead of the third one.
In the second sample the vest size can differ from the desired size by at most 2 sizes, so all soldiers can be equipped.
| 1,000
|
[
{
"input": "5 3 0 0\n1 2 3 3 4\n1 3 5",
"output": "2\n1 1\n3 2"
},
{
"input": "3 3 2 2\n1 5 9\n3 5 7",
"output": "3\n1 1\n2 2\n3 3"
},
{
"input": "1 1 0 0\n1\n1",
"output": "1\n1 1"
},
{
"input": "1 1 0 0\n1\n2",
"output": "0"
},
{
"input": "2 3 1 4\n1 5\n1 2 2",
"output": "1\n1 1"
},
{
"input": "20 30 1 4\n1 1 1 1 2 2 2 2 3 3 3 3 4 4 4 4 4 4 4 5\n1 1 1 1 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 4 4 4 4 4 4 4 4 5 5",
"output": "20\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 15\n14 16\n15 17\n16 18\n17 19\n18 20\n19 21\n20 22"
},
{
"input": "33 23 17 2\n1 1 2 2 2 3 3 3 3 3 3 4 4 4 4 4 5 5 5 6 6 7 7 7 8 8 8 8 8 9 9 10 10\n1 1 3 3 4 4 4 5 5 6 6 6 7 8 8 8 8 8 8 9 9 10 10",
"output": "23\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n12 10\n13 11\n14 12\n17 13\n20 14\n21 15\n22 16\n23 17\n24 18\n25 19\n26 20\n27 21\n28 22\n29 23"
},
{
"input": "2 2 1 4\n1 4\n3 6",
"output": "2\n1 1\n2 2"
},
{
"input": "20 20 1 4\n1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 4 4 5 5\n3 3 3 3 3 4 4 4 4 4 4 4 4 5 5 5 6 6 7 7",
"output": "20\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20"
},
{
"input": "33 23 17 2\n1 1 1 2 3 3 3 3 3 4 4 4 4 5 6 6 6 6 6 6 7 7 7 7 7 8 8 8 8 8 8 10 10\n10 10 10 11 12 12 12 12 12 13 13 13 13 14 15 15 15 15 15 15 16 16 16",
"output": "5\n26 1\n27 2\n28 3\n32 4\n33 5"
},
{
"input": "1 1 1 2\n783266931\n783266932",
"output": "1\n1 1"
},
{
"input": "2 3 1 4\n1 1\n3 3 4",
"output": "2\n1 1\n2 2"
},
{
"input": "20 30 1 4\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "20\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20"
},
{
"input": "33 23 17 2\n1 1 1 1 1 1 1 2 2 2 2 2 2 2 3 3 3 3 3 3 4 4 4 4 4 4 4 5 5 5 5 5 5\n10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 13 13 13",
"output": "0"
},
{
"input": "10 1 1 1\n1 1 1 5 5 7 7 8 8 8\n3",
"output": "0"
},
{
"input": "10 1 2 1\n1 2 5 8 9 9 9 10 10 10\n7",
"output": "1\n4 1"
},
{
"input": "1 1 2 1\n7\n8",
"output": "1\n1 1"
},
{
"input": "1 1 0 2\n9\n7",
"output": "0"
},
{
"input": "2 2 0 2\n2 8\n3 5",
"output": "1\n1 1"
},
{
"input": "2 2 1 0\n5 5\n6 7",
"output": "0"
},
{
"input": "2 2 3 0\n8 9\n1 5",
"output": "1\n1 2"
}
] | 1,545,105,359
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 218
| 0
|
n, m, x, y = map(int,input().split())
a = list(map(int,input().split()))
b = list(map(int,input().split()))
c = []
j = 0
for i in range(n):
while j < m and b[j] >= a[i] +y:
if a[i] - x <= b[j]:
j += 1
c += [(i+1, j)]
break
j += 1
print(len(c))
for i, j in c:
print(i, j)
|
Title: Dress'em in Vests!
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Two-dimensional kingdom is going through hard times... This morning the Three-Dimensional kingdom declared war on the Two-dimensional one. This (possibly armed) conflict will determine the ultimate owner of the straight line.
The Two-dimensional kingdom has a regular army of *n* people. Each soldier registered himself and indicated the desired size of the bulletproof vest: the *i*-th soldier indicated size *a**i*. The soldiers are known to be unpretentious, so the command staff assumes that the soldiers are comfortable in any vests with sizes from *a**i*<=-<=*x* to *a**i*<=+<=*y*, inclusive (numbers *x*,<=*y*<=≥<=0 are specified).
The Two-dimensional kingdom has *m* vests at its disposal, the *j*-th vest's size equals *b**j*. Help mobilize the Two-dimensional kingdom's army: equip with vests as many soldiers as possible. Each vest can be used only once. The *i*-th soldier can put on the *j*-th vest, if *a**i*<=-<=*x*<=≤<=*b**j*<=≤<=*a**i*<=+<=*y*.
Input Specification:
The first input line contains four integers *n*, *m*, *x* and *y* (1<=≤<=*n*,<=*m*<=≤<=105, 0<=≤<=*x*,<=*y*<=≤<=109) — the number of soldiers, the number of vests and two numbers that specify the soldiers' unpretentiousness, correspondingly.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) in non-decreasing order, separated by single spaces — the desired sizes of vests.
The third line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**j*<=≤<=109) in non-decreasing order, separated by single spaces — the sizes of the available vests.
Output Specification:
In the first line print a single integer *k* — the maximum number of soldiers equipped with bulletproof vests.
In the next *k* lines print *k* pairs, one pair per line, as "*u**i* *v**i*" (without the quotes). Pair (*u**i*, *v**i*) means that soldier number *u**i* must wear vest number *v**i*. Soldiers and vests are numbered starting from one in the order in which they are specified in the input. All numbers of soldiers in the pairs should be pairwise different, all numbers of vests in the pairs also should be pairwise different. You can print the pairs in any order.
If there are multiple optimal answers, you are allowed to print any of them.
Demo Input:
['5 3 0 0\n1 2 3 3 4\n1 3 5\n', '3 3 2 2\n1 5 9\n3 5 7\n']
Demo Output:
['2\n1 1\n3 2\n', '3\n1 1\n2 2\n3 3\n']
Note:
In the first sample you need the vests' sizes to match perfectly: the first soldier gets the first vest (size 1), the third soldier gets the second vest (size 3). This sample allows another answer, which gives the second vest to the fourth soldier instead of the third one.
In the second sample the vest size can differ from the desired size by at most 2 sizes, so all soldiers can be equipped.
|
```python
n, m, x, y = map(int,input().split())
a = list(map(int,input().split()))
b = list(map(int,input().split()))
c = []
j = 0
for i in range(n):
while j < m and b[j] >= a[i] +y:
if a[i] - x <= b[j]:
j += 1
c += [(i+1, j)]
break
j += 1
print(len(c))
for i, j in c:
print(i, j)
```
| 0
|
|
597
|
B
|
Restaurant
|
PROGRAMMING
| 1,600
|
[
"dp",
"greedy",
"sortings"
] | null | null |
A restaurant received *n* orders for the rental. Each rental order reserve the restaurant for a continuous period of time, the *i*-th order is characterized by two time values — the start time *l**i* and the finish time *r**i* (*l**i*<=≤<=*r**i*).
Restaurant management can accept and reject orders. What is the maximal number of orders the restaurant can accept?
No two accepted orders can intersect, i.e. they can't share even a moment of time. If one order ends in the moment other starts, they can't be accepted both.
|
The first line contains integer number *n* (1<=≤<=*n*<=≤<=5·105) — number of orders. The following *n* lines contain integer values *l**i* and *r**i* each (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=109).
|
Print the maximal number of orders that can be accepted.
|
[
"2\n7 11\n4 7\n",
"5\n1 2\n2 3\n3 4\n4 5\n5 6\n",
"6\n4 8\n1 5\n4 7\n2 5\n1 3\n6 8\n"
] |
[
"1\n",
"3\n",
"2\n"
] |
none
| 1,000
|
[
{
"input": "2\n7 11\n4 7",
"output": "1"
},
{
"input": "5\n1 2\n2 3\n3 4\n4 5\n5 6",
"output": "3"
},
{
"input": "6\n4 8\n1 5\n4 7\n2 5\n1 3\n6 8",
"output": "2"
},
{
"input": "1\n1 1",
"output": "1"
},
{
"input": "2\n4 6\n4 8",
"output": "1"
},
{
"input": "3\n22 22\n14 21\n9 25",
"output": "2"
},
{
"input": "4\n20 59\n30 62\n29 45\n29 32",
"output": "1"
},
{
"input": "5\n40 124\n40 117\n67 106\n36 121\n38 102",
"output": "1"
},
{
"input": "6\n124 155\n50 93\n45 120\n54 171\n46 190\n76 179",
"output": "2"
},
{
"input": "7\n94 113\n54 248\n64 325\n280 306\n62 328\n49 341\n90 324",
"output": "2"
},
{
"input": "8\n116 416\n104 472\n84 476\n100 486\n199 329\n169 444\n171 487\n134 441",
"output": "1"
},
{
"input": "9\n90 667\n366 539\n155 462\n266 458\n323 574\n101 298\n90 135\n641 661\n122 472",
"output": "3"
},
{
"input": "10\n195 443\n229 602\n200 948\n229 876\n228 904\n296 656\n189 818\n611 626\n215 714\n403 937",
"output": "2"
},
{
"input": "1\n28 74",
"output": "1"
},
{
"input": "2\n28 92\n2 59",
"output": "1"
},
{
"input": "3\n5 92\n1 100\n39 91",
"output": "1"
},
{
"input": "4\n4 92\n29 43\n13 73\n10 79",
"output": "1"
},
{
"input": "5\n64 86\n61 61\n46 54\n83 94\n19 46",
"output": "3"
},
{
"input": "6\n80 84\n21 24\n44 80\n14 53\n5 10\n61 74",
"output": "4"
},
{
"input": "7\n32 92\n32 86\n13 25\n45 75\n16 65\n1 99\n17 98",
"output": "2"
},
{
"input": "8\n3 59\n22 94\n26 97\n18 85\n7 84\n1 100\n4 100\n26 93",
"output": "1"
},
{
"input": "9\n11 90\n8 95\n62 95\n43 96\n16 84\n3 70\n23 93\n4 96\n11 86",
"output": "1"
},
{
"input": "10\n30 45\n5 8\n51 83\n37 52\n49 75\n28 92\n94 99\n4 13\n61 83\n36 96",
"output": "4"
},
{
"input": "11\n38 92\n16 85\n32 43\n65 84\n63 100\n21 45\n13 92\n29 58\n56 94\n18 83\n50 81",
"output": "2"
},
{
"input": "12\n66 78\n41 97\n55 69\n55 61\n36 64\n14 97\n96 99\n28 58\n44 93\n2 100\n42 88\n1 2",
"output": "4"
},
{
"input": "13\n50 85\n38 65\n5 51\n50 96\n4 92\n23 94\n2 99\n2 84\n1 98\n2 100\n12 100\n21 97\n7 84",
"output": "1"
},
{
"input": "14\n17 92\n7 96\n49 96\n10 99\n7 98\n12 85\n10 52\n2 99\n23 75\n4 98\n7 100\n2 69\n6 99\n20 87",
"output": "1"
},
{
"input": "15\n1 58\n15 21\n53 55\n59 90\n68 71\n29 51\n52 81\n32 52\n38 44\n57 59\n47 60\n27 32\n49 86\n26 94\n44 45",
"output": "6"
},
{
"input": "16\n4 80\n16 46\n15 16\n60 63\n8 54\n18 49\n67 99\n72 80\n1 8\n19 64\n1 54\n46 94\n2 89\n67 78\n21 47\n5 29",
"output": "5"
},
{
"input": "17\n34 42\n31 84\n8 96\n63 88\n11 99\n80 99\n1 96\n11 12\n27 28\n4 30\n1 79\n16 86\n15 86\n13 80\n3 98\n37 89\n59 88",
"output": "4"
},
{
"input": "18\n11 94\n12 85\n25 90\n7 61\n63 88\n6 87\n49 88\n16 76\n12 78\n61 84\n3 84\n20 91\n1 84\n17 100\n43 80\n8 86\n9 98\n35 97",
"output": "2"
},
{
"input": "19\n24 63\n23 86\n5 89\n10 83\n31 92\n8 96\n21 63\n1 83\n2 100\n5 96\n18 98\n9 77\n11 91\n44 95\n1 98\n22 60\n5 98\n22 91\n1 96",
"output": "1"
},
{
"input": "20\n22 77\n13 50\n55 64\n16 52\n67 96\n49 51\n59 95\n2 25\n69 91\n2 24\n4 46\n50 74\n45 63\n39 55\n31 33\n9 33\n6 72\n14 67\n56 98\n69 94",
"output": "5"
},
{
"input": "1\n1 1000000000",
"output": "1"
},
{
"input": "4\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000",
"output": "1"
},
{
"input": "2\n1000000000 1000000000\n1 1",
"output": "2"
},
{
"input": "4\n1 10000\n2 3\n4 5\n6 7",
"output": "3"
},
{
"input": "3\n1 10\n2 4\n6 8",
"output": "2"
},
{
"input": "2\n1 4\n2 3",
"output": "1"
},
{
"input": "3\n1 100\n2 3\n4 5",
"output": "2"
},
{
"input": "4\n1 10\n2 3\n4 5\n6 7",
"output": "3"
},
{
"input": "3\n1 5\n2 3\n4 4",
"output": "2"
},
{
"input": "3\n1 1000\n1 5\n6 1000",
"output": "2"
},
{
"input": "3\n1 10000\n3 5\n7 8",
"output": "2"
},
{
"input": "4\n1 5\n6 15\n8 10\n11 17",
"output": "3"
},
{
"input": "4\n1 3\n6 800\n7 9\n10 11",
"output": "3"
},
{
"input": "5\n1 10\n2 3\n4 5\n6 7\n8 9",
"output": "4"
},
{
"input": "3\n1 5\n1 3\n4 6",
"output": "2"
},
{
"input": "3\n1 10\n2 3\n4 5",
"output": "2"
},
{
"input": "2\n1 3\n2 4",
"output": "1"
}
] | 1,602,161,039
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 93
| 204,800
|
n=int(input())
l=[]
for i in range(n):
s=input()
temp=s.split()
temp1=[int(i) for i in temp]
l.append(temp1)
sorted(l,key=lambda x:x[1])
cnt=1
prev=l[0][1]
for i in range(1,len(l)):
if l[i][0]>prev:
cnt=cnt+1
prev=l[i][1]
print(cnt)
|
Title: Restaurant
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A restaurant received *n* orders for the rental. Each rental order reserve the restaurant for a continuous period of time, the *i*-th order is characterized by two time values — the start time *l**i* and the finish time *r**i* (*l**i*<=≤<=*r**i*).
Restaurant management can accept and reject orders. What is the maximal number of orders the restaurant can accept?
No two accepted orders can intersect, i.e. they can't share even a moment of time. If one order ends in the moment other starts, they can't be accepted both.
Input Specification:
The first line contains integer number *n* (1<=≤<=*n*<=≤<=5·105) — number of orders. The following *n* lines contain integer values *l**i* and *r**i* each (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=109).
Output Specification:
Print the maximal number of orders that can be accepted.
Demo Input:
['2\n7 11\n4 7\n', '5\n1 2\n2 3\n3 4\n4 5\n5 6\n', '6\n4 8\n1 5\n4 7\n2 5\n1 3\n6 8\n']
Demo Output:
['1\n', '3\n', '2\n']
Note:
none
|
```python
n=int(input())
l=[]
for i in range(n):
s=input()
temp=s.split()
temp1=[int(i) for i in temp]
l.append(temp1)
sorted(l,key=lambda x:x[1])
cnt=1
prev=l[0][1]
for i in range(1,len(l)):
if l[i][0]>prev:
cnt=cnt+1
prev=l[i][1]
print(cnt)
```
| 0
|
|
408
|
A
|
Line to Cashier
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Little Vasya went to the supermarket to get some groceries. He walked about the supermarket for a long time and got a basket full of products. Now he needs to choose the cashier to pay for the products.
There are *n* cashiers at the exit from the supermarket. At the moment the queue for the *i*-th cashier already has *k**i* people. The *j*-th person standing in the queue to the *i*-th cashier has *m**i*,<=*j* items in the basket. Vasya knows that:
- the cashier needs 5 seconds to scan one item; - after the cashier scans each item of some customer, he needs 15 seconds to take the customer's money and give him the change.
Of course, Vasya wants to select a queue so that he can leave the supermarket as soon as possible. Help him write a program that displays the minimum number of seconds after which Vasya can get to one of the cashiers.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of cashes in the shop. The second line contains *n* space-separated integers: *k*1,<=*k*2,<=...,<=*k**n* (1<=≤<=*k**i*<=≤<=100), where *k**i* is the number of people in the queue to the *i*-th cashier.
The *i*-th of the next *n* lines contains *k**i* space-separated integers: *m**i*,<=1,<=*m**i*,<=2,<=...,<=*m**i*,<=*k**i* (1<=≤<=*m**i*,<=*j*<=≤<=100) — the number of products the *j*-th person in the queue for the *i*-th cash has.
|
Print a single integer — the minimum number of seconds Vasya needs to get to the cashier.
|
[
"1\n1\n1\n",
"4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8\n"
] |
[
"20\n",
"100\n"
] |
In the second test sample, if Vasya goes to the first queue, he gets to the cashier in 100·5 + 15 = 515 seconds. But if he chooses the second queue, he will need 1·5 + 2·5 + 2·5 + 3·5 + 4·15 = 100 seconds. He will need 1·5 + 9·5 + 1·5 + 3·15 = 100 seconds for the third one and 7·5 + 8·5 + 2·15 = 105 seconds for the fourth one. Thus, Vasya gets to the cashier quicker if he chooses the second or the third queue.
| 500
|
[
{
"input": "1\n1\n1",
"output": "20"
},
{
"input": "4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8",
"output": "100"
},
{
"input": "4\n5 4 5 5\n3 1 3 1 2\n3 1 1 3\n1 1 1 2 2\n2 2 1 1 3",
"output": "100"
},
{
"input": "5\n5 3 6 6 4\n7 5 3 3 9\n6 8 2\n1 10 8 5 9 2\n9 7 8 5 9 10\n9 8 3 3",
"output": "125"
},
{
"input": "5\n10 10 10 10 10\n6 7 8 6 8 5 9 8 10 5\n9 6 9 8 7 8 8 10 8 5\n8 7 7 8 7 5 6 8 9 5\n6 5 10 5 5 10 7 8 5 5\n10 9 8 7 6 9 7 9 6 5",
"output": "480"
},
{
"input": "10\n9 10 10 10 9 5 9 7 8 7\n11 6 10 4 4 15 7 15 5\n3 9 11 12 11 1 13 13 1 5\n6 15 9 12 3 2 8 12 11 10\n7 1 1 6 10 2 6 1 14 2\n8 14 2 3 6 1 14 1 12\n6 10 9 3 5\n13 12 12 7 13 4 4 8 10\n5 6 4 3 14 9 13\n8 12 1 5 7 4 13 1\n1 9 5 3 5 1 4",
"output": "240"
},
{
"input": "10\n5 5 5 5 5 5 5 5 5 5\n5 5 4 5 4\n6 5 7 7 6\n5 4 4 5 5\n4 4 5 5 5\n7 6 4 5 7\n4 6 5 4 5\n6 6 7 6 6\n4 5 4 4 7\n7 5 4 4 5\n6 6 7 4 4",
"output": "190"
},
{
"input": "1\n1\n100",
"output": "515"
},
{
"input": "1\n90\n90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90",
"output": "41850"
}
] | 1,571,066,574
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 124
| 307,200
|
n= int(input())
k= list(map(int, input().split()))
mat=[]
for i in range(n):
l=list(map(int, input().split()))
mat.append(l)
res=[]
temp=0
for i in range(n):
t= k[i]
demo=0
for j in range(t):
demo= demo+mat[i][j]
demo= demo*5
demo+= t*15
res.append(demo)
print(min(res))
|
Title: Line to Cashier
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya went to the supermarket to get some groceries. He walked about the supermarket for a long time and got a basket full of products. Now he needs to choose the cashier to pay for the products.
There are *n* cashiers at the exit from the supermarket. At the moment the queue for the *i*-th cashier already has *k**i* people. The *j*-th person standing in the queue to the *i*-th cashier has *m**i*,<=*j* items in the basket. Vasya knows that:
- the cashier needs 5 seconds to scan one item; - after the cashier scans each item of some customer, he needs 15 seconds to take the customer's money and give him the change.
Of course, Vasya wants to select a queue so that he can leave the supermarket as soon as possible. Help him write a program that displays the minimum number of seconds after which Vasya can get to one of the cashiers.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of cashes in the shop. The second line contains *n* space-separated integers: *k*1,<=*k*2,<=...,<=*k**n* (1<=≤<=*k**i*<=≤<=100), where *k**i* is the number of people in the queue to the *i*-th cashier.
The *i*-th of the next *n* lines contains *k**i* space-separated integers: *m**i*,<=1,<=*m**i*,<=2,<=...,<=*m**i*,<=*k**i* (1<=≤<=*m**i*,<=*j*<=≤<=100) — the number of products the *j*-th person in the queue for the *i*-th cash has.
Output Specification:
Print a single integer — the minimum number of seconds Vasya needs to get to the cashier.
Demo Input:
['1\n1\n1\n', '4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8\n']
Demo Output:
['20\n', '100\n']
Note:
In the second test sample, if Vasya goes to the first queue, he gets to the cashier in 100·5 + 15 = 515 seconds. But if he chooses the second queue, he will need 1·5 + 2·5 + 2·5 + 3·5 + 4·15 = 100 seconds. He will need 1·5 + 9·5 + 1·5 + 3·15 = 100 seconds for the third one and 7·5 + 8·5 + 2·15 = 105 seconds for the fourth one. Thus, Vasya gets to the cashier quicker if he chooses the second or the third queue.
|
```python
n= int(input())
k= list(map(int, input().split()))
mat=[]
for i in range(n):
l=list(map(int, input().split()))
mat.append(l)
res=[]
temp=0
for i in range(n):
t= k[i]
demo=0
for j in range(t):
demo= demo+mat[i][j]
demo= demo*5
demo+= t*15
res.append(demo)
print(min(res))
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,633,773,759
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 30
| 184
| 20,172,800
|
n=input()
l=len(n)
lc=0
uc=0
for i in range(l):
if n[i].islower():
lc+=1
elif n[i].isupper():
uc+=1
if lc>uc:
n=n.lower()
elif uc>lc:
n=n.upper()
elif lc==uc:
n=n.lower()
print(n)
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
n=input()
l=len(n)
lc=0
uc=0
for i in range(l):
if n[i].islower():
lc+=1
elif n[i].isupper():
uc+=1
if lc>uc:
n=n.lower()
elif uc>lc:
n=n.upper()
elif lc==uc:
n=n.lower()
print(n)
```
| 3.916425
|
236
|
A
|
Boy or Girl
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network.
But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names.
This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
|
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
|
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
|
[
"wjmzbmr\n",
"xiaodao\n",
"sevenkplus\n"
] |
[
"CHAT WITH HER!\n",
"IGNORE HIM!\n",
"CHAT WITH HER!\n"
] |
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
| 500
|
[
{
"input": "wjmzbmr",
"output": "CHAT WITH HER!"
},
{
"input": "xiaodao",
"output": "IGNORE HIM!"
},
{
"input": "sevenkplus",
"output": "CHAT WITH HER!"
},
{
"input": "pezu",
"output": "CHAT WITH HER!"
},
{
"input": "wnemlgppy",
"output": "CHAT WITH HER!"
},
{
"input": "zcinitufxoldnokacdvtmdohsfdjepyfioyvclhmujiqwvmudbfjzxjfqqxjmoiyxrfsbvseawwoyynn",
"output": "IGNORE HIM!"
},
{
"input": "qsxxuoynwtebujwpxwpajitiwxaxwgbcylxneqiebzfphugwkftpaikixmumkhfbjiswmvzbtiyifbx",
"output": "CHAT WITH HER!"
},
{
"input": "qwbdfzfylckctudyjlyrtmvbidfatdoqfmrfshsqqmhzohhsczscvwzpwyoyswhktjlykumhvaounpzwpxcspxwlgt",
"output": "IGNORE HIM!"
},
{
"input": "nuezoadauueermoeaabjrkxttkatspjsjegjcjcdmcxgodowzbwuqncfbeqlhkk",
"output": "IGNORE HIM!"
},
{
"input": "lggvdmulrsvtuagoavstuyufhypdxfomjlzpnduulukszqnnwfvxbvxyzmleocmofwclmzz",
"output": "IGNORE HIM!"
},
{
"input": "tgcdptnkc",
"output": "IGNORE HIM!"
},
{
"input": "wvfgnfrzabgibzxhzsojskmnlmrokydjoexnvi",
"output": "IGNORE HIM!"
},
{
"input": "sxtburpzskucowowebgrbovhadrrayamuwypmmxhscrujkmcgvyinp",
"output": "IGNORE HIM!"
},
{
"input": "pjqxhvxkyeqqvyuujxhmbspatvrckhhkfloottuybjivkkhpyivcighxumavrxzxslfpggnwbtalmhysyfllznphzia",
"output": "IGNORE HIM!"
},
{
"input": "fpellxwskyekoyvrfnuf",
"output": "CHAT WITH HER!"
},
{
"input": "xninyvkuvakfbs",
"output": "IGNORE HIM!"
},
{
"input": "vnxhrweyvhqufpfywdwftoyrfgrhxuamqhblkvdpxmgvphcbeeqbqssresjifwyzgfhurmamhkwupymuomak",
"output": "CHAT WITH HER!"
},
{
"input": "kmsk",
"output": "IGNORE HIM!"
},
{
"input": "lqonogasrkzhryjxppjyriyfxmdfubieglthyswz",
"output": "CHAT WITH HER!"
},
{
"input": "ndormkufcrkxlihdhmcehzoimcfhqsmombnfjrlcalffq",
"output": "CHAT WITH HER!"
},
{
"input": "zqzlnnuwcfufwujygtczfakhcpqbtxtejrbgoodychepzdphdahtxyfpmlrycyicqthsgm",
"output": "IGNORE HIM!"
},
{
"input": "ppcpbnhwoizajrl",
"output": "IGNORE HIM!"
},
{
"input": "sgubujztzwkzvztitssxxxwzanfmddfqvv",
"output": "CHAT WITH HER!"
},
{
"input": "ptkyaxycecpbrjnvxcjtbqiocqcswnmicxbvhdsptbxyxswbw",
"output": "IGNORE HIM!"
},
{
"input": "yhbtzfppwcycxqjpqdfmjnhwaogyuaxamwxpnrdrnqsgdyfvxu",
"output": "CHAT WITH HER!"
},
{
"input": "ojjvpnkrxibyevxk",
"output": "CHAT WITH HER!"
},
{
"input": "wjweqcrqfuollfvfbiyriijovweg",
"output": "IGNORE HIM!"
},
{
"input": "hkdbykboclchfdsuovvpknwqr",
"output": "IGNORE HIM!"
},
{
"input": "stjvyfrfowopwfjdveduedqylerqugykyu",
"output": "IGNORE HIM!"
},
{
"input": "rafcaanqytfclvfdegak",
"output": "CHAT WITH HER!"
},
{
"input": "xczn",
"output": "CHAT WITH HER!"
},
{
"input": "arcoaeozyeawbveoxpmafxxzdjldsielp",
"output": "IGNORE HIM!"
},
{
"input": "smdfafbyehdylhaleevhoggiurdgeleaxkeqdixyfztkuqsculgslheqfafxyghyuibdgiuwrdxfcitojxika",
"output": "CHAT WITH HER!"
},
{
"input": "vbpfgjqnhfazmvtkpjrdasfhsuxnpiepxfrzvoh",
"output": "CHAT WITH HER!"
},
{
"input": "dbdokywnpqnotfrhdbrzmuyoxfdtrgrzcccninbtmoqvxfatcqg",
"output": "CHAT WITH HER!"
},
{
"input": "udlpagtpq",
"output": "CHAT WITH HER!"
},
{
"input": "zjurevbytijifnpfuyswfchdzelxheboruwjqijxcucylysmwtiqsqqhktexcynquvcwhbjsipy",
"output": "CHAT WITH HER!"
},
{
"input": "qagzrqjomdwhagkhrjahhxkieijyten",
"output": "CHAT WITH HER!"
},
{
"input": "achhcfjnnfwgoufxamcqrsontgjjhgyfzuhklkmiwybnrlsvblnsrjqdytglipxsulpnphpjpoewvlusalsgovwnsngb",
"output": "CHAT WITH HER!"
},
{
"input": "qbkjsdwpahdbbohggbclfcufqelnojoehsxxkr",
"output": "CHAT WITH HER!"
},
{
"input": "cpvftiwgyvnlmbkadiafddpgfpvhqqvuehkypqjsoibpiudfvpkhzlfrykc",
"output": "IGNORE HIM!"
},
{
"input": "lnpdosnceumubvk",
"output": "IGNORE HIM!"
},
{
"input": "efrk",
"output": "CHAT WITH HER!"
},
{
"input": "temnownneghnrujforif",
"output": "IGNORE HIM!"
},
{
"input": "ottnneymszwbumgobazfjyxewkjakglbfflsajuzescplpcxqta",
"output": "IGNORE HIM!"
},
{
"input": "eswpaclodzcwhgixhpyzvhdwsgneqidanbzdzszquefh",
"output": "IGNORE HIM!"
},
{
"input": "gwntwbpj",
"output": "IGNORE HIM!"
},
{
"input": "wuqvlbblkddeindiiswsinkfrnkxghhwunzmmvyovpqapdfbolyim",
"output": "IGNORE HIM!"
},
{
"input": "swdqsnzmzmsyvktukaoyqsqzgfmbzhezbfaqeywgwizrwjyzquaahucjchegknqaioliqd",
"output": "CHAT WITH HER!"
},
{
"input": "vlhrpzezawyolhbmvxbwhtjustdbqggexmzxyieihjlelvwjosmkwesfjmramsikhkupzvfgezmrqzudjcalpjacmhykhgfhrjx",
"output": "IGNORE HIM!"
},
{
"input": "lxxwbkrjgnqjwsnflfnsdyxihmlspgivirazsbveztnkuzpaxtygidniflyjheejelnjyjvgkgvdqks",
"output": "CHAT WITH HER!"
},
{
"input": "wpxbxzfhtdecetpljcrvpjjnllosdqirnkzesiqeukbedkayqx",
"output": "CHAT WITH HER!"
},
{
"input": "vmzxgacicvweclaodrunmjnfwtimceetsaoickarqyrkdghcmyjgmtgsqastcktyrjgvjqimdc",
"output": "CHAT WITH HER!"
},
{
"input": "yzlzmesxdttfcztooypjztlgxwcr",
"output": "IGNORE HIM!"
},
{
"input": "qpbjwzwgdzmeluheirjrvzrhbmagfsjdgvzgwumjtjzecsfkrfqjasssrhhtgdqqfydlmrktlgfc",
"output": "IGNORE HIM!"
},
{
"input": "aqzftsvezdgouyrirsxpbuvdjupnzvbhguyayeqozfzymfnepvwgblqzvmxxkxcilmsjvcgyqykpoaktjvsxbygfgsalbjoq",
"output": "CHAT WITH HER!"
},
{
"input": "znicjjgijhrbdlnwmtjgtdgziollrfxroabfhadygnomodaembllreorlyhnehijfyjbfxucazellblegyfrzuraogadj",
"output": "IGNORE HIM!"
},
{
"input": "qordzrdiknsympdrkgapjxokbldorpnmnpucmwakklmqenpmkom",
"output": "CHAT WITH HER!"
},
{
"input": "wqfldgihuxfktzanyycluzhtewmwvnawqlfoavuguhygqrrxtstxwouuzzsryjqtfqo",
"output": "CHAT WITH HER!"
},
{
"input": "vujtrrpshinkskgyknlcfckmqdrwtklkzlyipmetjvaqxdsslkskschbalmdhzsdrrjmxdltbtnxbh",
"output": "IGNORE HIM!"
},
{
"input": "zioixjibuhrzyrbzqcdjbbhhdmpgmqykixcxoqupggaqajuzonrpzihbsogjfsrrypbiphehonyhohsbybnnukqebopppa",
"output": "CHAT WITH HER!"
},
{
"input": "oh",
"output": "CHAT WITH HER!"
},
{
"input": "kxqthadqesbpgpsvpbcbznxpecqrzjoilpauttzlnxvaczcqwuri",
"output": "IGNORE HIM!"
},
{
"input": "zwlunigqnhrwirkvufqwrnwcnkqqonebrwzcshcbqqwkjxhymjjeakuzjettebciadjlkbfp",
"output": "CHAT WITH HER!"
},
{
"input": "fjuldpuejgmggvvigkwdyzytfxzwdlofrpifqpdnhfyroginqaufwgjcbgshyyruwhofctsdaisqpjxqjmtpp",
"output": "CHAT WITH HER!"
},
{
"input": "xiwntnheuitbtqxrmzvxmieldudakogealwrpygbxsbluhsqhtwmdlpjwzyafckrqrdduonkgo",
"output": "CHAT WITH HER!"
},
{
"input": "mnmbupgo",
"output": "IGNORE HIM!"
},
{
"input": "mcjehdiygkbmrbfjqwpwxidbdfelifwhstaxdapigbymmsgrhnzsdjhsqchl",
"output": "IGNORE HIM!"
},
{
"input": "yocxrzspinchmhtmqo",
"output": "CHAT WITH HER!"
},
{
"input": "vasvvnpymtgjirnzuynluluvmgpquskuaafwogeztfnvybblajvuuvfomtifeuzpikjrolzeeoftv",
"output": "CHAT WITH HER!"
},
{
"input": "ecsdicrznvglwggrdbrvehwzaenzjutjydhvimtqegweurpxtjkmpcznshtrvotkvrghxhacjkedidqqzrduzad",
"output": "IGNORE HIM!"
},
{
"input": "ubvhyaebyxoghakajqrpqpctwbrfqzli",
"output": "CHAT WITH HER!"
},
{
"input": "gogbxfeqylxoummvgxpkoqzsmobasesxbqjjktqbwqxeiaagnnhbvepbpy",
"output": "IGNORE HIM!"
},
{
"input": "nheihhxkbbrmlpxpxbhnpofcjmxemyvqqdbanwd",
"output": "IGNORE HIM!"
},
{
"input": "acrzbavz",
"output": "CHAT WITH HER!"
},
{
"input": "drvzznznvrzskftnrhvvzxcalwutxmdza",
"output": "IGNORE HIM!"
},
{
"input": "oacwxipdfcoabhkwxqdbtowiekpnflnqhlrkustgzryvws",
"output": "CHAT WITH HER!"
},
{
"input": "tpnwfmfsibnccvdwjvzviyvjfljupinfigfunyff",
"output": "CHAT WITH HER!"
},
{
"input": "gavaihhamfolcndgytcsgucqdqngxkrlovpthvteacmmthoglxu",
"output": "CHAT WITH HER!"
},
{
"input": "hsfcfvameeupldgvchmogrvwxrvsmnwxxkxoawwodtsahqvehlcw",
"output": "IGNORE HIM!"
},
{
"input": "sbkydrscoojychxchqsuciperfroumenelgiyiwlqfwximrgdbyvkmacy",
"output": "CHAT WITH HER!"
},
{
"input": "rhh",
"output": "CHAT WITH HER!"
},
{
"input": "zhdouqfmlkenjzdijxdfxnlegxeuvhelo",
"output": "IGNORE HIM!"
},
{
"input": "yufkkfwyhhvcjntsgsvpzbhqtmtgyxifqoewmuplphykmptfdebjxuaxigomjtwgtljwdjhjernkitifbomifbhysnmadtnyn",
"output": "CHAT WITH HER!"
},
{
"input": "urigreuzpxnej",
"output": "CHAT WITH HER!"
}
] | 1,696,685,386
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
username = input("enter a username : ")
distinct_characters = set(username)
n = len(distinct_characters)
if n%2==0:
print( "CHAT WITH HER!" )
else :
print("IGNORE HIM!")
|
Title: Boy or Girl
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network.
But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names.
This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
Input Specification:
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
Output Specification:
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
Demo Input:
['wjmzbmr\n', 'xiaodao\n', 'sevenkplus\n']
Demo Output:
['CHAT WITH HER!\n', 'IGNORE HIM!\n', 'CHAT WITH HER!\n']
Note:
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
|
```python
username = input("enter a username : ")
distinct_characters = set(username)
n = len(distinct_characters)
if n%2==0:
print( "CHAT WITH HER!" )
else :
print("IGNORE HIM!")
```
| 0
|
|
867
|
A
|
Between the Offices
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
|
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
|
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower).
|
[
"4\nFSSF\n",
"2\nSF\n",
"10\nFFFFFFFFFF\n",
"10\nSSFFSFFSFF\n"
] |
[
"NO\n",
"YES\n",
"NO\n",
"YES\n"
] |
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
| 500
|
[
{
"input": "4\nFSSF",
"output": "NO"
},
{
"input": "2\nSF",
"output": "YES"
},
{
"input": "10\nFFFFFFFFFF",
"output": "NO"
},
{
"input": "10\nSSFFSFFSFF",
"output": "YES"
},
{
"input": "20\nSFSFFFFSSFFFFSSSSFSS",
"output": "NO"
},
{
"input": "20\nSSFFFFFSFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "20\nSSFSFSFSFSFSFSFSSFSF",
"output": "YES"
},
{
"input": "20\nSSSSFSFSSFSFSSSSSSFS",
"output": "NO"
},
{
"input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF",
"output": "NO"
},
{
"input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF",
"output": "YES"
},
{
"input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS",
"output": "NO"
},
{
"input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS",
"output": "NO"
},
{
"input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS",
"output": "NO"
},
{
"input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS",
"output": "NO"
},
{
"input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF",
"output": "YES"
},
{
"input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF",
"output": "YES"
},
{
"input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF",
"output": "YES"
},
{
"input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF",
"output": "YES"
},
{
"input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF",
"output": "YES"
},
{
"input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF",
"output": "YES"
},
{
"input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "2\nSS",
"output": "NO"
}
] | 1,665,157,277
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 34
| 62
| 0
|
n = int(input())
s = input()
sf = 0
fs = 0
for i in range(len(s)-1):
if s[i]+s[i+1] == 'SF':
sf += 1
elif s[i]+s[i+1] == "FS":
fs += 1
if sf>fs:
print("YES")
else:
print("NO")
|
Title: Between the Offices
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
Input Specification:
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Output Specification:
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower).
Demo Input:
['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n', 'YES\n']
Note:
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
|
```python
n = int(input())
s = input()
sf = 0
fs = 0
for i in range(len(s)-1):
if s[i]+s[i+1] == 'SF':
sf += 1
elif s[i]+s[i+1] == "FS":
fs += 1
if sf>fs:
print("YES")
else:
print("NO")
```
| 3
|
|
399
|
A
|
Pages
|
PROGRAMMING
| 0
|
[
"implementation"
] | null | null |
User ainta is making a web site. This time he is going to make a navigation of the pages. In his site, there are *n* pages numbered by integers from 1 to *n*. Assume that somebody is on the *p*-th page now. The navigation will look like this:
When someone clicks the button "<<" he is redirected to page 1, and when someone clicks the button ">>" he is redirected to page *n*. Of course if someone clicks on a number, he is redirected to the corresponding page.
There are some conditions in the navigation:
- If page 1 is in the navigation, the button "<<" must not be printed. - If page *n* is in the navigation, the button ">>" must not be printed. - If the page number is smaller than 1 or greater than *n*, it must not be printed.
You can see some examples of the navigations. Make a program that prints the navigation.
|
The first and the only line contains three integers *n*, *p*, *k* (3<=≤<=*n*<=≤<=100; 1<=≤<=*p*<=≤<=*n*; 1<=≤<=*k*<=≤<=*n*)
|
Print the proper navigation. Follow the format of the output from the test samples.
|
[
"17 5 2\n",
"6 5 2\n",
"6 1 2\n",
"6 2 2\n",
"9 6 3\n",
"10 6 3\n",
"8 5 4\n"
] |
[
"<< 3 4 (5) 6 7 >> ",
"<< 3 4 (5) 6 ",
"(1) 2 3 >> ",
"1 (2) 3 4 >>",
"<< 3 4 5 (6) 7 8 9",
"<< 3 4 5 (6) 7 8 9 >>",
"1 2 3 4 (5) 6 7 8 "
] |
none
| 500
|
[
{
"input": "17 5 2",
"output": "<< 3 4 (5) 6 7 >> "
},
{
"input": "6 5 2",
"output": "<< 3 4 (5) 6 "
},
{
"input": "6 1 2",
"output": "(1) 2 3 >> "
},
{
"input": "6 2 2",
"output": "1 (2) 3 4 >> "
},
{
"input": "9 6 3",
"output": "<< 3 4 5 (6) 7 8 9 "
},
{
"input": "10 6 3",
"output": "<< 3 4 5 (6) 7 8 9 >> "
},
{
"input": "8 5 4",
"output": "1 2 3 4 (5) 6 7 8 "
},
{
"input": "100 10 20",
"output": "1 2 3 4 5 6 7 8 9 (10) 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 >> "
},
{
"input": "100 25 11",
"output": "<< 14 15 16 17 18 19 20 21 22 23 24 (25) 26 27 28 29 30 31 32 33 34 35 36 >> "
},
{
"input": "5 2 1",
"output": "1 (2) 3 >> "
},
{
"input": "5 3 1",
"output": "<< 2 (3) 4 >> "
},
{
"input": "79 35 12",
"output": "<< 23 24 25 26 27 28 29 30 31 32 33 34 (35) 36 37 38 39 40 41 42 43 44 45 46 47 >> "
},
{
"input": "100 99 5",
"output": "<< 94 95 96 97 98 (99) 100 "
},
{
"input": "100 99 15",
"output": "<< 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 (99) 100 "
},
{
"input": "100 100 17",
"output": "<< 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 (100) "
},
{
"input": "100 35 28",
"output": "<< 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 (35) 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 >> "
},
{
"input": "100 46 38",
"output": "<< 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 (46) 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 >> "
},
{
"input": "100 46 48",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 (46) 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 >> "
},
{
"input": "100 10 100",
"output": "1 2 3 4 5 6 7 8 9 (10) 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "3 1 1",
"output": "(1) 2 >> "
},
{
"input": "3 2 1",
"output": "1 (2) 3 "
},
{
"input": "17 5 3",
"output": "<< 2 3 4 (5) 6 7 8 >> "
},
{
"input": "3 1 3",
"output": "(1) 2 3 "
},
{
"input": "7 5 1",
"output": "<< 4 (5) 6 >> "
},
{
"input": "5 5 5",
"output": "1 2 3 4 (5) "
},
{
"input": "5 3 5",
"output": "1 2 (3) 4 5 "
}
] | 1,577,732,739
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 26
| 124
| 0
|
(b, p, f) = [int(a) for a in input().split(' ')]
t = ''
l = p - f
m = p + f
if l <= 1:
l = 1
else:
t = t + '<<' + ' '
if m > b:
m = b
for g in range (l, m + 1):
if g == p:
t = t + '(' + str(p) + ')' + ' '
else:
t = t + str(g) + ' '
if m < b:
t = t + '>>'
print (t)
|
Title: Pages
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
User ainta is making a web site. This time he is going to make a navigation of the pages. In his site, there are *n* pages numbered by integers from 1 to *n*. Assume that somebody is on the *p*-th page now. The navigation will look like this:
When someone clicks the button "<<" he is redirected to page 1, and when someone clicks the button ">>" he is redirected to page *n*. Of course if someone clicks on a number, he is redirected to the corresponding page.
There are some conditions in the navigation:
- If page 1 is in the navigation, the button "<<" must not be printed. - If page *n* is in the navigation, the button ">>" must not be printed. - If the page number is smaller than 1 or greater than *n*, it must not be printed.
You can see some examples of the navigations. Make a program that prints the navigation.
Input Specification:
The first and the only line contains three integers *n*, *p*, *k* (3<=≤<=*n*<=≤<=100; 1<=≤<=*p*<=≤<=*n*; 1<=≤<=*k*<=≤<=*n*)
Output Specification:
Print the proper navigation. Follow the format of the output from the test samples.
Demo Input:
['17 5 2\n', '6 5 2\n', '6 1 2\n', '6 2 2\n', '9 6 3\n', '10 6 3\n', '8 5 4\n']
Demo Output:
['<< 3 4 (5) 6 7 >> ', '<< 3 4 (5) 6 ', '(1) 2 3 >> ', '1 (2) 3 4 >>', '<< 3 4 5 (6) 7 8 9', '<< 3 4 5 (6) 7 8 9 >>', '1 2 3 4 (5) 6 7 8 ']
Note:
none
|
```python
(b, p, f) = [int(a) for a in input().split(' ')]
t = ''
l = p - f
m = p + f
if l <= 1:
l = 1
else:
t = t + '<<' + ' '
if m > b:
m = b
for g in range (l, m + 1):
if g == p:
t = t + '(' + str(p) + ')' + ' '
else:
t = t + str(g) + ' '
if m < b:
t = t + '>>'
print (t)
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Little Artem found a grasshopper. He brought it to his house and constructed a jumping area for him.
The area looks like a strip of cells 1<=×<=*n*. Each cell contains the direction for the next jump and the length of that jump. Grasshopper starts in the first cell and follows the instructions written on the cells. Grasshopper stops immediately if it jumps out of the strip. Now Artem wants to find out if this will ever happen.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — length of the strip.
Next line contains a string of length *n* which consists of characters "<" and ">" only, that provide the direction of the jump from the corresponding cell. Next line contains *n* integers *d**i* (1<=≤<=*d**i*<=≤<=109) — the length of the jump from the *i*-th cell.
|
Print "INFINITE" (without quotes) if grasshopper will continue his jumps forever. Otherwise print "FINITE" (without quotes).
|
[
"2\n><\n1 2\n",
"3\n>><\n2 1 1\n"
] |
[
"FINITE\n",
"INFINITE"
] |
In the first sample grasshopper starts from the first cell and jumps to the right on the next cell. When he is in the second cell he needs to jump two cells left so he will jump out of the strip.
Second sample grasshopper path is 1 - 3 - 2 - 3 - 2 - 3 and so on. The path is infinite.
| 0
|
[
{
"input": "2\n><\n1 2",
"output": "FINITE"
},
{
"input": "3\n>><\n2 1 1",
"output": "INFINITE"
},
{
"input": "1\n>\n1000000000",
"output": "FINITE"
},
{
"input": "1\n<\n1000000000",
"output": "FINITE"
},
{
"input": "2\n>>\n1 1",
"output": "FINITE"
},
{
"input": "5\n>><><\n1 2 3 1 2",
"output": "FINITE"
},
{
"input": "5\n>><><\n1 2 2 1 2",
"output": "INFINITE"
},
{
"input": "10\n>>>>>>>>><\n1 1 1 1 1 1 1 1 1 10",
"output": "FINITE"
},
{
"input": "10\n>>>>>>>>><\n1 1 1 1 1 1 1 1 1 5",
"output": "INFINITE"
},
{
"input": "10\n>>>>>>>>><\n1 1 1 1 1 1 1 1 1 1",
"output": "INFINITE"
},
{
"input": "3\n><<\n2 1 1",
"output": "INFINITE"
},
{
"input": "10\n>>>>>>>>>>\n1 1 1 1 1 1 1 1 1 100",
"output": "FINITE"
},
{
"input": "3\n><<\n2 100 2",
"output": "INFINITE"
},
{
"input": "3\n><<\n2 3 2",
"output": "INFINITE"
},
{
"input": "3\n>><\n2 3 2",
"output": "INFINITE"
},
{
"input": "3\n><>\n1 1 1",
"output": "INFINITE"
},
{
"input": "3\n>><\n2 2 2",
"output": "INFINITE"
},
{
"input": "4\n>><<\n2 100 2 100",
"output": "INFINITE"
},
{
"input": "3\n><>\n1 1 3",
"output": "INFINITE"
},
{
"input": "5\n><>>>\n1 1 10 10 10",
"output": "INFINITE"
},
{
"input": "5\n><<<<\n500 1 2 3 4",
"output": "FINITE"
},
{
"input": "4\n><><\n2 1000 1 1",
"output": "INFINITE"
},
{
"input": "3\n><<\n2 10 2",
"output": "INFINITE"
},
{
"input": "3\n><<\n2 5 2",
"output": "INFINITE"
},
{
"input": "2\n><\n5 5",
"output": "FINITE"
},
{
"input": "3\n>><\n1 10 10",
"output": "FINITE"
},
{
"input": "4\n><<>\n2 1 1 5",
"output": "INFINITE"
},
{
"input": "5\n<<>>>\n1 1 1 1 1",
"output": "FINITE"
},
{
"input": "3\n><>\n1 1 12345",
"output": "INFINITE"
},
{
"input": "4\n>>><\n3 2 2 3",
"output": "INFINITE"
},
{
"input": "3\n><>\n1 1 100000",
"output": "INFINITE"
}
] | 1,461,519,111
| 3,411
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 33
| 233
| 12,288,000
|
def f(ind):
global n, s, data, used
used[ind] = 1
v = data[ind]
if s[ind] == '<':
v *= -1
ind += v
if ind < 0 or ind >= n:
print('FINITE')
return
else:
if used[ind] == 1:
print('INFINITE')
else:
f(ind)
global n, s, data, used
n = int(input())
s = input()
data = [int(i) for i in input().split()]
used = [0 for i in range(n)]
f(0)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Artem found a grasshopper. He brought it to his house and constructed a jumping area for him.
The area looks like a strip of cells 1<=×<=*n*. Each cell contains the direction for the next jump and the length of that jump. Grasshopper starts in the first cell and follows the instructions written on the cells. Grasshopper stops immediately if it jumps out of the strip. Now Artem wants to find out if this will ever happen.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — length of the strip.
Next line contains a string of length *n* which consists of characters "<" and ">" only, that provide the direction of the jump from the corresponding cell. Next line contains *n* integers *d**i* (1<=≤<=*d**i*<=≤<=109) — the length of the jump from the *i*-th cell.
Output Specification:
Print "INFINITE" (without quotes) if grasshopper will continue his jumps forever. Otherwise print "FINITE" (without quotes).
Demo Input:
['2\n><\n1 2\n', '3\n>><\n2 1 1\n']
Demo Output:
['FINITE\n', 'INFINITE']
Note:
In the first sample grasshopper starts from the first cell and jumps to the right on the next cell. When he is in the second cell he needs to jump two cells left so he will jump out of the strip.
Second sample grasshopper path is 1 - 3 - 2 - 3 - 2 - 3 and so on. The path is infinite.
|
```python
def f(ind):
global n, s, data, used
used[ind] = 1
v = data[ind]
if s[ind] == '<':
v *= -1
ind += v
if ind < 0 or ind >= n:
print('FINITE')
return
else:
if used[ind] == 1:
print('INFINITE')
else:
f(ind)
global n, s, data, used
n = int(input())
s = input()
data = [int(i) for i in input().split()]
used = [0 for i in range(n)]
f(0)
```
| -1
|
|
133
|
A
|
HQ9+
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
HQ9+ is a joke programming language which has only four one-character instructions:
- "H" prints "Hello, World!",- "Q" prints the source code of the program itself,- "9" prints the lyrics of "99 Bottles of Beer" song, - "+" increments the value stored in the internal accumulator.
Instructions "H" and "Q" are case-sensitive and must be uppercase. The characters of the program which are not instructions are ignored.
You are given a program written in HQ9+. You have to figure out whether executing this program will produce any output.
|
The input will consist of a single line *p* which will give a program in HQ9+. String *p* will contain between 1 and 100 characters, inclusive. ASCII-code of each character of *p* will be between 33 (exclamation mark) and 126 (tilde), inclusive.
|
Output "YES", if executing the program will produce any output, and "NO" otherwise.
|
[
"Hi!\n",
"Codeforces\n"
] |
[
"YES\n",
"NO\n"
] |
In the first case the program contains only one instruction — "H", which prints "Hello, World!".
In the second case none of the program characters are language instructions.
| 500
|
[
{
"input": "Hi!",
"output": "YES"
},
{
"input": "Codeforces",
"output": "NO"
},
{
"input": "a+b=c",
"output": "NO"
},
{
"input": "hq-lowercase",
"output": "NO"
},
{
"input": "Q",
"output": "YES"
},
{
"input": "9",
"output": "YES"
},
{
"input": "H",
"output": "YES"
},
{
"input": "+",
"output": "NO"
},
{
"input": "~",
"output": "NO"
},
{
"input": "dEHsbM'gS[\\brZ_dpjXw8f?L[4E\"s4Zc9*(,j:>p$}m7HD[_9nOWQ\\uvq2mHWR",
"output": "YES"
},
{
"input": "tt6l=RHOfStm.;Qd$-}zDes*E,.F7qn5-b%HC",
"output": "YES"
},
{
"input": "@F%K2=%RyL/",
"output": "NO"
},
{
"input": "juq)k(FT.^G=G\\zcqnO\"uJIE1_]KFH9S=1c\"mJ;F9F)%>&.WOdp09+k`Yc6}\"6xw,Aos:M\\_^^:xBb[CcsHm?J",
"output": "YES"
},
{
"input": "6G_\"Fq#<AWyHG=Rci1t%#Jc#x<Fpg'N@t%F=``YO7\\Zd;6PkMe<#91YgzTC)",
"output": "YES"
},
{
"input": "Fvg_~wC>SO4lF}*c`Q;mII9E{4.QodbqN]C",
"output": "YES"
},
{
"input": "p-UXsbd&f",
"output": "NO"
},
{
"input": "<]D7NMA)yZe=`?RbP5lsa.l_Mg^V:\"-0x+$3c,q&L%18Ku<HcA\\s!^OQblk^x{35S'>yz8cKgVHWZ]kV0>_",
"output": "YES"
},
{
"input": "f.20)8b+.R}Gy!DbHU3v(.(=Q^`z[_BaQ}eO=C1IK;b2GkD\\{\\Bf\"!#qh]",
"output": "YES"
},
{
"input": "}do5RU<(w<q[\"-NR)IAH_HyiD{",
"output": "YES"
},
{
"input": "Iy^.,Aw*,5+f;l@Q;jLK'G5H-r1Pfmx?ei~`CjMmUe{K:lS9cu4ay8rqRh-W?Gqv!e-j*U)!Mzn{E8B6%~aSZ~iQ_QwlC9_cX(o8",
"output": "YES"
},
{
"input": "sKLje,:q>-D,;NvQ3,qN3-N&tPx0nL/,>Ca|z\"k2S{NF7btLa3_TyXG4XZ:`(t&\"'^M|@qObZxv",
"output": "YES"
},
{
"input": "%z:c@1ZsQ@\\6U/NQ+M9R>,$bwG`U1+C\\18^:S},;kw!&4r|z`",
"output": "YES"
},
{
"input": "OKBB5z7ud81[Tn@P\"nDUd,>@",
"output": "NO"
},
{
"input": "y{0;neX]w0IenPvPx0iXp+X|IzLZZaRzBJ>q~LhMhD$x-^GDwl;,a'<bAqH8QrFwbK@oi?I'W.bZ]MlIQ/x(0YzbTH^l.)]0Bv",
"output": "YES"
},
{
"input": "EL|xIP5_+Caon1hPpQ0[8+r@LX4;b?gMy>;/WH)pf@Ur*TiXu*e}b-*%acUA~A?>MDz#!\\Uh",
"output": "YES"
},
{
"input": "UbkW=UVb>;z6)p@Phr;^Dn.|5O{_i||:Rv|KJ_ay~V(S&Jp",
"output": "NO"
},
{
"input": "!3YPv@2JQ44@)R2O_4`GO",
"output": "YES"
},
{
"input": "Kba/Q,SL~FMd)3hOWU'Jum{9\"$Ld4:GW}D]%tr@G{hpG:PV5-c'VIZ~m/6|3I?_4*1luKnOp`%p|0H{[|Y1A~4-ZdX,Rw2[\\",
"output": "YES"
},
{
"input": "NRN*=v>;oU7[acMIJn*n^bWm!cm3#E7Efr>{g-8bl\"DN4~_=f?[T;~Fq#&)aXq%</GcTJD^e$@Extm[e\"C)q_L",
"output": "NO"
},
{
"input": "y#<fv{_=$MP!{D%I\\1OqjaqKh[pqE$KvYL<9@*V'j8uH0/gQdA'G;&y4Cv6&",
"output": "YES"
},
{
"input": "+SE_Pg<?7Fh,z&uITQut2a-mk8X8La`c2A}",
"output": "YES"
},
{
"input": "Uh3>ER](J",
"output": "NO"
},
{
"input": "!:!{~=9*\\P;Z6F?HC5GadFz)>k*=u|+\"Cm]ICTmB!`L{&oS/z6b~#Snbp/^\\Q>XWU-vY+/dP.7S=-#&whS@,",
"output": "YES"
},
{
"input": "KimtYBZp+ISeO(uH;UldoE6eAcp|9u?SzGZd6j-e}[}u#e[Cx8.qgY]$2!",
"output": "YES"
},
{
"input": "[:[SN-{r>[l+OggH3v3g{EPC*@YBATT@",
"output": "YES"
},
{
"input": "'jdL(vX",
"output": "NO"
},
{
"input": "Q;R+aay]cL?Zh*uG\"YcmO*@Dts*Gjp}D~M7Z96+<4?9I3aH~0qNdO(RmyRy=ci,s8qD_kwj;QHFzD|5,5",
"output": "YES"
},
{
"input": "{Q@#<LU_v^qdh%gGxz*pu)Y\"]k-l-N30WAxvp2IE3:jD0Wi4H/xWPH&s",
"output": "YES"
},
{
"input": "~@Gb(S&N$mBuBUMAky-z^{5VwLNTzYg|ZUZncL@ahS?K*As<$iNUARM3r43J'jJB)$ujfPAq\"G<S9flGyakZg!2Z.-NJ|2{F>]",
"output": "YES"
},
{
"input": "Jp5Aa>aP6fZ!\\6%A}<S}j{O4`C6y$8|i3IW,WHy&\"ioE&7zP\"'xHAY;:x%@SnS]Mr{R|})gU",
"output": "YES"
},
{
"input": "ZA#:U)$RI^sE\\vuAt]x\"2zipI!}YEu2<j$:H0_9/~eB?#->",
"output": "YES"
},
{
"input": "&ppw0._:\\p-PuWM@l}%%=",
"output": "NO"
},
{
"input": "P(^pix\"=oiEZu8?@d@J(I`Xp5TN^T3\\Z7P5\"ZrvZ{2Fwz3g-8`U!)(1$a<g+9Q|COhDoH;HwFY02Pa|ZGp$/WZBR=>6Jg!yr",
"output": "YES"
},
{
"input": "`WfODc\\?#ax~1xu@[ao+o_rN|L7%v,p,nDv>3+6cy.]q3)+A6b!q*Hc+#.t4f~vhUa~$^q",
"output": "YES"
},
{
"input": ",)TH9N}'6t2+0Yg?S#6/{_.,!)9d}h'wG|sY&'Ul4D0l0",
"output": "YES"
},
{
"input": "VXB&r9Z)IlKOJ:??KDA",
"output": "YES"
},
{
"input": "\")1cL>{o\\dcYJzu?CefyN^bGRviOH&P7rJS3PT4:0V3F)%\\}L=AJouYsj_>j2|7^1NWu*%NbOP>ngv-ls<;b-4Sd3Na0R",
"output": "YES"
},
{
"input": "2Y}\\A)>row{~c[g>:'.|ZC8%UTQ/jcdhK%6O)QRC.kd@%y}LJYk=V{G5pQK/yKJ%{G3C",
"output": "YES"
},
{
"input": "O.&=qt(`z(",
"output": "NO"
},
{
"input": "_^r6fyIc/~~;>l%9?aVEi7-{=,[<aMiB'-scSg$$|\"jAzY0N>QkHHGBZj2c\"=fhRlWd5;5K|GgU?7h]!;wl@",
"output": "YES"
},
{
"input": "+/`sAd&eB29E=Nu87${.u6GY@$^a$,}s^!p!F}B-z8<<wORb<S7;HM1a,gp",
"output": "YES"
},
{
"input": "U_ilyOGMT+QiW/M8/D(1=6a7)_FA,h4`8",
"output": "YES"
},
{
"input": "!0WKT:$O",
"output": "NO"
},
{
"input": "1EE*I%EQz6$~pPu7|(r7nyPQt4uGU@]~H'4uII?b1_Wn)K?ZRHrr0z&Kr;}aO3<mN=3:{}QgPxI|Ncm4#)",
"output": "YES"
},
{
"input": "[u3\"$+!:/.<Dp1M7tH}:zxjt],^kv}qP;y12\"`^'/u*h%AFmPJ>e1#Yly",
"output": "YES"
},
{
"input": "'F!_]tB<A&UO+p?7liE>(x&RFgG2~\\(",
"output": "NO"
},
{
"input": "Qv)X8",
"output": "YES"
},
{
"input": "aGv7,J@&g1(}E3g6[LuDZwZl2<v7IwQA%\"R(?ouBD>_=y\"3Kf%^>vON<a^T\\G^ootgE@whWmZo=[ex|F",
"output": "YES"
},
{
"input": "e{}2vQ+/r@p0}cLKNe4MCk",
"output": "YES"
},
{
"input": "mzbmweyydiadtlcouegmdbyfwurpwbpuvhifnuapwyndmhtqvkgkbhtytszotwflegsjzzszfwtzfpnscguemwrczqxycivdqnkH",
"output": "YES"
},
{
"input": "Qzbmweyydiadtlcouegmdbyfwurpwbpuvhifnuapwyndmhtqvkgkbhtytszotwflegsjzzszfwtzfpnscguemwrczqxycivdqnky",
"output": "YES"
},
{
"input": "mzbmweyydiadtlcouegmdbyfwurpwb9uvhifnuapwyndmhtqvkgkbhtytszotwflegsjzzszfwtzfpnscguemwrczqxycivdqnky",
"output": "YES"
},
{
"input": "1H1",
"output": "YES"
},
{
"input": "+Q",
"output": "YES"
},
{
"input": "1ab",
"output": "NO"
},
{
"input": "!",
"output": "NO"
},
{
"input": "0+",
"output": "NO"
},
{
"input": "+H",
"output": "YES"
},
{
"input": "cH",
"output": "YES"
},
{
"input": "+8",
"output": "NO"
},
{
"input": "8+",
"output": "NO"
},
{
"input": "++++++++++++++++++++++++++",
"output": "NO"
},
{
"input": "(+)",
"output": "NO"
},
{
"input": "H+",
"output": "YES"
},
{
"input": "a!",
"output": "NO"
},
{
"input": "++++++++++++++",
"output": "NO"
},
{
"input": "+++++++++++++++++++++++++++++++++++++++++++++++++++++++++",
"output": "NO"
},
{
"input": "8",
"output": "NO"
},
{
"input": "3",
"output": "NO"
},
{
"input": "HQ9",
"output": "YES"
},
{
"input": "+++H",
"output": "YES"
},
{
"input": "++++++++++",
"output": "NO"
},
{
"input": "HHHHHHH",
"output": "YES"
},
{
"input": "abacabaH",
"output": "YES"
},
{
"input": "+G",
"output": "NO"
}
] | 1,694,107,682
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 62
| 0
|
def code(string):
formula="HQ9+"
for i in range(len(string)):
if string[i] in formula:
return "YES"
return "NO"
string=input()
result=code(string)
print(result)
|
Title: HQ9+
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
HQ9+ is a joke programming language which has only four one-character instructions:
- "H" prints "Hello, World!",- "Q" prints the source code of the program itself,- "9" prints the lyrics of "99 Bottles of Beer" song, - "+" increments the value stored in the internal accumulator.
Instructions "H" and "Q" are case-sensitive and must be uppercase. The characters of the program which are not instructions are ignored.
You are given a program written in HQ9+. You have to figure out whether executing this program will produce any output.
Input Specification:
The input will consist of a single line *p* which will give a program in HQ9+. String *p* will contain between 1 and 100 characters, inclusive. ASCII-code of each character of *p* will be between 33 (exclamation mark) and 126 (tilde), inclusive.
Output Specification:
Output "YES", if executing the program will produce any output, and "NO" otherwise.
Demo Input:
['Hi!\n', 'Codeforces\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first case the program contains only one instruction — "H", which prints "Hello, World!".
In the second case none of the program characters are language instructions.
|
```python
def code(string):
formula="HQ9+"
for i in range(len(string)):
if string[i] in formula:
return "YES"
return "NO"
string=input()
result=code(string)
print(result)
```
| 0
|
|
285
|
C
|
Building Permutation
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*.
You have a sequence of integers *a*1,<=*a*2,<=...,<=*a**n*. In one move, you are allowed to decrease or increase any number by one. Count the minimum number of moves, needed to build a permutation from this sequence.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105) — the size of the sought permutation. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=109<=≤<=*a**i*<=≤<=109).
|
Print a single number — the minimum number of moves.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
[
"2\n3 0\n",
"3\n-1 -1 2\n"
] |
[
"2\n",
"6\n"
] |
In the first sample you should decrease the first number by one and then increase the second number by one. The resulting permutation is (2, 1).
In the second sample you need 6 moves to build permutation (1, 3, 2).
| 1,500
|
[
{
"input": "2\n3 0",
"output": "2"
},
{
"input": "3\n-1 -1 2",
"output": "6"
},
{
"input": "5\n-3 5 -3 3 3",
"output": "10"
},
{
"input": "10\n9 6 -2 4 1 1 1 9 6 2",
"output": "18"
},
{
"input": "9\n2 0 0 6 5 4 1 9 3",
"output": "15"
},
{
"input": "100\n-77 57 -95 -23 53 -28 82 -83 38 -73 85 28 25 6 -43 4 -10 -30 -9 -92 14 34 -93 61 36 -100 90 -68 28 16 100 -3 97 30 36 -55 62 -62 53 74 -50 -23 67 11 22 -30 -19 83 7 84 43 90 -65 -75 -15 97 90 15 66 2 13 -91 91 -44 46 51 51 -58 95 77 20 30 76 79 91 60 76 2 82 42 -93 94 -57 88 65 -95 -66 100 -9 33 -67 54 -99 97 53 13 54 66 60 -48",
"output": "3459"
}
] | 1,591,705,228
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 33
| 514
| 26,112,000
|
n=int(input())
arr=[int(i) for i in input().split()]
arr.sort()
ans=0
for i in range(n):
ans+=abs(arr[i]-i-1)
print(ans)
|
Title: Building Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*.
You have a sequence of integers *a*1,<=*a*2,<=...,<=*a**n*. In one move, you are allowed to decrease or increase any number by one. Count the minimum number of moves, needed to build a permutation from this sequence.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105) — the size of the sought permutation. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=109<=≤<=*a**i*<=≤<=109).
Output Specification:
Print a single number — the minimum number of moves.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['2\n3 0\n', '3\n-1 -1 2\n']
Demo Output:
['2\n', '6\n']
Note:
In the first sample you should decrease the first number by one and then increase the second number by one. The resulting permutation is (2, 1).
In the second sample you need 6 moves to build permutation (1, 3, 2).
|
```python
n=int(input())
arr=[int(i) for i in input().split()]
arr.sort()
ans=0
for i in range(n):
ans+=abs(arr[i]-i-1)
print(ans)
```
| 3
|
|
805
|
B
|
3-palindrome
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms"
] | null | null |
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
|
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
|
[
"2\n",
"3\n"
] |
[
"aa\n",
"bba\n"
] |
A palindrome is a sequence of characters which reads the same backward and forward.
| 1,000
|
[
{
"input": "2",
"output": "aa"
},
{
"input": "3",
"output": "aab"
},
{
"input": "38",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "47",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "59",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "67",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "77",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "89",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "98",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "109",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "117",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "1",
"output": "a"
},
{
"input": "200000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "100000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "143670",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "104217",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "17879",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "131809",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "140873",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "77859",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "153022",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "179227",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "182801",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "5188",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "86539",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "12802",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "120289",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "132866",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "133377",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "31775",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "160397",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "161415",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "163623",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "22942",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "134767",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "52257",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "64905",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "183758",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "60131",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "146883",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "6",
"output": "aabbaa"
},
{
"input": "4",
"output": "aabb"
}
] | 1,600,681,740
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 2
| 124
| 0
|
n = int(input())
# aabcaab
l = []
for i in range(0,n):
k = i%7
if k == 0 or k == 1 or k ==4 or k == 5:
l.append('a')
elif k == 2 or k == 6:
l.append('b')
else:
l.append('c')
s = ""
print(s.join(l))
|
Title: 3-palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
Output Specification:
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
Demo Input:
['2\n', '3\n']
Demo Output:
['aa\n', 'bba\n']
Note:
A palindrome is a sequence of characters which reads the same backward and forward.
|
```python
n = int(input())
# aabcaab
l = []
for i in range(0,n):
k = i%7
if k == 0 or k == 1 or k ==4 or k == 5:
l.append('a')
elif k == 2 or k == 6:
l.append('b')
else:
l.append('c')
s = ""
print(s.join(l))
```
| 0
|
|
762
|
A
|
k-th divisor
|
PROGRAMMING
| 1,400
|
[
"math",
"number theory"
] | null | null |
You are given two integers *n* and *k*. Find *k*-th smallest divisor of *n*, or report that it doesn't exist.
Divisor of *n* is any such natural number, that *n* can be divided by it without remainder.
|
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=1015, 1<=≤<=*k*<=≤<=109).
|
If *n* has less than *k* divisors, output -1.
Otherwise, output the *k*-th smallest divisor of *n*.
|
[
"4 2\n",
"5 3\n",
"12 5\n"
] |
[
"2\n",
"-1\n",
"6\n"
] |
In the first example, number 4 has three divisors: 1, 2 and 4. The second one is 2.
In the second example, number 5 has only two divisors: 1 and 5. The third divisor doesn't exist, so the answer is -1.
| 0
|
[
{
"input": "4 2",
"output": "2"
},
{
"input": "5 3",
"output": "-1"
},
{
"input": "12 5",
"output": "6"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "866421317361600 26880",
"output": "866421317361600"
},
{
"input": "866421317361600 26881",
"output": "-1"
},
{
"input": "1000000000000000 1000000000",
"output": "-1"
},
{
"input": "1000000000000000 100",
"output": "1953125"
},
{
"input": "1 2",
"output": "-1"
},
{
"input": "4 3",
"output": "4"
},
{
"input": "4 4",
"output": "-1"
},
{
"input": "9 3",
"output": "9"
},
{
"input": "21 3",
"output": "7"
},
{
"input": "67280421310721 1",
"output": "1"
},
{
"input": "6 3",
"output": "3"
},
{
"input": "3 3",
"output": "-1"
},
{
"input": "16 3",
"output": "4"
},
{
"input": "1 1000",
"output": "-1"
},
{
"input": "16 4",
"output": "8"
},
{
"input": "36 8",
"output": "18"
},
{
"input": "49 4",
"output": "-1"
},
{
"input": "9 4",
"output": "-1"
},
{
"input": "16 1",
"output": "1"
},
{
"input": "16 6",
"output": "-1"
},
{
"input": "16 5",
"output": "16"
},
{
"input": "25 4",
"output": "-1"
},
{
"input": "4010815561 2",
"output": "63331"
},
{
"input": "49 3",
"output": "49"
},
{
"input": "36 6",
"output": "9"
},
{
"input": "36 10",
"output": "-1"
},
{
"input": "25 3",
"output": "25"
},
{
"input": "22876792454961 28",
"output": "7625597484987"
},
{
"input": "1234 2",
"output": "2"
},
{
"input": "179458711 2",
"output": "179458711"
},
{
"input": "900104343024121 100000",
"output": "-1"
},
{
"input": "8 3",
"output": "4"
},
{
"input": "100 6",
"output": "20"
},
{
"input": "15500 26",
"output": "-1"
},
{
"input": "111111 1",
"output": "1"
},
{
"input": "100000000000000 200",
"output": "160000000000"
},
{
"input": "1000000000000 100",
"output": "6400000"
},
{
"input": "100 10",
"output": "-1"
},
{
"input": "1000000000039 2",
"output": "1000000000039"
},
{
"input": "64 5",
"output": "16"
},
{
"input": "999999961946176 33",
"output": "63245552"
},
{
"input": "376219076689 3",
"output": "376219076689"
},
{
"input": "999999961946176 63",
"output": "999999961946176"
},
{
"input": "1048576 12",
"output": "2048"
},
{
"input": "745 21",
"output": "-1"
},
{
"input": "748 6",
"output": "22"
},
{
"input": "999999961946176 50",
"output": "161082468097"
},
{
"input": "10 3",
"output": "5"
},
{
"input": "1099511627776 22",
"output": "2097152"
},
{
"input": "1000000007 100010",
"output": "-1"
},
{
"input": "3 1",
"output": "1"
},
{
"input": "100 8",
"output": "50"
},
{
"input": "100 7",
"output": "25"
},
{
"input": "7 2",
"output": "7"
},
{
"input": "999999961946176 64",
"output": "-1"
},
{
"input": "20 5",
"output": "10"
},
{
"input": "999999999999989 2",
"output": "999999999999989"
},
{
"input": "100000000000000 114",
"output": "10240000"
},
{
"input": "99999640000243 3",
"output": "9999991"
},
{
"input": "999998000001 566",
"output": "333332666667"
},
{
"input": "99999820000081 2",
"output": "9999991"
},
{
"input": "49000042000009 3",
"output": "49000042000009"
},
{
"input": "151491429961 4",
"output": "-1"
},
{
"input": "32416190071 2",
"output": "32416190071"
},
{
"input": "1000 8",
"output": "25"
},
{
"input": "1999967841 15",
"output": "1999967841"
},
{
"input": "26880 26880",
"output": "-1"
},
{
"input": "151491429961 3",
"output": "151491429961"
},
{
"input": "90000000000 300",
"output": "100000000"
},
{
"input": "98765004361 10",
"output": "-1"
},
{
"input": "15 2",
"output": "3"
},
{
"input": "16 2",
"output": "2"
},
{
"input": "1996 2",
"output": "2"
},
{
"input": "1997 2",
"output": "1997"
},
{
"input": "1999 2",
"output": "1999"
},
{
"input": "1998 2",
"output": "2"
},
{
"input": "1998 1",
"output": "1"
},
{
"input": "1998 7",
"output": "27"
},
{
"input": "1998 8",
"output": "37"
},
{
"input": "100000380000361 2",
"output": "10000019"
},
{
"input": "15 1",
"output": "1"
},
{
"input": "100000000000000 226",
"output": "-1"
},
{
"input": "844030857550613 517",
"output": "-1"
},
{
"input": "4567890 14",
"output": "430"
},
{
"input": "123123123 123123123",
"output": "-1"
},
{
"input": "24 4",
"output": "4"
},
{
"input": "999999993568952 17",
"output": "31622777"
},
{
"input": "99999999994190 9",
"output": "241656799"
},
{
"input": "999997874844049 4",
"output": "-1"
},
{
"input": "99999999999931 2",
"output": "99999999999931"
},
{
"input": "2 3",
"output": "-1"
},
{
"input": "67280421310721 2",
"output": "67280421310721"
}
] | 1,642,691,217
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 4
| 2,000
| 0
|
n,k = map(int,input().split())
kth = 0
contin = True
for i in range(1,int(n**0.5)+1):
if n%i == 0:
kth += 1
if kth == k:
print(i)
contin = False
break
if contin:
for i in range(int(n**0.5),0,-1):
if n%i == 0:
kth += 1
if kth == k:
print(n//i)
break
if kth<k:
print(-1)
|
Title: k-th divisor
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two integers *n* and *k*. Find *k*-th smallest divisor of *n*, or report that it doesn't exist.
Divisor of *n* is any such natural number, that *n* can be divided by it without remainder.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=1015, 1<=≤<=*k*<=≤<=109).
Output Specification:
If *n* has less than *k* divisors, output -1.
Otherwise, output the *k*-th smallest divisor of *n*.
Demo Input:
['4 2\n', '5 3\n', '12 5\n']
Demo Output:
['2\n', '-1\n', '6\n']
Note:
In the first example, number 4 has three divisors: 1, 2 and 4. The second one is 2.
In the second example, number 5 has only two divisors: 1 and 5. The third divisor doesn't exist, so the answer is -1.
|
```python
n,k = map(int,input().split())
kth = 0
contin = True
for i in range(1,int(n**0.5)+1):
if n%i == 0:
kth += 1
if kth == k:
print(i)
contin = False
break
if contin:
for i in range(int(n**0.5),0,-1):
if n%i == 0:
kth += 1
if kth == k:
print(n//i)
break
if kth<k:
print(-1)
```
| 0
|
|
991
|
D
|
Bishwock
|
PROGRAMMING
| 1,500
|
[
"dp",
"greedy"
] | null | null |
Bishwock is a chess figure that consists of three squares resembling an "L-bar". This figure can be rotated by 90, 180 and 270 degrees so it can have four possible states:
Bishwocks don't attack any squares and can even occupy on the adjacent squares as long as they don't occupy the same square.
Vasya has a board with $2\times n$ squares onto which he wants to put some bishwocks. To his dismay, several squares on this board are already occupied by pawns and Vasya can't put bishwocks there. However, pawns also don't attack bishwocks and they can occupy adjacent squares peacefully.
Knowing the positions of pawns on the board, help Vasya to determine the maximum amount of bishwocks he can put onto the board so that they wouldn't occupy the same squares and wouldn't occupy squares with pawns.
|
The input contains two nonempty strings that describe Vasya's board. Those strings contain only symbols "0" (zero) that denote the empty squares and symbols "X" (uppercase English letter) that denote the squares occupied by pawns. Strings are nonempty and are of the same length that does not exceed $100$.
|
Output a single integer — the maximum amount of bishwocks that can be placed onto the given board.
|
[
"00\n00\n",
"00X00X0XXX0\n0XXX0X00X00\n",
"0X0X0\n0X0X0\n",
"0XXX0\n00000\n"
] |
[
"1",
"4",
"0",
"2"
] |
none
| 1,500
|
[
{
"input": "00\n00",
"output": "1"
},
{
"input": "00X00X0XXX0\n0XXX0X00X00",
"output": "4"
},
{
"input": "0X0X0\n0X0X0",
"output": "0"
},
{
"input": "0XXX0\n00000",
"output": "2"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\nX",
"output": "0"
},
{
"input": "X\n0",
"output": "0"
},
{
"input": "XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX\nXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX",
"output": "0"
},
{
"input": "0000X0XX000X0XXXX0X0XXXX000X0X0XX000XXX0X00XX00XX00X0000XX0XX00X0X00X0X00X0XX000XX00XXXXXXXXXXXXXXX0\nX00XX0XX00XXXX00XXXX00XX0000000000XXX0X00XX0XX00XXX00X00X0XX0000X00XXXXXXX00X00000XXX00XXX00XXX0X0XX",
"output": "18"
},
{
"input": "X\nX",
"output": "0"
},
{
"input": "X0\n00",
"output": "1"
},
{
"input": "0X\n00",
"output": "1"
},
{
"input": "00\nX0",
"output": "1"
},
{
"input": "00\n0X",
"output": "1"
},
{
"input": "XX\nXX",
"output": "0"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "66"
},
{
"input": "00000\n00000",
"output": "3"
},
{
"input": "00000000\nXXXXXXXX",
"output": "0"
},
{
"input": "X00X0XXXX0\nX0XXX0XX00",
"output": "2"
},
{
"input": "00000XX0000000000000\n0X00000XX0000X00X000",
"output": "10"
},
{
"input": "XXX00XXX0XXX0X0XXXXX\nXXX00XXX0XXX0X0XXXXX",
"output": "1"
},
{
"input": "000X00000X00000X00000000000000\n000X00000X00000X00000000000000",
"output": "17"
},
{
"input": "00X0X00000X0X0X00X0X0XXX0000X0\n0000000X00X000X000000000X00000",
"output": "12"
},
{
"input": "000000000000000000000000000000000000000000\n00X000X00X00X0000X0XX000000000X000X0000000",
"output": "23"
},
{
"input": "X0XXX00XX00X0XXXXXXXX0X0X0XX0X0X0XXXXX00X0XXXX00XX000XX0X000XX000XX\n0000000000000000000000000000000000000000000000000000000000000000000",
"output": "24"
},
{
"input": "0000000000000000000000000000X00000000000000XX0X00000X0000000000000000000000000000000000000\n0000000000000000000000000X0000000000000000000000000000000000000000000000000000000000000000",
"output": "57"
},
{
"input": "0000000000000000000000000000000000000X000000000000000000000X0X00000000000000000000000000000\n000000000000000000000000000X0X0000000000000000000000000000000000000000000000000000000000000",
"output": "58"
},
{
"input": "00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\nX0X00000000000000000000000000X000000000X0000X00X000000XX000000X0X00000000X000X000000X0000X00",
"output": "55"
},
{
"input": "000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\nXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX0XXXXXXXXXXXXXXXX0XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX",
"output": "2"
},
{
"input": "XXXXXXXXXXXXXXXXXXXXXXX0XXX000XXXX0XXXXXXXXXXXXXXXXXXXXXXXXX0XXXXXXXXXXXX0X0XXXXXXXXXXXXXXXXXX\n0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "7"
},
{
"input": "00000XX0000000000000000000000000000000000000000000X0000000X0000000000000X0000000000000000X00000\n00000XX0000000000000000000000000000000000000000000X0000000X0000000000000X0000000000000000X00000",
"output": "56"
},
{
"input": "000000000000000X0000000000000000000000000XX0000000000000000X00000000000000000000000X000000000000\n000000000000000X0000000000000000000000000XX0000000000000000X00000000000000000000000X000000000000",
"output": "59"
},
{
"input": "000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "64"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n0000000000000000000X000X0000000000X00000000X00000000000000000000000000000000000000000000000000000000",
"output": "65"
},
{
"input": "000000000000000000X00X000000000000000000000000000000000000000X00000000X0000000X0000000000000000000X0\n000000000000000000X00X000000000000000000000000000000000000000X00000000X0000000X0000000000000000000X0",
"output": "60"
},
{
"input": "XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX0XX0XXXXXXXXXXXXXXXX0XXXXXXXXXXXXXXXXXXXXXXX0XXXXXXXXXXXX\nXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX0XX0XXXXXXXXXXXXXXXX0XXXXXXXXXXXXXXXXXXXXXXX0XXXXXXXXXXXX",
"output": "0"
},
{
"input": "XXXXXXXXXXX0X00XXXXXXXXXXXXXXXXXXXX0XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX0XXXXXXXXXXX00XXXXXXXXX0X0XXX0XX\nXXXXXXXXXXX0X00XXXXXXXXXXXXXXXXXXXX0XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX0XXXXXXXXXXX00XXXXXXXXX0X0XXX0XX",
"output": "2"
},
{
"input": "0X0X0\nX0X0X",
"output": "0"
},
{
"input": "X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0\n0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X",
"output": "0"
},
{
"input": "X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0\n0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X",
"output": "0"
},
{
"input": "X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X\n0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0",
"output": "0"
},
{
"input": "0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X\nX0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0",
"output": "0"
},
{
"input": "00000000000000X0000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "66"
},
{
"input": "XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX0XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX\nXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX00XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX",
"output": "1"
},
{
"input": "XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX00\nXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX0",
"output": "1"
},
{
"input": "00XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX\nX0XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX",
"output": "1"
},
{
"input": "XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX0XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX\nXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX00XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX",
"output": "0"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000X0000000000000000000000000000000000000X000\n0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "66"
},
{
"input": "00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000XX\n000000000000000000000000000000000X00000000000000000X000000000000000000000000000000000000000000000000",
"output": "65"
},
{
"input": "0000X00X000000X0000X00X00X0000000000X0000000X000X00000X0X000XXX00000000XX0XX000000000000X00000000000\n000000000XX000000X00000X00X00X00000000000000000X0X000XX0000000000000X0X00X0000X0000X000000X0000000XX",
"output": "49"
},
{
"input": "0000000000000000000000000000000000X0000000000000000000000000000000000000000000000000000000000000000\n000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "65"
},
{
"input": "00000000000000000000000000X000000000000000000000000000000000000000000X00000X0000X000000000000000000\n000X0000000000X000000000000000000000X0000000000X0X0000000000000000000X00000000000000000000000000000",
"output": "62"
},
{
"input": "000X00XX0XX0X00X0XX0XXXX00XXX0X00000000XXX0XXXXXXX0X00X00XX00X0XXX00000XXXX0XX00X00XXX00X0X0XXXX000\nXXXXX000X0XXX000XXXXX0XX0000XX0XXX0XXX000XXX00XXXXX00X00XX0000X0XX0XX0XX000X0XX00X00XX00XX00X00XX0X",
"output": "16"
},
{
"input": "X0X0XXXX0XXXXXXXXXX00XXXXXXXXXXXXXXXXXX0XXXXX0XX0X00X0XXXXXXX0X0XXXXXXXXX0X0X0XX0XX0000XXXX00XXX0XX\nXX0XXXXXXX0X0X00XXXX0X000X0XXXXXX0XXX0X0XXXX0XXXXXXXXXXXXXX00XX00XXX0XXXXXXXXXX00XXXX0XXXX0XXXXXXXX",
"output": "4"
},
{
"input": "000\n000",
"output": "2"
},
{
"input": "000000000000000000000\n000000000000000000000",
"output": "14"
},
{
"input": "00000000000000000000000000000000000000\n00000000000000000000000000000000000000",
"output": "25"
},
{
"input": "0000\n00X0",
"output": "2"
},
{
"input": "000\n00X",
"output": "1"
},
{
"input": "X000\nX000",
"output": "2"
},
{
"input": "X0000X000XX00000000000000000000XX000X0000X00X0X00XX000000000000X0000X0X0XX00\n00X00XX00000000X0000000X000X000X0X0X00X000X0X0X0000X0000000X000XX000XX000X00",
"output": "33"
},
{
"input": "0X00\n0000",
"output": "2"
},
{
"input": "0X0\n000",
"output": "1"
},
{
"input": "000000\n000000",
"output": "4"
},
{
"input": "X00X0\n00000",
"output": "2"
},
{
"input": "000\n0X0",
"output": "1"
},
{
"input": "X000\n00X0",
"output": "2"
},
{
"input": "X0000\n00000",
"output": "3"
},
{
"input": "X000X\nX000X",
"output": "2"
},
{
"input": "X0000X\n00000X",
"output": "3"
},
{
"input": "000000000000\n000000000000",
"output": "8"
},
{
"input": "00000\n0000X",
"output": "3"
}
] | 1,689,040,094
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 72
| 92
| 2,252,800
|
from functools import cache
x = input()
y = input()
@cache
def dfs(a, b: bytes, index: int):
if index == len(x): return 0
ans = dfs(x[index], y[index], index + 1)
if (a == '0' or b == '0') and x[index] == '0' and y[index] == '0':
ans = max(ans, dfs('X', 'X', index + 1) + 1)
if a == '0' and b == '0' and x[index] == '0':
ans = max(dfs('X', y[index], index + 1) + 1, ans)
if a == '0' and b == '0' and y[index] == '0':
ans = max(dfs(x[index], 'X', index + 1) + 1, ans)
return ans
print(dfs(x[0], y[0], 1))
|
Title: Bishwock
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bishwock is a chess figure that consists of three squares resembling an "L-bar". This figure can be rotated by 90, 180 and 270 degrees so it can have four possible states:
Bishwocks don't attack any squares and can even occupy on the adjacent squares as long as they don't occupy the same square.
Vasya has a board with $2\times n$ squares onto which he wants to put some bishwocks. To his dismay, several squares on this board are already occupied by pawns and Vasya can't put bishwocks there. However, pawns also don't attack bishwocks and they can occupy adjacent squares peacefully.
Knowing the positions of pawns on the board, help Vasya to determine the maximum amount of bishwocks he can put onto the board so that they wouldn't occupy the same squares and wouldn't occupy squares with pawns.
Input Specification:
The input contains two nonempty strings that describe Vasya's board. Those strings contain only symbols "0" (zero) that denote the empty squares and symbols "X" (uppercase English letter) that denote the squares occupied by pawns. Strings are nonempty and are of the same length that does not exceed $100$.
Output Specification:
Output a single integer — the maximum amount of bishwocks that can be placed onto the given board.
Demo Input:
['00\n00\n', '00X00X0XXX0\n0XXX0X00X00\n', '0X0X0\n0X0X0\n', '0XXX0\n00000\n']
Demo Output:
['1', '4', '0', '2']
Note:
none
|
```python
from functools import cache
x = input()
y = input()
@cache
def dfs(a, b: bytes, index: int):
if index == len(x): return 0
ans = dfs(x[index], y[index], index + 1)
if (a == '0' or b == '0') and x[index] == '0' and y[index] == '0':
ans = max(ans, dfs('X', 'X', index + 1) + 1)
if a == '0' and b == '0' and x[index] == '0':
ans = max(dfs('X', y[index], index + 1) + 1, ans)
if a == '0' and b == '0' and y[index] == '0':
ans = max(dfs(x[index], 'X', index + 1) + 1, ans)
return ans
print(dfs(x[0], y[0], 1))
```
| 3
|
|
265
|
A
|
Colorful Stones (Simplified Edition)
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
|
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
|
Print the final 1-based position of Liss in a single line.
|
[
"RGB\nRRR\n",
"RRRBGBRBBB\nBBBRR\n",
"BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n"
] |
[
"2\n",
"3\n",
"15\n"
] |
none
| 500
|
[
{
"input": "RGB\nRRR",
"output": "2"
},
{
"input": "RRRBGBRBBB\nBBBRR",
"output": "3"
},
{
"input": "BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB",
"output": "15"
},
{
"input": "G\nRRBBRBRRBR",
"output": "1"
},
{
"input": "RRRRRBRRBRRGRBGGRRRGRBBRBBBBBRGRBGBRRGBBBRBBGBRGBB\nB",
"output": "1"
},
{
"input": "RRGGBRGRBG\nBRRGGBBGGR",
"output": "7"
},
{
"input": "BBRRGBGGRGBRGBRBRBGR\nGGGRBGGGBRRRRGRBGBGRGRRBGRBGBG",
"output": "15"
},
{
"input": "GBRRBGBGBBBBRRRGBGRRRGBGBBBRGR\nRRGBRRGRBBBBBBGRRBBR",
"output": "8"
},
{
"input": "BRGRRGRGRRGBBGBBBRRBBRRBGBBGRGBBGGRGBRBGGGRRRBGGBB\nRGBBGRRBBBRRGRRBRBBRGBBGGGRGBGRRRRBRBGGBRBGGGRGBRR",
"output": "16"
},
{
"input": "GGRGGBRRGRGBRRGGRBBGGRRGBBBGBBBGGRBGGBRBBRGBRRRBRG\nGGRGRRRRRRRRRGBBBBRGBRGRGRRGBBRGGBRBBRBGBRGRRRRGGR",
"output": "18"
},
{
"input": "RBBRBGBBGGGBRRBGBRGRRGGRBBBBGRBGGBRRBGBBRBRGBBGGGG\nBRRGRBGRBGBRGBRBGGBBBGBBRGRBGRGRBGRBGGRRBGBRGRRBBG",
"output": "23"
},
{
"input": "RRGGRRBRGRGBRGBRGBBRGGGBRBGBRGBRGGBRBRGBGRRBBGGRBR\nBRGRBBBGRBGRRGGRRRRRRRRGGGGGGGGBGGGGGGGRGRBBRGRGBR",
"output": "14"
},
{
"input": "RBRBRRRRRGGR\nBBBBRRGGBGRBRGBBRGGGRGGBRRBRBRBGGG",
"output": "12"
},
{
"input": "GGRGGGBRGRGRBBRGGGRBGRRR\nGBBBBGBGBGBBBRGGRGGBGRRGRRRGBGB",
"output": "12"
},
{
"input": "RGRBGBRBBGBRRGGGBBGBRRBGRGBBBBBGRRRGGRBB\nBGR",
"output": "2"
},
{
"input": "R\nB",
"output": "1"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "50"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
},
{
"input": "R\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
}
] | 1,678,321,814
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 19
| 92
| 0
|
s = input()
t = input()
c = s[0]
j = 0
count = 0
for i in range(len(t)):
if c == t[i]:
count += 1
j += 1
c = s[j]
print(count + 1)
|
Title: Colorful Stones (Simplified Edition)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
Input Specification:
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
Output Specification:
Print the final 1-based position of Liss in a single line.
Demo Input:
['RGB\nRRR\n', 'RRRBGBRBBB\nBBBRR\n', 'BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n']
Demo Output:
['2\n', '3\n', '15\n']
Note:
none
|
```python
s = input()
t = input()
c = s[0]
j = 0
count = 0
for i in range(len(t)):
if c == t[i]:
count += 1
j += 1
c = s[j]
print(count + 1)
```
| 3
|
|
839
|
A
|
Arya and Bran
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Bran and his older sister Arya are from the same house. Bran like candies so much, so Arya is going to give him some Candies.
At first, Arya and Bran have 0 Candies. There are *n* days, at the *i*-th day, Arya finds *a**i* candies in a box, that is given by the Many-Faced God. Every day she can give Bran at most 8 of her candies. If she don't give him the candies at the same day, they are saved for her and she can give them to him later.
Your task is to find the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day. Formally, you need to output the minimum day index to the end of which *k* candies will be given out (the days are indexed from 1 to *n*).
Print -1 if she can't give him *k* candies during *n* given days.
|
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=10000).
The second line contains *n* integers *a*1,<=*a*2,<=*a*3,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100).
|
If it is impossible for Arya to give Bran *k* candies within *n* days, print -1.
Otherwise print a single integer — the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day.
|
[
"2 3\n1 2\n",
"3 17\n10 10 10\n",
"1 9\n10\n"
] |
[
"2",
"3",
"-1"
] |
In the first sample, Arya can give Bran 3 candies in 2 days.
In the second sample, Arya can give Bran 17 candies in 3 days, because she can give him at most 8 candies per day.
In the third sample, Arya can't give Bran 9 candies, because she can give him at most 8 candies per day and she must give him the candies within 1 day.
| 500
|
[
{
"input": "2 3\n1 2",
"output": "2"
},
{
"input": "3 17\n10 10 10",
"output": "3"
},
{
"input": "1 9\n10",
"output": "-1"
},
{
"input": "10 70\n6 5 2 3 3 2 1 4 3 2",
"output": "-1"
},
{
"input": "20 140\n40 4 81 40 10 54 34 50 84 60 16 1 90 78 38 93 99 60 81 99",
"output": "18"
},
{
"input": "30 133\n3 2 3 4 3 7 4 5 5 6 7 2 1 3 4 6 7 4 6 4 7 5 7 1 3 4 1 6 8 5",
"output": "30"
},
{
"input": "40 320\n70 79 21 64 95 36 63 29 66 89 30 34 100 76 42 12 4 56 80 78 83 1 39 9 34 45 6 71 27 31 55 52 72 71 38 21 43 83 48 47",
"output": "40"
},
{
"input": "50 300\n5 3 11 8 7 4 9 5 5 1 6 3 5 7 4 2 2 10 8 1 7 10 4 4 11 5 2 4 9 1 5 4 11 9 11 2 7 4 4 8 10 9 1 11 10 2 4 11 6 9",
"output": "-1"
},
{
"input": "37 30\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "30"
},
{
"input": "100 456\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "57"
},
{
"input": "90 298\n94 90 98 94 93 90 99 98 90 96 93 96 92 92 97 98 94 94 96 100 93 96 95 98 94 91 95 95 94 90 93 96 93 100 99 98 94 95 98 91 91 98 97 100 98 93 92 93 91 100 92 97 95 95 97 94 98 97 99 100 90 96 93 100 95 99 92 100 99 91 97 99 98 93 90 93 97 95 94 96 90 100 94 93 91 92 97 97 97 100",
"output": "38"
},
{
"input": "7 43\n4 3 7 9 3 8 10",
"output": "-1"
},
{
"input": "99 585\n8 2 3 3 10 7 9 4 7 4 6 8 7 11 5 8 7 4 7 7 6 7 11 8 1 7 3 2 10 1 6 10 10 5 10 2 5 5 11 6 4 1 5 10 5 8 1 3 7 10 6 1 1 3 8 11 5 8 2 2 5 4 7 6 7 5 8 7 10 9 6 11 4 8 2 7 1 7 1 4 11 1 9 6 1 10 6 10 1 5 6 5 2 5 11 5 1 10 8",
"output": "-1"
},
{
"input": "30 177\n8 7 5 8 3 7 2 4 3 8 11 3 9 11 2 4 1 4 5 6 11 5 8 3 6 3 11 2 11 8",
"output": "-1"
},
{
"input": "19 129\n3 3 10 11 4 7 3 8 10 2 11 6 11 9 4 2 11 10 5",
"output": "-1"
},
{
"input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "13 104\n94 55 20 96 86 76 13 71 13 1 32 76 69",
"output": "13"
},
{
"input": "85 680\n61 44 55 6 30 74 27 26 17 45 73 1 67 71 39 32 13 25 79 66 4 59 49 28 29 22 10 17 98 80 36 99 52 24 59 44 27 79 29 46 29 12 47 72 82 25 6 30 81 72 95 65 30 71 72 45 39 16 16 89 48 42 59 71 50 58 31 65 91 70 48 56 28 34 53 89 94 98 49 55 94 65 91 11 53",
"output": "85"
},
{
"input": "100 458\n3 6 4 1 8 4 1 5 4 4 5 8 4 4 6 6 5 1 2 2 2 1 7 1 1 2 6 5 7 8 3 3 8 3 7 5 7 6 6 2 4 2 2 1 1 8 6 1 5 3 3 4 1 4 6 8 5 4 8 5 4 5 5 1 3 1 6 7 6 2 7 3 4 8 1 8 6 7 1 2 4 6 7 4 8 8 8 4 8 7 5 2 8 4 2 5 6 8 8 5",
"output": "100"
},
{
"input": "98 430\n4 7 6 3 4 1 7 1 1 6 6 1 5 4 6 1 5 4 6 6 1 5 1 1 8 1 6 6 2 6 8 4 4 6 6 8 8 7 4 1 2 4 1 5 4 3 7 3 2 5 7 7 7 2 2 2 7 2 8 7 3 4 5 7 8 3 7 6 7 3 2 4 7 1 4 4 7 1 1 8 4 5 8 3 1 5 3 5 2 1 3 3 8 1 3 5 8 6",
"output": "98"
},
{
"input": "90 80\n6 1 7 1 1 8 6 6 6 1 5 4 2 2 8 4 8 7 7 2 5 7 7 8 5 5 6 3 3 8 3 5 6 3 4 2 6 5 5 3 3 3 8 6 6 1 8 3 6 5 4 8 5 4 3 7 1 3 2 3 3 7 7 7 3 5 2 6 2 3 6 4 6 5 5 3 2 1 1 7 3 3 4 3 4 2 1 2 3 1",
"output": "18"
},
{
"input": "89 99\n7 7 3 5 2 7 8 8 1 1 5 7 7 4 1 5 3 4 4 8 8 3 3 2 6 3 8 2 7 5 8 1 3 5 3 6 4 3 6 2 3 3 4 5 1 6 1 7 7 7 6 7 7 7 8 8 8 2 1 7 5 8 6 7 7 4 7 5 7 8 1 3 5 8 7 1 4 2 5 8 3 4 4 5 5 6 2 4 2",
"output": "21"
},
{
"input": "50 700\n4 3 2 8 8 5 5 3 3 4 7 2 6 6 3 3 8 4 2 4 8 6 5 4 5 4 5 8 6 5 4 7 2 4 1 6 2 6 8 6 2 5 8 1 3 8 3 8 4 1",
"output": "-1"
},
{
"input": "82 359\n95 98 95 90 90 96 91 94 93 99 100 100 92 99 96 94 99 90 94 96 91 91 90 93 97 96 90 94 97 99 93 90 99 98 96 100 93 97 100 91 100 92 93 100 92 90 90 94 99 95 100 98 99 96 94 96 96 99 99 91 97 100 95 100 99 91 94 91 98 98 100 97 93 93 96 97 94 94 92 100 91 91",
"output": "45"
},
{
"input": "60 500\n93 93 100 99 91 92 95 93 95 99 93 91 97 98 90 91 98 100 95 100 94 93 92 91 91 98 98 90 93 91 90 96 92 93 92 94 94 91 96 94 98 100 97 96 96 97 91 99 97 95 96 94 91 92 99 95 97 92 98 90",
"output": "-1"
},
{
"input": "98 776\n48 63 26 3 88 81 27 33 37 10 2 89 41 84 98 93 25 44 42 90 41 65 97 1 28 69 42 14 86 18 96 28 28 94 78 8 44 31 96 45 26 52 93 25 48 39 3 75 94 93 63 59 67 86 18 74 27 38 68 7 31 60 69 67 20 11 19 34 47 43 86 96 3 49 56 60 35 49 89 28 92 69 48 15 17 73 99 69 2 73 27 35 28 53 11 1 96 50",
"output": "97"
},
{
"input": "100 189\n15 14 32 65 28 96 33 93 48 28 57 20 32 20 90 42 57 53 18 58 94 21 27 29 37 22 94 45 67 60 83 23 20 23 35 93 3 42 6 46 68 46 34 25 17 16 50 5 49 91 23 76 69 100 58 68 81 32 88 41 64 29 37 13 95 25 6 59 74 58 31 35 16 80 13 80 10 59 85 18 16 70 51 40 44 28 8 76 8 87 53 86 28 100 2 73 14 100 52 9",
"output": "24"
},
{
"input": "99 167\n72 4 79 73 49 58 15 13 92 92 42 36 35 21 13 10 51 94 64 35 86 50 6 80 93 77 59 71 2 88 22 10 27 30 87 12 77 6 34 56 31 67 78 84 36 27 15 15 12 56 80 7 56 14 10 9 14 59 15 20 34 81 8 49 51 72 4 58 38 77 31 86 18 61 27 86 95 36 46 36 39 18 78 39 48 37 71 12 51 92 65 48 39 22 16 87 4 5 42",
"output": "21"
},
{
"input": "90 4\n48 4 4 78 39 3 85 29 69 52 70 39 11 98 42 56 65 98 77 24 61 31 6 59 60 62 84 46 67 59 15 44 99 23 12 74 2 48 84 60 51 28 17 90 10 82 3 43 50 100 45 57 57 95 53 71 20 74 52 46 64 59 72 33 74 16 44 44 80 71 83 1 70 59 61 6 82 69 81 45 88 28 17 24 22 25 53 97 1 100",
"output": "1"
},
{
"input": "30 102\n55 94 3 96 3 47 92 85 25 78 27 70 97 83 40 2 55 12 74 84 91 37 31 85 7 40 33 54 72 5",
"output": "13"
},
{
"input": "81 108\n61 59 40 100 8 75 5 74 87 12 6 23 98 26 59 68 27 4 98 79 14 44 4 11 89 77 29 90 33 3 43 1 87 91 28 24 4 84 75 7 37 46 15 46 8 87 68 66 5 21 36 62 77 74 91 95 88 28 12 48 18 93 14 51 33 5 99 62 99 38 49 15 56 87 52 64 69 46 41 12 92",
"output": "14"
},
{
"input": "2 16\n10 6",
"output": "2"
},
{
"input": "2 8\n7 8",
"output": "2"
},
{
"input": "2 9\n4 8",
"output": "2"
},
{
"input": "3 19\n9 9 1",
"output": "3"
},
{
"input": "4 32\n9 9 9 5",
"output": "4"
},
{
"input": "2 15\n14 1",
"output": "2"
},
{
"input": "2 3\n3 3",
"output": "1"
},
{
"input": "3 10\n10 1 1",
"output": "2"
},
{
"input": "12 20\n3 16 19 10 1 6 17 8 6 20 1 4",
"output": "4"
},
{
"input": "4 15\n14 3 3 3",
"output": "2"
},
{
"input": "5 40\n10 10 10 10 1",
"output": "5"
},
{
"input": "4 31\n9 9 8 5",
"output": "4"
},
{
"input": "4 31\n20 7 1 1",
"output": "-1"
},
{
"input": "2 10\n9 1",
"output": "2"
},
{
"input": "10 50\n100 10 1 1 1 1 1 1 1 1",
"output": "7"
},
{
"input": "2 11\n10 2",
"output": "2"
},
{
"input": "3 21\n10 10 1",
"output": "3"
},
{
"input": "2 2\n1 2",
"output": "2"
},
{
"input": "3 2\n1 8 8",
"output": "2"
},
{
"input": "2 11\n10 1",
"output": "2"
},
{
"input": "2 16\n12 4",
"output": "2"
},
{
"input": "3 11\n9 2 2",
"output": "2"
},
{
"input": "3 11\n4 3 4",
"output": "3"
},
{
"input": "2 13\n7 6",
"output": "2"
},
{
"input": "3 24\n14 3 4",
"output": "-1"
},
{
"input": "2 13\n10 3",
"output": "2"
},
{
"input": "3 11\n9 2 1",
"output": "2"
},
{
"input": "2 15\n12 3",
"output": "2"
},
{
"input": "2 14\n11 4",
"output": "2"
}
] | 1,595,331,375
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 60
| 109
| 6,656,000
|
n,k=map(int, input().split())
l=list(map(int, input().split()))
for i in range(n):
c=min(k,l[i],8)
if i!=n-1:
l[i+1]+=l[i]-c
k-=c
if k==0:
print(i+1)
break
else:
print("-1")
|
Title: Arya and Bran
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bran and his older sister Arya are from the same house. Bran like candies so much, so Arya is going to give him some Candies.
At first, Arya and Bran have 0 Candies. There are *n* days, at the *i*-th day, Arya finds *a**i* candies in a box, that is given by the Many-Faced God. Every day she can give Bran at most 8 of her candies. If she don't give him the candies at the same day, they are saved for her and she can give them to him later.
Your task is to find the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day. Formally, you need to output the minimum day index to the end of which *k* candies will be given out (the days are indexed from 1 to *n*).
Print -1 if she can't give him *k* candies during *n* given days.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=10000).
The second line contains *n* integers *a*1,<=*a*2,<=*a*3,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100).
Output Specification:
If it is impossible for Arya to give Bran *k* candies within *n* days, print -1.
Otherwise print a single integer — the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day.
Demo Input:
['2 3\n1 2\n', '3 17\n10 10 10\n', '1 9\n10\n']
Demo Output:
['2', '3', '-1']
Note:
In the first sample, Arya can give Bran 3 candies in 2 days.
In the second sample, Arya can give Bran 17 candies in 3 days, because she can give him at most 8 candies per day.
In the third sample, Arya can't give Bran 9 candies, because she can give him at most 8 candies per day and she must give him the candies within 1 day.
|
```python
n,k=map(int, input().split())
l=list(map(int, input().split()))
for i in range(n):
c=min(k,l[i],8)
if i!=n-1:
l[i+1]+=l[i]-c
k-=c
if k==0:
print(i+1)
break
else:
print("-1")
```
| 3
|
|
205
|
A
|
Little Elephant and Rozdil
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation"
] | null | null |
The Little Elephant loves Ukraine very much. Most of all he loves town Rozdol (ukr. "Rozdil").
However, Rozdil is dangerous to settle, so the Little Elephant wants to go to some other town. The Little Elephant doesn't like to spend much time on travelling, so for his journey he will choose a town that needs minimum time to travel to. If there are multiple such cities, then the Little Elephant won't go anywhere.
For each town except for Rozdil you know the time needed to travel to this town. Find the town the Little Elephant will go to or print "Still Rozdil", if he stays in Rozdil.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of cities. The next line contains *n* integers, separated by single spaces: the *i*-th integer represents the time needed to go from town Rozdil to the *i*-th town. The time values are positive integers, not exceeding 109.
You can consider the cities numbered from 1 to *n*, inclusive. Rozdil is not among the numbered cities.
|
Print the answer on a single line — the number of the town the Little Elephant will go to. If there are multiple cities with minimum travel time, print "Still Rozdil" (without the quotes).
|
[
"2\n7 4\n",
"7\n7 4 47 100 4 9 12\n"
] |
[
"2\n",
"Still Rozdil\n"
] |
In the first sample there are only two cities where the Little Elephant can go. The travel time for the first town equals 7, to the second one — 4. The town which is closest to Rodzil (the only one) is the second one, so the answer is 2.
In the second sample the closest cities are cities two and five, the travelling time to both of them equals 4, so the answer is "Still Rozdil".
| 500
|
[
{
"input": "2\n7 4",
"output": "2"
},
{
"input": "7\n7 4 47 100 4 9 12",
"output": "Still Rozdil"
},
{
"input": "1\n47",
"output": "1"
},
{
"input": "2\n1000000000 1000000000",
"output": "Still Rozdil"
},
{
"input": "7\n7 6 5 4 3 2 1",
"output": "7"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "Still Rozdil"
},
{
"input": "4\n1000000000 100000000 1000000 1000000",
"output": "Still Rozdil"
},
{
"input": "20\n7 1 1 2 1 1 8 7 7 8 4 3 7 10 5 3 10 5 10 6",
"output": "Still Rozdil"
},
{
"input": "20\n3 3 6 9 8 2 4 1 7 3 2 9 7 7 9 7 2 6 2 7",
"output": "8"
},
{
"input": "47\n35 79 84 56 67 95 80 34 77 68 14 55 95 32 40 89 58 79 96 66 50 79 35 86 31 74 91 35 22 72 84 38 11 59 73 51 65 11 11 62 30 12 32 71 69 15 11",
"output": "Still Rozdil"
},
{
"input": "47\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "32"
},
{
"input": "25\n73 56 65 70 57 57 49 50 65 68 54 48 66 55 55 66 60 70 47 62 63 70 62 70 63",
"output": "19"
},
{
"input": "100\n922 938 103 689 526 118 314 496 373 47 224 544 495 656 804 754 269 356 354 536 817 597 787 178 516 659 790 993 786 169 866 779 997 350 674 437 219 546 564 893 402 449 751 628 238 686 392 951 716 439 332 563 215 146 746 311 866 773 548 675 731 183 890 802 488 944 473 25 662 559 732 534 777 144 502 593 839 692 84 337 679 718 1005 663 709 940 86 469 310 960 902 233 606 761 116 231 662 903 68 622",
"output": "68"
},
{
"input": "5\n5 5 2 3 1",
"output": "5"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "3\n7 7 4",
"output": "3"
},
{
"input": "3\n2 2 1",
"output": "3"
},
{
"input": "3\n4 4 3",
"output": "3"
},
{
"input": "2\n10000001 10000002",
"output": "1"
},
{
"input": "4\n3 3 2 1",
"output": "4"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "2\n1000000000 100000000",
"output": "2"
},
{
"input": "1\n99999999",
"output": "1"
},
{
"input": "3\n5 5 3",
"output": "3"
},
{
"input": "3\n7 7 5",
"output": "3"
},
{
"input": "3\n3 3 1",
"output": "3"
},
{
"input": "4\n10 10 10 1",
"output": "4"
}
] | 1,662,906,958
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 156
| 7,987,200
|
n=int(input())
l=list(map(int,input().split()))[:n]
k=min(l)
if l.count(k)==1:
print(l.index(k)+1)
else:
print('Still Rozdil')
|
Title: Little Elephant and Rozdil
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant loves Ukraine very much. Most of all he loves town Rozdol (ukr. "Rozdil").
However, Rozdil is dangerous to settle, so the Little Elephant wants to go to some other town. The Little Elephant doesn't like to spend much time on travelling, so for his journey he will choose a town that needs minimum time to travel to. If there are multiple such cities, then the Little Elephant won't go anywhere.
For each town except for Rozdil you know the time needed to travel to this town. Find the town the Little Elephant will go to or print "Still Rozdil", if he stays in Rozdil.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of cities. The next line contains *n* integers, separated by single spaces: the *i*-th integer represents the time needed to go from town Rozdil to the *i*-th town. The time values are positive integers, not exceeding 109.
You can consider the cities numbered from 1 to *n*, inclusive. Rozdil is not among the numbered cities.
Output Specification:
Print the answer on a single line — the number of the town the Little Elephant will go to. If there are multiple cities with minimum travel time, print "Still Rozdil" (without the quotes).
Demo Input:
['2\n7 4\n', '7\n7 4 47 100 4 9 12\n']
Demo Output:
['2\n', 'Still Rozdil\n']
Note:
In the first sample there are only two cities where the Little Elephant can go. The travel time for the first town equals 7, to the second one — 4. The town which is closest to Rodzil (the only one) is the second one, so the answer is 2.
In the second sample the closest cities are cities two and five, the travelling time to both of them equals 4, so the answer is "Still Rozdil".
|
```python
n=int(input())
l=list(map(int,input().split()))[:n]
k=min(l)
if l.count(k)==1:
print(l.index(k)+1)
else:
print('Still Rozdil')
```
| 3
|
|
577
|
B
|
Modulo Sum
|
PROGRAMMING
| 1,900
|
[
"combinatorics",
"data structures",
"dp",
"two pointers"
] | null | null |
You are given a sequence of numbers *a*1,<=*a*2,<=...,<=*a**n*, and a number *m*.
Check if it is possible to choose a non-empty subsequence *a**i**j* such that the sum of numbers in this subsequence is divisible by *m*.
|
The first line contains two numbers, *n* and *m* (1<=≤<=*n*<=≤<=106, 2<=≤<=*m*<=≤<=103) — the size of the original sequence and the number such that sum should be divisible by it.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109).
|
In the single line print either "YES" (without the quotes) if there exists the sought subsequence, or "NO" (without the quotes), if such subsequence doesn't exist.
|
[
"3 5\n1 2 3\n",
"1 6\n5\n",
"4 6\n3 1 1 3\n",
"6 6\n5 5 5 5 5 5\n"
] |
[
"YES\n",
"NO\n",
"YES\n",
"YES\n"
] |
In the first sample test you can choose numbers 2 and 3, the sum of which is divisible by 5.
In the second sample test the single non-empty subsequence of numbers is a single number 5. Number 5 is not divisible by 6, that is, the sought subsequence doesn't exist.
In the third sample test you need to choose two numbers 3 on the ends.
In the fourth sample test you can take the whole subsequence.
| 1,250
|
[
{
"input": "3 5\n1 2 3",
"output": "YES"
},
{
"input": "1 6\n5",
"output": "NO"
},
{
"input": "4 6\n3 1 1 3",
"output": "YES"
},
{
"input": "6 6\n5 5 5 5 5 5",
"output": "YES"
},
{
"input": "4 5\n1 1 1 1",
"output": "NO"
},
{
"input": "5 5\n1 1 1 1 1",
"output": "YES"
},
{
"input": "4 7\n1 2 3 3",
"output": "YES"
},
{
"input": "1 47\n0",
"output": "YES"
},
{
"input": "2 47\n1 0",
"output": "YES"
},
{
"input": "9 11\n8 8 8 8 8 8 8 8 5",
"output": "NO"
},
{
"input": "10 11\n8 8 8 8 8 8 8 8 7 8",
"output": "YES"
},
{
"input": "3 5\n2 1 3",
"output": "YES"
},
{
"input": "100 968\n966 966 967 966 967 967 967 967 966 966 966 967 966 966 966 967 967 966 966 967 967 967 967 966 967 967 967 967 563 967 967 967 600 967 967 966 967 966 967 966 967 966 967 966 966 966 967 966 967 966 966 967 967 193 966 966 967 966 967 967 967 966 967 966 966 580 966 967 966 966 967 966 966 966 967 967 967 967 966 967 967 966 966 966 967 967 966 966 967 966 966 966 967 966 966 967 966 967 966 966",
"output": "YES"
},
{
"input": "100 951\n950 949 949 949 949 950 950 949 949 950 950 949 949 949 496 949 950 949 950 159 950 949 949 950 950 949 950 949 949 950 949 950 949 949 950 949 950 950 950 950 949 949 949 949 949 950 950 950 950 950 950 950 949 950 949 949 950 949 950 950 949 950 950 950 949 950 949 950 950 950 950 949 949 950 950 949 950 950 950 950 949 950 950 949 949 635 612 949 949 949 949 949 949 949 950 949 949 950 949 950",
"output": "YES"
},
{
"input": "100 940\n1 2 1 1 1 2 1 1 1 1 2 1 1 1 1 1 2 1 1 1 2 2 1 1 1 2 2 2 2 1 1 1 1 2 2 1 403 2 2 1 1 1 2 2 2 1 2 2 1 1 2 2 1 1 1 1 2 1 2 691 1 2 1 1 1 1 1 2 2 2 2 2 1 2 1 1 1 1 1 1 2 2 1 2 2 1 1 1 2 1 2 1 1 2 2 1 1 2 786 1",
"output": "YES"
},
{
"input": "100 917\n2 1 2 2 2 1 1 2 2 2 1 1 1 2 1 2 2 1 2 1 1 1 1 1 1 2 1 1 1 2 1 1 2 1 1 1 1 2 1 2 340 2 399 2 1 2 2 2 2 178 1 1 2 1 1 1 2 2 1 2 2 2 1 2 1 1 1 1 1 1 2 1 1 1 2 2 1 1 2 2 2 1 2 2 2 2 1 2 1 2 2 2 2 2 1 1 2 2 2 2",
"output": "YES"
},
{
"input": "1 2\n1000000000",
"output": "YES"
}
] | 1,679,019,601
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 1
| 46
| 0
|
# https://codeforces.com/problemset/problem/577/B
n, m = map(int, input().split())
a = list(map(int, input().split()))
dp = [False] * m
dp[0] = True
for i in range(n):
for j in range(m):
if dp[j]:
dp[(j + a[i]) % m] = True
if dp[0]:
print("YES")
else:
print("NO")
|
Title: Modulo Sum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a sequence of numbers *a*1,<=*a*2,<=...,<=*a**n*, and a number *m*.
Check if it is possible to choose a non-empty subsequence *a**i**j* such that the sum of numbers in this subsequence is divisible by *m*.
Input Specification:
The first line contains two numbers, *n* and *m* (1<=≤<=*n*<=≤<=106, 2<=≤<=*m*<=≤<=103) — the size of the original sequence and the number such that sum should be divisible by it.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109).
Output Specification:
In the single line print either "YES" (without the quotes) if there exists the sought subsequence, or "NO" (without the quotes), if such subsequence doesn't exist.
Demo Input:
['3 5\n1 2 3\n', '1 6\n5\n', '4 6\n3 1 1 3\n', '6 6\n5 5 5 5 5 5\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n', 'YES\n']
Note:
In the first sample test you can choose numbers 2 and 3, the sum of which is divisible by 5.
In the second sample test the single non-empty subsequence of numbers is a single number 5. Number 5 is not divisible by 6, that is, the sought subsequence doesn't exist.
In the third sample test you need to choose two numbers 3 on the ends.
In the fourth sample test you can take the whole subsequence.
|
```python
# https://codeforces.com/problemset/problem/577/B
n, m = map(int, input().split())
a = list(map(int, input().split()))
dp = [False] * m
dp[0] = True
for i in range(n):
for j in range(m):
if dp[j]:
dp[(j + a[i]) % m] = True
if dp[0]:
print("YES")
else:
print("NO")
```
| 0
|
|
822
|
A
|
I'm bored with life
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"number theory"
] | null | null |
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
|
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
|
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
|
[
"4 3\n"
] |
[
"6\n"
] |
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
| 500
|
[
{
"input": "4 3",
"output": "6"
},
{
"input": "10 399603090",
"output": "3628800"
},
{
"input": "6 973151934",
"output": "720"
},
{
"input": "2 841668075",
"output": "2"
},
{
"input": "7 415216919",
"output": "5040"
},
{
"input": "3 283733059",
"output": "6"
},
{
"input": "11 562314608",
"output": "39916800"
},
{
"input": "3 990639260",
"output": "6"
},
{
"input": "11 859155400",
"output": "39916800"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "5 3",
"output": "6"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "5 4",
"output": "24"
},
{
"input": "1 12",
"output": "1"
},
{
"input": "9 7",
"output": "5040"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "6 11",
"output": "720"
},
{
"input": "6 7",
"output": "720"
},
{
"input": "11 11",
"output": "39916800"
},
{
"input": "4 999832660",
"output": "24"
},
{
"input": "7 999228288",
"output": "5040"
},
{
"input": "11 999257105",
"output": "39916800"
},
{
"input": "11 999286606",
"output": "39916800"
},
{
"input": "3 999279109",
"output": "6"
},
{
"input": "999632727 11",
"output": "39916800"
},
{
"input": "999625230 7",
"output": "5040"
},
{
"input": "999617047 3",
"output": "6"
},
{
"input": "999646548 7",
"output": "5040"
},
{
"input": "999639051 3",
"output": "6"
},
{
"input": "12 12",
"output": "479001600"
},
{
"input": "12 1",
"output": "1"
},
{
"input": "1213 5",
"output": "120"
},
{
"input": "8 9",
"output": "40320"
},
{
"input": "12 9",
"output": "362880"
},
{
"input": "12 1000000000",
"output": "479001600"
},
{
"input": "1000000000 1",
"output": "1"
},
{
"input": "12 13",
"output": "479001600"
},
{
"input": "2 29845",
"output": "2"
},
{
"input": "10 21",
"output": "3628800"
},
{
"input": "12 20",
"output": "479001600"
},
{
"input": "15 12",
"output": "479001600"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000 12",
"output": "479001600"
},
{
"input": "11 30",
"output": "39916800"
},
{
"input": "17 12",
"output": "479001600"
},
{
"input": "4 19",
"output": "24"
},
{
"input": "12 15",
"output": "479001600"
},
{
"input": "20 6",
"output": "720"
},
{
"input": "10 20",
"output": "3628800"
},
{
"input": "10 10",
"output": "3628800"
},
{
"input": "22 12",
"output": "479001600"
},
{
"input": "20 12",
"output": "479001600"
},
{
"input": "12 23",
"output": "479001600"
},
{
"input": "12 22",
"output": "479001600"
},
{
"input": "18 3",
"output": "6"
},
{
"input": "14 10",
"output": "3628800"
},
{
"input": "14 12",
"output": "479001600"
},
{
"input": "8 3",
"output": "6"
},
{
"input": "5 5",
"output": "120"
}
] | 1,676,541,636
| 2,147,483,647
|
PyPy 3-64
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 1
| 1,000
| 12,083,200
|
import math
my_list = input().split()
n = [int(i) for i in my_list]
def fact(n):
fact = 1
if(n < 0):
return 1
else:
for i in range(1,n+1):
fact = fact * i
return fact
print(math.gcd(fact(n[0]),fact(n[1])))
|
Title: I'm bored with life
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
Input Specification:
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
Output Specification:
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
Demo Input:
['4 3\n']
Demo Output:
['6\n']
Note:
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
|
```python
import math
my_list = input().split()
n = [int(i) for i in my_list]
def fact(n):
fact = 1
if(n < 0):
return 1
else:
for i in range(1,n+1):
fact = fact * i
return fact
print(math.gcd(fact(n[0]),fact(n[1])))
```
| 0
|
|
557
|
A
|
Ilya and Diplomas
|
PROGRAMMING
| 1,100
|
[
"greedy",
"implementation",
"math"
] | null | null |
Soon a school Olympiad in Informatics will be held in Berland, *n* schoolchildren will participate there.
At a meeting of the jury of the Olympiad it was decided that each of the *n* participants, depending on the results, will get a diploma of the first, second or third degree. Thus, each student will receive exactly one diploma.
They also decided that there must be given at least *min*1 and at most *max*1 diplomas of the first degree, at least *min*2 and at most *max*2 diplomas of the second degree, and at least *min*3 and at most *max*3 diplomas of the third degree.
After some discussion it was decided to choose from all the options of distributing diplomas satisfying these limitations the one that maximizes the number of participants who receive diplomas of the first degree. Of all these options they select the one which maximizes the number of the participants who receive diplomas of the second degree. If there are multiple of these options, they select the option that maximizes the number of diplomas of the third degree.
Choosing the best option of distributing certificates was entrusted to Ilya, one of the best programmers of Berland. However, he found more important things to do, so it is your task now to choose the best option of distributing of diplomas, based on the described limitations.
It is guaranteed that the described limitations are such that there is a way to choose such an option of distributing diplomas that all *n* participants of the Olympiad will receive a diploma of some degree.
|
The first line of the input contains a single integer *n* (3<=≤<=*n*<=≤<=3·106) — the number of schoolchildren who will participate in the Olympiad.
The next line of the input contains two integers *min*1 and *max*1 (1<=≤<=*min*1<=≤<=*max*1<=≤<=106) — the minimum and maximum limits on the number of diplomas of the first degree that can be distributed.
The third line of the input contains two integers *min*2 and *max*2 (1<=≤<=*min*2<=≤<=*max*2<=≤<=106) — the minimum and maximum limits on the number of diplomas of the second degree that can be distributed.
The next line of the input contains two integers *min*3 and *max*3 (1<=≤<=*min*3<=≤<=*max*3<=≤<=106) — the minimum and maximum limits on the number of diplomas of the third degree that can be distributed.
It is guaranteed that *min*1<=+<=*min*2<=+<=*min*3<=≤<=*n*<=≤<=*max*1<=+<=*max*2<=+<=*max*3.
|
In the first line of the output print three numbers, showing how many diplomas of the first, second and third degree will be given to students in the optimal variant of distributing diplomas.
The optimal variant of distributing diplomas is the one that maximizes the number of students who receive diplomas of the first degree. Of all the suitable options, the best one is the one which maximizes the number of participants who receive diplomas of the second degree. If there are several of these options, the best one is the one that maximizes the number of diplomas of the third degree.
|
[
"6\n1 5\n2 6\n3 7\n",
"10\n1 2\n1 3\n1 5\n",
"6\n1 3\n2 2\n2 2\n"
] |
[
"1 2 3 \n",
"2 3 5 \n",
"2 2 2 \n"
] |
none
| 500
|
[
{
"input": "6\n1 5\n2 6\n3 7",
"output": "1 2 3 "
},
{
"input": "10\n1 2\n1 3\n1 5",
"output": "2 3 5 "
},
{
"input": "6\n1 3\n2 2\n2 2",
"output": "2 2 2 "
},
{
"input": "55\n1 1000000\n40 50\n10 200",
"output": "5 40 10 "
},
{
"input": "3\n1 1\n1 1\n1 1",
"output": "1 1 1 "
},
{
"input": "3\n1 1000000\n1 1000000\n1 1000000",
"output": "1 1 1 "
},
{
"input": "1000\n100 400\n300 500\n400 1200",
"output": "300 300 400 "
},
{
"input": "3000000\n1 1000000\n1 1000000\n1 1000000",
"output": "1000000 1000000 1000000 "
},
{
"input": "11\n3 5\n3 5\n3 5",
"output": "5 3 3 "
},
{
"input": "12\n3 5\n3 5\n3 5",
"output": "5 4 3 "
},
{
"input": "13\n3 5\n3 5\n3 5",
"output": "5 5 3 "
},
{
"input": "3000000\n1000000 1000000\n1000000 1000000\n1000000 1000000",
"output": "1000000 1000000 1000000 "
},
{
"input": "50\n1 100\n1 100\n1 100",
"output": "48 1 1 "
},
{
"input": "1279\n123 670\n237 614\n846 923",
"output": "196 237 846 "
},
{
"input": "1589\n213 861\n5 96\n506 634",
"output": "861 96 632 "
},
{
"input": "2115\n987 987\n112 483\n437 959",
"output": "987 483 645 "
},
{
"input": "641\n251 960\n34 370\n149 149",
"output": "458 34 149 "
},
{
"input": "1655\n539 539\n10 425\n605 895",
"output": "539 425 691 "
},
{
"input": "1477\n210 336\n410 837\n448 878",
"output": "336 693 448 "
},
{
"input": "1707\n149 914\n190 422\n898 899",
"output": "619 190 898 "
},
{
"input": "1529\n515 515\n563 869\n169 451",
"output": "515 845 169 "
},
{
"input": "1543\n361 994\n305 407\n102 197",
"output": "994 407 142 "
},
{
"input": "1107\n471 849\n360 741\n71 473",
"output": "676 360 71 "
},
{
"input": "1629279\n267360 999930\n183077 674527\n202618 786988",
"output": "999930 426731 202618 "
},
{
"input": "1233589\n2850 555444\n500608 921442\n208610 607343",
"output": "524371 500608 208610 "
},
{
"input": "679115\n112687 183628\n101770 982823\n81226 781340",
"output": "183628 414261 81226 "
},
{
"input": "1124641\n117999 854291\n770798 868290\n76651 831405",
"output": "277192 770798 76651 "
},
{
"input": "761655\n88152 620061\n60403 688549\n79370 125321",
"output": "620061 62224 79370 "
},
{
"input": "2174477\n276494 476134\n555283 954809\n319941 935631",
"output": "476134 954809 743534 "
},
{
"input": "1652707\n201202 990776\n34796 883866\n162979 983308",
"output": "990776 498952 162979 "
},
{
"input": "2065529\n43217 891429\n434379 952871\n650231 855105",
"output": "891429 523869 650231 "
},
{
"input": "1702543\n405042 832833\n50931 747750\n381818 796831",
"output": "832833 487892 381818 "
},
{
"input": "501107\n19061 859924\n126478 724552\n224611 489718",
"output": "150018 126478 224611 "
},
{
"input": "1629279\n850831 967352\n78593 463906\n452094 885430",
"output": "967352 209833 452094 "
},
{
"input": "1233589\n2850 157021\n535109 748096\n392212 475634",
"output": "157021 684356 392212 "
},
{
"input": "679115\n125987 786267\n70261 688983\n178133 976789",
"output": "430721 70261 178133 "
},
{
"input": "1124641\n119407 734250\n213706 860770\n102149 102149",
"output": "734250 288242 102149 "
},
{
"input": "761655\n325539 325539\n280794 792505\n18540 106895",
"output": "325539 417576 18540 "
},
{
"input": "2174477\n352351 791072\n365110 969163\n887448 955610",
"output": "791072 495957 887448 "
},
{
"input": "1652707\n266774 638522\n65688 235422\n924898 992826",
"output": "638522 89287 924898 "
},
{
"input": "2065529\n608515 608515\n751563 864337\n614898 705451",
"output": "608515 842116 614898 "
},
{
"input": "1702543\n5784 996578\n47395 300407\n151614 710197",
"output": "996578 300407 405558 "
},
{
"input": "501107\n8073 390048\n190494 647328\n274071 376923",
"output": "36542 190494 274071 "
},
{
"input": "200\n50 50\n100 100\n50 50",
"output": "50 100 50 "
},
{
"input": "14\n1 100\n1 100\n8 9",
"output": "5 1 8 "
},
{
"input": "300\n200 400\n50 100\n40 80",
"output": "210 50 40 "
},
{
"input": "10\n3 6\n3 6\n3 6",
"output": "4 3 3 "
},
{
"input": "14\n3 6\n3 6\n3 6",
"output": "6 5 3 "
},
{
"input": "17\n3 6\n3 6\n3 6",
"output": "6 6 5 "
},
{
"input": "1000000\n300000 600000\n300000 600000\n300000 600000",
"output": "400000 300000 300000 "
},
{
"input": "1400000\n300000 600000\n300000 600000\n300000 600000",
"output": "600000 500000 300000 "
},
{
"input": "1700000\n300000 600000\n300000 600000\n300000 600000",
"output": "600000 600000 500000 "
},
{
"input": "561\n400 400\n80 80\n81 81",
"output": "400 80 81 "
},
{
"input": "2000\n100 1000\n1 1\n1 2000",
"output": "1000 1 999 "
},
{
"input": "1000002\n1 1000000\n1 1000000\n999999 1000000",
"output": "2 1 999999 "
},
{
"input": "1000002\n1 1000000\n1 1000000\n1000000 1000000",
"output": "1 1 1000000 "
}
] | 1,435,876,223
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 5
| 1,000
| 0
|
n = int(input())
m1 ,ma1= map(int, input().split())
m2,ma2 = map(int, input().split())
m3,ma3 = map(int, input().split())
a1 = ma1
a2 = ma2
a3 = ma3
while True :
if a1 + a2 + a3 == n :
break
if(a3 > m3):
a3 -= 1
elif(a2 > m2):
a2 -= 1
elif(a1 > m1):
a1 -= 1
print(a1,a2,a3)
|
Title: Ilya and Diplomas
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Soon a school Olympiad in Informatics will be held in Berland, *n* schoolchildren will participate there.
At a meeting of the jury of the Olympiad it was decided that each of the *n* participants, depending on the results, will get a diploma of the first, second or third degree. Thus, each student will receive exactly one diploma.
They also decided that there must be given at least *min*1 and at most *max*1 diplomas of the first degree, at least *min*2 and at most *max*2 diplomas of the second degree, and at least *min*3 and at most *max*3 diplomas of the third degree.
After some discussion it was decided to choose from all the options of distributing diplomas satisfying these limitations the one that maximizes the number of participants who receive diplomas of the first degree. Of all these options they select the one which maximizes the number of the participants who receive diplomas of the second degree. If there are multiple of these options, they select the option that maximizes the number of diplomas of the third degree.
Choosing the best option of distributing certificates was entrusted to Ilya, one of the best programmers of Berland. However, he found more important things to do, so it is your task now to choose the best option of distributing of diplomas, based on the described limitations.
It is guaranteed that the described limitations are such that there is a way to choose such an option of distributing diplomas that all *n* participants of the Olympiad will receive a diploma of some degree.
Input Specification:
The first line of the input contains a single integer *n* (3<=≤<=*n*<=≤<=3·106) — the number of schoolchildren who will participate in the Olympiad.
The next line of the input contains two integers *min*1 and *max*1 (1<=≤<=*min*1<=≤<=*max*1<=≤<=106) — the minimum and maximum limits on the number of diplomas of the first degree that can be distributed.
The third line of the input contains two integers *min*2 and *max*2 (1<=≤<=*min*2<=≤<=*max*2<=≤<=106) — the minimum and maximum limits on the number of diplomas of the second degree that can be distributed.
The next line of the input contains two integers *min*3 and *max*3 (1<=≤<=*min*3<=≤<=*max*3<=≤<=106) — the minimum and maximum limits on the number of diplomas of the third degree that can be distributed.
It is guaranteed that *min*1<=+<=*min*2<=+<=*min*3<=≤<=*n*<=≤<=*max*1<=+<=*max*2<=+<=*max*3.
Output Specification:
In the first line of the output print three numbers, showing how many diplomas of the first, second and third degree will be given to students in the optimal variant of distributing diplomas.
The optimal variant of distributing diplomas is the one that maximizes the number of students who receive diplomas of the first degree. Of all the suitable options, the best one is the one which maximizes the number of participants who receive diplomas of the second degree. If there are several of these options, the best one is the one that maximizes the number of diplomas of the third degree.
Demo Input:
['6\n1 5\n2 6\n3 7\n', '10\n1 2\n1 3\n1 5\n', '6\n1 3\n2 2\n2 2\n']
Demo Output:
['1 2 3 \n', '2 3 5 \n', '2 2 2 \n']
Note:
none
|
```python
n = int(input())
m1 ,ma1= map(int, input().split())
m2,ma2 = map(int, input().split())
m3,ma3 = map(int, input().split())
a1 = ma1
a2 = ma2
a3 = ma3
while True :
if a1 + a2 + a3 == n :
break
if(a3 > m3):
a3 -= 1
elif(a2 > m2):
a2 -= 1
elif(a1 > m1):
a1 -= 1
print(a1,a2,a3)
```
| 0
|
|
384
|
A
|
Coder
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1).
Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000).
|
On the first line print an integer, the maximum number of Coders that can be placed on the chessboard.
On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'.
If there are multiple correct answers, you can print any.
|
[
"2\n"
] |
[
"2\nC.\n.C\n"
] |
none
| 500
|
[
{
"input": "2",
"output": "2\nC.\n.C"
},
{
"input": "3",
"output": "5\nC.C\n.C.\nC.C"
},
{
"input": "4",
"output": "8\nC.C.\n.C.C\nC.C.\n.C.C"
},
{
"input": "10",
"output": "50\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C"
},
{
"input": "15",
"output": "113\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C"
},
{
"input": "100",
"output": "5000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "101",
"output": "5101\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "500",
"output": "125000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n...."
},
{
"input": "501",
"output": "125501\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n..."
},
{
"input": "755",
"output": "285013\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "888",
"output": "394272\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "998",
"output": "498002\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "999",
"output": "499001\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "1000",
"output": "500000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "1",
"output": "1\nC"
}
] | 1,578,766,468
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 139
| 0
|
def read():
return int(input())
n = read()
for i in range(0, n):
t = ''
for j in range(0, n):
if i % 2 == 0:
if j % 2 == 0: t += 'C'
else: t += '.'
else:
if j % 2 == 1: t += 'C'
else: t += '.'
print(t)
|
Title: Coder
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1).
Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000).
Output Specification:
On the first line print an integer, the maximum number of Coders that can be placed on the chessboard.
On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'.
If there are multiple correct answers, you can print any.
Demo Input:
['2\n']
Demo Output:
['2\nC.\n.C\n']
Note:
none
|
```python
def read():
return int(input())
n = read()
for i in range(0, n):
t = ''
for j in range(0, n):
if i % 2 == 0:
if j % 2 == 0: t += 'C'
else: t += '.'
else:
if j % 2 == 1: t += 'C'
else: t += '.'
print(t)
```
| 0
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Gerald has been selling state secrets at leisure. All the secrets cost the same: *n* marks. The state which secrets Gerald is selling, has no paper money, only coins. But there are coins of all positive integer denominations that are powers of three: 1 mark, 3 marks, 9 marks, 27 marks and so on. There are no coins of other denominations. Of course, Gerald likes it when he gets money without the change. And all buyers respect him and try to give the desired sum without change, if possible. But this does not always happen.
One day an unlucky buyer came. He did not have the desired sum without change. Then he took out all his coins and tried to give Gerald a larger than necessary sum with as few coins as possible. What is the maximum number of coins he could get?
The formal explanation of the previous paragraph: we consider all the possible combinations of coins for which the buyer can not give Gerald the sum of *n* marks without change. For each such combination calculate the minimum number of coins that can bring the buyer at least *n* marks. Among all combinations choose the maximum of the minimum number of coins. This is the number we want.
|
The single line contains a single integer *n* (1<=≤<=*n*<=≤<=1017).
Please, do not use the %lld specifier to read or write 64 bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
In a single line print an integer: the maximum number of coins the unlucky buyer could have paid with.
|
[
"1\n",
"4\n"
] |
[
"1\n",
"2\n"
] |
In the first test case, if a buyer has exactly one coin of at least 3 marks, then, to give Gerald one mark, he will have to give this coin. In this sample, the customer can not have a coin of one mark, as in this case, he will be able to give the money to Gerald without any change.
In the second test case, if the buyer had exactly three coins of 3 marks, then, to give Gerald 4 marks, he will have to give two of these coins. The buyer cannot give three coins as he wants to minimize the number of coins that he gives.
| 0
|
[
{
"input": "1",
"output": "1"
},
{
"input": "4",
"output": "2"
},
{
"input": "3",
"output": "1"
},
{
"input": "8",
"output": "3"
},
{
"input": "10",
"output": "4"
},
{
"input": "100000000000000000",
"output": "33333333333333334"
},
{
"input": "99999999999999999",
"output": "3703703703703704"
},
{
"input": "50031545098999707",
"output": "1"
},
{
"input": "16677181699666569",
"output": "1"
},
{
"input": "72900000000000",
"output": "33333333334"
},
{
"input": "99999999999999997",
"output": "33333333333333333"
},
{
"input": "58061299250691018",
"output": "32"
},
{
"input": "49664023559436051",
"output": "128191526"
},
{
"input": "66708726798666276",
"output": "2"
},
{
"input": "29442431889534807",
"output": "48"
},
{
"input": "70414767176369958",
"output": "13"
},
{
"input": "93886356235159944",
"output": "51"
},
{
"input": "97626528902553453",
"output": "551104613133"
},
{
"input": "52013157885656046",
"output": "880847395988"
},
{
"input": "37586570003500923",
"output": "548"
},
{
"input": "34391854792828422",
"output": "582429080812"
},
{
"input": "205891132094649",
"output": "1"
},
{
"input": "243",
"output": "1"
},
{
"input": "5559060566555523",
"output": "1"
},
{
"input": "81",
"output": "1"
},
{
"input": "108",
"output": "2"
},
{
"input": "2",
"output": "1"
},
{
"input": "1129718145924",
"output": "2"
}
] | 1,584,514,619
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 216
| 0
|
from math import ceil
n=int(input())
k=1
while pow(3, k)<n and n%pow(3, k)==0:
k+=1
print(ceil(n/pow(3, k)))
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gerald has been selling state secrets at leisure. All the secrets cost the same: *n* marks. The state which secrets Gerald is selling, has no paper money, only coins. But there are coins of all positive integer denominations that are powers of three: 1 mark, 3 marks, 9 marks, 27 marks and so on. There are no coins of other denominations. Of course, Gerald likes it when he gets money without the change. And all buyers respect him and try to give the desired sum without change, if possible. But this does not always happen.
One day an unlucky buyer came. He did not have the desired sum without change. Then he took out all his coins and tried to give Gerald a larger than necessary sum with as few coins as possible. What is the maximum number of coins he could get?
The formal explanation of the previous paragraph: we consider all the possible combinations of coins for which the buyer can not give Gerald the sum of *n* marks without change. For each such combination calculate the minimum number of coins that can bring the buyer at least *n* marks. Among all combinations choose the maximum of the minimum number of coins. This is the number we want.
Input Specification:
The single line contains a single integer *n* (1<=≤<=*n*<=≤<=1017).
Please, do not use the %lld specifier to read or write 64 bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Output Specification:
In a single line print an integer: the maximum number of coins the unlucky buyer could have paid with.
Demo Input:
['1\n', '4\n']
Demo Output:
['1\n', '2\n']
Note:
In the first test case, if a buyer has exactly one coin of at least 3 marks, then, to give Gerald one mark, he will have to give this coin. In this sample, the customer can not have a coin of one mark, as in this case, he will be able to give the money to Gerald without any change.
In the second test case, if the buyer had exactly three coins of 3 marks, then, to give Gerald 4 marks, he will have to give two of these coins. The buyer cannot give three coins as he wants to minimize the number of coins that he gives.
|
```python
from math import ceil
n=int(input())
k=1
while pow(3, k)<n and n%pow(3, k)==0:
k+=1
print(ceil(n/pow(3, k)))
```
| 0
|
|
780
|
A
|
Andryusha and Socks
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Andryusha is an orderly boy and likes to keep things in their place.
Today he faced a problem to put his socks in the wardrobe. He has *n* distinct pairs of socks which are initially in a bag. The pairs are numbered from 1 to *n*. Andryusha wants to put paired socks together and put them in the wardrobe. He takes the socks one by one from the bag, and for each sock he looks whether the pair of this sock has been already took out of the bag, or not. If not (that means the pair of this sock is still in the bag), he puts the current socks on the table in front of him. Otherwise, he puts both socks from the pair to the wardrobe.
Andryusha remembers the order in which he took the socks from the bag. Can you tell him what is the maximum number of socks that were on the table at the same time?
|
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=105) — the number of sock pairs.
The second line contains 2*n* integers *x*1,<=*x*2,<=...,<=*x*2*n* (1<=≤<=*x**i*<=≤<=*n*), which describe the order in which Andryusha took the socks from the bag. More precisely, *x**i* means that the *i*-th sock Andryusha took out was from pair *x**i*.
It is guaranteed that Andryusha took exactly two socks of each pair.
|
Print single integer — the maximum number of socks that were on the table at the same time.
|
[
"1\n1 1\n",
"3\n2 1 1 3 2 3\n"
] |
[
"1\n",
"2\n"
] |
In the first example Andryusha took a sock from the first pair and put it on the table. Then he took the next sock which is from the first pair as well, so he immediately puts both socks to the wardrobe. Thus, at most one sock was on the table at the same time.
In the second example Andryusha behaved as follows:
- Initially the table was empty, he took out a sock from pair 2 and put it on the table. - Sock (2) was on the table. Andryusha took out a sock from pair 1 and put it on the table. - Socks (1, 2) were on the table. Andryusha took out a sock from pair 1, and put this pair into the wardrobe. - Sock (2) was on the table. Andryusha took out a sock from pair 3 and put it on the table. - Socks (2, 3) were on the table. Andryusha took out a sock from pair 2, and put this pair into the wardrobe. - Sock (3) was on the table. Andryusha took out a sock from pair 3 and put this pair into the wardrobe.
| 500
|
[
{
"input": "1\n1 1",
"output": "1"
},
{
"input": "3\n2 1 1 3 2 3",
"output": "2"
},
{
"input": "5\n5 1 3 2 4 3 1 2 4 5",
"output": "5"
},
{
"input": "10\n4 2 6 3 4 8 7 1 1 5 2 10 6 8 3 5 10 9 9 7",
"output": "6"
},
{
"input": "50\n30 47 31 38 37 50 36 43 9 23 2 2 15 31 14 49 9 16 6 44 27 14 5 6 3 47 25 26 1 35 3 15 24 19 8 46 49 41 4 26 40 28 42 11 34 35 46 18 7 28 18 40 19 42 4 41 38 48 50 12 29 39 33 17 25 22 22 21 36 45 27 30 20 7 13 29 39 44 21 8 37 45 34 1 20 10 11 17 33 12 43 13 10 16 48 24 32 5 23 32",
"output": "25"
},
{
"input": "50\n1 1 2 2 3 3 4 4 5 5 6 6 7 7 8 8 9 9 10 10 11 11 12 12 13 13 14 14 15 15 16 16 17 17 18 18 19 19 20 20 21 21 22 22 23 23 24 24 25 25 26 26 27 27 28 28 29 29 30 30 31 31 32 32 33 33 34 34 35 35 36 36 37 37 38 38 39 39 40 40 41 41 42 42 43 43 44 44 45 45 46 46 47 47 48 48 49 49 50 50",
"output": "1"
},
{
"input": "50\n50 50 49 49 48 48 47 47 46 46 45 45 44 44 43 43 42 42 41 41 40 40 39 39 38 38 37 37 36 36 35 35 34 34 33 33 32 32 31 31 30 30 29 29 28 28 27 27 26 26 25 25 24 24 23 23 22 22 21 21 20 20 19 19 18 18 17 17 16 16 15 15 14 14 13 13 12 12 11 11 10 10 9 9 8 8 7 7 6 6 5 5 4 4 3 3 2 2 1 1",
"output": "1"
},
{
"input": "50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "50"
},
{
"input": "50\n50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "50"
},
{
"input": "10\n2 9 4 1 6 7 10 3 1 5 8 6 2 3 10 7 4 8 5 9",
"output": "9"
}
] | 1,610,468,906
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 61
| 307,200
|
n = int(input())
a = list(map(int, input().split()))
b = a[:]
count = 0
for k in range(len(a)):
n1 = a[k]
c = 0
for m in range(k):
if a[m] != 0:
c += 1
n2 = b[m]
if n1 == n2:
a[m] = 0
a[k] = 0
b[m] = 0
break
if c > count:
count = c
print(count)
|
Title: Andryusha and Socks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Andryusha is an orderly boy and likes to keep things in their place.
Today he faced a problem to put his socks in the wardrobe. He has *n* distinct pairs of socks which are initially in a bag. The pairs are numbered from 1 to *n*. Andryusha wants to put paired socks together and put them in the wardrobe. He takes the socks one by one from the bag, and for each sock he looks whether the pair of this sock has been already took out of the bag, or not. If not (that means the pair of this sock is still in the bag), he puts the current socks on the table in front of him. Otherwise, he puts both socks from the pair to the wardrobe.
Andryusha remembers the order in which he took the socks from the bag. Can you tell him what is the maximum number of socks that were on the table at the same time?
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=105) — the number of sock pairs.
The second line contains 2*n* integers *x*1,<=*x*2,<=...,<=*x*2*n* (1<=≤<=*x**i*<=≤<=*n*), which describe the order in which Andryusha took the socks from the bag. More precisely, *x**i* means that the *i*-th sock Andryusha took out was from pair *x**i*.
It is guaranteed that Andryusha took exactly two socks of each pair.
Output Specification:
Print single integer — the maximum number of socks that were on the table at the same time.
Demo Input:
['1\n1 1\n', '3\n2 1 1 3 2 3\n']
Demo Output:
['1\n', '2\n']
Note:
In the first example Andryusha took a sock from the first pair and put it on the table. Then he took the next sock which is from the first pair as well, so he immediately puts both socks to the wardrobe. Thus, at most one sock was on the table at the same time.
In the second example Andryusha behaved as follows:
- Initially the table was empty, he took out a sock from pair 2 and put it on the table. - Sock (2) was on the table. Andryusha took out a sock from pair 1 and put it on the table. - Socks (1, 2) were on the table. Andryusha took out a sock from pair 1, and put this pair into the wardrobe. - Sock (2) was on the table. Andryusha took out a sock from pair 3 and put it on the table. - Socks (2, 3) were on the table. Andryusha took out a sock from pair 2, and put this pair into the wardrobe. - Sock (3) was on the table. Andryusha took out a sock from pair 3 and put this pair into the wardrobe.
|
```python
n = int(input())
a = list(map(int, input().split()))
b = a[:]
count = 0
for k in range(len(a)):
n1 = a[k]
c = 0
for m in range(k):
if a[m] != 0:
c += 1
n2 = b[m]
if n1 == n2:
a[m] = 0
a[k] = 0
b[m] = 0
break
if c > count:
count = c
print(count)
```
| 0
|
|
938
|
A
|
Word Correction
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Victor tries to write his own text editor, with word correction included. However, the rules of word correction are really strange.
Victor thinks that if a word contains two consecutive vowels, then it's kinda weird and it needs to be replaced. So the word corrector works in such a way: as long as there are two consecutive vowels in the word, it deletes the first vowel in a word such that there is another vowel right before it. If there are no two consecutive vowels in the word, it is considered to be correct.
You are given a word *s*. Can you predict what will it become after correction?
In this problem letters a, e, i, o, u and y are considered to be vowels.
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of letters in word *s* before the correction.
The second line contains a string *s* consisting of exactly *n* lowercase Latin letters — the word before the correction.
|
Output the word *s* after the correction.
|
[
"5\nweird\n",
"4\nword\n",
"5\naaeaa\n"
] |
[
"werd\n",
"word\n",
"a\n"
] |
Explanations of the examples:
1. There is only one replace: weird <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> werd;1. No replace needed since there are no two consecutive vowels;1. aaeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> a.
| 0
|
[
{
"input": "5\nweird",
"output": "werd"
},
{
"input": "4\nword",
"output": "word"
},
{
"input": "5\naaeaa",
"output": "a"
},
{
"input": "100\naaaaabbbbboyoyoyoyoyacadabbbbbiuiufgiuiuaahjabbbklboyoyoyoyoyaaaaabbbbbiuiuiuiuiuaaaaabbbbbeyiyuyzyw",
"output": "abbbbbocadabbbbbifgihjabbbklbobbbbbibbbbbezyw"
},
{
"input": "69\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "12\nmmmmmmmmmmmm",
"output": "mmmmmmmmmmmm"
},
{
"input": "18\nyaywptqwuyiqypwoyw",
"output": "ywptqwuqypwow"
},
{
"input": "85\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "13\nmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmm"
},
{
"input": "10\nmmmmmmmmmm",
"output": "mmmmmmmmmm"
},
{
"input": "11\nmmmmmmmmmmm",
"output": "mmmmmmmmmmm"
},
{
"input": "15\nmmmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmmmm"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "14\nmmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmmm"
},
{
"input": "33\nmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm"
},
{
"input": "79\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "90\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "2\naa",
"output": "a"
},
{
"input": "18\niuiuqpyyaoaetiwliu",
"output": "iqpytiwli"
},
{
"input": "5\nxxxxx",
"output": "xxxxx"
},
{
"input": "6\nxxxahg",
"output": "xxxahg"
},
{
"input": "3\nzcv",
"output": "zcv"
},
{
"input": "4\naepo",
"output": "apo"
},
{
"input": "5\nqqqqq",
"output": "qqqqq"
},
{
"input": "6\naaaaaa",
"output": "a"
},
{
"input": "4\naeta",
"output": "ata"
},
{
"input": "20\nttyttlwaoieulyiluuri",
"output": "ttyttlwalyluri"
},
{
"input": "1\nb",
"output": "b"
},
{
"input": "3\nanc",
"output": "anc"
},
{
"input": "1\ne",
"output": "e"
},
{
"input": "3\naie",
"output": "a"
},
{
"input": "3\nvio",
"output": "vi"
},
{
"input": "2\nea",
"output": "e"
},
{
"input": "3\nuas",
"output": "us"
},
{
"input": "2\nba",
"output": "ba"
},
{
"input": "2\naq",
"output": "aq"
},
{
"input": "2\nya",
"output": "y"
},
{
"input": "2\nou",
"output": "o"
},
{
"input": "2\nbb",
"output": "bb"
},
{
"input": "7\nayylmao",
"output": "alma"
},
{
"input": "2\nab",
"output": "ab"
},
{
"input": "19\nyuouiyaoiiweqrryqqp",
"output": "yweqrryqqp"
},
{
"input": "25\niqypwqpriiioetiuqqqttouei",
"output": "iqypwqpritiqqqtto"
},
{
"input": "100\naaaaabbbbboyoyoyoyoyacadabbbbbiuiufgiuiuaahjabbbklboyoyoyoyoyaaaaabbbbbiuiuiuiuiuaaaaabbbbbeyiyuyzyz",
"output": "abbbbbocadabbbbbifgihjabbbklbobbbbbibbbbbezyz"
},
{
"input": "17\naccccccccccccccca",
"output": "accccccccccccccca"
},
{
"input": "5\nababa",
"output": "ababa"
},
{
"input": "10\naaaaaaaaaa",
"output": "a"
},
{
"input": "22\naaaaabbbbboyoyoyoyoyac",
"output": "abbbbboc"
},
{
"input": "7\nmahmoud",
"output": "mahmod"
}
] | 1,608,637,388
| 788
|
Python 3
|
OK
|
TESTS
| 49
| 109
| 0
|
n = input()
s = input()
vows = ["a", "e", "i", "o", "u", "y"]
s_new = ''
if s[0] in vows:
s_new = s[0]
for char in s:
if char not in vows:
s_new += char
else:
if s_new[-1] not in vows:
s_new += char
print(s_new)
|
Title: Word Correction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Victor tries to write his own text editor, with word correction included. However, the rules of word correction are really strange.
Victor thinks that if a word contains two consecutive vowels, then it's kinda weird and it needs to be replaced. So the word corrector works in such a way: as long as there are two consecutive vowels in the word, it deletes the first vowel in a word such that there is another vowel right before it. If there are no two consecutive vowels in the word, it is considered to be correct.
You are given a word *s*. Can you predict what will it become after correction?
In this problem letters a, e, i, o, u and y are considered to be vowels.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of letters in word *s* before the correction.
The second line contains a string *s* consisting of exactly *n* lowercase Latin letters — the word before the correction.
Output Specification:
Output the word *s* after the correction.
Demo Input:
['5\nweird\n', '4\nword\n', '5\naaeaa\n']
Demo Output:
['werd\n', 'word\n', 'a\n']
Note:
Explanations of the examples:
1. There is only one replace: weird <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> werd;1. No replace needed since there are no two consecutive vowels;1. aaeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> a.
|
```python
n = input()
s = input()
vows = ["a", "e", "i", "o", "u", "y"]
s_new = ''
if s[0] in vows:
s_new = s[0]
for char in s:
if char not in vows:
s_new += char
else:
if s_new[-1] not in vows:
s_new += char
print(s_new)
```
| 3
|
|
507
|
B
|
Amr and Pins
|
PROGRAMMING
| 1,400
|
[
"geometry",
"math"
] | null | null |
Amr loves Geometry. One day he came up with a very interesting problem.
Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*').
In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin.
Help Amr to achieve his goal in minimum number of steps.
|
Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=≤<=*r*<=≤<=105, <=-<=105<=≤<=*x*,<=*y*,<=*x*',<=*y*'<=≤<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively.
|
Output a single integer — minimum number of steps required to move the center of the circle to the destination point.
|
[
"2 0 0 0 4\n",
"1 1 1 4 4\n",
"4 5 6 5 6\n"
] |
[
"1\n",
"3\n",
"0\n"
] |
In the first sample test the optimal way is to put a pin at point (0, 2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter).
<img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "2 0 0 0 4",
"output": "1"
},
{
"input": "1 1 1 4 4",
"output": "3"
},
{
"input": "4 5 6 5 6",
"output": "0"
},
{
"input": "10 20 0 40 0",
"output": "1"
},
{
"input": "9 20 0 40 0",
"output": "2"
},
{
"input": "5 -1 -6 -5 1",
"output": "1"
},
{
"input": "99125 26876 -21414 14176 17443",
"output": "1"
},
{
"input": "8066 7339 19155 -90534 -60666",
"output": "8"
},
{
"input": "100000 -100000 -100000 100000 100000",
"output": "2"
},
{
"input": "10 20 0 41 0",
"output": "2"
},
{
"input": "25 -64 -6 -56 64",
"output": "2"
},
{
"input": "125 455 450 439 721",
"output": "2"
},
{
"input": "5 6 3 7 2",
"output": "1"
},
{
"input": "24 130 14786 3147 2140",
"output": "271"
},
{
"input": "125 -363 176 93 330",
"output": "2"
},
{
"input": "1 14 30 30 14",
"output": "12"
},
{
"input": "25 96 13 7 2",
"output": "2"
},
{
"input": "4 100000 -100000 100000 -100000",
"output": "0"
},
{
"input": "1 3 4 2 5",
"output": "1"
},
{
"input": "1 -3 3 2 6",
"output": "3"
},
{
"input": "2 7 20 13 -5",
"output": "7"
},
{
"input": "1 1 1 1 4",
"output": "2"
},
{
"input": "249 -54242 -30537 -45023 -89682",
"output": "121"
},
{
"input": "4 100000 -100000 100000 -99999",
"output": "1"
},
{
"input": "97741 23818 78751 97583 26933",
"output": "1"
},
{
"input": "56767 -29030 51625 79823 -56297",
"output": "2"
},
{
"input": "98260 13729 74998 23701 9253",
"output": "1"
},
{
"input": "67377 -80131 -90254 -57320 14102",
"output": "1"
},
{
"input": "1 100000 100000 100000 -100000",
"output": "100000"
},
{
"input": "19312 19470 82059 58064 62231",
"output": "2"
},
{
"input": "67398 -68747 -79056 -34193 29400",
"output": "1"
},
{
"input": "91099 37184 -71137 75650 -3655",
"output": "1"
},
{
"input": "46456 -2621 -23623 -98302 -99305",
"output": "2"
},
{
"input": "100 100000 -100000 100000 -99999",
"output": "1"
},
{
"input": "1 100000 -100000 100000 -100000",
"output": "0"
},
{
"input": "8 0 0 0 32",
"output": "2"
},
{
"input": "100000 100000 1 -100000 0",
"output": "2"
}
] | 1,569,574,193
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 139
| 0
|
import math
g=input()
r,x,y,X,Y=[int(x) for x in g.split()]
d=math.sqrt((X-x)**2+(Y-y)**2)
l=1
if d==0:
print("0")
elif (2*r)>=d:
print("1")
else:
while (2*r)<d:
l+=1
d=d-2*r
print(l)
|
Title: Amr and Pins
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Amr loves Geometry. One day he came up with a very interesting problem.
Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*').
In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin.
Help Amr to achieve his goal in minimum number of steps.
Input Specification:
Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=≤<=*r*<=≤<=105, <=-<=105<=≤<=*x*,<=*y*,<=*x*',<=*y*'<=≤<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively.
Output Specification:
Output a single integer — minimum number of steps required to move the center of the circle to the destination point.
Demo Input:
['2 0 0 0 4\n', '1 1 1 4 4\n', '4 5 6 5 6\n']
Demo Output:
['1\n', '3\n', '0\n']
Note:
In the first sample test the optimal way is to put a pin at point (0, 2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter).
<img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
import math
g=input()
r,x,y,X,Y=[int(x) for x in g.split()]
d=math.sqrt((X-x)**2+(Y-y)**2)
l=1
if d==0:
print("0")
elif (2*r)>=d:
print("1")
else:
while (2*r)<d:
l+=1
d=d-2*r
print(l)
```
| 3
|
|
185
|
A
|
Plant
|
PROGRAMMING
| 1,300
|
[
"math"
] | null | null |
Dwarfs have planted a very interesting plant, which is a triangle directed "upwards". This plant has an amusing feature. After one year a triangle plant directed "upwards" divides into four triangle plants: three of them will point "upwards" and one will point "downwards". After another year, each triangle plant divides into four triangle plants: three of them will be directed in the same direction as the parent plant, and one of them will be directed in the opposite direction. Then each year the process repeats. The figure below illustrates this process.
Help the dwarfs find out how many triangle plants that point "upwards" will be in *n* years.
|
The first line contains a single integer *n* (0<=≤<=*n*<=≤<=1018) — the number of full years when the plant grew.
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier.
|
Print a single integer — the remainder of dividing the number of plants that will point "upwards" in *n* years by 1000000007 (109<=+<=7).
|
[
"1\n",
"2\n"
] |
[
"3\n",
"10\n"
] |
The first test sample corresponds to the second triangle on the figure in the statement. The second test sample corresponds to the third one.
| 500
|
[
{
"input": "1",
"output": "3"
},
{
"input": "2",
"output": "10"
},
{
"input": "385599124",
"output": "493875375"
},
{
"input": "989464295",
"output": "31966163"
},
{
"input": "376367012",
"output": "523204186"
},
{
"input": "529357306",
"output": "142578489"
},
{
"input": "782916801",
"output": "51174574"
},
{
"input": "74859961358140080",
"output": "478768275"
},
{
"input": "0",
"output": "1"
},
{
"input": "252509053898415171",
"output": "886314547"
},
{
"input": "760713016078377938",
"output": "79611270"
},
{
"input": "919845424847912644",
"output": "388845650"
},
{
"input": "585335721566249104",
"output": "301383716"
},
{
"input": "522842183413115087",
"output": "556012763"
},
{
"input": "148049062285906746",
"output": "913927498"
},
{
"input": "84324827171274022",
"output": "462535280"
},
{
"input": "354979172034763159",
"output": "239287993"
},
{
"input": "1312148742261680",
"output": "799725655"
},
{
"input": "269587448053313253",
"output": "536645997"
},
{
"input": "645762257531682045",
"output": "543988614"
},
{
"input": "615812227854199662",
"output": "357939938"
},
{
"input": "819875140559301751",
"output": "968653685"
},
{
"input": "349993003033420740",
"output": "709392758"
},
{
"input": "891351282398722856",
"output": "70758467"
},
{
"input": "563324730406715801",
"output": "353494903"
},
{
"input": "520974001002628386",
"output": "164118419"
},
{
"input": "666729339260489789",
"output": "784700006"
},
{
"input": "856674609788912527",
"output": "720540265"
},
{
"input": "791809296233191092",
"output": "369199735"
},
{
"input": "711066335916901717",
"output": "15590358"
},
{
"input": "931356501703211379",
"output": "239824013"
},
{
"input": "234122431978145893",
"output": "905163056"
},
{
"input": "1000000000000000000",
"output": "899770636"
},
{
"input": "3",
"output": "36"
},
{
"input": "4",
"output": "136"
},
{
"input": "5",
"output": "528"
},
{
"input": "6",
"output": "2080"
},
{
"input": "7",
"output": "8256"
},
{
"input": "8",
"output": "32896"
},
{
"input": "9",
"output": "131328"
},
{
"input": "10",
"output": "524800"
},
{
"input": "11",
"output": "2098176"
},
{
"input": "12",
"output": "8390656"
},
{
"input": "13",
"output": "33558528"
},
{
"input": "14",
"output": "134225920"
},
{
"input": "15",
"output": "536887296"
},
{
"input": "16",
"output": "147516402"
},
{
"input": "0",
"output": "1"
},
{
"input": "6265",
"output": "980996097"
}
] | 1,615,714,729
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 122
| 0
|
mod = 1000000007
n = int(input())
h = pow(2, n, mod)
print(((h) * (h + 1) % mod)//2)
|
Title: Plant
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dwarfs have planted a very interesting plant, which is a triangle directed "upwards". This plant has an amusing feature. After one year a triangle plant directed "upwards" divides into four triangle plants: three of them will point "upwards" and one will point "downwards". After another year, each triangle plant divides into four triangle plants: three of them will be directed in the same direction as the parent plant, and one of them will be directed in the opposite direction. Then each year the process repeats. The figure below illustrates this process.
Help the dwarfs find out how many triangle plants that point "upwards" will be in *n* years.
Input Specification:
The first line contains a single integer *n* (0<=≤<=*n*<=≤<=1018) — the number of full years when the plant grew.
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier.
Output Specification:
Print a single integer — the remainder of dividing the number of plants that will point "upwards" in *n* years by 1000000007 (109<=+<=7).
Demo Input:
['1\n', '2\n']
Demo Output:
['3\n', '10\n']
Note:
The first test sample corresponds to the second triangle on the figure in the statement. The second test sample corresponds to the third one.
|
```python
mod = 1000000007
n = int(input())
h = pow(2, n, mod)
print(((h) * (h + 1) % mod)//2)
```
| 0
|
|
681
|
A
|
A Good Contest
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Codeforces user' handle color depends on his rating — it is red if his rating is greater or equal to 2400; it is orange if his rating is less than 2400 but greater or equal to 2200, etc. Each time participant takes part in a rated contest, his rating is changed depending on his performance.
Anton wants the color of his handle to become red. He considers his performance in the rated contest to be good if he outscored some participant, whose handle was colored red before the contest and his rating has increased after it.
Anton has written a program that analyses contest results and determines whether he performed good or not. Are you able to do the same?
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants Anton has outscored in this contest .
The next *n* lines describe participants results: the *i*-th of them consists of a participant handle *name**i* and two integers *before**i* and *after**i* (<=-<=4000<=≤<=*before**i*,<=*after**i*<=≤<=4000) — participant's rating before and after the contest, respectively. Each handle is a non-empty string, consisting of no more than 10 characters, which might be lowercase and uppercase English letters, digits, characters «_» and «-» characters.
It is guaranteed that all handles are distinct.
|
Print «YES» (quotes for clarity), if Anton has performed good in the contest and «NO» (quotes for clarity) otherwise.
|
[
"3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749\n",
"3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450\n"
] |
[
"YES",
"NO"
] |
In the first sample, Anton has outscored user with handle Burunduk1, whose handle was colored red before the contest and his rating has increased after the contest.
In the second sample, Applejack's rating has not increased after the contest, while both Fluttershy's and Pinkie_Pie's handles were not colored red before the contest.
| 500
|
[
{
"input": "3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749",
"output": "YES"
},
{
"input": "3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450",
"output": "NO"
},
{
"input": "1\nDb -3373 3591",
"output": "NO"
},
{
"input": "5\nQ2bz 960 2342\nhmX 2710 -1348\ngbAe -1969 -963\nE -160 196\npsi 2665 -3155",
"output": "NO"
},
{
"input": "9\nmwAz9lQ 1786 -1631\nnYgYFXZQfY -1849 -1775\nKU4jF -1773 -3376\nopR 3752 2931\nGl -1481 -1002\nR -1111 3778\n0i9B21DC 3650 289\nQ8L2dS0 358 -3305\ng -2662 3968",
"output": "NO"
},
{
"input": "5\nzMSBcOUf -2883 -2238\nYN -3314 -1480\nfHpuccQn06 -1433 -589\naM1NVEPQi 399 3462\n_L 2516 -3290",
"output": "NO"
},
{
"input": "1\na 2400 2401",
"output": "YES"
},
{
"input": "1\nfucker 4000 4000",
"output": "NO"
},
{
"input": "1\nJora 2400 2401",
"output": "YES"
},
{
"input": "1\nACA 2400 2420",
"output": "YES"
},
{
"input": "1\nAca 2400 2420",
"output": "YES"
},
{
"input": "1\nSub_d 2401 2402",
"output": "YES"
},
{
"input": "2\nHack 2400 2401\nDum 1243 555",
"output": "YES"
},
{
"input": "1\nXXX 2400 2500",
"output": "YES"
},
{
"input": "1\nfucker 2400 2401",
"output": "YES"
},
{
"input": "1\nX 2400 2500",
"output": "YES"
},
{
"input": "1\nvineet 2400 2401",
"output": "YES"
},
{
"input": "1\nabc 2400 2500",
"output": "YES"
},
{
"input": "1\naaaaa 2400 2401",
"output": "YES"
},
{
"input": "1\nhoge 2400 2401",
"output": "YES"
},
{
"input": "1\nInfinity 2400 2468",
"output": "YES"
},
{
"input": "1\nBurunduk1 2400 2401",
"output": "YES"
},
{
"input": "1\nFuck 2400 2401",
"output": "YES"
},
{
"input": "1\nfuck 2400 2401",
"output": "YES"
},
{
"input": "3\nApplejack 2400 2401\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450",
"output": "YES"
},
{
"input": "1\nalex 2400 2401",
"output": "YES"
},
{
"input": "1\nA 2400 2401",
"output": "YES"
},
{
"input": "1\na 2400 2455",
"output": "YES"
},
{
"input": "1\nlol 2400 2401",
"output": "YES"
},
{
"input": "2\nBurunduk1 2400 2537\nBudAlNik 2084 2214",
"output": "YES"
},
{
"input": "1\naaaaaa 2400 2401",
"output": "YES"
},
{
"input": "1\nBurunduk1 2400 2500",
"output": "YES"
},
{
"input": "1\nds 2400 2410",
"output": "YES"
},
{
"input": "1\nas 2400 2401",
"output": "YES"
},
{
"input": "1\nabc 2400 2401",
"output": "YES"
},
{
"input": "3\nBudAlNik 2084 2214\nsubscriber 2833 2749\nBurunduk1 2526 2537",
"output": "YES"
},
{
"input": "1\ncaonima 2400 2401",
"output": "YES"
},
{
"input": "1\narr 2400 2500",
"output": "YES"
},
{
"input": "1\nx 2400 2401",
"output": "YES"
},
{
"input": "1\narrr 2400 2500",
"output": "YES"
},
{
"input": "1\nabc 2400 2405",
"output": "YES"
},
{
"input": "3\nBurunduk1 2400 2420\nBudAlNik 2084 2214\nsubscriber 2833 2749",
"output": "YES"
},
{
"input": "1\nBurunduk1 2400 2537",
"output": "YES"
},
{
"input": "1\nHELLO 2400 2401",
"output": "YES"
},
{
"input": "1\neatmore 2400 2500",
"output": "YES"
},
{
"input": "1\nb 2400 2401",
"output": "YES"
},
{
"input": "3\nBurunduk1 2400 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749",
"output": "YES"
},
{
"input": "1\nApplejack 2400 2410",
"output": "YES"
},
{
"input": "1\nabacaba 2400 2451",
"output": "YES"
},
{
"input": "1\nrekt_n00b 2500 2600",
"output": "YES"
}
] | 1,593,980,866
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 60
| 155
| 20,172,800
|
import sys
numCases = int(input())
isGood = False
for i in range(0, numCases):
inputArray = input().split(' ')
score1 = int(inputArray[1])
score2 = int(inputArray[2])
if score1 >= 2400 and score2 > score1:
isGood = True
if isGood:
print("YES")
else:
print("NO")
|
Title: A Good Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Codeforces user' handle color depends on his rating — it is red if his rating is greater or equal to 2400; it is orange if his rating is less than 2400 but greater or equal to 2200, etc. Each time participant takes part in a rated contest, his rating is changed depending on his performance.
Anton wants the color of his handle to become red. He considers his performance in the rated contest to be good if he outscored some participant, whose handle was colored red before the contest and his rating has increased after it.
Anton has written a program that analyses contest results and determines whether he performed good or not. Are you able to do the same?
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants Anton has outscored in this contest .
The next *n* lines describe participants results: the *i*-th of them consists of a participant handle *name**i* and two integers *before**i* and *after**i* (<=-<=4000<=≤<=*before**i*,<=*after**i*<=≤<=4000) — participant's rating before and after the contest, respectively. Each handle is a non-empty string, consisting of no more than 10 characters, which might be lowercase and uppercase English letters, digits, characters «_» and «-» characters.
It is guaranteed that all handles are distinct.
Output Specification:
Print «YES» (quotes for clarity), if Anton has performed good in the contest and «NO» (quotes for clarity) otherwise.
Demo Input:
['3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749\n', '3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450\n']
Demo Output:
['YES', 'NO']
Note:
In the first sample, Anton has outscored user with handle Burunduk1, whose handle was colored red before the contest and his rating has increased after the contest.
In the second sample, Applejack's rating has not increased after the contest, while both Fluttershy's and Pinkie_Pie's handles were not colored red before the contest.
|
```python
import sys
numCases = int(input())
isGood = False
for i in range(0, numCases):
inputArray = input().split(' ')
score1 = int(inputArray[1])
score2 = int(inputArray[2])
if score1 >= 2400 and score2 > score1:
isGood = True
if isGood:
print("YES")
else:
print("NO")
```
| 3
|
|
469
|
A
|
I Wanna Be the Guy
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation"
] | null | null |
There is a game called "I Wanna Be the Guy", consisting of *n* levels. Little X and his friend Little Y are addicted to the game. Each of them wants to pass the whole game.
Little X can pass only *p* levels of the game. And Little Y can pass only *q* levels of the game. You are given the indices of levels Little X can pass and the indices of levels Little Y can pass. Will Little X and Little Y pass the whole game, if they cooperate each other?
|
The first line contains a single integer *n* (1<=≤<=<=*n*<=≤<=100).
The next line contains an integer *p* (0<=≤<=*p*<=≤<=*n*) at first, then follows *p* distinct integers *a*1,<=*a*2,<=...,<=*a**p* (1<=≤<=*a**i*<=≤<=*n*). These integers denote the indices of levels Little X can pass. The next line contains the levels Little Y can pass in the same format. It's assumed that levels are numbered from 1 to *n*.
|
If they can pass all the levels, print "I become the guy.". If it's impossible, print "Oh, my keyboard!" (without the quotes).
|
[
"4\n3 1 2 3\n2 2 4\n",
"4\n3 1 2 3\n2 2 3\n"
] |
[
"I become the guy.\n",
"Oh, my keyboard!\n"
] |
In the first sample, Little X can pass levels [1 2 3], and Little Y can pass level [2 4], so they can pass all the levels both.
In the second sample, no one can pass level 4.
| 500
|
[
{
"input": "4\n3 1 2 3\n2 2 4",
"output": "I become the guy."
},
{
"input": "4\n3 1 2 3\n2 2 3",
"output": "Oh, my keyboard!"
},
{
"input": "10\n5 8 6 1 5 4\n6 1 3 2 9 4 6",
"output": "Oh, my keyboard!"
},
{
"input": "10\n8 8 10 7 3 1 4 2 6\n8 9 5 10 3 7 2 4 8",
"output": "I become the guy."
},
{
"input": "10\n9 6 1 8 3 9 7 5 10 4\n7 1 3 2 7 6 9 5",
"output": "I become the guy."
},
{
"input": "100\n75 83 69 73 30 76 37 48 14 41 42 21 35 15 50 61 86 85 46 3 31 13 78 10 2 44 80 95 56 82 38 75 77 4 99 9 84 53 12 11 36 74 39 72 43 89 57 28 54 1 51 66 27 22 93 59 68 88 91 29 7 20 63 8 52 23 64 58 100 79 65 49 96 71 33 45\n83 50 89 73 34 28 99 67 77 44 19 60 68 42 8 27 94 85 14 39 17 78 24 21 29 63 92 32 86 22 71 81 31 82 65 48 80 59 98 3 70 55 37 12 15 72 47 9 11 33 16 7 91 74 13 64 38 84 6 61 93 90 45 69 1 54 52 100 57 10 35 49 53 75 76 43 62 5 4 18 36 96 79 23",
"output": "Oh, my keyboard!"
},
{
"input": "1\n1 1\n1 1",
"output": "I become the guy."
},
{
"input": "1\n0\n1 1",
"output": "I become the guy."
},
{
"input": "1\n1 1\n0",
"output": "I become the guy."
},
{
"input": "1\n0\n0",
"output": "Oh, my keyboard!"
},
{
"input": "100\n0\n0",
"output": "Oh, my keyboard!"
},
{
"input": "100\n44 71 70 55 49 43 16 53 7 95 58 56 38 76 67 94 20 73 29 90 25 30 8 84 5 14 77 52 99 91 66 24 39 37 22 44 78 12 63 59 32 51 15 82 34\n56 17 10 96 80 69 13 81 31 57 4 48 68 89 50 45 3 33 36 2 72 100 64 87 21 75 54 74 92 65 23 40 97 61 18 28 98 93 35 83 9 79 46 27 41 62 88 6 47 60 86 26 42 85 19 1 11",
"output": "I become the guy."
},
{
"input": "100\n78 63 59 39 11 58 4 2 80 69 22 95 90 26 65 16 30 100 66 99 67 79 54 12 23 28 45 56 70 74 60 82 73 91 68 43 92 75 51 21 17 97 86 44 62 47 85 78 72 64 50 81 71 5 57 13 31 76 87 9 49 96 25 42 19 35 88 53 7 83 38 27 29 41 89 93 10 84 18\n78 1 16 53 72 99 9 36 59 49 75 77 94 79 35 4 92 42 82 83 76 97 20 68 55 47 65 50 14 30 13 67 98 8 7 40 64 32 87 10 33 90 93 18 26 71 17 46 24 28 89 58 37 91 39 34 25 48 84 31 96 95 80 88 3 51 62 52 85 61 12 15 27 6 45 38 2 22 60",
"output": "I become the guy."
},
{
"input": "2\n2 2 1\n0",
"output": "I become the guy."
},
{
"input": "2\n1 2\n2 1 2",
"output": "I become the guy."
},
{
"input": "80\n57 40 1 47 36 69 24 76 5 72 26 4 29 62 6 60 3 70 8 64 18 37 16 14 13 21 25 7 66 68 44 74 61 39 38 33 15 63 34 65 10 23 56 51 80 58 49 75 71 12 50 57 2 30 54 27 17 52\n61 22 67 15 28 41 26 1 80 44 3 38 18 37 79 57 11 7 65 34 9 36 40 5 48 29 64 31 51 63 27 4 50 13 24 32 58 23 19 46 8 73 39 2 21 56 77 53 59 78 43 12 55 45 30 74 33 68 42 47 17 54",
"output": "Oh, my keyboard!"
},
{
"input": "100\n78 87 96 18 73 32 38 44 29 64 40 70 47 91 60 69 24 1 5 34 92 94 99 22 83 65 14 68 15 20 74 31 39 100 42 4 97 46 25 6 8 56 79 9 71 35 54 19 59 93 58 62 10 85 57 45 33 7 86 81 30 98 26 61 84 41 23 28 88 36 66 51 80 53 37 63 43 95 75\n76 81 53 15 26 37 31 62 24 87 41 39 75 86 46 76 34 4 51 5 45 65 67 48 68 23 71 27 94 47 16 17 9 96 84 89 88 100 18 52 69 42 6 92 7 64 49 12 98 28 21 99 25 55 44 40 82 19 36 30 77 90 14 43 50 3 13 95 78 35 20 54 58 11 2 1 33",
"output": "Oh, my keyboard!"
},
{
"input": "100\n77 55 26 98 13 91 78 60 23 76 12 11 36 62 84 80 18 1 68 92 81 67 19 4 2 10 17 77 96 63 15 69 46 97 82 42 83 59 50 72 14 40 89 9 52 29 56 31 74 39 45 85 22 99 44 65 95 6 90 38 54 32 49 34 3 70 75 33 94 53 21 71 5 66 73 41 100 24\n69 76 93 5 24 57 59 6 81 4 30 12 44 15 67 45 73 3 16 8 47 95 20 64 68 85 54 17 90 86 66 58 13 37 42 51 35 32 1 28 43 80 7 14 48 19 62 55 2 91 25 49 27 26 38 79 89 99 22 60 75 53 88 82 34 21 87 71 72 61",
"output": "I become the guy."
},
{
"input": "100\n74 96 32 63 12 69 72 99 15 22 1 41 79 77 71 31 20 28 75 73 85 37 38 59 42 100 86 89 55 87 68 4 24 57 52 8 92 27 56 98 95 58 34 9 45 14 11 36 66 76 61 19 25 23 78 49 90 26 80 43 70 13 65 10 5 74 81 21 44 60 97 3 47 93 6\n64 68 21 27 16 91 23 22 33 12 71 88 90 50 62 43 28 29 57 59 5 74 10 95 35 1 67 93 36 32 86 40 6 64 78 46 89 15 84 53 18 30 17 85 2 3 47 92 25 48 76 51 20 82 52 83 99 63 80 11 94 54 39 7 58",
"output": "I become the guy."
},
{
"input": "100\n75 11 98 44 47 88 94 23 78 59 70 2 43 39 34 63 71 19 42 61 30 74 14 77 97 53 92 60 67 36 37 13 6 86 62 46 41 3 25 93 7 12 27 48 55 49 31 35 51 10 57 54 95 82 28 90 73 26 17 50 81 56 20 87 40 85 72 64 99 29 91 5 80 18 24 52\n72 93 59 5 88 47 9 58 48 1 43 50 100 87 61 91 45 98 99 56 25 84 53 73 78 54 63 38 37 2 77 95 89 85 4 90 10 33 12 22 74 32 34 70 71 52 96 57 15 66 31 27 75 8 21 39 62 44 67 94 81 68 14 19 36 28 11 79 16 65 46 83 76",
"output": "Oh, my keyboard!"
},
{
"input": "3\n1 2\n2 2 3",
"output": "Oh, my keyboard!"
},
{
"input": "4\n1 2\n3 1 3 4",
"output": "I become the guy."
},
{
"input": "6\n2 1 2\n3 4 5 6",
"output": "Oh, my keyboard!"
}
] | 1,691,433,471
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 46
| 0
|
n = int(input())
x = input()[1:]
y = input()[1:]
xy = x+y
if all([str(i) in xy for i in range(1, n+1)]):
print('I become the guy.')
else:
print('Oh, my keyboard!')
|
Title: I Wanna Be the Guy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a game called "I Wanna Be the Guy", consisting of *n* levels. Little X and his friend Little Y are addicted to the game. Each of them wants to pass the whole game.
Little X can pass only *p* levels of the game. And Little Y can pass only *q* levels of the game. You are given the indices of levels Little X can pass and the indices of levels Little Y can pass. Will Little X and Little Y pass the whole game, if they cooperate each other?
Input Specification:
The first line contains a single integer *n* (1<=≤<=<=*n*<=≤<=100).
The next line contains an integer *p* (0<=≤<=*p*<=≤<=*n*) at first, then follows *p* distinct integers *a*1,<=*a*2,<=...,<=*a**p* (1<=≤<=*a**i*<=≤<=*n*). These integers denote the indices of levels Little X can pass. The next line contains the levels Little Y can pass in the same format. It's assumed that levels are numbered from 1 to *n*.
Output Specification:
If they can pass all the levels, print "I become the guy.". If it's impossible, print "Oh, my keyboard!" (without the quotes).
Demo Input:
['4\n3 1 2 3\n2 2 4\n', '4\n3 1 2 3\n2 2 3\n']
Demo Output:
['I become the guy.\n', 'Oh, my keyboard!\n']
Note:
In the first sample, Little X can pass levels [1 2 3], and Little Y can pass level [2 4], so they can pass all the levels both.
In the second sample, no one can pass level 4.
|
```python
n = int(input())
x = input()[1:]
y = input()[1:]
xy = x+y
if all([str(i) in xy for i in range(1, n+1)]):
print('I become the guy.')
else:
print('Oh, my keyboard!')
```
| 3
|
|
509
|
A
|
Maximum in Table
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
|
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
|
Print a single line containing a positive integer *m* — the maximum value in the table.
|
[
"1\n",
"5\n"
] |
[
"1",
"70"
] |
In the second test the rows of the table look as follows:
| 0
|
[
{
"input": "1",
"output": "1"
},
{
"input": "5",
"output": "70"
},
{
"input": "2",
"output": "2"
},
{
"input": "3",
"output": "6"
},
{
"input": "4",
"output": "20"
},
{
"input": "6",
"output": "252"
},
{
"input": "7",
"output": "924"
},
{
"input": "9",
"output": "12870"
},
{
"input": "10",
"output": "48620"
},
{
"input": "8",
"output": "3432"
}
] | 1,629,025,236
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 10
| 62
| 6,963,200
|
def main(n):
n = int(n)
mas = []
for i in range(n):
mas.append([1]*n)
#print(mas)
for i in range(1,n):
for j in range(1,n):
mas[i][j] = mas[i-1][j] + mas[i][j-1]
#for i in range(n):
#mas[0][i] = 1
return mas[-1][-1]
print(main(input()))
|
Title: Maximum in Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
Input Specification:
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
Output Specification:
Print a single line containing a positive integer *m* — the maximum value in the table.
Demo Input:
['1\n', '5\n']
Demo Output:
['1', '70']
Note:
In the second test the rows of the table look as follows:
|
```python
def main(n):
n = int(n)
mas = []
for i in range(n):
mas.append([1]*n)
#print(mas)
for i in range(1,n):
for j in range(1,n):
mas[i][j] = mas[i-1][j] + mas[i][j-1]
#for i in range(n):
#mas[0][i] = 1
return mas[-1][-1]
print(main(input()))
```
| 3
|
|
621
|
A
|
Wet Shark and Odd and Even
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Today, Wet Shark is given *n* integers. Using any of these integers no more than once, Wet Shark wants to get maximum possible even (divisible by 2) sum. Please, calculate this value for Wet Shark.
Note, that if Wet Shark uses no integers from the *n* integers, the sum is an even integer 0.
|
The first line of the input contains one integer, *n* (1<=≤<=*n*<=≤<=100<=000). The next line contains *n* space separated integers given to Wet Shark. Each of these integers is in range from 1 to 109, inclusive.
|
Print the maximum possible even sum that can be obtained if we use some of the given integers.
|
[
"3\n1 2 3\n",
"5\n999999999 999999999 999999999 999999999 999999999\n"
] |
[
"6",
"3999999996"
] |
In the first sample, we can simply take all three integers for a total sum of 6.
In the second sample Wet Shark should take any four out of five integers 999 999 999.
| 500
|
[
{
"input": "3\n1 2 3",
"output": "6"
},
{
"input": "5\n999999999 999999999 999999999 999999999 999999999",
"output": "3999999996"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "15\n39 52 88 78 46 95 84 98 55 3 68 42 6 18 98",
"output": "870"
},
{
"input": "15\n59 96 34 48 8 72 67 90 15 85 7 90 97 47 25",
"output": "840"
},
{
"input": "15\n87 37 91 29 58 45 51 74 70 71 47 38 91 89 44",
"output": "922"
},
{
"input": "15\n11 81 49 7 11 14 30 67 29 50 90 81 77 18 59",
"output": "674"
},
{
"input": "15\n39 21 95 89 73 90 9 55 85 32 30 21 68 59 82",
"output": "848"
},
{
"input": "15\n59 70 48 54 26 67 84 39 40 18 77 69 70 88 93",
"output": "902"
},
{
"input": "15\n87 22 98 32 88 36 72 31 100 97 17 16 60 22 20",
"output": "798"
},
{
"input": "15\n15 63 51 13 37 9 43 19 55 79 57 60 50 59 31",
"output": "632"
},
{
"input": "1\n4",
"output": "4"
},
{
"input": "2\n1 4",
"output": "4"
},
{
"input": "3\n1 2 4",
"output": "6"
},
{
"input": "2\n9 3",
"output": "12"
},
{
"input": "2\n1000000000 1001",
"output": "1000000000"
},
{
"input": "3\n1 8 4",
"output": "12"
},
{
"input": "3\n7 4 4",
"output": "8"
},
{
"input": "5\n2 3 4 5 3",
"output": "14"
},
{
"input": "2\n4 5",
"output": "4"
},
{
"input": "3\n2 4 5",
"output": "6"
},
{
"input": "3\n2 2 3",
"output": "4"
},
{
"input": "2\n2 3",
"output": "2"
},
{
"input": "4\n2 3 7 7",
"output": "16"
},
{
"input": "2\n999999999 2",
"output": "2"
},
{
"input": "2\n2 5",
"output": "2"
},
{
"input": "3\n5 3 1",
"output": "8"
},
{
"input": "4\n3 2 5 7",
"output": "14"
}
] | 1,578,372,713
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 87
| 171
| 8,499,200
|
n = int(input())
a = [int(x) for x in input().split()]
if(sum(a) % 2 ==0):
print(sum(a))
else:
x =[]
for i in a:
if i % 2 !=0:
x.append(i)
print(sum(a) - min(x))
|
Title: Wet Shark and Odd and Even
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today, Wet Shark is given *n* integers. Using any of these integers no more than once, Wet Shark wants to get maximum possible even (divisible by 2) sum. Please, calculate this value for Wet Shark.
Note, that if Wet Shark uses no integers from the *n* integers, the sum is an even integer 0.
Input Specification:
The first line of the input contains one integer, *n* (1<=≤<=*n*<=≤<=100<=000). The next line contains *n* space separated integers given to Wet Shark. Each of these integers is in range from 1 to 109, inclusive.
Output Specification:
Print the maximum possible even sum that can be obtained if we use some of the given integers.
Demo Input:
['3\n1 2 3\n', '5\n999999999 999999999 999999999 999999999 999999999\n']
Demo Output:
['6', '3999999996']
Note:
In the first sample, we can simply take all three integers for a total sum of 6.
In the second sample Wet Shark should take any four out of five integers 999 999 999.
|
```python
n = int(input())
a = [int(x) for x in input().split()]
if(sum(a) % 2 ==0):
print(sum(a))
else:
x =[]
for i in a:
if i % 2 !=0:
x.append(i)
print(sum(a) - min(x))
```
| 3
|
|
148
|
C
|
Terse princess
|
PROGRAMMING
| 1,700
|
[
"constructive algorithms",
"greedy"
] | null | null |
«Next please», — the princess called and cast an estimating glance at the next groom.
The princess intends to choose the most worthy groom, this is, the richest one. Whenever she sees a groom who is more rich than each of the previous ones, she says a measured «Oh...». Whenever the groom is richer than all previous ones added together, she exclaims «Wow!» (no «Oh...» in this case). At the sight of the first groom the princess stays calm and says nothing.
The fortune of each groom is described with an integer between 1 and 50000. You know that during the day the princess saw *n* grooms, said «Oh...» exactly *a* times and exclaimed «Wow!» exactly *b* times. Your task is to output a sequence of *n* integers *t*1,<=*t*2,<=...,<=*t**n*, where *t**i* describes the fortune of *i*-th groom. If several sequences are possible, output any of them. If no sequence exists that would satisfy all the requirements, output a single number -1.
|
The only line of input data contains three integer numbers *n*,<=*a* and *b* (1<=≤<=*n*<=≤<=100,<=0<=≤<=*a*,<=*b*<=≤<=15,<=*n*<=><=*a*<=+<=*b*), separated with single spaces.
|
Output any sequence of integers *t*1,<=*t*2,<=...,<=*t**n*, where *t**i* (1<=≤<=*t**i*<=≤<=50000) is the fortune of *i*-th groom, that satisfies the given constraints. If no sequence exists that would satisfy all the requirements, output a single number -1.
|
[
"10 2 3\n",
"5 0 0\n"
] |
[
"5 1 3 6 16 35 46 4 200 99",
"10 10 6 6 5"
] |
Let's have a closer look at the answer for the first sample test.
- The princess said «Oh...» (highlighted in bold): 5 1 3 6 16 35 46 4 200 99. - The princess exclaimed «Wow!» (highlighted in bold): 5 1 3 6 16 35 46 4 200 99.
| 1,000
|
[
{
"input": "10 2 3",
"output": "1 2 4 8 9 10 10 10 10 10 "
},
{
"input": "5 0 0",
"output": "1 1 1 1 1 "
},
{
"input": "5 2 2",
"output": "1 2 4 5 6 "
},
{
"input": "6 2 2",
"output": "1 2 4 5 6 6 "
},
{
"input": "10 9 0",
"output": "-1"
},
{
"input": "1 0 0",
"output": "1 "
},
{
"input": "10 0 9",
"output": "1 2 4 8 16 32 64 128 256 512 "
},
{
"input": "42 10 13",
"output": "1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 8193 8194 8195 8196 8197 8198 8199 8200 8201 8202 8202 8202 8202 8202 8202 8202 8202 8202 8202 8202 8202 8202 8202 8202 8202 8202 8202 8202 "
},
{
"input": "7 3 3",
"output": "1 2 4 8 9 10 11 "
},
{
"input": "12 0 0",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "19 1 0",
"output": "1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "17 2 3",
"output": "1 2 4 8 9 10 10 10 10 10 10 10 10 10 10 10 10 "
},
{
"input": "7 3 1",
"output": "1 2 3 4 5 5 5 "
},
{
"input": "19 3 1",
"output": "1 2 3 4 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 "
},
{
"input": "10 4 4",
"output": "1 2 4 8 16 17 18 19 20 20 "
},
{
"input": "11 5 4",
"output": "1 2 4 8 16 17 18 19 20 21 21 "
},
{
"input": "8 0 2",
"output": "1 2 4 4 4 4 4 4 "
},
{
"input": "19 5 1",
"output": "1 2 3 4 5 6 7 7 7 7 7 7 7 7 7 7 7 7 7 "
},
{
"input": "100 9 0",
"output": "1 1 2 3 4 5 6 7 8 9 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 "
},
{
"input": "2 0 1",
"output": "1 2 "
},
{
"input": "2 1 0",
"output": "-1"
},
{
"input": "3 0 2",
"output": "1 2 4 "
},
{
"input": "3 1 1",
"output": "1 2 3 "
},
{
"input": "3 2 0",
"output": "-1"
},
{
"input": "4 0 0",
"output": "1 1 1 1 "
},
{
"input": "4 0 1",
"output": "1 2 2 2 "
},
{
"input": "4 0 2",
"output": "1 2 4 4 "
},
{
"input": "4 0 3",
"output": "1 2 4 8 "
},
{
"input": "4 1 0",
"output": "1 1 2 2 "
},
{
"input": "4 2 0",
"output": "1 1 2 3 "
},
{
"input": "4 3 0",
"output": "-1"
},
{
"input": "4 1 1",
"output": "1 2 3 3 "
},
{
"input": "4 1 2",
"output": "1 2 4 5 "
},
{
"input": "4 2 1",
"output": "1 2 3 4 "
},
{
"input": "100 0 0",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "100 0 1",
"output": "1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "100 1 0",
"output": "1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "100 1 1",
"output": "1 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 "
},
{
"input": "100 2 0",
"output": "1 1 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 "
},
{
"input": "100 0 2",
"output": "1 2 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 "
},
{
"input": "16 0 15",
"output": "1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 "
},
{
"input": "16 15 0",
"output": "-1"
},
{
"input": "100 0 15",
"output": "1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 32768 ..."
},
{
"input": "100 15 0",
"output": "1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 "
},
{
"input": "100 11 13",
"output": "1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 8193 8194 8195 8196 8197 8198 8199 8200 8201 8202 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 8203 "
},
{
"input": "100 15 15",
"output": "1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 32769 32770 32771 32772 32773 32774 32775 32776 32777 32778 32779 32780 32781 32782 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 32783 ..."
},
{
"input": "100 14 15",
"output": "1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 32769 32770 32771 32772 32773 32774 32775 32776 32777 32778 32779 32780 32781 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 32782 ..."
},
{
"input": "100 15 14",
"output": "1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 16385 16386 16387 16388 16389 16390 16391 16392 16393 16394 16395 16396 16397 16398 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 16399 ..."
},
{
"input": "9 4 4",
"output": "1 2 4 8 16 17 18 19 20 "
},
{
"input": "100 2 15",
"output": "1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 32769 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 32770 ..."
},
{
"input": "3 1 0",
"output": "1 1 2 "
},
{
"input": "7 4 0",
"output": "1 1 2 3 4 5 5 "
},
{
"input": "5 2 0",
"output": "1 1 2 3 3 "
},
{
"input": "2 0 0",
"output": "1 1 "
},
{
"input": "5 1 0",
"output": "1 1 2 2 2 "
},
{
"input": "10 2 0",
"output": "1 1 2 3 3 3 3 3 3 3 "
},
{
"input": "10 7 0",
"output": "1 1 2 3 4 5 6 7 8 8 "
},
{
"input": "5 3 0",
"output": "1 1 2 3 4 "
},
{
"input": "10 1 0",
"output": "1 1 2 2 2 2 2 2 2 2 "
},
{
"input": "10 5 0",
"output": "1 1 2 3 4 5 6 6 6 6 "
},
{
"input": "100 3 0",
"output": "1 1 2 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 "
},
{
"input": "100 5 12",
"output": "1 2 4 8 16 32 64 128 256 512 1024 2048 4096 4097 4098 4099 4100 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 4101 "
},
{
"input": "15 10 0",
"output": "1 1 2 3 4 5 6 7 8 9 10 11 11 11 11 "
}
] | 1,689,947,840
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
n,a,b=map(int,input().split())
e=b
if b>12:
x=[1]
d=1
r=1
else:
x=[15]
d=15
r=15
while b:
b-=1
x.append(d+1)
r+=d+1
d=r
while a:
x.append(r+1)
a-=1
r+=1
while len(x)<n:
x.append(1)
if e==15:
print(-1)
else:
print(*x)
|
Title: Terse princess
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
«Next please», — the princess called and cast an estimating glance at the next groom.
The princess intends to choose the most worthy groom, this is, the richest one. Whenever she sees a groom who is more rich than each of the previous ones, she says a measured «Oh...». Whenever the groom is richer than all previous ones added together, she exclaims «Wow!» (no «Oh...» in this case). At the sight of the first groom the princess stays calm and says nothing.
The fortune of each groom is described with an integer between 1 and 50000. You know that during the day the princess saw *n* grooms, said «Oh...» exactly *a* times and exclaimed «Wow!» exactly *b* times. Your task is to output a sequence of *n* integers *t*1,<=*t*2,<=...,<=*t**n*, where *t**i* describes the fortune of *i*-th groom. If several sequences are possible, output any of them. If no sequence exists that would satisfy all the requirements, output a single number -1.
Input Specification:
The only line of input data contains three integer numbers *n*,<=*a* and *b* (1<=≤<=*n*<=≤<=100,<=0<=≤<=*a*,<=*b*<=≤<=15,<=*n*<=><=*a*<=+<=*b*), separated with single spaces.
Output Specification:
Output any sequence of integers *t*1,<=*t*2,<=...,<=*t**n*, where *t**i* (1<=≤<=*t**i*<=≤<=50000) is the fortune of *i*-th groom, that satisfies the given constraints. If no sequence exists that would satisfy all the requirements, output a single number -1.
Demo Input:
['10 2 3\n', '5 0 0\n']
Demo Output:
['5 1 3 6 16 35 46 4 200 99', '10 10 6 6 5']
Note:
Let's have a closer look at the answer for the first sample test.
- The princess said «Oh...» (highlighted in bold): 5 1 3 6 16 35 46 4 200 99. - The princess exclaimed «Wow!» (highlighted in bold): 5 1 3 6 16 35 46 4 200 99.
|
```python
n,a,b=map(int,input().split())
e=b
if b>12:
x=[1]
d=1
r=1
else:
x=[15]
d=15
r=15
while b:
b-=1
x.append(d+1)
r+=d+1
d=r
while a:
x.append(r+1)
a-=1
r+=1
while len(x)<n:
x.append(1)
if e==15:
print(-1)
else:
print(*x)
```
| 0
|
|
902
|
B
|
Coloring a Tree
|
PROGRAMMING
| 1,200
|
[
"dfs and similar",
"dsu",
"greedy"
] | null | null |
You are given a rooted tree with *n* vertices. The vertices are numbered from 1 to *n*, the root is the vertex number 1.
Each vertex has a color, let's denote the color of vertex *v* by *c**v*. Initially *c**v*<==<=0.
You have to color the tree into the given colors using the smallest possible number of steps. On each step you can choose a vertex *v* and a color *x*, and then color all vectices in the subtree of *v* (including *v* itself) in color *x*. In other words, for every vertex *u*, such that the path from root to *u* passes through *v*, set *c**u*<==<=*x*.
It is guaranteed that you have to color each vertex in a color different from 0.
You can learn what a rooted tree is using the link: [https://en.wikipedia.org/wiki/Tree_(graph_theory)](https://en.wikipedia.org/wiki/Tree_(graph_theory)).
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=104) — the number of vertices in the tree.
The second line contains *n*<=-<=1 integers *p*2,<=*p*3,<=...,<=*p**n* (1<=≤<=*p**i*<=<<=*i*), where *p**i* means that there is an edge between vertices *i* and *p**i*.
The third line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=*n*), where *c**i* is the color you should color the *i*-th vertex into.
It is guaranteed that the given graph is a tree.
|
Print a single integer — the minimum number of steps you have to perform to color the tree into given colors.
|
[
"6\n1 2 2 1 5\n2 1 1 1 1 1\n",
"7\n1 1 2 3 1 4\n3 3 1 1 1 2 3\n"
] |
[
"3\n",
"5\n"
] |
The tree from the first sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/10324ccdc37f95343acc4f3c6050d8c334334ffa.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 2 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/1c7bb267e2c1a006132248a43121400189309e2f.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On seond step we color all vertices in the subtree of vertex 5 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/2201a6d49b89ba850ff0d0bdcbb3f8e9dd3871a8.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 2 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/6fa977fcdebdde94c47695151e0427b33d0102c5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
The tree from the second sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/d70f9ae72a2ed429dd6531cac757e375dd3c953d.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 3 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/7289e8895d0dd56c47b6b17969b9cf77b36786b5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On second step we color all vertices in the subtree of vertex 3 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/819001df7229138db3a407713744d1e3be88b64e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 6 into color 2:
<img class="tex-graphics" src="https://espresso.codeforces.com/80ebbd870a0a339636a21b9acdaf9de046458b43.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fourth step we color all vertices in the subtree of vertex 4 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/ed836aa723ac0176abde4e32988e3ac205014e93.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fith step we color all vertices in the subtree of vertex 7 into color 3:
<img class="tex-graphics" src="https://espresso.codeforces.com/8132909e11b41c27b8df2f0b0c10bc841f35e58a.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "6\n1 2 2 1 5\n2 1 1 1 1 1",
"output": "3"
},
{
"input": "7\n1 1 2 3 1 4\n3 3 1 1 1 2 3",
"output": "5"
},
{
"input": "2\n1\n2 2",
"output": "1"
},
{
"input": "3\n1 1\n2 2 2",
"output": "1"
},
{
"input": "4\n1 2 1\n1 2 3 4",
"output": "4"
},
{
"input": "4\n1 2 3\n4 1 2 4",
"output": "4"
},
{
"input": "5\n1 2 1 4\n1 1 1 2 2",
"output": "2"
},
{
"input": "3\n1 2\n2 1 1",
"output": "2"
},
{
"input": "4\n1 1 1\n3 1 3 1",
"output": "3"
},
{
"input": "4\n1 1 2\n4 1 4 1",
"output": "2"
},
{
"input": "4\n1 2 2\n3 1 2 3",
"output": "4"
},
{
"input": "3\n1 1\n1 2 2",
"output": "3"
}
] | 1,513,782,184
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 50
| 92
| 7,168,000
|
n=int(input())
m=[]
p=list(map(int,input().split()))
c=[0]+list(map(int,input().split()))
m=[1]+[list() for i in range(n)]
for i in range(n-1):
m[p[i]].append(i+2)
stack=[[1,c[1]]]
k=1
while stack:
x,col=stack.pop(0)
for i in m[x]:
if c[i]!=col:
k+=1
stack.append([i,c[i]])
print(k)
|
Title: Coloring a Tree
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a rooted tree with *n* vertices. The vertices are numbered from 1 to *n*, the root is the vertex number 1.
Each vertex has a color, let's denote the color of vertex *v* by *c**v*. Initially *c**v*<==<=0.
You have to color the tree into the given colors using the smallest possible number of steps. On each step you can choose a vertex *v* and a color *x*, and then color all vectices in the subtree of *v* (including *v* itself) in color *x*. In other words, for every vertex *u*, such that the path from root to *u* passes through *v*, set *c**u*<==<=*x*.
It is guaranteed that you have to color each vertex in a color different from 0.
You can learn what a rooted tree is using the link: [https://en.wikipedia.org/wiki/Tree_(graph_theory)](https://en.wikipedia.org/wiki/Tree_(graph_theory)).
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=104) — the number of vertices in the tree.
The second line contains *n*<=-<=1 integers *p*2,<=*p*3,<=...,<=*p**n* (1<=≤<=*p**i*<=<<=*i*), where *p**i* means that there is an edge between vertices *i* and *p**i*.
The third line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=*n*), where *c**i* is the color you should color the *i*-th vertex into.
It is guaranteed that the given graph is a tree.
Output Specification:
Print a single integer — the minimum number of steps you have to perform to color the tree into given colors.
Demo Input:
['6\n1 2 2 1 5\n2 1 1 1 1 1\n', '7\n1 1 2 3 1 4\n3 3 1 1 1 2 3\n']
Demo Output:
['3\n', '5\n']
Note:
The tree from the first sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/10324ccdc37f95343acc4f3c6050d8c334334ffa.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 2 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/1c7bb267e2c1a006132248a43121400189309e2f.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On seond step we color all vertices in the subtree of vertex 5 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/2201a6d49b89ba850ff0d0bdcbb3f8e9dd3871a8.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 2 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/6fa977fcdebdde94c47695151e0427b33d0102c5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
The tree from the second sample is shown on the picture (numbers are vetices' indices):
<img class="tex-graphics" src="https://espresso.codeforces.com/d70f9ae72a2ed429dd6531cac757e375dd3c953d.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On first step we color all vertices in the subtree of vertex 1 into color 3 (numbers are colors):
<img class="tex-graphics" src="https://espresso.codeforces.com/7289e8895d0dd56c47b6b17969b9cf77b36786b5.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On second step we color all vertices in the subtree of vertex 3 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/819001df7229138db3a407713744d1e3be88b64e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On third step we color all vertices in the subtree of vertex 6 into color 2:
<img class="tex-graphics" src="https://espresso.codeforces.com/80ebbd870a0a339636a21b9acdaf9de046458b43.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fourth step we color all vertices in the subtree of vertex 4 into color 1:
<img class="tex-graphics" src="https://espresso.codeforces.com/ed836aa723ac0176abde4e32988e3ac205014e93.png" style="max-width: 100.0%;max-height: 100.0%;"/>
On fith step we color all vertices in the subtree of vertex 7 into color 3:
<img class="tex-graphics" src="https://espresso.codeforces.com/8132909e11b41c27b8df2f0b0c10bc841f35e58a.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
n=int(input())
m=[]
p=list(map(int,input().split()))
c=[0]+list(map(int,input().split()))
m=[1]+[list() for i in range(n)]
for i in range(n-1):
m[p[i]].append(i+2)
stack=[[1,c[1]]]
k=1
while stack:
x,col=stack.pop(0)
for i in m[x]:
if c[i]!=col:
k+=1
stack.append([i,c[i]])
print(k)
```
| 3
|
|
225
|
B
|
Well-known Numbers
|
PROGRAMMING
| 1,600
|
[
"binary search",
"greedy",
"number theory"
] | null | null |
Numbers *k*-bonacci (*k* is integer, *k*<=><=1) are a generalization of Fibonacci numbers and are determined as follows:
- *F*(*k*,<=*n*)<==<=0, for integer *n*, 1<=≤<=*n*<=<<=*k*; - *F*(*k*,<=*k*)<==<=1; - *F*(*k*,<=*n*)<==<=*F*(*k*,<=*n*<=-<=1)<=+<=*F*(*k*,<=*n*<=-<=2)<=+<=...<=+<=*F*(*k*,<=*n*<=-<=*k*), for integer *n*, *n*<=><=*k*.
Note that we determine the *k*-bonacci numbers, *F*(*k*,<=*n*), only for integer values of *n* and *k*.
You've got a number *s*, represent it as a sum of several (at least two) distinct *k*-bonacci numbers.
|
The first line contains two integers *s* and *k* (1<=≤<=*s*,<=*k*<=≤<=109; *k*<=><=1).
|
In the first line print an integer *m* (*m*<=≥<=2) that shows how many numbers are in the found representation. In the second line print *m* distinct integers *a*1,<=*a*2,<=...,<=*a**m*. Each printed integer should be a *k*-bonacci number. The sum of printed integers must equal *s*.
It is guaranteed that the answer exists. If there are several possible answers, print any of them.
|
[
"5 2\n",
"21 5\n"
] |
[
"3\n0 2 3\n",
"3\n4 1 16\n"
] |
none
| 1,000
|
[
{
"input": "5 2",
"output": "3\n0 2 3"
},
{
"input": "21 5",
"output": "3\n4 1 16"
},
{
"input": "1 1000",
"output": "2\n1 0 "
},
{
"input": "1000000000 1000000000",
"output": "14\n536870912 268435456 134217728 33554432 16777216 8388608 1048576 524288 131072 32768 16384 2048 512 0 "
},
{
"input": "122 7",
"output": "6\n64 32 16 8 2 0 "
},
{
"input": "4 3",
"output": "2\n4 0 "
},
{
"input": "321123 3211232",
"output": "11\n262144 32768 16384 8192 1024 512 64 32 2 1 0 "
},
{
"input": "1 2",
"output": "2\n1 0 "
},
{
"input": "2 2",
"output": "2\n2 0 "
},
{
"input": "3 2",
"output": "2\n3 0 "
},
{
"input": "8 2",
"output": "2\n8 0 "
},
{
"input": "17 2",
"output": "4\n13 3 1 0 "
},
{
"input": "137 2",
"output": "5\n89 34 13 1 0 "
},
{
"input": "7298 2",
"output": "7\n6765 377 144 8 3 1 0 "
},
{
"input": "76754 2",
"output": "7\n75025 1597 89 34 8 1 0 "
},
{
"input": "12345678 2",
"output": "8\n9227465 2178309 832040 75025 28657 4181 1 0 "
},
{
"input": "987654321 2",
"output": "16\n701408733 267914296 14930352 2178309 832040 317811 46368 17711 6765 1597 233 89 13 3 1 0 "
},
{
"input": "1000000000 2",
"output": "15\n701408733 267914296 24157817 5702887 514229 196418 75025 28657 1597 233 89 13 5 1 0 "
},
{
"input": "701408733 2",
"output": "2\n701408733 0 "
},
{
"input": "1 3",
"output": "2\n1 0 "
},
{
"input": "2 3",
"output": "2\n2 0 "
},
{
"input": "3 3",
"output": "3\n2 1 0 "
},
{
"input": "100 3",
"output": "5\n81 13 4 2 0 "
},
{
"input": "87783 3",
"output": "8\n66012 19513 1705 504 44 4 1 0 "
},
{
"input": "615693473 3",
"output": "23\n334745777 181997601 53798080 29249425 8646064 4700770 1389537 755476 223317 121415 35890 19513 5768 3136 927 504 149 81 24 13 4 2 0 "
},
{
"input": "615693474 3",
"output": "2\n615693474 0 "
},
{
"input": "1000000000 3",
"output": "15\n615693474 334745777 29249425 15902591 2555757 1389537 410744 35890 10609 5768 274 149 4 1 0 "
},
{
"input": "1 4",
"output": "2\n1 0 "
},
{
"input": "2 4",
"output": "2\n2 0 "
},
{
"input": "17 4",
"output": "3\n15 2 0 "
},
{
"input": "234 4",
"output": "6\n208 15 8 2 1 0 "
},
{
"input": "23435345 4",
"output": "13\n14564533 7555935 1055026 147312 76424 20569 10671 2872 1490 401 108 4 0 "
},
{
"input": "989464701 4",
"output": "18\n747044834 201061985 28074040 7555935 3919944 1055026 547337 147312 39648 10671 5536 1490 773 108 56 4 2 0 "
},
{
"input": "464 5",
"output": "2\n464 0 "
},
{
"input": "7647474 5",
"output": "8\n5976577 1546352 103519 13624 6930 464 8 0 "
},
{
"input": "457787655 5",
"output": "14\n345052351 89277256 23099186 203513 103519 26784 13624 6930 3525 912 31 16 8 0 "
},
{
"input": "764747 6",
"output": "13\n463968 233904 59448 3840 1936 976 492 125 32 16 8 2 0 "
},
{
"input": "980765665 7",
"output": "16\n971364608 7805695 987568 495776 62725 31489 15808 1004 504 253 127 64 32 8 4 0 "
},
{
"input": "877655444 8",
"output": "17\n512966536 256993248 64504063 32316160 8111200 2035872 510994 128257 64256 16128 8080 509 128 8 4 1 0 "
},
{
"input": "567886500 9",
"output": "11\n525375999 32965728 8257696 1035269 129792 64960 32512 16272 8144 128 0 "
},
{
"input": "656777660 10",
"output": "13\n531372800 66519472 33276064 16646200 8327186 521472 65280 32656 16336 128 64 2 0 "
},
{
"input": "197445609 11",
"output": "18\n133628064 33423378 16715781 8359937 4180992 1045760 65424 16364 8184 1024 512 128 32 16 8 4 1 0 "
},
{
"input": "647474474 12",
"output": "18\n535625888 66977797 33492993 8375296 2094336 523712 261888 65488 32748 16376 4095 2048 1024 512 256 16 1 0 "
},
{
"input": "856644446 14",
"output": "16\n536592385 268304384 33541120 16771072 1048320 262096 65528 32765 16383 8192 2048 128 16 8 1 0 "
},
{
"input": "980345678 19",
"output": "18\n536864768 268432640 134216448 33554176 4194284 2097144 524287 262144 131072 65536 2048 1024 64 32 8 2 1 0 "
},
{
"input": "561854567 23",
"output": "17\n536870656 16777213 4194304 2097152 1048576 524288 262144 65536 8192 4096 2048 256 64 32 8 2 0 "
},
{
"input": "987654321 27",
"output": "20\n536870904 268435453 134217727 33554432 8388608 4194304 1048576 524288 262144 131072 16384 8192 2048 128 32 16 8 4 1 0 "
},
{
"input": "780787655 29",
"output": "18\n536870911 134217728 67108864 33554432 8388608 524288 65536 32768 16384 4096 2048 1024 512 256 128 64 8 0 "
},
{
"input": "999999999 30",
"output": "22\n536870912 268435456 134217728 33554432 16777216 8388608 1048576 524288 131072 32768 16384 2048 256 128 64 32 16 8 4 2 1 0 "
},
{
"input": "1 50",
"output": "2\n1 0 "
},
{
"input": "5 54",
"output": "3\n4 1 0 "
},
{
"input": "378 83",
"output": "7\n256 64 32 16 8 2 0 "
},
{
"input": "283847 111",
"output": "10\n262144 16384 4096 1024 128 64 4 2 1 0 "
},
{
"input": "38746466 2847",
"output": "14\n33554432 4194304 524288 262144 131072 65536 8192 4096 2048 256 64 32 2 0 "
},
{
"input": "83768466 12345",
"output": "15\n67108864 8388608 4194304 2097152 1048576 524288 262144 131072 8192 4096 1024 128 16 2 0 "
},
{
"input": "987654321 7475657",
"output": "18\n536870912 268435456 134217728 33554432 8388608 4194304 1048576 524288 262144 131072 16384 8192 2048 128 32 16 1 0 "
},
{
"input": "10 174764570",
"output": "3\n8 2 0 "
},
{
"input": "967755664 974301345",
"output": "17\n536870912 268435456 134217728 16777216 8388608 2097152 524288 262144 131072 32768 16384 1024 512 256 128 16 0 "
},
{
"input": "76 758866446",
"output": "4\n64 8 4 0 "
},
{
"input": "1 1000000000",
"output": "2\n1 0 "
},
{
"input": "469766205 719342208",
"output": "10\n268435456 134217728 67108864 4096 32 16 8 4 1 0 "
},
{
"input": "918938066 77",
"output": "17\n536870912 268435456 67108864 33554432 8388608 4194304 262144 65536 32768 16384 8192 256 128 64 16 2 0 "
},
{
"input": "856089381 19",
"output": "15\n536864768 268432640 33554176 16777104 262144 131072 65536 1024 512 256 128 16 4 1 0 "
},
{
"input": "152235195 16",
"output": "16\n134204416 16775936 1048528 131069 65535 8192 1024 256 128 64 32 8 4 2 1 0 "
},
{
"input": "429960894 3101",
"output": "17\n268435456 134217728 16777216 8388608 2097152 32768 8192 2048 1024 512 128 32 16 8 4 2 0 "
},
{
"input": "450695564 7",
"output": "18\n244804400 122895984 61695880 15548665 3918592 987568 495776 248888 62725 31489 3984 1004 504 64 32 8 1 0 "
},
{
"input": "154517270 24",
"output": "18\n134217708 16777215 2097152 1048576 262144 65536 32768 8192 4096 2048 1024 512 256 32 8 2 1 0 "
},
{
"input": "300919980 24",
"output": "20\n268435408 16777215 8388608 4194304 2097152 524288 262144 131072 65536 32768 8192 2048 1024 128 64 16 8 4 1 0 "
},
{
"input": "900077555 2",
"output": "16\n701408733 165580141 24157817 5702887 2178309 832040 196418 17711 2584 610 233 55 13 3 1 0 "
},
{
"input": "172285923 26",
"output": "17\n134217725 33554432 4194304 262144 32768 16384 4096 2048 1024 512 256 128 64 32 4 2 0 "
}
] | 1,596,957,948
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 3
| 2,000
| 33,996,800
|
def arr(s,k):
x=[]
n=0
while(F(k,n)<=s):
x.append(F(k,n))
n+=1
return x
def F(k,n):
if n<k:
return 0
elif n==k:
return 1
else:
return g(k,n)
def g(k,n):
sumi=0
for z in range(1,k+1):
sumi+=F(k,n-z)
return sumi
s,k=list(map(int,input().split()))
x=arr(s,k)
x=list(set(x))
x.sort()
ans=[]
for z1 in reversed(range(len(x))):
if x[z1]<=s:
s-=x[z1]
x[z1]=str(x[z1])
ans.append(x[z1])
print(len(ans))
x=" ".join(ans)
print(x)
|
Title: Well-known Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Numbers *k*-bonacci (*k* is integer, *k*<=><=1) are a generalization of Fibonacci numbers and are determined as follows:
- *F*(*k*,<=*n*)<==<=0, for integer *n*, 1<=≤<=*n*<=<<=*k*; - *F*(*k*,<=*k*)<==<=1; - *F*(*k*,<=*n*)<==<=*F*(*k*,<=*n*<=-<=1)<=+<=*F*(*k*,<=*n*<=-<=2)<=+<=...<=+<=*F*(*k*,<=*n*<=-<=*k*), for integer *n*, *n*<=><=*k*.
Note that we determine the *k*-bonacci numbers, *F*(*k*,<=*n*), only for integer values of *n* and *k*.
You've got a number *s*, represent it as a sum of several (at least two) distinct *k*-bonacci numbers.
Input Specification:
The first line contains two integers *s* and *k* (1<=≤<=*s*,<=*k*<=≤<=109; *k*<=><=1).
Output Specification:
In the first line print an integer *m* (*m*<=≥<=2) that shows how many numbers are in the found representation. In the second line print *m* distinct integers *a*1,<=*a*2,<=...,<=*a**m*. Each printed integer should be a *k*-bonacci number. The sum of printed integers must equal *s*.
It is guaranteed that the answer exists. If there are several possible answers, print any of them.
Demo Input:
['5 2\n', '21 5\n']
Demo Output:
['3\n0 2 3\n', '3\n4 1 16\n']
Note:
none
|
```python
def arr(s,k):
x=[]
n=0
while(F(k,n)<=s):
x.append(F(k,n))
n+=1
return x
def F(k,n):
if n<k:
return 0
elif n==k:
return 1
else:
return g(k,n)
def g(k,n):
sumi=0
for z in range(1,k+1):
sumi+=F(k,n-z)
return sumi
s,k=list(map(int,input().split()))
x=arr(s,k)
x=list(set(x))
x.sort()
ans=[]
for z1 in reversed(range(len(x))):
if x[z1]<=s:
s-=x[z1]
x[z1]=str(x[z1])
ans.append(x[z1])
print(len(ans))
x=" ".join(ans)
print(x)
```
| 0
|
|
989
|
A
|
A Blend of Springtime
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] | null | null |
"What a pity it's already late spring," sighs Mino with regret, "one more drizzling night and they'd be gone."
"But these blends are at their best, aren't they?" Absorbed in the landscape, Kanno remains optimistic.
The landscape can be expressed as a row of consecutive cells, each of which either contains a flower of colour amber or buff or canary yellow, or is empty.
When a flower withers, it disappears from the cell that it originally belonged to, and it spreads petals of its colour in its two neighbouring cells (or outside the field if the cell is on the side of the landscape). In case petals fall outside the given cells, they simply become invisible.
You are to help Kanno determine whether it's possible that after some (possibly none or all) flowers shed their petals, at least one of the cells contains all three colours, considering both petals and flowers. Note that flowers can wither in arbitrary order.
|
The first and only line of input contains a non-empty string $s$ consisting of uppercase English letters 'A', 'B', 'C' and characters '.' (dots) only ($\lvert s \rvert \leq 100$) — denoting cells containing an amber flower, a buff one, a canary yellow one, and no flowers, respectively.
|
Output "Yes" if it's possible that all three colours appear in some cell, and "No" otherwise.
You can print each letter in any case (upper or lower).
|
[
".BAC.\n",
"AA..CB\n"
] |
[
"Yes\n",
"No\n"
] |
In the first example, the buff and canary yellow flowers can leave their petals in the central cell, blending all three colours in it.
In the second example, it's impossible to satisfy the requirement because there is no way that amber and buff meet in any cell.
| 500
|
[
{
"input": ".BAC.",
"output": "Yes"
},
{
"input": "AA..CB",
"output": "No"
},
{
"input": ".",
"output": "No"
},
{
"input": "ACB.AAAAAA",
"output": "Yes"
},
{
"input": "B.BC.BBBCA",
"output": "Yes"
},
{
"input": "BA..CAB..B",
"output": "Yes"
},
{
"input": "CACCBAA.BC",
"output": "Yes"
},
{
"input": ".CAACCBBA.CBB.AC..BABCCBCCB..B.BC..CBC.CA.CC.C.CC.B.A.CC.BBCCBB..ACAACAC.CBCCB.AABAAC.CBCC.BA..CCBC.",
"output": "Yes"
},
{
"input": "A",
"output": "No"
},
{
"input": "..",
"output": "No"
},
{
"input": "BC",
"output": "No"
},
{
"input": "CAB",
"output": "Yes"
},
{
"input": "A.CB",
"output": "No"
},
{
"input": "B.ACAA.CA..CBCBBAA.B.CCBCB.CAC.ABC...BC.BCCC.BC.CB",
"output": "Yes"
},
{
"input": "B.B...CC.B..CCCB.CB..CBCB..CBCC.CCBC.B.CB..CA.C.C.",
"output": "No"
},
{
"input": "AA.CBAABABCCC..B..B.ABBABAB.B.B.CCA..CB.B...A..CBC",
"output": "Yes"
},
{
"input": "CA.ABB.CC.B.C.BBBABAAB.BBBAACACAAA.C.AACA.AAC.C.BCCB.CCBC.C..CCACA.CBCCB.CCAABAAB.AACAA..A.AAA.",
"output": "No"
},
{
"input": "CBC...AC.BBBB.BBABABA.CAAACC.AAABB..A.BA..BC.CBBBC.BBBBCCCAA.ACCBB.AB.C.BA..CC..AAAC...AB.A.AAABBA.A",
"output": "No"
},
{
"input": "CC.AAAC.BA.BBB.AABABBCCAA.A.CBCCB.B.BC.ABCBCBBAA.CACA.CCCA.CB.CCB.A.BCCCB...C.A.BCCBC..B.ABABB.C.BCB",
"output": "Yes"
},
{
"input": "CCC..A..CACACCA.CA.ABAAB.BBA..C.AAA...ACB.ACA.CA.B.AB.A..C.BC.BC.A.C....ABBCCACCCBCC.BBBAA.ACCACB.BB",
"output": "Yes"
},
{
"input": "BC.ABACAACC..AC.A..CCCAABBCCACAC.AA.CC.BAABABABBCBB.BA..C.C.C.A.BBA.C..BC.ACACCC.AAAACCCCC.AAC.AC.AB",
"output": "Yes"
},
{
"input": "ACAC.BAA.C..CAAC..ABBAACC..BAA...CC...ACCBBCA.BAABABAACCAC.A.BBCACCC..BCB.BABAAAACCBCB.BCAABBC.C.BBB",
"output": "Yes"
},
{
"input": "CCAC.BCBC.A.ABBAB.C.C.BC.CCABBCBCCBC..B.AA.C.BC...B..BAA.ACCCCBBB.AAAACA.CAACCB.CCB.CC.BCCAB.BBBBABB",
"output": "Yes"
},
{
"input": ".AACAA.AAAAC.BBBB.BC...CCACCACAAA.A..CCA..BCC.AB.ABAAB..AABA...B.C.CBAB.BAAB.A.C.AAC.BBBA.ACAAA.BB.C",
"output": "Yes"
},
{
"input": "CC.ACCC.BCCCCAA.BBAACB.ABABAAAA.A.CBAB.CBACBBC..C.CA.AAA..AA..ABBB.A.C..CBBCAAACC.B..CC.AC..CAABACB.",
"output": "Yes"
},
{
"input": ".BAB.",
"output": "No"
},
{
"input": "BBBBBBBBB",
"output": "No"
},
{
"input": "..AAC..",
"output": "No"
},
{
"input": ".AAABBBCCC.",
"output": "No"
},
{
"input": "AAABC",
"output": "Yes"
},
{
"input": "BBB",
"output": "No"
},
{
"input": "AAAAABABAAAAA",
"output": "No"
},
{
"input": "AABBCC",
"output": "No"
},
{
"input": ".BA",
"output": "No"
},
{
"input": "CAAAAB",
"output": "No"
}
] | 1,600,165,723
| 523
|
Python 3
|
OK
|
TESTS
| 37
| 187
| 1,638,400
|
from collections import Counter
import string
import math
import sys
def array_int():
return [int(i) for i in sys.stdin.readline().split()]
def vary(number_of_variables):
if number_of_variables==1:
return int(sys.stdin.readline())
if number_of_variables>=2:
return map(int,sys.stdin.readline().split())
def makedict(var):
return dict(Counter(var))
from fractions import Fraction
mod=100000007
if 1:
s=input()
h=s.find('ACB')
k=s.find('ABC')
t=s.find('BCA')
u=s.find('CAB')
v=s.find('CBA')
w=s.find('BAC')
if k+t+v+u+h+w==-6:
print('No')
else:
print('Yes')
|
Title: A Blend of Springtime
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"What a pity it's already late spring," sighs Mino with regret, "one more drizzling night and they'd be gone."
"But these blends are at their best, aren't they?" Absorbed in the landscape, Kanno remains optimistic.
The landscape can be expressed as a row of consecutive cells, each of which either contains a flower of colour amber or buff or canary yellow, or is empty.
When a flower withers, it disappears from the cell that it originally belonged to, and it spreads petals of its colour in its two neighbouring cells (or outside the field if the cell is on the side of the landscape). In case petals fall outside the given cells, they simply become invisible.
You are to help Kanno determine whether it's possible that after some (possibly none or all) flowers shed their petals, at least one of the cells contains all three colours, considering both petals and flowers. Note that flowers can wither in arbitrary order.
Input Specification:
The first and only line of input contains a non-empty string $s$ consisting of uppercase English letters 'A', 'B', 'C' and characters '.' (dots) only ($\lvert s \rvert \leq 100$) — denoting cells containing an amber flower, a buff one, a canary yellow one, and no flowers, respectively.
Output Specification:
Output "Yes" if it's possible that all three colours appear in some cell, and "No" otherwise.
You can print each letter in any case (upper or lower).
Demo Input:
['.BAC.\n', 'AA..CB\n']
Demo Output:
['Yes\n', 'No\n']
Note:
In the first example, the buff and canary yellow flowers can leave their petals in the central cell, blending all three colours in it.
In the second example, it's impossible to satisfy the requirement because there is no way that amber and buff meet in any cell.
|
```python
from collections import Counter
import string
import math
import sys
def array_int():
return [int(i) for i in sys.stdin.readline().split()]
def vary(number_of_variables):
if number_of_variables==1:
return int(sys.stdin.readline())
if number_of_variables>=2:
return map(int,sys.stdin.readline().split())
def makedict(var):
return dict(Counter(var))
from fractions import Fraction
mod=100000007
if 1:
s=input()
h=s.find('ACB')
k=s.find('ABC')
t=s.find('BCA')
u=s.find('CAB')
v=s.find('CBA')
w=s.find('BAC')
if k+t+v+u+h+w==-6:
print('No')
else:
print('Yes')
```
| 3
|
|
527
|
B
|
Error Correct System
|
PROGRAMMING
| 1,500
|
[
"greedy"
] | null | null |
Ford Prefect got a job as a web developer for a small company that makes towels. His current work task is to create a search engine for the website of the company. During the development process, he needs to write a subroutine for comparing strings *S* and *T* of equal length to be "similar". After a brief search on the Internet, he learned about the Hamming distance between two strings *S* and *T* of the same length, which is defined as the number of positions in which *S* and *T* have different characters. For example, the Hamming distance between words "permanent" and "pergament" is two, as these words differ in the fourth and sixth letters.
Moreover, as he was searching for information, he also noticed that modern search engines have powerful mechanisms to correct errors in the request to improve the quality of search. Ford doesn't know much about human beings, so he assumed that the most common mistake in a request is swapping two arbitrary letters of the string (not necessarily adjacent). Now he wants to write a function that determines which two letters should be swapped in string *S*, so that the Hamming distance between a new string *S* and string *T* would be as small as possible, or otherwise, determine that such a replacement cannot reduce the distance between the strings.
Help him do this!
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the length of strings *S* and *T*.
The second line contains string *S*.
The third line contains string *T*.
Each of the lines only contains lowercase Latin letters.
|
In the first line, print number *x* — the minimum possible Hamming distance between strings *S* and *T* if you swap at most one pair of letters in *S*.
In the second line, either print the indexes *i* and *j* (1<=≤<=*i*,<=*j*<=≤<=*n*, *i*<=≠<=*j*), if reaching the minimum possible distance is possible by swapping letters on positions *i* and *j*, or print "-1 -1", if it is not necessary to swap characters.
If there are multiple possible answers, print any of them.
|
[
"9\npergament\npermanent\n",
"6\nwookie\ncookie\n",
"4\npetr\negor\n",
"6\ndouble\nbundle\n"
] |
[
"1\n4 6\n",
"1\n-1 -1\n",
"2\n1 2\n",
"2\n4 1\n"
] |
In the second test it is acceptable to print *i* = 2, *j* = 3.
| 1,000
|
[
{
"input": "9\npergament\npermanent",
"output": "1\n4 6"
},
{
"input": "6\nwookie\ncookie",
"output": "1\n-1 -1"
},
{
"input": "4\npetr\negor",
"output": "2\n1 2"
},
{
"input": "6\ndouble\nbundle",
"output": "2\n4 1"
},
{
"input": "1\na\na",
"output": "0\n-1 -1"
},
{
"input": "1\na\nb",
"output": "1\n-1 -1"
},
{
"input": "2\naa\naa",
"output": "0\n-1 -1"
},
{
"input": "2\nzz\nzz",
"output": "0\n-1 -1"
},
{
"input": "2\nzx\nzz",
"output": "1\n-1 -1"
},
{
"input": "2\nzz\nzx",
"output": "1\n-1 -1"
},
{
"input": "2\nxy\nzz",
"output": "2\n-1 -1"
},
{
"input": "2\nzz\nxy",
"output": "2\n-1 -1"
},
{
"input": "2\nzx\nxz",
"output": "0\n2 1"
},
{
"input": "2\nab\nbc",
"output": "1\n1 2"
},
{
"input": "2\nab\ncb",
"output": "1\n-1 -1"
},
{
"input": "2\nxx\nyy",
"output": "2\n-1 -1"
},
{
"input": "10\ncdcddbacdb\naababacabc",
"output": "8\n7 8"
},
{
"input": "2\nab\ncd",
"output": "2\n-1 -1"
},
{
"input": "2\naa\nab",
"output": "1\n-1 -1"
},
{
"input": "3\nabc\nbca",
"output": "2\n1 2"
},
{
"input": "3\nxyx\nyxy",
"output": "1\n3 2"
},
{
"input": "4\nabba\nbbaa",
"output": "0\n1 3"
},
{
"input": "4\nabba\nabca",
"output": "1\n-1 -1"
},
{
"input": "4\nabba\ncaba",
"output": "1\n2 1"
},
{
"input": "4\nyydd\ndxyz",
"output": "2\n3 1"
}
] | 1,426,701,726
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 31
| 0
|
def getInput() :
n = int(input())
recup1 = str(input())
recup2 = str(input())
mot1 = []
mot2 = []
for i in range(n) :
mot1.append(recup1[i])
mot2.append(recup2[i])
return n, mot1, mot2
def solve(n, mot1, mot2) :
hammingMinimum = 0
besti = -1
bestj = -1
delete = []
nbDelete = 0
for a in range(n) :
if mot1[a] != mot2[a] :
hammingMinimum += 1
else :
delete.append(a)
nbDelete += 1
for a in range(nbDelete) :
mot1.pop(delete[nbDelete-1-a])
mot2.pop(delete[nbDelete-1-a])
final = hammingMinimum
for i in range(n-nbDelete) :
for j in range(i+1, n-nbDelete) :
if mot2[i] != mot2[j] :
compteur = hammingMinimum
if mot1[i] == mot2[j] :
compteur -= 1
if mot1[j] == mot2[i] :
compteur -= 1
if mot1[i] == mot2[i] :
compteur += 1
if mot1[j] == mot2[j] :
compteur += 1
if compteur < final :
final = compteur
besti = i
bestj = j
print(final)
if besti == -1 :
print(str(-1) + " " + str(-1))
else :
print(str(besti+1) + " " + str(bestj+1))
(n, mot1, mot2) = getInput()
solve(n, mot1, mot2)
|
Title: Error Correct System
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ford Prefect got a job as a web developer for a small company that makes towels. His current work task is to create a search engine for the website of the company. During the development process, he needs to write a subroutine for comparing strings *S* and *T* of equal length to be "similar". After a brief search on the Internet, he learned about the Hamming distance between two strings *S* and *T* of the same length, which is defined as the number of positions in which *S* and *T* have different characters. For example, the Hamming distance between words "permanent" and "pergament" is two, as these words differ in the fourth and sixth letters.
Moreover, as he was searching for information, he also noticed that modern search engines have powerful mechanisms to correct errors in the request to improve the quality of search. Ford doesn't know much about human beings, so he assumed that the most common mistake in a request is swapping two arbitrary letters of the string (not necessarily adjacent). Now he wants to write a function that determines which two letters should be swapped in string *S*, so that the Hamming distance between a new string *S* and string *T* would be as small as possible, or otherwise, determine that such a replacement cannot reduce the distance between the strings.
Help him do this!
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the length of strings *S* and *T*.
The second line contains string *S*.
The third line contains string *T*.
Each of the lines only contains lowercase Latin letters.
Output Specification:
In the first line, print number *x* — the minimum possible Hamming distance between strings *S* and *T* if you swap at most one pair of letters in *S*.
In the second line, either print the indexes *i* and *j* (1<=≤<=*i*,<=*j*<=≤<=*n*, *i*<=≠<=*j*), if reaching the minimum possible distance is possible by swapping letters on positions *i* and *j*, or print "-1 -1", if it is not necessary to swap characters.
If there are multiple possible answers, print any of them.
Demo Input:
['9\npergament\npermanent\n', '6\nwookie\ncookie\n', '4\npetr\negor\n', '6\ndouble\nbundle\n']
Demo Output:
['1\n4 6\n', '1\n-1 -1\n', '2\n1 2\n', '2\n4 1\n']
Note:
In the second test it is acceptable to print *i* = 2, *j* = 3.
|
```python
def getInput() :
n = int(input())
recup1 = str(input())
recup2 = str(input())
mot1 = []
mot2 = []
for i in range(n) :
mot1.append(recup1[i])
mot2.append(recup2[i])
return n, mot1, mot2
def solve(n, mot1, mot2) :
hammingMinimum = 0
besti = -1
bestj = -1
delete = []
nbDelete = 0
for a in range(n) :
if mot1[a] != mot2[a] :
hammingMinimum += 1
else :
delete.append(a)
nbDelete += 1
for a in range(nbDelete) :
mot1.pop(delete[nbDelete-1-a])
mot2.pop(delete[nbDelete-1-a])
final = hammingMinimum
for i in range(n-nbDelete) :
for j in range(i+1, n-nbDelete) :
if mot2[i] != mot2[j] :
compteur = hammingMinimum
if mot1[i] == mot2[j] :
compteur -= 1
if mot1[j] == mot2[i] :
compteur -= 1
if mot1[i] == mot2[i] :
compteur += 1
if mot1[j] == mot2[j] :
compteur += 1
if compteur < final :
final = compteur
besti = i
bestj = j
print(final)
if besti == -1 :
print(str(-1) + " " + str(-1))
else :
print(str(besti+1) + " " + str(bestj+1))
(n, mot1, mot2) = getInput()
solve(n, mot1, mot2)
```
| 0
|
|
447
|
B
|
DZY Loves Strings
|
PROGRAMMING
| 1,000
|
[
"greedy",
"implementation"
] | null | null |
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
|
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
|
Print a single integer — the largest possible value of the resulting string DZY could get.
|
[
"abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n"
] |
[
"41\n"
] |
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
| 1,000
|
[
{
"input": "abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "41"
},
{
"input": "mmzhr\n3\n443 497 867 471 195 670 453 413 579 466 553 881 847 642 269 996 666 702 487 209 257 741 974 133 519 453",
"output": "29978"
},
{
"input": "ajeeseerqnpaujubmajpibxrccazaawetywxmifzehojf\n23\n359 813 772 413 733 654 33 87 890 433 395 311 801 852 376 148 914 420 636 695 583 733 664 394 407 314",
"output": "1762894"
},
{
"input": "uahngxejpomhbsebcxvelfsojbaouynnlsogjyvktpwwtcyddkcdqcqs\n34\n530 709 150 660 947 830 487 142 208 276 885 542 138 214 76 184 273 753 30 195 722 236 82 691 572 585",
"output": "2960349"
},
{
"input": "xnzeqmouqyzvblcidmhbkqmtusszuczadpooslqxegldanwopilmdwzbczvrwgnwaireykwpugvpnpafbxlyggkgawghysufuegvmzvpgcqyjkoadcreaguzepbendwnowsuekxxivkziibxvxfoilofxcgnxvfefyezfhevfvtetsuhwtyxdlkccdkvqjl\n282\n170 117 627 886 751 147 414 187 150 960 410 70 576 681 641 729 798 877 611 108 772 643 683 166 305 933",
"output": "99140444"
},
{
"input": "pplkqmluhfympkjfjnfdkwrkpumgdmbkfbbldpepicbbmdgafttpopzdxsevlqbtywzkoxyviglbbxsohycbdqksrhlumsldiwzjmednbkcjishkiekfrchzuztkcxnvuykhuenqojrmzaxlaoxnljnvqgnabtmcftisaazzgbmubmpsorygyusmeonrhrgphnfhlaxrvyhuxsnnezjxmdoklpquzpvjbxgbywppmegzxknhfzyygrmejleesoqfwheulmqhonqaukyuejtwxskjldplripyihbfpookxkuehiwqthbfafyrgmykuxglpplozycgydyecqkgfjljfqvigqhuxssqqtfanwszduwbsoytnrtgc\n464\n838 95 473 955 690 84 436 19 179 437 674 626 377 365 781 4 733 776 462 203 119 256 381 668 855 686",
"output": "301124161"
},
{
"input": "qkautnuilwlhjsldfcuwhiqtgtoihifszlyvfaygrnivzgvwthkrzzdtfjcirrjjlrmjtbjlzmjeqmuffsjorjyggzefwgvmblvotvzffnwjhqxorpowzdcnfksdibezdtfjjxfozaghieksbmowrbeehuxlesmvqjsphlvauxiijm\n98\n121 622 0 691 616 959 838 161 581 862 876 830 267 812 598 106 337 73 588 323 999 17 522 399 657 495",
"output": "30125295"
},
{
"input": "tghyxqfmhz\n8\n191 893 426 203 780 326 148 259 182 140 847 636 778 97 167 773 219 891 758 993 695 603 223 779 368 165",
"output": "136422"
},
{
"input": "nyawbfjxnxjiyhwkydaruozobpphgjqdpfdqzezcsoyvurnapu\n30\n65 682 543 533 990 148 815 821 315 916 632 771 332 513 472 864 12 73 548 687 660 572 507 192 226 348",
"output": "2578628"
},
{
"input": "pylrnkrbcjgoytvdnhmlvnkknijkdgdhworlvtwuonrkhrilkewcnofodaumgvnsisxooswgrgtvdeauyxhkipfoxrrtysuepjcf\n60\n894 206 704 179 272 337 413 828 119 182 330 46 440 102 250 191 242 539 678 783 843 431 612 567 33 338",
"output": "9168707"
},
{
"input": "vhjnkrxbyhjhnjrxvwxmhxwoxttbtqosfxtcuvhfjlkyfspeypthsdkkwnqdpxdlnxsgtzvkrgqosgfjrwetqbxgoarkjhrjbspzgblsapifltkfxbfdbxqwoohlgyzijmiwnpmveybyzvasoctxsmgjehpyysmqblwnmkappbecklqjfmxhlyceordroflnposohfplrvijxbwvqdtvzhobtrumiujnyrfbwthvciinuveoizkccelxtaveiiagryqnyvsgfnipnavrtmdqlcnldepocbpzmqnarkdvykds\n276\n364 244 798 82 582 9 309 950 286 547 892 371 569 159 705 975 740 845 655 179 130 993 255 552 882 657",
"output": "144901921"
},
{
"input": "gsaddmezrnttfalbwlqbnedumvikplfosw\n12\n290 850 872 361 483 895 152 118 974 619 701 154 899 285 328 712 669 984 407 340 851 775 324 892 554 860",
"output": "809931"
},
{
"input": "a\n0\n5 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "5"
},
{
"input": "lol\n3\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "21"
}
] | 1,560,759,927
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 24
| 124
| 0
|
# import sys
# sys.stdin=open("input.in",'r')
# sys.stdout=open("out.out",'w')
x=input()
n=int(input())
s=list(map(int,input().split()))
v=0
for i in range(len(x)):
m=ord(x[i])-97
v+=(i+1)*s[m]
s.sort()
i+=2
while n:
v+=i*s[-1]
n-=1
i+=1
print(v)
|
Title: DZY Loves Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
Input Specification:
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
Output Specification:
Print a single integer — the largest possible value of the resulting string DZY could get.
Demo Input:
['abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n']
Demo Output:
['41\n']
Note:
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
|
```python
# import sys
# sys.stdin=open("input.in",'r')
# sys.stdout=open("out.out",'w')
x=input()
n=int(input())
s=list(map(int,input().split()))
v=0
for i in range(len(x)):
m=ord(x[i])-97
v+=(i+1)*s[m]
s.sort()
i+=2
while n:
v+=i*s[-1]
n-=1
i+=1
print(v)
```
| 3
|
|
447
|
B
|
DZY Loves Strings
|
PROGRAMMING
| 1,000
|
[
"greedy",
"implementation"
] | null | null |
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
|
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
|
Print a single integer — the largest possible value of the resulting string DZY could get.
|
[
"abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n"
] |
[
"41\n"
] |
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
| 1,000
|
[
{
"input": "abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "41"
},
{
"input": "mmzhr\n3\n443 497 867 471 195 670 453 413 579 466 553 881 847 642 269 996 666 702 487 209 257 741 974 133 519 453",
"output": "29978"
},
{
"input": "ajeeseerqnpaujubmajpibxrccazaawetywxmifzehojf\n23\n359 813 772 413 733 654 33 87 890 433 395 311 801 852 376 148 914 420 636 695 583 733 664 394 407 314",
"output": "1762894"
},
{
"input": "uahngxejpomhbsebcxvelfsojbaouynnlsogjyvktpwwtcyddkcdqcqs\n34\n530 709 150 660 947 830 487 142 208 276 885 542 138 214 76 184 273 753 30 195 722 236 82 691 572 585",
"output": "2960349"
},
{
"input": "xnzeqmouqyzvblcidmhbkqmtusszuczadpooslqxegldanwopilmdwzbczvrwgnwaireykwpugvpnpafbxlyggkgawghysufuegvmzvpgcqyjkoadcreaguzepbendwnowsuekxxivkziibxvxfoilofxcgnxvfefyezfhevfvtetsuhwtyxdlkccdkvqjl\n282\n170 117 627 886 751 147 414 187 150 960 410 70 576 681 641 729 798 877 611 108 772 643 683 166 305 933",
"output": "99140444"
},
{
"input": "pplkqmluhfympkjfjnfdkwrkpumgdmbkfbbldpepicbbmdgafttpopzdxsevlqbtywzkoxyviglbbxsohycbdqksrhlumsldiwzjmednbkcjishkiekfrchzuztkcxnvuykhuenqojrmzaxlaoxnljnvqgnabtmcftisaazzgbmubmpsorygyusmeonrhrgphnfhlaxrvyhuxsnnezjxmdoklpquzpvjbxgbywppmegzxknhfzyygrmejleesoqfwheulmqhonqaukyuejtwxskjldplripyihbfpookxkuehiwqthbfafyrgmykuxglpplozycgydyecqkgfjljfqvigqhuxssqqtfanwszduwbsoytnrtgc\n464\n838 95 473 955 690 84 436 19 179 437 674 626 377 365 781 4 733 776 462 203 119 256 381 668 855 686",
"output": "301124161"
},
{
"input": "qkautnuilwlhjsldfcuwhiqtgtoihifszlyvfaygrnivzgvwthkrzzdtfjcirrjjlrmjtbjlzmjeqmuffsjorjyggzefwgvmblvotvzffnwjhqxorpowzdcnfksdibezdtfjjxfozaghieksbmowrbeehuxlesmvqjsphlvauxiijm\n98\n121 622 0 691 616 959 838 161 581 862 876 830 267 812 598 106 337 73 588 323 999 17 522 399 657 495",
"output": "30125295"
},
{
"input": "tghyxqfmhz\n8\n191 893 426 203 780 326 148 259 182 140 847 636 778 97 167 773 219 891 758 993 695 603 223 779 368 165",
"output": "136422"
},
{
"input": "nyawbfjxnxjiyhwkydaruozobpphgjqdpfdqzezcsoyvurnapu\n30\n65 682 543 533 990 148 815 821 315 916 632 771 332 513 472 864 12 73 548 687 660 572 507 192 226 348",
"output": "2578628"
},
{
"input": "pylrnkrbcjgoytvdnhmlvnkknijkdgdhworlvtwuonrkhrilkewcnofodaumgvnsisxooswgrgtvdeauyxhkipfoxrrtysuepjcf\n60\n894 206 704 179 272 337 413 828 119 182 330 46 440 102 250 191 242 539 678 783 843 431 612 567 33 338",
"output": "9168707"
},
{
"input": "vhjnkrxbyhjhnjrxvwxmhxwoxttbtqosfxtcuvhfjlkyfspeypthsdkkwnqdpxdlnxsgtzvkrgqosgfjrwetqbxgoarkjhrjbspzgblsapifltkfxbfdbxqwoohlgyzijmiwnpmveybyzvasoctxsmgjehpyysmqblwnmkappbecklqjfmxhlyceordroflnposohfplrvijxbwvqdtvzhobtrumiujnyrfbwthvciinuveoizkccelxtaveiiagryqnyvsgfnipnavrtmdqlcnldepocbpzmqnarkdvykds\n276\n364 244 798 82 582 9 309 950 286 547 892 371 569 159 705 975 740 845 655 179 130 993 255 552 882 657",
"output": "144901921"
},
{
"input": "gsaddmezrnttfalbwlqbnedumvikplfosw\n12\n290 850 872 361 483 895 152 118 974 619 701 154 899 285 328 712 669 984 407 340 851 775 324 892 554 860",
"output": "809931"
},
{
"input": "a\n0\n5 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "5"
},
{
"input": "lol\n3\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "21"
}
] | 1,586,428,738
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 93
| 307,200
|
import math
alph="abcdefghijklmnopqrstuvwxyz"
#-----------------------------------
s=str(input())
k=int(input())
w=list(map(int,input().split()))
a=[max(w)]*k
for i in range(len(s)):
a.append(w[alph.index(s[i])])
E=0;a.sort()
for i in range(len(s)+k):
E+=(i+1)*a[i]
print(E)
|
Title: DZY Loves Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
Input Specification:
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
Output Specification:
Print a single integer — the largest possible value of the resulting string DZY could get.
Demo Input:
['abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n']
Demo Output:
['41\n']
Note:
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
|
```python
import math
alph="abcdefghijklmnopqrstuvwxyz"
#-----------------------------------
s=str(input())
k=int(input())
w=list(map(int,input().split()))
a=[max(w)]*k
for i in range(len(s)):
a.append(w[alph.index(s[i])])
E=0;a.sort()
for i in range(len(s)+k):
E+=(i+1)*a[i]
print(E)
```
| 0
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,668,718,989
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 0
| 154
| 2,764,800
|
M=int(input())
N=int(input())
print((N*M)//2)
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
M=int(input())
N=int(input())
print((N*M)//2)
```
| -1
|
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.