contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
888
|
D
|
Almost Identity Permutations
|
PROGRAMMING
| 1,600
|
[
"combinatorics",
"dp",
"math"
] | null | null |
A permutation *p* of size *n* is an array such that every integer from 1 to *n* occurs exactly once in this array.
Let's call a permutation an almost identity permutation iff there exist at least *n*<=-<=*k* indices *i* (1<=≤<=*i*<=≤<=*n*) such that *p**i*<==<=*i*.
Your task is to count the number of almost identity permutations for given numbers *n* and *k*.
|
The first line contains two integers *n* and *k* (4<=≤<=*n*<=≤<=1000, 1<=≤<=*k*<=≤<=4).
|
Print the number of almost identity permutations for given *n* and *k*.
|
[
"4 1\n",
"4 2\n",
"5 3\n",
"5 4\n"
] |
[
"1\n",
"7\n",
"31\n",
"76\n"
] |
none
| 0
|
[
{
"input": "4 1",
"output": "1"
},
{
"input": "4 2",
"output": "7"
},
{
"input": "5 3",
"output": "31"
},
{
"input": "5 4",
"output": "76"
},
{
"input": "200 1",
"output": "1"
},
{
"input": "200 2",
"output": "19901"
},
{
"input": "200 3",
"output": "2646701"
},
{
"input": "200 4",
"output": "584811251"
},
{
"input": "400 1",
"output": "1"
},
{
"input": "400 2",
"output": "79801"
},
{
"input": "400 3",
"output": "21253401"
},
{
"input": "400 4",
"output": "9477912501"
},
{
"input": "600 1",
"output": "1"
},
{
"input": "600 2",
"output": "179701"
},
{
"input": "600 3",
"output": "71820101"
},
{
"input": "600 4",
"output": "48187303751"
},
{
"input": "800 1",
"output": "1"
},
{
"input": "800 2",
"output": "319601"
},
{
"input": "800 3",
"output": "170346801"
},
{
"input": "800 4",
"output": "152620985001"
},
{
"input": "1000 1",
"output": "1"
},
{
"input": "1000 2",
"output": "499501"
},
{
"input": "1000 3",
"output": "332833501"
},
{
"input": "1000 4",
"output": "373086956251"
},
{
"input": "4 4",
"output": "24"
}
] | 1,618,232,440
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 1
| 93
| 0
|
from sys import stdin,stdout
import math
nmbr = lambda: int(input())
lst = lambda:list(map(int,input().split()))
def ncr(n,r):
lim=min(r,n-r)
num,den=5,1
nn=dd=1
for i in range(lim):
nn*=num
dd*=den
num-=1
den+=1
return nn//dd
for _ in range(1):#nmbr():
n,k=lst()
dp=[0]*(1+n)
dp[1]=0
dp[2]=1
for i in range(3,n+1):
dp[i]=(i-1)*(dp[i-1]+dp[i-2])
sm=p=0
while p<=k:
sm+=ncr(n,p)*dp[p]
p+=1
print(sm+1)
|
Title: Almost Identity Permutations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A permutation *p* of size *n* is an array such that every integer from 1 to *n* occurs exactly once in this array.
Let's call a permutation an almost identity permutation iff there exist at least *n*<=-<=*k* indices *i* (1<=≤<=*i*<=≤<=*n*) such that *p**i*<==<=*i*.
Your task is to count the number of almost identity permutations for given numbers *n* and *k*.
Input Specification:
The first line contains two integers *n* and *k* (4<=≤<=*n*<=≤<=1000, 1<=≤<=*k*<=≤<=4).
Output Specification:
Print the number of almost identity permutations for given *n* and *k*.
Demo Input:
['4 1\n', '4 2\n', '5 3\n', '5 4\n']
Demo Output:
['1\n', '7\n', '31\n', '76\n']
Note:
none
|
```python
from sys import stdin,stdout
import math
nmbr = lambda: int(input())
lst = lambda:list(map(int,input().split()))
def ncr(n,r):
lim=min(r,n-r)
num,den=5,1
nn=dd=1
for i in range(lim):
nn*=num
dd*=den
num-=1
den+=1
return nn//dd
for _ in range(1):#nmbr():
n,k=lst()
dp=[0]*(1+n)
dp[1]=0
dp[2]=1
for i in range(3,n+1):
dp[i]=(i-1)*(dp[i-1]+dp[i-2])
sm=p=0
while p<=k:
sm+=ncr(n,p)*dp[p]
p+=1
print(sm+1)
```
| 0
|
|
96
|
A
|
Football
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] |
A. Football
|
2
|
256
|
Petya loves football very much. One day, as he was watching a football match, he was writing the players' current positions on a piece of paper. To simplify the situation he depicted it as a string consisting of zeroes and ones. A zero corresponds to players of one team; a one corresponds to players of another team. If there are at least 7 players of some team standing one after another, then the situation is considered dangerous. For example, the situation 00100110111111101 is dangerous and 11110111011101 is not. You are given the current situation. Determine whether it is dangerous or not.
|
The first input line contains a non-empty string consisting of characters "0" and "1", which represents players. The length of the string does not exceed 100 characters. There's at least one player from each team present on the field.
|
Print "YES" if the situation is dangerous. Otherwise, print "NO".
|
[
"001001\n",
"1000000001\n"
] |
[
"NO\n",
"YES\n"
] |
none
| 500
|
[
{
"input": "001001",
"output": "NO"
},
{
"input": "1000000001",
"output": "YES"
},
{
"input": "00100110111111101",
"output": "YES"
},
{
"input": "11110111111111111",
"output": "YES"
},
{
"input": "01",
"output": "NO"
},
{
"input": "10100101",
"output": "NO"
},
{
"input": "1010010100000000010",
"output": "YES"
},
{
"input": "101010101",
"output": "NO"
},
{
"input": "000000000100000000000110101100000",
"output": "YES"
},
{
"input": "100001000000110101100000",
"output": "NO"
},
{
"input": "100001000011010110000",
"output": "NO"
},
{
"input": "010",
"output": "NO"
},
{
"input": "10101011111111111111111111111100",
"output": "YES"
},
{
"input": "1001101100",
"output": "NO"
},
{
"input": "1001101010",
"output": "NO"
},
{
"input": "1111100111",
"output": "NO"
},
{
"input": "00110110001110001111",
"output": "NO"
},
{
"input": "11110001001111110001",
"output": "NO"
},
{
"input": "10001111001011111101",
"output": "NO"
},
{
"input": "10000010100000001000110001010100001001001010011",
"output": "YES"
},
{
"input": "01111011111010111100101100001011001010111110000010",
"output": "NO"
},
{
"input": "00100000100100101110011001011011101110110110010100",
"output": "NO"
},
{
"input": "10110100110001001011110101110010100010000000000100101010111110111110100011",
"output": "YES"
},
{
"input": "00011101010101111001011011001101101011111101000010100000111000011100101011",
"output": "NO"
},
{
"input": "01110000110100110101110100111000101101011101011110110100100111100001110111",
"output": "NO"
},
{
"input": "11110110011000100111100111101101011111110100010101011011111101110110110111",
"output": "YES"
},
{
"input": "100100010101110010001011001110100011100010011110100101100011010001001010001001101111001100",
"output": "NO"
},
{
"input": "111110010001011010010011111100110110001111000010100011011100111101111101110010101111011110000001010",
"output": "NO"
},
{
"input": "111110111100010100000100001010111011101011000111011011011010110010100010000101011111000011010011110",
"output": "NO"
},
{
"input": "1011110110111010110111111010010010100011111011110000011000110010011110111010110100011010100010111000",
"output": "NO"
},
{
"input": "0010100111100010110110000011100111110100111110001010000100111111111010111100101101010101001011010110",
"output": "YES"
},
{
"input": "1111010100010100101011101100101101110011000010100010000001111100010011100101010001101111000001011000",
"output": "NO"
},
{
"input": "0101100011001110001110100111100011010101011000000000110110010010111100101111010111100011101100100101",
"output": "YES"
},
{
"input": "0001101110011101110000000010011111101001101111100001001010110000110001100000010001111011011110001101",
"output": "YES"
},
{
"input": "1000010000100000100010000100001000010000100001000010000100001000010000100001000010000100001000010000",
"output": "NO"
},
{
"input": "1000000000100000000010000000001000000000100000000010000000001000000000100000000010000000001000000000",
"output": "YES"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "YES"
},
{
"input": "1111111111111111111111111111111111111111011111111111111111111111111111111111111111111111111111111111",
"output": "YES"
},
{
"input": "10100101000",
"output": "NO"
},
{
"input": "11110111011101",
"output": "NO"
},
{
"input": "10000000",
"output": "YES"
},
{
"input": "00000001",
"output": "YES"
},
{
"input": "01111111",
"output": "YES"
},
{
"input": "11111110",
"output": "YES"
}
] | 1,677,190,056
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 60
| 0
|
num=input()
list=[int(i) for i in num]
x=0
for i in range(len(list[:-1])):
if list[i]==list[i+1]:
x+=1
if x>=7:
q=True
else:
x=0
print("YES" if q else "NO")
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves football very much. One day, as he was watching a football match, he was writing the players' current positions on a piece of paper. To simplify the situation he depicted it as a string consisting of zeroes and ones. A zero corresponds to players of one team; a one corresponds to players of another team. If there are at least 7 players of some team standing one after another, then the situation is considered dangerous. For example, the situation 00100110111111101 is dangerous and 11110111011101 is not. You are given the current situation. Determine whether it is dangerous or not.
Input Specification:
The first input line contains a non-empty string consisting of characters "0" and "1", which represents players. The length of the string does not exceed 100 characters. There's at least one player from each team present on the field.
Output Specification:
Print "YES" if the situation is dangerous. Otherwise, print "NO".
Demo Input:
['001001\n', '1000000001\n']
Demo Output:
['NO\n', 'YES\n']
Note:
none
|
```python
num=input()
list=[int(i) for i in num]
x=0
for i in range(len(list[:-1])):
if list[i]==list[i+1]:
x+=1
if x>=7:
q=True
else:
x=0
print("YES" if q else "NO")
```
| -1
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,623,671,598
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 124
| 0
|
n = int(input())
sp = list(map(int, input().split()))
if (sp[0] % 2 + sp[1] % 2 + sp[2] % 2) <= 1:
ind = 0
else:
ind = -1
norm = sorted(sp, key=lambda x: x % 2 == 0)
print(sp.index(norm[ind]) + 1)
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
n = int(input())
sp = list(map(int, input().split()))
if (sp[0] % 2 + sp[1] % 2 + sp[2] % 2) <= 1:
ind = 0
else:
ind = -1
norm = sorted(sp, key=lambda x: x % 2 == 0)
print(sp.index(norm[ind]) + 1)
```
| 3.969
|
129
|
B
|
Students and Shoelaces
|
PROGRAMMING
| 1,200
|
[
"brute force",
"dfs and similar",
"graphs",
"implementation"
] | null | null |
Anna and Maria are in charge of the math club for junior students. When the club gathers together, the students behave badly. They've brought lots of shoe laces to the club and got tied with each other. Specifically, each string ties together two students. Besides, if two students are tied, then the lace connects the first student with the second one as well as the second student with the first one.
To restore order, Anna and Maria do the following. First, for each student Anna finds out what other students he is tied to. If a student is tied to exactly one other student, Anna reprimands him. Then Maria gathers in a single group all the students who have been just reprimanded. She kicks them out from the club. This group of students immediately leaves the club. These students takes with them the laces that used to tie them. Then again for every student Anna finds out how many other students he is tied to and so on. And they do so until Anna can reprimand at least one student.
Determine how many groups of students will be kicked out of the club.
|
The first line contains two integers *n* and *m* — the initial number of students and laces (). The students are numbered from 1 to *n*, and the laces are numbered from 1 to *m*. Next *m* lines each contain two integers *a* and *b* — the numbers of students tied by the *i*-th lace (1<=≤<=*a*,<=*b*<=≤<=*n*,<=*a*<=≠<=*b*). It is guaranteed that no two students are tied with more than one lace. No lace ties a student to himself.
|
Print the single number — the number of groups of students that will be kicked out from the club.
|
[
"3 3\n1 2\n2 3\n3 1\n",
"6 3\n1 2\n2 3\n3 4\n",
"6 5\n1 4\n2 4\n3 4\n5 4\n6 4\n"
] |
[
"0\n",
"2\n",
"1\n"
] |
In the first sample Anna and Maria won't kick out any group of students — in the initial position every student is tied to two other students and Anna won't be able to reprimand anyone.
In the second sample four students are tied in a chain and two more are running by themselves. First Anna and Maria kick out the two students from both ends of the chain (1 and 4), then — two other students from the chain (2 and 3). At that the students who are running by themselves will stay in the club.
In the third sample Anna and Maria will momentarily kick out all students except for the fourth one and the process stops at that point. The correct answer is one.
| 1,000
|
[
{
"input": "3 3\n1 2\n2 3\n3 1",
"output": "0"
},
{
"input": "6 3\n1 2\n2 3\n3 4",
"output": "2"
},
{
"input": "6 5\n1 4\n2 4\n3 4\n5 4\n6 4",
"output": "1"
},
{
"input": "100 0",
"output": "0"
},
{
"input": "5 5\n1 2\n2 3\n3 4\n4 5\n5 1",
"output": "0"
},
{
"input": "5 4\n1 4\n4 3\n4 5\n5 2",
"output": "2"
},
{
"input": "11 10\n1 2\n1 3\n3 4\n1 5\n5 6\n6 7\n1 8\n8 9\n9 10\n10 11",
"output": "4"
},
{
"input": "7 7\n1 2\n2 3\n3 1\n1 4\n4 5\n4 6\n4 7",
"output": "2"
},
{
"input": "12 49\n6 3\n12 9\n10 11\n3 5\n10 2\n6 9\n8 5\n6 12\n7 3\n3 12\n3 2\n5 6\n7 5\n9 2\n11 1\n7 6\n5 4\n8 7\n12 5\n5 11\n8 9\n10 3\n6 2\n10 4\n9 10\n9 11\n11 3\n5 9\n11 6\n10 8\n7 9\n10 7\n4 6\n3 8\n4 11\n12 2\n4 9\n2 11\n7 11\n1 5\n7 2\n8 1\n4 12\n9 1\n4 2\n8 2\n11 12\n3 1\n1 6",
"output": "0"
},
{
"input": "10 29\n4 5\n1 7\n4 2\n3 8\n7 6\n8 10\n10 6\n4 1\n10 1\n6 2\n7 4\n7 10\n2 7\n9 8\n5 10\n2 5\n8 5\n4 9\n2 8\n5 7\n4 8\n7 3\n6 5\n1 3\n1 9\n10 4\n10 9\n10 2\n2 3",
"output": "0"
},
{
"input": "9 33\n5 7\n5 9\n9 6\n9 1\n7 4\n3 5\n7 8\n8 6\n3 6\n8 2\n3 8\n1 6\n1 8\n1 4\n4 2\n1 2\n2 5\n3 4\n8 5\n2 6\n3 1\n1 5\n1 7\n3 2\n5 4\n9 4\n3 9\n7 3\n6 4\n9 8\n7 9\n8 4\n6 5",
"output": "0"
},
{
"input": "7 8\n5 7\n2 7\n1 6\n1 3\n3 7\n6 3\n6 4\n2 6",
"output": "1"
},
{
"input": "6 15\n3 1\n4 5\n1 4\n6 2\n3 5\n6 3\n1 6\n1 5\n2 3\n2 5\n6 4\n5 6\n4 2\n1 2\n3 4",
"output": "0"
},
{
"input": "7 11\n5 3\n6 5\n6 4\n1 6\n7 1\n2 6\n7 5\n2 5\n3 1\n3 4\n2 4",
"output": "0"
},
{
"input": "95 0",
"output": "0"
},
{
"input": "100 0",
"output": "0"
},
{
"input": "62 30\n29 51\n29 55\n4 12\n53 25\n36 28\n32 11\n29 11\n47 9\n21 8\n25 4\n51 19\n26 56\n22 21\n37 9\n9 33\n7 25\n16 7\n40 49\n15 21\n49 58\n34 30\n20 46\n62 48\n53 57\n33 6\n60 37\n41 34\n62 36\n36 43\n11 39",
"output": "2"
},
{
"input": "56 25\n12 40\n31 27\n18 40\n1 43\n9 10\n25 47\n27 29\n26 28\n19 38\n19 40\n22 14\n21 51\n29 31\n55 29\n51 33\n20 17\n24 15\n3 48\n31 56\n15 29\n49 42\n50 4\n22 42\n25 17\n18 51",
"output": "3"
},
{
"input": "51 29\n36 30\n37 45\n4 24\n40 18\n47 35\n15 1\n30 38\n15 18\n32 40\n34 42\n2 47\n35 21\n25 28\n13 1\n13 28\n36 1\n46 47\n22 17\n41 45\n43 45\n40 15\n29 35\n47 15\n30 21\n9 14\n18 38\n18 50\n42 10\n31 41",
"output": "3"
},
{
"input": "72 45\n5 15\n8 18\n40 25\n71 66\n67 22\n6 44\n16 25\n8 23\n19 70\n26 34\n48 15\n24 2\n54 68\n44 43\n17 37\n49 19\n71 49\n34 38\n59 1\n65 70\n11 54\n5 11\n15 31\n29 50\n48 16\n70 57\n25 59\n2 59\n56 12\n66 62\n24 16\n46 27\n45 67\n68 43\n31 11\n31 30\n8 44\n64 33\n38 44\n54 10\n13 9\n7 51\n25 4\n40 70\n26 65",
"output": "5"
},
{
"input": "56 22\n17 27\n48 49\n29 8\n47 20\n32 7\n44 5\n14 39\n5 13\n40 2\n50 42\n38 9\n18 37\n16 44\n21 32\n21 39\n37 54\n19 46\n30 47\n17 13\n30 31\n49 16\n56 7",
"output": "4"
},
{
"input": "81 46\n53 58\n31 14\n18 54\n43 61\n57 65\n6 38\n49 5\n6 40\n6 10\n17 72\n27 48\n58 39\n21 75\n21 43\n78 20\n34 4\n15 35\n74 48\n76 15\n49 38\n46 51\n78 9\n80 5\n26 42\n64 31\n46 72\n1 29\n20 17\n32 45\n53 43\n24 5\n52 59\n3 80\n78 19\n61 17\n80 12\n17 8\n63 2\n8 4\n44 10\n53 72\n18 60\n68 15\n17 58\n79 71\n73 35",
"output": "4"
},
{
"input": "82 46\n64 43\n32 24\n57 30\n24 46\n70 12\n23 41\n63 39\n46 70\n4 61\n19 12\n39 79\n14 28\n37 3\n12 27\n15 20\n35 39\n25 64\n59 16\n68 63\n37 14\n76 7\n67 29\n9 5\n14 55\n46 26\n71 79\n47 42\n5 55\n18 45\n28 40\n44 78\n74 9\n60 53\n44 19\n52 81\n65 52\n40 13\n40 19\n43 1\n24 23\n68 9\n16 20\n70 14\n41 40\n29 10\n45 65",
"output": "8"
},
{
"input": "69 38\n63 35\n52 17\n43 69\n2 57\n12 5\n26 36\n13 10\n16 68\n5 18\n5 41\n10 4\n60 9\n39 22\n39 28\n53 57\n13 52\n66 38\n49 61\n12 19\n27 46\n67 7\n25 8\n23 58\n52 34\n29 2\n2 42\n8 53\n57 43\n68 11\n48 28\n56 19\n46 33\n63 21\n57 16\n68 59\n67 34\n28 43\n56 36",
"output": "4"
},
{
"input": "75 31\n32 50\n52 8\n21 9\n68 35\n12 72\n47 26\n38 58\n40 55\n31 70\n53 75\n44 1\n65 22\n33 22\n33 29\n14 39\n1 63\n16 52\n70 15\n12 27\n63 31\n47 9\n71 31\n43 17\n43 49\n8 26\n11 39\n9 22\n30 45\n65 47\n32 9\n60 70",
"output": "4"
},
{
"input": "77 41\n48 45\n50 36\n6 69\n70 3\n22 21\n72 6\n54 3\n49 31\n2 23\n14 59\n68 58\n4 54\n60 12\n63 60\n44 24\n28 24\n40 8\n5 1\n13 24\n29 15\n19 76\n70 50\n65 71\n23 33\n58 16\n50 42\n71 28\n58 54\n24 73\n6 17\n29 13\n60 4\n42 4\n21 60\n77 39\n57 9\n51 19\n61 6\n49 36\n24 32\n41 66",
"output": "3"
},
{
"input": "72 39\n9 44\n15 12\n2 53\n34 18\n41 70\n54 72\n39 19\n26 7\n4 54\n53 59\n46 49\n70 6\n9 10\n64 51\n31 60\n61 53\n59 71\n9 60\n67 16\n4 16\n34 3\n2 61\n16 23\n34 6\n10 18\n13 38\n66 40\n59 9\n40 14\n38 24\n31 48\n7 69\n20 39\n49 52\n32 67\n61 35\n62 45\n37 54\n5 27",
"output": "8"
},
{
"input": "96 70\n30 37\n47 56\n19 79\n15 28\n2 43\n43 54\n59 75\n42 22\n38 18\n18 14\n47 41\n60 29\n35 11\n90 4\n14 41\n11 71\n41 24\n68 28\n45 92\n14 15\n34 63\n77 32\n67 38\n36 8\n37 4\n58 95\n68 84\n69 81\n35 23\n56 63\n78 91\n35 44\n66 63\n80 19\n87 88\n28 14\n62 35\n24 23\n83 37\n54 89\n14 40\n9 35\n94 9\n56 46\n92 70\n16 58\n96 31\n53 23\n56 5\n36 42\n89 77\n29 51\n26 13\n46 70\n25 56\n95 96\n3 51\n76 8\n36 82\n44 85\n54 56\n89 67\n32 5\n82 78\n33 65\n43 28\n35 1\n94 13\n26 24\n10 51",
"output": "4"
},
{
"input": "76 49\n15 59\n23 26\n57 48\n49 51\n42 76\n36 40\n37 40\n29 15\n28 71\n47 70\n27 39\n76 21\n55 16\n21 18\n19 1\n25 31\n51 71\n54 42\n28 9\n61 69\n33 9\n18 19\n58 51\n51 45\n29 34\n9 67\n26 8\n70 37\n11 62\n24 22\n59 76\n67 17\n59 11\n54 1\n12 57\n23 3\n46 47\n37 20\n65 9\n51 12\n31 19\n56 13\n58 22\n26 59\n39 76\n27 11\n48 64\n59 35\n44 75",
"output": "5"
},
{
"input": "52 26\n29 41\n16 26\n18 48\n31 17\n37 42\n26 1\n11 7\n29 6\n23 17\n12 47\n34 23\n41 16\n15 35\n25 21\n45 7\n52 2\n37 10\n28 19\n1 27\n30 47\n42 35\n50 30\n30 34\n19 30\n42 25\n47 31",
"output": "3"
},
{
"input": "86 48\n59 34\n21 33\n45 20\n62 23\n4 68\n2 65\n63 26\n64 20\n51 34\n64 21\n68 78\n61 80\n81 3\n38 39\n47 48\n24 34\n44 71\n72 78\n50 2\n13 51\n82 78\n11 74\n14 48\n2 75\n49 55\n63 85\n20 85\n4 53\n51 15\n11 67\n1 15\n2 64\n10 81\n6 7\n68 18\n84 28\n77 69\n10 36\n15 14\n32 86\n16 79\n26 13\n38 55\n47 43\n47 39\n45 37\n58 81\n42 35",
"output": "8"
},
{
"input": "58 29\n27 24\n40 52\n51 28\n44 50\n7 28\n14 53\n10 16\n16 45\n8 56\n35 26\n39 6\n6 14\n45 22\n35 13\n20 17\n42 6\n37 21\n4 11\n26 56\n54 55\n3 57\n40 3\n55 27\n4 51\n35 29\n50 16\n47 7\n48 20\n1 37",
"output": "3"
},
{
"input": "51 23\n46 47\n31 27\n1 20\n49 16\n2 10\n29 47\n13 27\n34 26\n31 2\n28 20\n17 40\n39 4\n29 26\n28 44\n3 39\n50 12\n19 1\n30 21\n41 23\n2 29\n16 3\n49 28\n49 41",
"output": "4"
},
{
"input": "75 43\n46 34\n33 12\n51 39\n47 74\n68 64\n40 46\n20 51\n47 19\n4 5\n57 59\n12 26\n68 65\n38 42\n73 37\n5 74\n36 61\n8 18\n58 33\n34 73\n42 43\n10 49\n70 50\n49 18\n24 53\n71 73\n44 24\n49 56\n24 29\n44 67\n70 46\n57 25\n73 63\n3 51\n30 71\n41 44\n17 69\n17 18\n19 68\n42 7\n11 51\n1 5\n72 23\n65 53",
"output": "5"
}
] | 1,692,294,623
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 70
| 312
| 3,481,600
|
n , m = [int(x) for x in input().split()]
students = [i for i in range(n)]
adj = [[] for i in range(n)]
for i in range(m):
s1 , s2 = [int(x) - 1 for x in input().split()]
adj[s1].append(s2)
adj[s2].append(s1)
def dfs(s):
global visited
global out
visited[s] = True
if len(adj[s]) == 1:
out.append(s)
for i in adj[s]:
if not visited:
dfs(i)
c = 0
for i in range(100):
visited = [False for i in range(n)]
out = []
for student in students:
if not visited[student]:
dfs(student)
if len(out) != 0 :
c += 1
for i in out:
students.remove(i)
for k in adj[i]:
adj[k].remove(i)
adj[i] = []
else:
break
print(c)
|
Title: Students and Shoelaces
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anna and Maria are in charge of the math club for junior students. When the club gathers together, the students behave badly. They've brought lots of shoe laces to the club and got tied with each other. Specifically, each string ties together two students. Besides, if two students are tied, then the lace connects the first student with the second one as well as the second student with the first one.
To restore order, Anna and Maria do the following. First, for each student Anna finds out what other students he is tied to. If a student is tied to exactly one other student, Anna reprimands him. Then Maria gathers in a single group all the students who have been just reprimanded. She kicks them out from the club. This group of students immediately leaves the club. These students takes with them the laces that used to tie them. Then again for every student Anna finds out how many other students he is tied to and so on. And they do so until Anna can reprimand at least one student.
Determine how many groups of students will be kicked out of the club.
Input Specification:
The first line contains two integers *n* and *m* — the initial number of students and laces (). The students are numbered from 1 to *n*, and the laces are numbered from 1 to *m*. Next *m* lines each contain two integers *a* and *b* — the numbers of students tied by the *i*-th lace (1<=≤<=*a*,<=*b*<=≤<=*n*,<=*a*<=≠<=*b*). It is guaranteed that no two students are tied with more than one lace. No lace ties a student to himself.
Output Specification:
Print the single number — the number of groups of students that will be kicked out from the club.
Demo Input:
['3 3\n1 2\n2 3\n3 1\n', '6 3\n1 2\n2 3\n3 4\n', '6 5\n1 4\n2 4\n3 4\n5 4\n6 4\n']
Demo Output:
['0\n', '2\n', '1\n']
Note:
In the first sample Anna and Maria won't kick out any group of students — in the initial position every student is tied to two other students and Anna won't be able to reprimand anyone.
In the second sample four students are tied in a chain and two more are running by themselves. First Anna and Maria kick out the two students from both ends of the chain (1 and 4), then — two other students from the chain (2 and 3). At that the students who are running by themselves will stay in the club.
In the third sample Anna and Maria will momentarily kick out all students except for the fourth one and the process stops at that point. The correct answer is one.
|
```python
n , m = [int(x) for x in input().split()]
students = [i for i in range(n)]
adj = [[] for i in range(n)]
for i in range(m):
s1 , s2 = [int(x) - 1 for x in input().split()]
adj[s1].append(s2)
adj[s2].append(s1)
def dfs(s):
global visited
global out
visited[s] = True
if len(adj[s]) == 1:
out.append(s)
for i in adj[s]:
if not visited:
dfs(i)
c = 0
for i in range(100):
visited = [False for i in range(n)]
out = []
for student in students:
if not visited[student]:
dfs(student)
if len(out) != 0 :
c += 1
for i in out:
students.remove(i)
for k in adj[i]:
adj[k].remove(i)
adj[i] = []
else:
break
print(c)
```
| 3
|
|
455
|
A
|
Boredom
|
PROGRAMMING
| 1,500
|
[
"dp"
] | null | null |
Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it.
Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player.
Alex is a perfectionist, so he decided to get as many points as possible. Help him.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105).
|
Print a single integer — the maximum number of points that Alex can earn.
|
[
"2\n1 2\n",
"3\n1 2 3\n",
"9\n1 2 1 3 2 2 2 2 3\n"
] |
[
"2\n",
"4\n",
"10\n"
] |
Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points.
| 500
|
[
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n1 2 3",
"output": "4"
},
{
"input": "9\n1 2 1 3 2 2 2 2 3",
"output": "10"
},
{
"input": "5\n3 3 4 5 4",
"output": "11"
},
{
"input": "5\n5 3 5 3 4",
"output": "16"
},
{
"input": "5\n4 2 3 2 5",
"output": "9"
},
{
"input": "10\n10 5 8 9 5 6 8 7 2 8",
"output": "46"
},
{
"input": "10\n1 1 1 1 1 1 2 3 4 4",
"output": "14"
},
{
"input": "100\n6 6 8 9 7 9 6 9 5 7 7 4 5 3 9 1 10 3 4 5 8 9 6 5 6 4 10 9 1 4 1 7 1 4 9 10 8 2 9 9 10 5 8 9 5 6 8 7 2 8 7 6 2 6 10 8 6 2 5 5 3 2 8 8 5 3 6 2 1 4 7 2 7 3 7 4 10 10 7 5 4 7 5 10 7 1 1 10 7 7 7 2 3 4 2 8 4 7 4 4",
"output": "296"
},
{
"input": "100\n6 1 5 7 10 10 2 7 3 7 2 10 7 6 3 5 5 5 3 7 2 4 2 7 7 4 2 8 2 10 4 7 9 1 1 7 9 7 1 10 10 9 5 6 10 1 7 5 8 1 1 5 3 10 2 4 3 5 2 7 4 9 5 10 1 3 7 6 6 9 3 6 6 10 1 10 6 1 10 3 4 1 7 9 2 7 8 9 3 3 2 4 6 6 1 2 9 4 1 2",
"output": "313"
},
{
"input": "100\n7 6 3 8 8 3 10 5 3 8 6 4 6 9 6 7 3 9 10 7 5 5 9 10 7 2 3 8 9 5 4 7 9 3 6 4 9 10 7 6 8 7 6 6 10 3 7 4 5 7 7 5 1 5 4 8 7 3 3 4 7 8 5 9 2 2 3 1 6 4 6 6 6 1 7 10 7 4 5 3 9 2 4 1 5 10 9 3 9 6 8 5 2 1 10 4 8 5 10 9",
"output": "298"
},
{
"input": "100\n2 10 9 1 2 6 7 2 2 8 9 9 9 5 6 2 5 1 1 10 7 4 5 5 8 1 9 4 10 1 9 3 1 8 4 10 8 8 2 4 6 5 1 4 2 2 1 2 8 5 3 9 4 10 10 7 8 6 1 8 2 6 7 1 6 7 3 10 10 3 7 7 6 9 6 8 8 10 4 6 4 3 3 3 2 3 10 6 8 5 5 10 3 7 3 1 1 1 5 5",
"output": "312"
},
{
"input": "100\n4 9 7 10 4 7 2 6 1 9 1 8 7 5 5 7 6 7 9 8 10 5 3 5 7 10 3 2 1 3 8 9 4 10 4 7 6 4 9 6 7 1 9 4 3 5 8 9 2 7 10 5 7 5 3 8 10 3 8 9 3 4 3 10 6 5 1 8 3 2 5 8 4 7 5 3 3 2 6 9 9 8 2 7 6 3 2 2 8 8 4 5 6 9 2 3 2 2 5 2",
"output": "287"
},
{
"input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8",
"output": "380"
},
{
"input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8",
"output": "380"
},
{
"input": "100\n10 5 8 4 4 4 1 4 5 8 3 10 2 4 1 10 8 1 1 6 8 4 2 9 1 3 1 7 7 9 3 5 5 8 6 9 9 4 8 1 3 3 2 6 1 5 4 5 3 5 5 6 7 5 7 9 3 5 4 9 2 6 8 1 1 7 7 3 8 9 8 7 3 2 4 1 6 1 3 9 4 2 2 8 5 10 1 8 8 5 1 5 6 9 4 5 6 5 10 2",
"output": "265"
},
{
"input": "100\n7 5 1 8 5 6 6 2 6 2 7 7 3 6 2 4 4 2 10 2 2 2 10 6 6 1 5 10 9 1 5 9 8 9 4 1 10 5 7 5 7 6 4 8 8 1 7 8 3 8 2 1 8 4 10 3 5 6 6 10 9 6 5 1 10 7 6 9 9 2 10 10 9 1 2 1 7 7 4 10 1 10 5 5 3 8 9 8 1 4 10 2 4 5 4 4 1 6 2 9",
"output": "328"
},
{
"input": "100\n5 6 10 7 1 7 10 1 9 1 5 1 4 1 3 3 7 9 1 6 1 6 5 7 1 6 3 1 3 6 3 8 2 4 1 5 2 10 7 3 10 4 10 1 5 4 2 9 7 9 5 7 10 4 1 4 8 9 3 1 3 7 7 4 3 7 7 10 6 9 5 5 6 5 3 9 8 8 5 5 4 10 9 4 10 4 1 8 3 5 4 10 9 3 10 4 10 7 10 9",
"output": "324"
},
{
"input": "10\n7 4 5 3 9 1 10 3 4 5",
"output": "34"
},
{
"input": "10\n8 9 6 5 6 4 10 9 1 4",
"output": "39"
},
{
"input": "10\n1 7 1 4 9 10 8 2 9 9",
"output": "40"
},
{
"input": "1\n100000",
"output": "100000"
}
] | 1,668,951,890
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 186
| 7,065,600
|
input()
nums=[int(x) for x in input().split( )]
count=[0]+[0]*max(nums)
dp=[0]+[0]*max(nums)
for a in nums:
count[a]+=1
dp[1]=count[1]*1
for b in range(1,max(nums)+1):
dp[b]=max(dp[b-1],dp[b-2]+count[b]*b)
print(max(dp))
|
Title: Boredom
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it.
Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player.
Alex is a perfectionist, so he decided to get as many points as possible. Help him.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105).
Output Specification:
Print a single integer — the maximum number of points that Alex can earn.
Demo Input:
['2\n1 2\n', '3\n1 2 3\n', '9\n1 2 1 3 2 2 2 2 3\n']
Demo Output:
['2\n', '4\n', '10\n']
Note:
Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points.
|
```python
input()
nums=[int(x) for x in input().split( )]
count=[0]+[0]*max(nums)
dp=[0]+[0]*max(nums)
for a in nums:
count[a]+=1
dp[1]=count[1]*1
for b in range(1,max(nums)+1):
dp[b]=max(dp[b-1],dp[b-2]+count[b]*b)
print(max(dp))
```
| 3
|
|
895
|
C
|
Square Subsets
|
PROGRAMMING
| 2,000
|
[
"bitmasks",
"combinatorics",
"dp",
"math"
] | null | null |
Petya was late for the lesson too. The teacher gave him an additional task. For some array *a* Petya should find the number of different ways to select non-empty subset of elements from it in such a way that their product is equal to a square of some integer.
Two ways are considered different if sets of indexes of elements chosen by these ways are different.
Since the answer can be very large, you should find the answer modulo 109<=+<=7.
|
First line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the number of elements in the array.
Second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=70) — the elements of the array.
|
Print one integer — the number of different ways to choose some elements so that their product is a square of a certain integer modulo 109<=+<=7.
|
[
"4\n1 1 1 1\n",
"4\n2 2 2 2\n",
"5\n1 2 4 5 8\n"
] |
[
"15\n",
"7\n",
"7\n"
] |
In first sample product of elements chosen by any way is 1 and 1 = 1<sup class="upper-index">2</sup>. So the answer is 2<sup class="upper-index">4</sup> - 1 = 15.
In second sample there are six different ways to choose elements so that their product is 4, and only one way so that their product is 16. So the answer is 6 + 1 = 7.
| 1,750
|
[
{
"input": "4\n1 1 1 1",
"output": "15"
},
{
"input": "4\n2 2 2 2",
"output": "7"
},
{
"input": "5\n1 2 4 5 8",
"output": "7"
},
{
"input": "1\n64",
"output": "1"
},
{
"input": "5\n2 2 2 2 2",
"output": "15"
},
{
"input": "6\n1 2 3 4 5 6",
"output": "7"
},
{
"input": "2\n70 70",
"output": "1"
},
{
"input": "7\n4 9 16 25 36 49 64",
"output": "127"
},
{
"input": "13\n64 65 40 26 36 46 53 31 63 11 2 46 59",
"output": "15"
},
{
"input": "15\n66 34 43 45 61 14 12 67 38 25 55 9 30 41 16",
"output": "15"
},
{
"input": "17\n44 57 54 57 54 65 40 57 59 16 39 51 32 51 20 9 8",
"output": "511"
},
{
"input": "18\n22 41 40 8 36 48 23 5 58 12 26 44 53 49 3 56 58 57",
"output": "127"
},
{
"input": "20\n20 34 51 40 70 64 14 30 24 20 6 1 70 28 38 43 9 60 31 69",
"output": "2047"
},
{
"input": "5\n19 51 55 29 13",
"output": "0"
},
{
"input": "6\n19 60 48 64 56 27",
"output": "3"
},
{
"input": "7\n67 52 58 62 38 26 2",
"output": "1"
},
{
"input": "7\n5 28 46 57 39 26 45",
"output": "1"
},
{
"input": "7\n53 59 56 9 13 1 28",
"output": "3"
},
{
"input": "10\n38 58 51 41 61 12 17 47 18 24",
"output": "3"
},
{
"input": "10\n27 44 40 3 33 38 56 37 43 36",
"output": "7"
},
{
"input": "10\n51 4 25 46 15 21 32 9 43 8",
"output": "15"
},
{
"input": "10\n5 66 19 60 34 27 15 27 42 51",
"output": "7"
},
{
"input": "5\n2 3 5 7 11",
"output": "0"
},
{
"input": "10\n2 3 5 7 11 13 17 19 23 29",
"output": "0"
},
{
"input": "2\n15 45",
"output": "0"
}
] | 1,568,655,722
| 2,147,483,647
|
PyPy 3
|
MEMORY_LIMIT_EXCEEDED
|
TESTS
| 0
| 1,294
| 268,390,400
|
n = int(input())
arr = [ int(i) for i in input().split() ]
MOD = 10**9+7
num_ways = [ [1,0] for i in range(71) ]
primes = [2,3,5,7,11,13,17,19,23,29,31,37,41,43,47,53,59,61,67]
def get_mask(i):
new = 0
for ind,j in enumerate(primes):
cnt = 0
if (i % j) == 0:
while( (i % j) == 0 ):
i = i // j
cnt += 1
if cnt % 2 == 1:
new += (1<<ind)
return new
for i in arr:
prev = num_ways[i][0]
num_ways[i][0] = num_ways[i][0] + num_ways[i][1]
num_ways[i][1] = prev + num_ways[i][1]
dp = [ [0 for i in range(1<<19+1)] for j in range(73) ]
dp[0][0] = 1
for i in range(1,71):
msk = get_mask(i)
for mask in range(0, (1<<19) + 1):
dp[i][mask] = (dp[i-1][mask] * num_ways[i][0]) + (dp[i-1][mask ^ msk] * num_ways[i][1])
print((dp[70][0] - 1) % MOD)
|
Title: Square Subsets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya was late for the lesson too. The teacher gave him an additional task. For some array *a* Petya should find the number of different ways to select non-empty subset of elements from it in such a way that their product is equal to a square of some integer.
Two ways are considered different if sets of indexes of elements chosen by these ways are different.
Since the answer can be very large, you should find the answer modulo 109<=+<=7.
Input Specification:
First line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the number of elements in the array.
Second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=70) — the elements of the array.
Output Specification:
Print one integer — the number of different ways to choose some elements so that their product is a square of a certain integer modulo 109<=+<=7.
Demo Input:
['4\n1 1 1 1\n', '4\n2 2 2 2\n', '5\n1 2 4 5 8\n']
Demo Output:
['15\n', '7\n', '7\n']
Note:
In first sample product of elements chosen by any way is 1 and 1 = 1<sup class="upper-index">2</sup>. So the answer is 2<sup class="upper-index">4</sup> - 1 = 15.
In second sample there are six different ways to choose elements so that their product is 4, and only one way so that their product is 16. So the answer is 6 + 1 = 7.
|
```python
n = int(input())
arr = [ int(i) for i in input().split() ]
MOD = 10**9+7
num_ways = [ [1,0] for i in range(71) ]
primes = [2,3,5,7,11,13,17,19,23,29,31,37,41,43,47,53,59,61,67]
def get_mask(i):
new = 0
for ind,j in enumerate(primes):
cnt = 0
if (i % j) == 0:
while( (i % j) == 0 ):
i = i // j
cnt += 1
if cnt % 2 == 1:
new += (1<<ind)
return new
for i in arr:
prev = num_ways[i][0]
num_ways[i][0] = num_ways[i][0] + num_ways[i][1]
num_ways[i][1] = prev + num_ways[i][1]
dp = [ [0 for i in range(1<<19+1)] for j in range(73) ]
dp[0][0] = 1
for i in range(1,71):
msk = get_mask(i)
for mask in range(0, (1<<19) + 1):
dp[i][mask] = (dp[i-1][mask] * num_ways[i][0]) + (dp[i-1][mask ^ msk] * num_ways[i][1])
print((dp[70][0] - 1) % MOD)
```
| 0
|
|
821
|
C
|
Okabe and Boxes
|
PROGRAMMING
| 1,500
|
[
"data structures",
"greedy",
"trees"
] | null | null |
Okabe and Super Hacker Daru are stacking and removing boxes. There are *n* boxes numbered from 1 to *n*. Initially there are no boxes on the stack.
Okabe, being a control freak, gives Daru 2*n* commands: *n* of which are to add a box to the top of the stack, and *n* of which are to remove a box from the top of the stack and throw it in the trash. Okabe wants Daru to throw away the boxes in the order from 1 to *n*. Of course, this means that it might be impossible for Daru to perform some of Okabe's remove commands, because the required box is not on the top of the stack.
That's why Daru can decide to wait until Okabe looks away and then reorder the boxes in the stack in any way he wants. He can do it at any point of time between Okabe's commands, but he can't add or remove boxes while he does it.
Tell Daru the minimum number of times he needs to reorder the boxes so that he can successfully complete all of Okabe's commands. It is guaranteed that every box is added before it is required to be removed.
|
The first line of input contains the integer *n* (1<=≤<=*n*<=≤<=3·105) — the number of boxes.
Each of the next 2*n* lines of input starts with a string "add" or "remove". If the line starts with the "add", an integer *x* (1<=≤<=*x*<=≤<=*n*) follows, indicating that Daru should add the box with number *x* to the top of the stack.
It is guaranteed that exactly *n* lines contain "add" operations, all the boxes added are distinct, and *n* lines contain "remove" operations. It is also guaranteed that a box is always added before it is required to be removed.
|
Print the minimum number of times Daru needs to reorder the boxes to successfully complete all of Okabe's commands.
|
[
"3\nadd 1\nremove\nadd 2\nadd 3\nremove\nremove\n",
"7\nadd 3\nadd 2\nadd 1\nremove\nadd 4\nremove\nremove\nremove\nadd 6\nadd 7\nadd 5\nremove\nremove\nremove\n"
] |
[
"1\n",
"2\n"
] |
In the first sample, Daru should reorder the boxes after adding box 3 to the stack.
In the second sample, Daru should reorder the boxes after adding box 4 and box 7 to the stack.
| 1,500
|
[
{
"input": "3\nadd 1\nremove\nadd 2\nadd 3\nremove\nremove",
"output": "1"
},
{
"input": "7\nadd 3\nadd 2\nadd 1\nremove\nadd 4\nremove\nremove\nremove\nadd 6\nadd 7\nadd 5\nremove\nremove\nremove",
"output": "2"
},
{
"input": "4\nadd 1\nadd 3\nremove\nadd 4\nadd 2\nremove\nremove\nremove",
"output": "2"
},
{
"input": "2\nadd 1\nremove\nadd 2\nremove",
"output": "0"
},
{
"input": "1\nadd 1\nremove",
"output": "0"
},
{
"input": "15\nadd 12\nadd 7\nadd 10\nadd 11\nadd 5\nadd 2\nadd 1\nadd 6\nadd 8\nremove\nremove\nadd 15\nadd 4\nadd 13\nadd 9\nadd 3\nadd 14\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove",
"output": "2"
},
{
"input": "14\nadd 7\nadd 2\nadd 13\nadd 5\nadd 12\nadd 6\nadd 4\nadd 1\nadd 14\nremove\nadd 10\nremove\nadd 9\nadd 8\nadd 11\nadd 3\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove",
"output": "3"
},
{
"input": "11\nadd 10\nadd 9\nadd 11\nadd 1\nadd 5\nadd 6\nremove\nadd 3\nadd 8\nadd 2\nadd 4\nremove\nremove\nremove\nremove\nremove\nadd 7\nremove\nremove\nremove\nremove\nremove",
"output": "2"
},
{
"input": "3\nadd 3\nadd 2\nadd 1\nremove\nremove\nremove",
"output": "0"
},
{
"input": "4\nadd 1\nadd 3\nadd 4\nremove\nadd 2\nremove\nremove\nremove",
"output": "1"
},
{
"input": "6\nadd 3\nadd 4\nadd 5\nadd 1\nadd 6\nremove\nadd 2\nremove\nremove\nremove\nremove\nremove",
"output": "1"
},
{
"input": "16\nadd 1\nadd 2\nadd 3\nadd 4\nadd 5\nadd 6\nadd 7\nadd 8\nadd 9\nadd 10\nadd 11\nadd 12\nadd 13\nadd 14\nadd 15\nadd 16\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove",
"output": "1"
},
{
"input": "2\nadd 2\nadd 1\nremove\nremove",
"output": "0"
},
{
"input": "17\nadd 1\nadd 2\nadd 3\nadd 4\nadd 5\nadd 6\nadd 7\nadd 8\nadd 9\nadd 10\nadd 11\nadd 12\nadd 13\nadd 14\nadd 15\nadd 16\nadd 17\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove",
"output": "1"
},
{
"input": "18\nadd 1\nadd 2\nadd 3\nadd 4\nadd 5\nadd 6\nadd 7\nadd 8\nadd 9\nadd 10\nadd 11\nadd 12\nadd 13\nadd 14\nadd 15\nadd 16\nadd 17\nadd 18\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove",
"output": "1"
},
{
"input": "4\nadd 1\nadd 2\nremove\nremove\nadd 4\nadd 3\nremove\nremove",
"output": "1"
},
{
"input": "19\nadd 1\nadd 2\nadd 3\nadd 4\nadd 5\nadd 6\nadd 7\nadd 8\nadd 9\nadd 10\nadd 11\nadd 12\nadd 13\nadd 14\nadd 15\nadd 16\nadd 17\nadd 18\nadd 19\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove",
"output": "1"
},
{
"input": "5\nadd 4\nadd 3\nadd 1\nremove\nadd 2\nremove\nremove\nadd 5\nremove\nremove",
"output": "1"
},
{
"input": "7\nadd 4\nadd 6\nadd 1\nadd 5\nadd 7\nremove\nadd 2\nremove\nadd 3\nremove\nremove\nremove\nremove\nremove",
"output": "1"
},
{
"input": "8\nadd 1\nadd 2\nadd 3\nadd 7\nadd 8\nremove\nremove\nremove\nadd 6\nadd 5\nadd 4\nremove\nremove\nremove\nremove\nremove",
"output": "1"
},
{
"input": "4\nadd 1\nadd 4\nremove\nadd 3\nadd 2\nremove\nremove\nremove",
"output": "1"
},
{
"input": "7\nadd 1\nadd 2\nadd 3\nadd 5\nadd 7\nremove\nremove\nremove\nadd 4\nremove\nremove\nadd 6\nremove\nremove",
"output": "1"
},
{
"input": "4\nadd 4\nadd 1\nadd 2\nremove\nremove\nadd 3\nremove\nremove",
"output": "1"
},
{
"input": "5\nadd 1\nadd 3\nadd 4\nadd 5\nremove\nadd 2\nremove\nremove\nremove\nremove",
"output": "1"
},
{
"input": "5\nadd 2\nadd 1\nremove\nremove\nadd 5\nadd 3\nremove\nadd 4\nremove\nremove",
"output": "0"
},
{
"input": "9\nadd 3\nadd 2\nadd 1\nadd 4\nadd 6\nadd 9\nremove\nremove\nremove\nremove\nadd 5\nremove\nremove\nadd 8\nadd 7\nremove\nremove\nremove",
"output": "1"
},
{
"input": "10\nadd 9\nadd 10\nadd 4\nadd 3\nadd 2\nadd 1\nremove\nremove\nremove\nremove\nadd 8\nadd 7\nadd 5\nadd 6\nremove\nremove\nremove\nremove\nremove\nremove",
"output": "1"
}
] | 1,565,595,744
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 6
| 124
| 0
|
n = int(input())
h = []
g = 0
sa = 0
for i in range(n * 2):
s = input()
if s[:3] == "add":
sa += 1
else:
if sa >= 2:
g += 1
sa = 0
print(g)
|
Title: Okabe and Boxes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Okabe and Super Hacker Daru are stacking and removing boxes. There are *n* boxes numbered from 1 to *n*. Initially there are no boxes on the stack.
Okabe, being a control freak, gives Daru 2*n* commands: *n* of which are to add a box to the top of the stack, and *n* of which are to remove a box from the top of the stack and throw it in the trash. Okabe wants Daru to throw away the boxes in the order from 1 to *n*. Of course, this means that it might be impossible for Daru to perform some of Okabe's remove commands, because the required box is not on the top of the stack.
That's why Daru can decide to wait until Okabe looks away and then reorder the boxes in the stack in any way he wants. He can do it at any point of time between Okabe's commands, but he can't add or remove boxes while he does it.
Tell Daru the minimum number of times he needs to reorder the boxes so that he can successfully complete all of Okabe's commands. It is guaranteed that every box is added before it is required to be removed.
Input Specification:
The first line of input contains the integer *n* (1<=≤<=*n*<=≤<=3·105) — the number of boxes.
Each of the next 2*n* lines of input starts with a string "add" or "remove". If the line starts with the "add", an integer *x* (1<=≤<=*x*<=≤<=*n*) follows, indicating that Daru should add the box with number *x* to the top of the stack.
It is guaranteed that exactly *n* lines contain "add" operations, all the boxes added are distinct, and *n* lines contain "remove" operations. It is also guaranteed that a box is always added before it is required to be removed.
Output Specification:
Print the minimum number of times Daru needs to reorder the boxes to successfully complete all of Okabe's commands.
Demo Input:
['3\nadd 1\nremove\nadd 2\nadd 3\nremove\nremove\n', '7\nadd 3\nadd 2\nadd 1\nremove\nadd 4\nremove\nremove\nremove\nadd 6\nadd 7\nadd 5\nremove\nremove\nremove\n']
Demo Output:
['1\n', '2\n']
Note:
In the first sample, Daru should reorder the boxes after adding box 3 to the stack.
In the second sample, Daru should reorder the boxes after adding box 4 and box 7 to the stack.
|
```python
n = int(input())
h = []
g = 0
sa = 0
for i in range(n * 2):
s = input()
if s[:3] == "add":
sa += 1
else:
if sa >= 2:
g += 1
sa = 0
print(g)
```
| 0
|
|
60
|
A
|
Where Are My Flakes?
|
PROGRAMMING
| 1,300
|
[
"implementation",
"two pointers"
] |
A. Where Are My Flakes?
|
2
|
256
|
One morning the Cereal Guy found out that all his cereal flakes were gone. He found a note instead of them. It turned out that his smart roommate hid the flakes in one of *n* boxes. The boxes stand in one row, they are numbered from 1 to *n* from the left to the right. The roommate left hints like "Hidden to the left of the *i*-th box" ("To the left of *i*"), "Hidden to the right of the *i*-th box" ("To the right of *i*"). Such hints mean that there are no flakes in the *i*-th box as well. The Cereal Guy wants to know the minimal number of boxes he necessarily needs to check to find the flakes considering all the hints. Or he wants to find out that the hints are contradictory and the roommate lied to him, that is, no box has the flakes.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=1000,<=0<=≤<=*m*<=≤<=1000) which represent the number of boxes and the number of hints correspondingly. Next *m* lines contain hints like "To the left of *i*" and "To the right of *i*", where *i* is integer (1<=≤<=*i*<=≤<=*n*). The hints may coincide.
|
The answer should contain exactly one integer — the number of boxes that should necessarily be checked or "-1" if the hints are contradictory.
|
[
"2 1\nTo the left of 2\n",
"3 2\nTo the right of 1\nTo the right of 2\n",
"3 1\nTo the left of 3\n",
"3 2\nTo the left of 2\nTo the right of 1\n"
] |
[
"1\n",
"1\n",
"2\n",
"-1\n"
] |
none
| 500
|
[
{
"input": "2 1\nTo the left of 2",
"output": "1"
},
{
"input": "3 2\nTo the right of 1\nTo the right of 2",
"output": "1"
},
{
"input": "3 1\nTo the left of 3",
"output": "2"
},
{
"input": "3 2\nTo the left of 2\nTo the right of 1",
"output": "-1"
},
{
"input": "3 0",
"output": "3"
},
{
"input": "2 2\nTo the left of 2\nTo the left of 2",
"output": "1"
},
{
"input": "5 0",
"output": "5"
},
{
"input": "6 2\nTo the right of 2\nTo the left of 4",
"output": "1"
},
{
"input": "8 6\nTo the right of 3\nTo the left of 4\nTo the left of 4\nTo the right of 1\nTo the right of 5\nTo the left of 6",
"output": "-1"
},
{
"input": "459 16\nTo the right of 9\nTo the right of 148\nTo the left of 406\nTo the left of 335\nTo the right of 240\nTo the left of 409\nTo the left of 365\nTo the left of 426\nTo the left of 416\nTo the right of 247\nTo the left of 284\nTo the right of 187\nTo the right of 134\nTo the right of 128\nTo the right of 98\nTo the left of 412",
"output": "36"
},
{
"input": "1000 1\nTo the right of 117",
"output": "883"
},
{
"input": "1000 0",
"output": "1000"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "2 0",
"output": "2"
},
{
"input": "1 1\nTo the right of 1",
"output": "-1"
},
{
"input": "1 1\nTo the left of 1",
"output": "-1"
},
{
"input": "2 1\nTo the right of 2",
"output": "-1"
}
] | 1,672,900,006
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 54
| 154
| 1,740,800
|
n,m=list(map(int,input().split()))
i,j=1,n
right=[]
left=[]
for k in range(m):
x=input()
#print(x)
if x.find("To the left of ")!=-1:
#print(x.find("2"))
left.append(int(x[15::]))
else:
#print(x[16::])
right.append(int(x[16::]))
#print(left,right)
if (right!=[]):
i=max(right)+1
if (left!=[]):
#print(min(left))
j=min(left)-1
#print(i,j)
if i>j:
print(-1)
else:
print(j-i+1)
|
Title: Where Are My Flakes?
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One morning the Cereal Guy found out that all his cereal flakes were gone. He found a note instead of them. It turned out that his smart roommate hid the flakes in one of *n* boxes. The boxes stand in one row, they are numbered from 1 to *n* from the left to the right. The roommate left hints like "Hidden to the left of the *i*-th box" ("To the left of *i*"), "Hidden to the right of the *i*-th box" ("To the right of *i*"). Such hints mean that there are no flakes in the *i*-th box as well. The Cereal Guy wants to know the minimal number of boxes he necessarily needs to check to find the flakes considering all the hints. Or he wants to find out that the hints are contradictory and the roommate lied to him, that is, no box has the flakes.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=1000,<=0<=≤<=*m*<=≤<=1000) which represent the number of boxes and the number of hints correspondingly. Next *m* lines contain hints like "To the left of *i*" and "To the right of *i*", where *i* is integer (1<=≤<=*i*<=≤<=*n*). The hints may coincide.
Output Specification:
The answer should contain exactly one integer — the number of boxes that should necessarily be checked or "-1" if the hints are contradictory.
Demo Input:
['2 1\nTo the left of 2\n', '3 2\nTo the right of 1\nTo the right of 2\n', '3 1\nTo the left of 3\n', '3 2\nTo the left of 2\nTo the right of 1\n']
Demo Output:
['1\n', '1\n', '2\n', '-1\n']
Note:
none
|
```python
n,m=list(map(int,input().split()))
i,j=1,n
right=[]
left=[]
for k in range(m):
x=input()
#print(x)
if x.find("To the left of ")!=-1:
#print(x.find("2"))
left.append(int(x[15::]))
else:
#print(x[16::])
right.append(int(x[16::]))
#print(left,right)
if (right!=[]):
i=max(right)+1
if (left!=[]):
#print(min(left))
j=min(left)-1
#print(i,j)
if i>j:
print(-1)
else:
print(j-i+1)
```
| 3.958258
|
570
|
A
|
Elections
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
The country of Byalechinsk is running elections involving *n* candidates. The country consists of *m* cities. We know how many people in each city voted for each candidate.
The electoral system in the country is pretty unusual. At the first stage of elections the votes are counted for each city: it is assumed that in each city won the candidate who got the highest number of votes in this city, and if several candidates got the maximum number of votes, then the winner is the one with a smaller index.
At the second stage of elections the winner is determined by the same principle over the cities: the winner of the elections is the candidate who won in the maximum number of cities, and among those who got the maximum number of cities the winner is the one with a smaller index.
Determine who will win the elections.
|
The first line of the input contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of candidates and of cities, respectively.
Each of the next *m* lines contains *n* non-negative integers, the *j*-th number in the *i*-th line *a**ij* (1<=≤<=*j*<=≤<=*n*, 1<=≤<=*i*<=≤<=*m*, 0<=≤<=*a**ij*<=≤<=109) denotes the number of votes for candidate *j* in city *i*.
It is guaranteed that the total number of people in all the cities does not exceed 109.
|
Print a single number — the index of the candidate who won the elections. The candidates are indexed starting from one.
|
[
"3 3\n1 2 3\n2 3 1\n1 2 1\n",
"3 4\n10 10 3\n5 1 6\n2 2 2\n1 5 7\n"
] |
[
"2",
"1"
] |
Note to the first sample test. At the first stage city 1 chosen candidate 3, city 2 chosen candidate 2, city 3 chosen candidate 2. The winner is candidate 2, he gained 2 votes.
Note to the second sample test. At the first stage in city 1 candidates 1 and 2 got the same maximum number of votes, but candidate 1 has a smaller index, so the city chose candidate 1. City 2 chosen candidate 3. City 3 chosen candidate 1, due to the fact that everyone has the same number of votes, and 1 has the smallest index. City 4 chosen the candidate 3. On the second stage the same number of cities chose candidates 1 and 3. The winner is candidate 1, the one with the smaller index.
| 500
|
[
{
"input": "3 3\n1 2 3\n2 3 1\n1 2 1",
"output": "2"
},
{
"input": "3 4\n10 10 3\n5 1 6\n2 2 2\n1 5 7",
"output": "1"
},
{
"input": "1 3\n5\n3\n2",
"output": "1"
},
{
"input": "3 1\n1 2 3",
"output": "3"
},
{
"input": "3 1\n100 100 100",
"output": "1"
},
{
"input": "2 2\n1 2\n2 1",
"output": "1"
},
{
"input": "2 2\n2 1\n2 1",
"output": "1"
},
{
"input": "2 2\n1 2\n1 2",
"output": "2"
},
{
"input": "3 3\n0 0 0\n1 1 1\n2 2 2",
"output": "1"
},
{
"input": "1 1\n1000000000",
"output": "1"
},
{
"input": "5 5\n1 2 3 4 5\n2 3 4 5 6\n3 4 5 6 7\n4 5 6 7 8\n5 6 7 8 9",
"output": "5"
},
{
"input": "4 4\n1 3 1 3\n3 1 3 1\n2 0 0 2\n0 1 1 0",
"output": "1"
},
{
"input": "4 4\n1 4 1 3\n3 1 2 1\n1 0 0 2\n0 1 10 0",
"output": "1"
},
{
"input": "4 4\n1 4 1 300\n3 1 2 1\n5 0 0 2\n0 1 10 100",
"output": "1"
},
{
"input": "5 5\n15 45 15 300 10\n53 15 25 51 10\n5 50 50 2 10\n1000 1 10 100 10\n10 10 10 10 10",
"output": "1"
},
{
"input": "1 100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "1"
},
{
"input": "100 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "1 100\n859\n441\n272\n47\n355\n345\n612\n569\n545\n599\n410\n31\n720\n303\n58\n537\n561\n730\n288\n275\n446\n955\n195\n282\n153\n455\n996\n121\n267\n702\n769\n560\n353\n89\n990\n282\n801\n335\n573\n258\n722\n768\n324\n41\n249\n125\n557\n303\n664\n945\n156\n884\n985\n816\n433\n65\n976\n963\n85\n647\n46\n877\n665\n523\n714\n182\n377\n549\n994\n385\n184\n724\n447\n99\n766\n353\n494\n747\n324\n436\n915\n472\n879\n582\n928\n84\n627\n156\n972\n651\n159\n372\n70\n903\n590\n480\n184\n540\n270\n892",
"output": "1"
},
{
"input": "100 1\n439 158 619 538 187 153 973 781 610 475 94 947 449 531 220 51 788 118 189 501 54 434 465 902 280 635 688 214 737 327 682 690 683 519 261 923 254 388 529 659 662 276 376 735 976 664 521 285 42 147 187 259 407 977 879 465 522 17 550 701 114 921 577 265 668 812 232 267 135 371 586 201 608 373 771 358 101 412 195 582 199 758 507 882 16 484 11 712 916 699 783 618 405 124 904 257 606 610 230 718",
"output": "54"
},
{
"input": "1 99\n511\n642\n251\n30\n494\n128\n189\n324\n884\n656\n120\n616\n959\n328\n411\n933\n895\n350\n1\n838\n996\n761\n619\n131\n824\n751\n707\n688\n915\n115\n244\n476\n293\n986\n29\n787\n607\n259\n756\n864\n394\n465\n303\n387\n521\n582\n485\n355\n299\n997\n683\n472\n424\n948\n339\n383\n285\n957\n591\n203\n866\n79\n835\n980\n344\n493\n361\n159\n160\n947\n46\n362\n63\n553\n793\n754\n429\n494\n523\n227\n805\n313\n409\n243\n927\n350\n479\n971\n825\n460\n544\n235\n660\n327\n216\n729\n147\n671\n738",
"output": "1"
},
{
"input": "99 1\n50 287 266 159 551 198 689 418 809 43 691 367 160 664 86 805 461 55 127 950 576 351 721 493 972 560 934 885 492 92 321 759 767 989 883 7 127 413 404 604 80 645 666 874 371 718 893 158 722 198 563 293 134 255 742 913 252 378 859 721 502 251 839 284 133 209 962 514 773 124 205 903 785 859 911 93 861 786 747 213 690 69 942 697 211 203 284 961 351 137 962 952 408 249 238 850 944 40 346",
"output": "34"
},
{
"input": "100 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2",
"output": "100"
},
{
"input": "1 1\n0",
"output": "1"
},
{
"input": "2 1\n0 0",
"output": "1"
},
{
"input": "2 2\n0 0\n0 0",
"output": "1"
},
{
"input": "2 2\n1 2\n0 0",
"output": "1"
},
{
"input": "3 3\n0 0 0\n0 0 0\n0 0 0",
"output": "1"
},
{
"input": "2 3\n0 0\n0 0\n0 1",
"output": "1"
},
{
"input": "3 2\n1 1 3\n0 0 0",
"output": "1"
},
{
"input": "3 4\n1 10 3\n0 0 0\n0 0 0\n0 0 0",
"output": "1"
},
{
"input": "2 4\n2 1\n1 2\n0 0\n1 2",
"output": "1"
},
{
"input": "2 2\n0 1\n0 1",
"output": "2"
},
{
"input": "2 3\n1 2\n0 0\n2 1",
"output": "1"
},
{
"input": "2 2\n0 0\n4 5",
"output": "1"
},
{
"input": "3 2\n10 15 20\n0 0 0",
"output": "1"
},
{
"input": "3 4\n0 0 0\n0 0 0\n0 0 0\n1 2 3",
"output": "1"
},
{
"input": "3 3\n0 0 0\n0 0 0\n0 0 1",
"output": "1"
},
{
"input": "3 3\n0 0 0\n1 2 3\n1 3 2",
"output": "1"
},
{
"input": "3 1\n0 0 0",
"output": "1"
},
{
"input": "3 3\n0 0 1\n0 0 0\n0 0 0",
"output": "1"
}
] | 1,629,741,531
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 78
| 6,963,200
|
import sys
def input(): return sys.stdin.readline().rstrip("\r\n")
def maps():return [int(i) for i in input().split()]
def func():
n , m = maps()
if n > m +1 or m > 2*(n +1) :
print(-1)
else:
if n == m : #self - explanatory
print('10'*n)
elif n == m + 1: #self - explanatory
print('01'*m + '0')
elif 2*n + 2 == m: #special case
print('110'*n + '11')
else:
t = m - n - 1 #'110'*t -- make the m as close to n , now m = n+1 is left
print('110'*t + '10'*(n-t) + '1')
class Seq:
def calc(self , s):
S = str(s)
return s + int(max(S))*int(min(S))
def solve(self):
for _ in range(*maps()):
a , k = maps()
k-=1
prev = 0
while k and a - prev:
k-=1
prev = a
a = calc(a)
print(a)
from _collections import defaultdict,OrderedDict
class Young:
def solve(self):
for _ in range(*maps()):
n, = maps()
a = [*maps()]
dic = defaultdict(int)
gr = 0
for i in a:
dic[i]+=1
# print(dic,"bef")
for i in dic:
x = dic[i]//i
gr+=x
dic[i]-=x*i
# print(dic,gr)
rem = []
for i in dic:
while dic[i]:
rem.append(i)
dic[i]-=1
rem.sort()
# print(rem,gr)
i = 0
mx = 0
dis = 0
while i < len(rem):
dis+=1
mx = max (mx, rem[i])
if mx <= dis:
gr+=1
dis = 0
i+=1
print(gr)
class Johnny:
def solve(self):
for _ in range(*maps()):
n, = maps()
a = [*maps()]
diff = [0]*n
cc = 0
for i in range(n):
if i+ 1 != a[i]:
cc+=1
diff[i] = 1
if cc == n:
print(1)
elif cc == 0:
print(0)
else:
diff = ''.join(map(str ,diff)).split('0')
x = sum([1 if len(i) else 0 for i in diff])
print(min(2 , x))
def applejack():
n, = maps()
a = [*maps()]
q, = maps()
d = defaultdict(int)
cnt1 , cnt2 = 0 , 0
for i in a:
d[i]+=1
for i in d:
cnt1 += d[i]//4 #squares
cnt2 += (d[i]%4)//2 #recs each parallel side
for i in range(q):
s , x = input().split()
x = int(x)
f = d[x]
if s == '+':
d[x]+=1
if f % 4 == 1:
cnt2+=1
elif f % 4 == 3:
cnt1+=1
cnt2-=1
else:
d[x]-=1
if f %4 == 0:
cnt1 -=1
cnt2 +=1
elif f % 4 == 2:
cnt2-=1
if cnt1 > 1 or (cnt1 and cnt2 > 1):
print('YES')
else:
print('NO')
#An alternative solution is using heaps
n , m = maps()
d = defaultdict(int)
#n -- number of candidates
#m -- number of cities
#largest num of votes in a city with the smallest index wins
wins = [0]*m
for _ in range(m):
a = [*maps()]
wins[_] = a.index(max(a))
for i in wins:
d[i]+=1
mx = 0
for i in d:
if d[i] > mx:
mx = d[i]
c = i
print(c+1)
|
Title: Elections
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The country of Byalechinsk is running elections involving *n* candidates. The country consists of *m* cities. We know how many people in each city voted for each candidate.
The electoral system in the country is pretty unusual. At the first stage of elections the votes are counted for each city: it is assumed that in each city won the candidate who got the highest number of votes in this city, and if several candidates got the maximum number of votes, then the winner is the one with a smaller index.
At the second stage of elections the winner is determined by the same principle over the cities: the winner of the elections is the candidate who won in the maximum number of cities, and among those who got the maximum number of cities the winner is the one with a smaller index.
Determine who will win the elections.
Input Specification:
The first line of the input contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of candidates and of cities, respectively.
Each of the next *m* lines contains *n* non-negative integers, the *j*-th number in the *i*-th line *a**ij* (1<=≤<=*j*<=≤<=*n*, 1<=≤<=*i*<=≤<=*m*, 0<=≤<=*a**ij*<=≤<=109) denotes the number of votes for candidate *j* in city *i*.
It is guaranteed that the total number of people in all the cities does not exceed 109.
Output Specification:
Print a single number — the index of the candidate who won the elections. The candidates are indexed starting from one.
Demo Input:
['3 3\n1 2 3\n2 3 1\n1 2 1\n', '3 4\n10 10 3\n5 1 6\n2 2 2\n1 5 7\n']
Demo Output:
['2', '1']
Note:
Note to the first sample test. At the first stage city 1 chosen candidate 3, city 2 chosen candidate 2, city 3 chosen candidate 2. The winner is candidate 2, he gained 2 votes.
Note to the second sample test. At the first stage in city 1 candidates 1 and 2 got the same maximum number of votes, but candidate 1 has a smaller index, so the city chose candidate 1. City 2 chosen candidate 3. City 3 chosen candidate 1, due to the fact that everyone has the same number of votes, and 1 has the smallest index. City 4 chosen the candidate 3. On the second stage the same number of cities chose candidates 1 and 3. The winner is candidate 1, the one with the smaller index.
|
```python
import sys
def input(): return sys.stdin.readline().rstrip("\r\n")
def maps():return [int(i) for i in input().split()]
def func():
n , m = maps()
if n > m +1 or m > 2*(n +1) :
print(-1)
else:
if n == m : #self - explanatory
print('10'*n)
elif n == m + 1: #self - explanatory
print('01'*m + '0')
elif 2*n + 2 == m: #special case
print('110'*n + '11')
else:
t = m - n - 1 #'110'*t -- make the m as close to n , now m = n+1 is left
print('110'*t + '10'*(n-t) + '1')
class Seq:
def calc(self , s):
S = str(s)
return s + int(max(S))*int(min(S))
def solve(self):
for _ in range(*maps()):
a , k = maps()
k-=1
prev = 0
while k and a - prev:
k-=1
prev = a
a = calc(a)
print(a)
from _collections import defaultdict,OrderedDict
class Young:
def solve(self):
for _ in range(*maps()):
n, = maps()
a = [*maps()]
dic = defaultdict(int)
gr = 0
for i in a:
dic[i]+=1
# print(dic,"bef")
for i in dic:
x = dic[i]//i
gr+=x
dic[i]-=x*i
# print(dic,gr)
rem = []
for i in dic:
while dic[i]:
rem.append(i)
dic[i]-=1
rem.sort()
# print(rem,gr)
i = 0
mx = 0
dis = 0
while i < len(rem):
dis+=1
mx = max (mx, rem[i])
if mx <= dis:
gr+=1
dis = 0
i+=1
print(gr)
class Johnny:
def solve(self):
for _ in range(*maps()):
n, = maps()
a = [*maps()]
diff = [0]*n
cc = 0
for i in range(n):
if i+ 1 != a[i]:
cc+=1
diff[i] = 1
if cc == n:
print(1)
elif cc == 0:
print(0)
else:
diff = ''.join(map(str ,diff)).split('0')
x = sum([1 if len(i) else 0 for i in diff])
print(min(2 , x))
def applejack():
n, = maps()
a = [*maps()]
q, = maps()
d = defaultdict(int)
cnt1 , cnt2 = 0 , 0
for i in a:
d[i]+=1
for i in d:
cnt1 += d[i]//4 #squares
cnt2 += (d[i]%4)//2 #recs each parallel side
for i in range(q):
s , x = input().split()
x = int(x)
f = d[x]
if s == '+':
d[x]+=1
if f % 4 == 1:
cnt2+=1
elif f % 4 == 3:
cnt1+=1
cnt2-=1
else:
d[x]-=1
if f %4 == 0:
cnt1 -=1
cnt2 +=1
elif f % 4 == 2:
cnt2-=1
if cnt1 > 1 or (cnt1 and cnt2 > 1):
print('YES')
else:
print('NO')
#An alternative solution is using heaps
n , m = maps()
d = defaultdict(int)
#n -- number of candidates
#m -- number of cities
#largest num of votes in a city with the smallest index wins
wins = [0]*m
for _ in range(m):
a = [*maps()]
wins[_] = a.index(max(a))
for i in wins:
d[i]+=1
mx = 0
for i in d:
if d[i] > mx:
mx = d[i]
c = i
print(c+1)
```
| 0
|
|
41
|
A
|
Translation
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Translation
|
2
|
256
|
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
|
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
|
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
|
[
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,639,731,642
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 0
|
st1 = input()
st2 = input()
print(st1 == st2[::-1])
|
Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
st1 = input()
st2 = input()
print(st1 == st2[::-1])
```
| 0
|
950
|
A
|
Left-handers, Right-handers and Ambidexters
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
You are at a water bowling training. There are *l* people who play with their left hand, *r* people, who play with their right hand, and *a* ambidexters, who can play with left or right hand.
The coach decided to form a team of even number of players, exactly half of the players should play with their right hand, and exactly half of the players should play with their left hand. One player should use only on of his hands.
Ambidexters play as well with their right hand as with their left hand. In the team, an ambidexter can play with their left hand, or with their right hand.
Please find the maximum possible size of the team, where equal number of players use their left and right hands, respectively.
|
The only line contains three integers *l*, *r* and *a* (0<=≤<=*l*,<=*r*,<=*a*<=≤<=100) — the number of left-handers, the number of right-handers and the number of ambidexters at the training.
|
Print a single even integer — the maximum number of players in the team. It is possible that the team can only have zero number of players.
|
[
"1 4 2\n",
"5 5 5\n",
"0 2 0\n"
] |
[
"6\n",
"14\n",
"0\n"
] |
In the first example you can form a team of 6 players. You should take the only left-hander and two ambidexters to play with left hand, and three right-handers to play with right hand. The only person left can't be taken into the team.
In the second example you can form a team of 14 people. You have to take all five left-handers, all five right-handers, two ambidexters to play with left hand and two ambidexters to play with right hand.
| 500
|
[
{
"input": "1 4 2",
"output": "6"
},
{
"input": "5 5 5",
"output": "14"
},
{
"input": "0 2 0",
"output": "0"
},
{
"input": "30 70 34",
"output": "128"
},
{
"input": "89 32 24",
"output": "112"
},
{
"input": "89 44 77",
"output": "210"
},
{
"input": "0 0 0",
"output": "0"
},
{
"input": "100 100 100",
"output": "300"
},
{
"input": "1 1 1",
"output": "2"
},
{
"input": "30 70 35",
"output": "130"
},
{
"input": "89 44 76",
"output": "208"
},
{
"input": "0 100 100",
"output": "200"
},
{
"input": "100 0 100",
"output": "200"
},
{
"input": "100 1 100",
"output": "200"
},
{
"input": "1 100 100",
"output": "200"
},
{
"input": "100 100 0",
"output": "200"
},
{
"input": "100 100 1",
"output": "200"
},
{
"input": "1 2 1",
"output": "4"
},
{
"input": "0 0 100",
"output": "100"
},
{
"input": "0 100 0",
"output": "0"
},
{
"input": "100 0 0",
"output": "0"
},
{
"input": "10 8 7",
"output": "24"
},
{
"input": "45 47 16",
"output": "108"
},
{
"input": "59 43 100",
"output": "202"
},
{
"input": "34 1 30",
"output": "62"
},
{
"input": "14 81 1",
"output": "30"
},
{
"input": "53 96 94",
"output": "242"
},
{
"input": "62 81 75",
"output": "218"
},
{
"input": "21 71 97",
"output": "188"
},
{
"input": "49 82 73",
"output": "204"
},
{
"input": "88 19 29",
"output": "96"
},
{
"input": "89 4 62",
"output": "132"
},
{
"input": "58 3 65",
"output": "126"
},
{
"input": "27 86 11",
"output": "76"
},
{
"input": "35 19 80",
"output": "134"
},
{
"input": "4 86 74",
"output": "156"
},
{
"input": "32 61 89",
"output": "182"
},
{
"input": "68 60 98",
"output": "226"
},
{
"input": "37 89 34",
"output": "142"
},
{
"input": "92 9 28",
"output": "74"
},
{
"input": "79 58 98",
"output": "234"
},
{
"input": "35 44 88",
"output": "166"
},
{
"input": "16 24 19",
"output": "58"
},
{
"input": "74 71 75",
"output": "220"
},
{
"input": "83 86 99",
"output": "268"
},
{
"input": "97 73 15",
"output": "176"
},
{
"input": "77 76 73",
"output": "226"
},
{
"input": "48 85 55",
"output": "188"
},
{
"input": "1 2 2",
"output": "4"
},
{
"input": "2 2 2",
"output": "6"
},
{
"input": "2 1 2",
"output": "4"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "3 2 1",
"output": "6"
},
{
"input": "1 2 3",
"output": "6"
},
{
"input": "1 3 2",
"output": "6"
},
{
"input": "2 1 3",
"output": "6"
},
{
"input": "2 3 1",
"output": "6"
},
{
"input": "3 1 2",
"output": "6"
},
{
"input": "99 99 99",
"output": "296"
},
{
"input": "99 99 100",
"output": "298"
},
{
"input": "99 100 99",
"output": "298"
},
{
"input": "99 100 100",
"output": "298"
},
{
"input": "100 99 99",
"output": "298"
},
{
"input": "100 99 100",
"output": "298"
},
{
"input": "100 100 99",
"output": "298"
},
{
"input": "89 32 23",
"output": "110"
},
{
"input": "4 5 0",
"output": "8"
},
{
"input": "3 0 3",
"output": "6"
},
{
"input": "0 0 2",
"output": "2"
},
{
"input": "97 97 0",
"output": "194"
},
{
"input": "1 4 0",
"output": "2"
},
{
"input": "5 2 0",
"output": "4"
},
{
"input": "0 5 10",
"output": "14"
},
{
"input": "0 1 2",
"output": "2"
},
{
"input": "5 2 3",
"output": "10"
},
{
"input": "5 5 0",
"output": "10"
},
{
"input": "0 0 10",
"output": "10"
},
{
"input": "0 1 1",
"output": "2"
},
{
"input": "0 0 1",
"output": "0"
}
] | 1,573,501,401
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 79
| 140
| 0
|
# cf 950 A 900
l, r, a = map(int, input().split())
if l < r:
d = r - l
d = min(a, d)
l += d
a -= d
else:
d = l - r
d = min(a, d)
r += d
a -= d
print(2 * (min(l, r) + a // 2))
|
Title: Left-handers, Right-handers and Ambidexters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are at a water bowling training. There are *l* people who play with their left hand, *r* people, who play with their right hand, and *a* ambidexters, who can play with left or right hand.
The coach decided to form a team of even number of players, exactly half of the players should play with their right hand, and exactly half of the players should play with their left hand. One player should use only on of his hands.
Ambidexters play as well with their right hand as with their left hand. In the team, an ambidexter can play with their left hand, or with their right hand.
Please find the maximum possible size of the team, where equal number of players use their left and right hands, respectively.
Input Specification:
The only line contains three integers *l*, *r* and *a* (0<=≤<=*l*,<=*r*,<=*a*<=≤<=100) — the number of left-handers, the number of right-handers and the number of ambidexters at the training.
Output Specification:
Print a single even integer — the maximum number of players in the team. It is possible that the team can only have zero number of players.
Demo Input:
['1 4 2\n', '5 5 5\n', '0 2 0\n']
Demo Output:
['6\n', '14\n', '0\n']
Note:
In the first example you can form a team of 6 players. You should take the only left-hander and two ambidexters to play with left hand, and three right-handers to play with right hand. The only person left can't be taken into the team.
In the second example you can form a team of 14 people. You have to take all five left-handers, all five right-handers, two ambidexters to play with left hand and two ambidexters to play with right hand.
|
```python
# cf 950 A 900
l, r, a = map(int, input().split())
if l < r:
d = r - l
d = min(a, d)
l += d
a -= d
else:
d = l - r
d = min(a, d)
r += d
a -= d
print(2 * (min(l, r) + a // 2))
```
| 3
|
|
9
|
A
|
Die Roll
|
PROGRAMMING
| 800
|
[
"math",
"probabilities"
] |
A. Die Roll
|
1
|
64
|
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
|
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
|
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
|
[
"4 2\n"
] |
[
"1/2\n"
] |
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
| 0
|
[
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,695,292,277
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 60
| 0
|
y,w = map(int,input().split())
if y>w:
y = 6-y+1
elif w>y:
w = 6-w+1
else:
y = 6
print(str(y)+"/"+str(6))
|
Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
|
```python
y,w = map(int,input().split())
if y>w:
y = 6-y+1
elif w>y:
w = 6-w+1
else:
y = 6
print(str(y)+"/"+str(6))
```
| 0
|
407
|
A
|
Triangle
|
PROGRAMMING
| 1,600
|
[
"brute force",
"geometry",
"implementation",
"math"
] | null | null |
There is a right triangle with legs of length *a* and *b*. Your task is to determine whether it is possible to locate the triangle on the plane in such a way that none of its sides is parallel to the coordinate axes. All the vertices must have integer coordinates. If there exists such a location, you have to output the appropriate coordinates of vertices.
|
The first line contains two integers *a*,<=*b* (1<=≤<=*a*,<=*b*<=≤<=1000), separated by a single space.
|
In the first line print either "YES" or "NO" (without the quotes) depending on whether the required location exists. If it does, print in the next three lines three pairs of integers — the coordinates of the triangle vertices, one pair per line. The coordinates must be integers, not exceeding 109 in their absolute value.
|
[
"1 1\n",
"5 5\n",
"5 10\n"
] |
[
"NO\n",
"YES\n2 1\n5 5\n-2 4\n",
"YES\n-10 4\n-2 -2\n1 2\n"
] |
none
| 500
|
[
{
"input": "1 1",
"output": "NO"
},
{
"input": "5 5",
"output": "YES\n2 1\n5 5\n-2 4"
},
{
"input": "5 10",
"output": "YES\n-10 4\n-2 -2\n1 2"
},
{
"input": "2 2",
"output": "NO"
},
{
"input": "5 6",
"output": "NO"
},
{
"input": "5 11",
"output": "NO"
},
{
"input": "10 15",
"output": "YES\n0 0\n6 8\n-12 9"
},
{
"input": "935 938",
"output": "NO"
},
{
"input": "999 1000",
"output": "NO"
},
{
"input": "1000 1000",
"output": "YES\n0 0\n280 960\n-960 280"
},
{
"input": "15 20",
"output": "YES\n0 0\n12 9\n-12 16"
},
{
"input": "20 15",
"output": "YES\n0 0\n12 16\n-12 9"
},
{
"input": "629 865",
"output": "NO"
},
{
"input": "45 872",
"output": "NO"
},
{
"input": "757 582",
"output": "NO"
},
{
"input": "173 588",
"output": "NO"
},
{
"input": "533 298",
"output": "NO"
},
{
"input": "949 360",
"output": "NO"
},
{
"input": "661 175",
"output": "NO"
},
{
"input": "728 299",
"output": "YES\n0 0\n280 672\n-276 115"
},
{
"input": "575 85",
"output": "YES\n0 0\n345 460\n-68 51"
},
{
"input": "385 505",
"output": "YES\n0 0\n231 308\n-404 303"
},
{
"input": "755 865",
"output": "YES\n0 0\n453 604\n-692 519"
},
{
"input": "395 55",
"output": "YES\n0 0\n237 316\n-44 33"
},
{
"input": "600 175",
"output": "YES\n0 0\n168 576\n-168 49"
},
{
"input": "280 210",
"output": "YES\n0 0\n168 224\n-168 126"
},
{
"input": "180 135",
"output": "YES\n0 0\n108 144\n-108 81"
},
{
"input": "140 105",
"output": "YES\n0 0\n84 112\n-84 63"
},
{
"input": "440 330",
"output": "YES\n0 0\n264 352\n-264 198"
},
{
"input": "130 312",
"output": "YES\n0 0\n120 50\n-120 288"
},
{
"input": "65 156",
"output": "YES\n0 0\n60 25\n-60 144"
},
{
"input": "105 140",
"output": "YES\n0 0\n84 63\n-84 112"
},
{
"input": "408 765",
"output": "YES\n0 0\n360 192\n-360 675"
},
{
"input": "195 468",
"output": "YES\n0 0\n180 75\n-180 432"
},
{
"input": "305 949",
"output": "NO"
},
{
"input": "80 60",
"output": "YES\n0 0\n48 64\n-48 36"
},
{
"input": "15 15",
"output": "YES\n0 0\n9 12\n-12 9"
},
{
"input": "120 90",
"output": "YES\n0 0\n72 96\n-72 54"
},
{
"input": "60 80",
"output": "YES\n0 0\n48 36\n-48 64"
},
{
"input": "5 25",
"output": "YES\n0 0\n3 4\n-20 15"
},
{
"input": "5 1000",
"output": "YES\n0 0\n3 4\n-800 600"
},
{
"input": "25 35",
"output": "YES\n0 0\n15 20\n-28 21"
},
{
"input": "25 5",
"output": "YES\n0 0\n15 20\n-4 3"
},
{
"input": "30 40",
"output": "YES\n0 0\n24 18\n-24 32"
},
{
"input": "65 156",
"output": "YES\n0 0\n60 25\n-60 144"
},
{
"input": "455 470",
"output": "YES\n0 0\n273 364\n-376 282"
},
{
"input": "90 120",
"output": "YES\n0 0\n72 54\n-72 96"
},
{
"input": "5 205",
"output": "YES\n0 0\n3 4\n-164 123"
},
{
"input": "111 111",
"output": "YES\n0 0\n36 105\n-105 36"
},
{
"input": "17 17",
"output": "YES\n0 0\n8 15\n-15 8"
},
{
"input": "1000 5",
"output": "YES\n0 0\n600 800\n-4 3"
}
] | 1,634,231,639
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 0
|
import math
a, b = map(int, input().split())
for x in range(1, a):
y = math.sqrt(a * a - x * x)
if(int(y) == y):
deg = math.atan2(y, x) + math.pi / 2.0
x2 = b * math.cos(deg)
y2 = b * math.sin(deg)
if(x2 == int(x2) and y2 == int(y2) and y2 != y):
print("yEs")
print(0, 0)
print(int(x), int(y))
print(int(x2), int(y2))
exit(0)
print("nO")
|
Title: Triangle
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a right triangle with legs of length *a* and *b*. Your task is to determine whether it is possible to locate the triangle on the plane in such a way that none of its sides is parallel to the coordinate axes. All the vertices must have integer coordinates. If there exists such a location, you have to output the appropriate coordinates of vertices.
Input Specification:
The first line contains two integers *a*,<=*b* (1<=≤<=*a*,<=*b*<=≤<=1000), separated by a single space.
Output Specification:
In the first line print either "YES" or "NO" (without the quotes) depending on whether the required location exists. If it does, print in the next three lines three pairs of integers — the coordinates of the triangle vertices, one pair per line. The coordinates must be integers, not exceeding 109 in their absolute value.
Demo Input:
['1 1\n', '5 5\n', '5 10\n']
Demo Output:
['NO\n', 'YES\n2 1\n5 5\n-2 4\n', 'YES\n-10 4\n-2 -2\n1 2\n']
Note:
none
|
```python
import math
a, b = map(int, input().split())
for x in range(1, a):
y = math.sqrt(a * a - x * x)
if(int(y) == y):
deg = math.atan2(y, x) + math.pi / 2.0
x2 = b * math.cos(deg)
y2 = b * math.sin(deg)
if(x2 == int(x2) and y2 == int(y2) and y2 != y):
print("yEs")
print(0, 0)
print(int(x), int(y))
print(int(x2), int(y2))
exit(0)
print("nO")
```
| 0
|
|
289
|
B
|
Polo the Penguin and Matrix
|
PROGRAMMING
| 1,400
|
[
"brute force",
"dp",
"implementation",
"sortings",
"ternary search"
] | null | null |
Little penguin Polo has an *n*<=×<=*m* matrix, consisting of integers. Let's index the matrix rows from 1 to *n* from top to bottom and let's index the columns from 1 to *m* from left to right. Let's represent the matrix element on the intersection of row *i* and column *j* as *a**ij*.
In one move the penguin can add or subtract number *d* from some matrix element. Find the minimum number of moves needed to make all matrix elements equal. If the described plan is impossible to carry out, say so.
|
The first line contains three integers *n*, *m* and *d* (1<=≤<=*n*,<=*m*<=≤<=100,<=1<=≤<=*d*<=≤<=104) — the matrix sizes and the *d* parameter. Next *n* lines contain the matrix: the *j*-th integer in the *i*-th row is the matrix element *a**ij* (1<=≤<=*a**ij*<=≤<=104).
|
In a single line print a single integer — the minimum number of moves the penguin needs to make all matrix elements equal. If that is impossible, print "-1" (without the quotes).
|
[
"2 2 2\n2 4\n6 8\n",
"1 2 7\n6 7\n"
] |
[
"4\n",
"-1\n"
] |
none
| 1,000
|
[
{
"input": "2 2 2\n2 4\n6 8",
"output": "4"
},
{
"input": "1 2 7\n6 7",
"output": "-1"
},
{
"input": "3 2 1\n5 7\n1 2\n5 100",
"output": "104"
},
{
"input": "3 3 3\n5 8 5\n11 11 17\n14 5 2",
"output": "12"
},
{
"input": "3 3 3\n5 8 5\n11 11 17\n14 5 3",
"output": "-1"
},
{
"input": "2 2 4\n5 5\n5 5",
"output": "0"
},
{
"input": "7 4 5\n7 7 7 12\n7 12 12 7\n7 7 7 7\n7 7 12 7\n7 7 12 12\n12 12 7 12\n7 7 7 7",
"output": "9"
},
{
"input": "7 7 47\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91",
"output": "0"
},
{
"input": "7 7 47\n47 47 47 47 47 47 47\n47 47 47 47 77 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 127 47",
"output": "-1"
},
{
"input": "7 5 47\n9583 1734 4601 5353 2110\n3802 5165 7985 6293 324\n7045 653 9160 7891 4930\n1781 3520 4178 2298 3943\n1405 2956 5447 5494 6528\n3097 1640 7750 4883 8032\n4225 8455 1875 4789 4366",
"output": "1508"
},
{
"input": "1 1 1\n1",
"output": "0"
},
{
"input": "1 1 8\n12",
"output": "0"
}
] | 1,580,824,957
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 31
| 310
| 1,740,800
|
n, m, d = list(map(int, input().rstrip().split()))
mat=[]
for _ in range(n):
mat += list(map(int, input().rstrip().split()))
mat.sort()
if n * m == 1:
print(0)
else:
flag = 1
for i in range(n * m - 1):
if (mat[i + 1] - mat[i]) % d != 0:
flag = 0
break
if flag == 0:
print(-1)
else:
if (n * m) % 2 == 1:
median = mat[(n * m) // 2]
else:
median = 0.5 * (mat[(n * m) // 2] + mat[((n * m) // 2) - 1])
# print(median)
add = 0
for x in mat:
add += abs(x - median)
ans = int(add // d)
print(ans)
|
Title: Polo the Penguin and Matrix
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little penguin Polo has an *n*<=×<=*m* matrix, consisting of integers. Let's index the matrix rows from 1 to *n* from top to bottom and let's index the columns from 1 to *m* from left to right. Let's represent the matrix element on the intersection of row *i* and column *j* as *a**ij*.
In one move the penguin can add or subtract number *d* from some matrix element. Find the minimum number of moves needed to make all matrix elements equal. If the described plan is impossible to carry out, say so.
Input Specification:
The first line contains three integers *n*, *m* and *d* (1<=≤<=*n*,<=*m*<=≤<=100,<=1<=≤<=*d*<=≤<=104) — the matrix sizes and the *d* parameter. Next *n* lines contain the matrix: the *j*-th integer in the *i*-th row is the matrix element *a**ij* (1<=≤<=*a**ij*<=≤<=104).
Output Specification:
In a single line print a single integer — the minimum number of moves the penguin needs to make all matrix elements equal. If that is impossible, print "-1" (without the quotes).
Demo Input:
['2 2 2\n2 4\n6 8\n', '1 2 7\n6 7\n']
Demo Output:
['4\n', '-1\n']
Note:
none
|
```python
n, m, d = list(map(int, input().rstrip().split()))
mat=[]
for _ in range(n):
mat += list(map(int, input().rstrip().split()))
mat.sort()
if n * m == 1:
print(0)
else:
flag = 1
for i in range(n * m - 1):
if (mat[i + 1] - mat[i]) % d != 0:
flag = 0
break
if flag == 0:
print(-1)
else:
if (n * m) % 2 == 1:
median = mat[(n * m) // 2]
else:
median = 0.5 * (mat[(n * m) // 2] + mat[((n * m) // 2) - 1])
# print(median)
add = 0
for x in mat:
add += abs(x - median)
ans = int(add // d)
print(ans)
```
| 3
|
|
920
|
C
|
Swap Adjacent Elements
|
PROGRAMMING
| 1,400
|
[
"dfs and similar",
"greedy",
"math",
"sortings",
"two pointers"
] | null | null |
You have an array *a* consisting of *n* integers. Each integer from 1 to *n* appears exactly once in this array.
For some indices *i* (1<=≤<=*i*<=≤<=*n*<=-<=1) it is possible to swap *i*-th element with (*i*<=+<=1)-th, for other indices it is not possible. You may perform any number of swapping operations any order. There is no limit on the number of times you swap *i*-th element with (*i*<=+<=1)-th (if the position is not forbidden).
Can you make this array sorted in ascending order performing some sequence of swapping operations?
|
The first line contains one integer *n* (2<=≤<=*n*<=≤<=200000) — the number of elements in the array.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=200000) — the elements of the array. Each integer from 1 to *n* appears exactly once.
The third line contains a string of *n*<=-<=1 characters, each character is either 0 or 1. If *i*-th character is 1, then you can swap *i*-th element with (*i*<=+<=1)-th any number of times, otherwise it is forbidden to swap *i*-th element with (*i*<=+<=1)-th.
|
If it is possible to sort the array in ascending order using any sequence of swaps you are allowed to make, print YES. Otherwise, print NO.
|
[
"6\n1 2 5 3 4 6\n01110\n",
"6\n1 2 5 3 4 6\n01010\n"
] |
[
"YES\n",
"NO\n"
] |
In the first example you may swap *a*<sub class="lower-index">3</sub> and *a*<sub class="lower-index">4</sub>, and then swap *a*<sub class="lower-index">4</sub> and *a*<sub class="lower-index">5</sub>.
| 0
|
[
{
"input": "6\n1 2 5 3 4 6\n01110",
"output": "YES"
},
{
"input": "6\n1 2 5 3 4 6\n01010",
"output": "NO"
},
{
"input": "6\n1 6 3 4 5 2\n01101",
"output": "NO"
},
{
"input": "6\n2 3 1 4 5 6\n01111",
"output": "NO"
},
{
"input": "4\n2 3 1 4\n011",
"output": "NO"
},
{
"input": "2\n2 1\n0",
"output": "NO"
},
{
"input": "5\n1 2 4 5 3\n0101",
"output": "NO"
},
{
"input": "5\n1 2 4 5 3\n0001",
"output": "NO"
},
{
"input": "5\n1 4 5 2 3\n0110",
"output": "NO"
},
{
"input": "5\n4 5 1 2 3\n0111",
"output": "NO"
},
{
"input": "3\n3 1 2\n10",
"output": "NO"
},
{
"input": "5\n2 3 4 5 1\n0011",
"output": "NO"
},
{
"input": "16\n3 4 14 16 11 7 13 9 10 8 6 5 15 12 1 2\n111111101111111",
"output": "NO"
},
{
"input": "5\n1 5 3 4 2\n1101",
"output": "NO"
},
{
"input": "6\n6 1 2 3 4 5\n11101",
"output": "NO"
},
{
"input": "3\n2 3 1\n01",
"output": "NO"
},
{
"input": "6\n1 6 3 4 5 2\n01110",
"output": "NO"
},
{
"input": "7\n1 7 3 4 5 6 2\n010001",
"output": "NO"
},
{
"input": "5\n5 2 3 4 1\n1001",
"output": "NO"
},
{
"input": "4\n1 3 4 2\n001",
"output": "NO"
},
{
"input": "5\n4 5 1 2 3\n1011",
"output": "NO"
},
{
"input": "6\n1 5 3 4 2 6\n11011",
"output": "NO"
},
{
"input": "5\n1 4 2 5 3\n1101",
"output": "NO"
},
{
"input": "5\n3 2 4 1 5\n1010",
"output": "NO"
},
{
"input": "6\n1 4 3 5 6 2\n01101",
"output": "NO"
},
{
"input": "6\n2 3 4 5 1 6\n00010",
"output": "NO"
},
{
"input": "10\n5 2 7 9 1 10 3 4 6 8\n111101000",
"output": "NO"
},
{
"input": "5\n2 4 3 1 5\n0110",
"output": "NO"
},
{
"input": "4\n3 1 2 4\n100",
"output": "NO"
},
{
"input": "6\n1 5 3 4 2 6\n01010",
"output": "NO"
},
{
"input": "4\n3 1 2 4\n101",
"output": "NO"
},
{
"input": "4\n2 4 3 1\n011",
"output": "NO"
},
{
"input": "4\n2 3 4 1\n001",
"output": "NO"
},
{
"input": "4\n3 4 1 2\n011",
"output": "NO"
},
{
"input": "5\n2 4 1 3 5\n0110",
"output": "NO"
},
{
"input": "4\n1 3 4 2\n101",
"output": "NO"
},
{
"input": "20\n20 19 18 17 16 15 1 2 3 4 5 14 13 12 11 10 9 8 7 6\n1111111011111111111",
"output": "NO"
},
{
"input": "6\n6 5 4 1 2 3\n11100",
"output": "NO"
},
{
"input": "5\n2 3 5 1 4\n0011",
"output": "NO"
},
{
"input": "4\n1 4 2 3\n010",
"output": "NO"
},
{
"input": "6\n1 6 3 4 5 2\n01001",
"output": "NO"
},
{
"input": "7\n1 7 2 4 3 5 6\n011110",
"output": "NO"
},
{
"input": "5\n1 3 4 2 5\n0010",
"output": "NO"
},
{
"input": "5\n5 4 3 1 2\n1110",
"output": "NO"
},
{
"input": "5\n2 5 4 3 1\n0111",
"output": "NO"
},
{
"input": "4\n2 3 4 1\n101",
"output": "NO"
},
{
"input": "5\n1 4 5 2 3\n1011",
"output": "NO"
},
{
"input": "5\n1 3 2 5 4\n1110",
"output": "NO"
},
{
"input": "6\n3 2 4 1 5 6\n10111",
"output": "NO"
},
{
"input": "7\n3 1 7 4 5 2 6\n101110",
"output": "NO"
},
{
"input": "10\n5 4 10 9 2 1 6 7 3 8\n011111111",
"output": "NO"
},
{
"input": "5\n1 5 3 2 4\n1110",
"output": "NO"
},
{
"input": "4\n2 3 4 1\n011",
"output": "NO"
},
{
"input": "5\n5 4 3 2 1\n0000",
"output": "NO"
},
{
"input": "12\n6 9 11 1 12 7 5 8 10 4 3 2\n11111111110",
"output": "NO"
},
{
"input": "5\n3 1 5 2 4\n1011",
"output": "NO"
},
{
"input": "5\n4 5 1 2 3\n1110",
"output": "NO"
},
{
"input": "10\n1 2 3 4 5 6 8 9 7 10\n000000000",
"output": "NO"
},
{
"input": "6\n5 6 3 2 4 1\n01111",
"output": "NO"
},
{
"input": "5\n1 3 4 2 5\n0100",
"output": "NO"
},
{
"input": "4\n2 1 4 3\n100",
"output": "NO"
},
{
"input": "6\n1 2 3 4 6 5\n00000",
"output": "NO"
},
{
"input": "6\n4 6 5 3 2 1\n01111",
"output": "NO"
},
{
"input": "5\n3 1 4 5 2\n1001",
"output": "NO"
},
{
"input": "5\n5 2 3 1 4\n1011",
"output": "NO"
},
{
"input": "3\n2 3 1\n10",
"output": "NO"
},
{
"input": "10\n6 5 9 4 3 2 8 10 7 1\n111111110",
"output": "NO"
},
{
"input": "7\n1 2 7 3 4 5 6\n111101",
"output": "NO"
},
{
"input": "6\n5 6 1 2 4 3\n11101",
"output": "NO"
},
{
"input": "6\n4 6 3 5 2 1\n11110",
"output": "NO"
},
{
"input": "5\n5 4 2 3 1\n1110",
"output": "NO"
},
{
"input": "2\n2 1\n1",
"output": "YES"
},
{
"input": "3\n1 3 2\n10",
"output": "NO"
},
{
"input": "5\n3 4 5 1 2\n1110",
"output": "NO"
},
{
"input": "5\n3 4 2 1 5\n0110",
"output": "NO"
},
{
"input": "6\n6 1 2 3 4 5\n10001",
"output": "NO"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10\n000000000",
"output": "YES"
},
{
"input": "3\n3 2 1\n00",
"output": "NO"
},
{
"input": "5\n5 4 3 2 1\n1110",
"output": "NO"
},
{
"input": "6\n3 1 2 5 6 4\n10011",
"output": "NO"
},
{
"input": "6\n3 2 1 6 5 4\n11000",
"output": "NO"
},
{
"input": "2\n1 2\n0",
"output": "YES"
},
{
"input": "2\n1 2\n1",
"output": "YES"
},
{
"input": "11\n1 2 3 4 5 6 7 8 9 10 11\n0000000000",
"output": "YES"
},
{
"input": "4\n2 4 3 1\n101",
"output": "NO"
},
{
"input": "4\n3 4 1 2\n101",
"output": "NO"
},
{
"input": "3\n1 3 2\n01",
"output": "YES"
},
{
"input": "6\n6 2 3 1 4 5\n11110",
"output": "NO"
},
{
"input": "3\n2 1 3\n01",
"output": "NO"
},
{
"input": "5\n1 5 4 3 2\n0111",
"output": "YES"
},
{
"input": "6\n1 2 6 3 4 5\n11110",
"output": "NO"
},
{
"input": "7\n2 3 1 7 6 5 4\n011111",
"output": "NO"
},
{
"input": "6\n5 6 1 2 3 4\n01111",
"output": "NO"
},
{
"input": "4\n1 2 4 3\n001",
"output": "YES"
},
{
"input": "6\n1 2 3 6 4 5\n11001",
"output": "NO"
},
{
"input": "11\n9 8 10 11 1 2 3 4 5 6 7\n1101111111",
"output": "NO"
},
{
"input": "5\n1 5 3 4 2\n0101",
"output": "NO"
},
{
"input": "10\n9 1 2 3 7 8 5 6 4 10\n110111100",
"output": "NO"
},
{
"input": "7\n1 2 7 3 4 5 6\n111011",
"output": "NO"
},
{
"input": "10\n3 10 1 2 6 4 5 7 8 9\n111111001",
"output": "NO"
},
{
"input": "10\n1 3 6 5 2 9 7 8 4 10\n001101111",
"output": "NO"
},
{
"input": "10\n1 8 9 7 6 10 4 2 3 5\n111111101",
"output": "NO"
},
{
"input": "7\n1 2 5 3 6 4 7\n111011",
"output": "NO"
},
{
"input": "4\n2 4 3 1\n100",
"output": "NO"
},
{
"input": "6\n1 2 3 4 6 5\n00001",
"output": "YES"
},
{
"input": "6\n2 1 3 4 5 6\n10000",
"output": "YES"
},
{
"input": "5\n3 2 1 5 4\n1100",
"output": "NO"
},
{
"input": "9\n2 1 3 6 5 4 7 9 8\n10011001",
"output": "YES"
},
{
"input": "8\n2 6 4 1 5 7 3 8\n1010010",
"output": "NO"
},
{
"input": "5\n1 2 4 5 3\n1101",
"output": "NO"
},
{
"input": "6\n1 3 5 2 4 6\n00110",
"output": "NO"
},
{
"input": "6\n1 3 6 2 4 5\n10111",
"output": "NO"
},
{
"input": "9\n9 8 7 6 5 4 3 1 2\n11111110",
"output": "NO"
},
{
"input": "10\n6 7 8 9 10 1 2 3 4 5\n111111110",
"output": "NO"
},
{
"input": "8\n6 1 7 8 3 2 5 4\n1011111",
"output": "NO"
},
{
"input": "70\n4 65 66 30 67 16 39 35 57 14 42 51 5 21 61 53 63 13 60 29 68 70 69 46 20 2 43 47 49 52 26 44 54 62 25 19 12 28 27 24 18 36 6 33 7 8 11 1 45 32 64 38 23 22 56 59 15 9 41 37 40 55 3 31 34 48 50 10 17 58\n111111101101111111111110101111111111111101101111010010110011011110010",
"output": "NO"
},
{
"input": "5\n5 3 2 4 1\n0100",
"output": "NO"
},
{
"input": "6\n3 2 6 5 1 4\n11011",
"output": "NO"
},
{
"input": "6\n1 2 4 5 6 3\n10011",
"output": "NO"
},
{
"input": "7\n1 7 3 2 5 6 4\n111001",
"output": "NO"
}
] | 1,617,948,180
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 2
| 93
| 13,107,200
|
n = int(input())
l = list(map(int,input().split()))
s = input()
ll = sorted(l)
ans = []
f = 0
for i in range(n):
if l[i]!=ll[i]:
if f==0:
f = 1
ans.append(i)
elif f==1:
ans.pop(-1)
ok = 1
for i in ans:
if s[i]=='0':
print("NO")
ok=0
break
if ok:
print('YES')
|
Title: Swap Adjacent Elements
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have an array *a* consisting of *n* integers. Each integer from 1 to *n* appears exactly once in this array.
For some indices *i* (1<=≤<=*i*<=≤<=*n*<=-<=1) it is possible to swap *i*-th element with (*i*<=+<=1)-th, for other indices it is not possible. You may perform any number of swapping operations any order. There is no limit on the number of times you swap *i*-th element with (*i*<=+<=1)-th (if the position is not forbidden).
Can you make this array sorted in ascending order performing some sequence of swapping operations?
Input Specification:
The first line contains one integer *n* (2<=≤<=*n*<=≤<=200000) — the number of elements in the array.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=200000) — the elements of the array. Each integer from 1 to *n* appears exactly once.
The third line contains a string of *n*<=-<=1 characters, each character is either 0 or 1. If *i*-th character is 1, then you can swap *i*-th element with (*i*<=+<=1)-th any number of times, otherwise it is forbidden to swap *i*-th element with (*i*<=+<=1)-th.
Output Specification:
If it is possible to sort the array in ascending order using any sequence of swaps you are allowed to make, print YES. Otherwise, print NO.
Demo Input:
['6\n1 2 5 3 4 6\n01110\n', '6\n1 2 5 3 4 6\n01010\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first example you may swap *a*<sub class="lower-index">3</sub> and *a*<sub class="lower-index">4</sub>, and then swap *a*<sub class="lower-index">4</sub> and *a*<sub class="lower-index">5</sub>.
|
```python
n = int(input())
l = list(map(int,input().split()))
s = input()
ll = sorted(l)
ans = []
f = 0
for i in range(n):
if l[i]!=ll[i]:
if f==0:
f = 1
ans.append(i)
elif f==1:
ans.pop(-1)
ok = 1
for i in ans:
if s[i]=='0':
print("NO")
ok=0
break
if ok:
print('YES')
```
| -1
|
|
61
|
A
|
Ultra-Fast Mathematician
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Ultra-Fast Mathematician
|
2
|
256
|
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
|
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
|
Write one line — the corresponding answer. Do not omit the leading 0s.
|
[
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] |
[
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] |
none
| 500
|
[
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,605,013,404
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 102
| 109
| 0
|
a1=input()
a=list(a1)
a2=input()
b=list(a2)
s=[]
for i in range(len(a)):
if a[i]==b[i]:
list.append(s,'0')
else:
list.append(s,'1')
print(''.join(s))
|
Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none
|
```python
a1=input()
a=list(a1)
a2=input()
b=list(a2)
s=[]
for i in range(len(a)):
if a[i]==b[i]:
list.append(s,'0')
else:
list.append(s,'1')
print(''.join(s))
```
| 3.97275
|
802
|
G
|
Fake News (easy)
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
|
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
|
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
|
[
"abcheaibcdi\n",
"hiedi\n"
] |
[
"YES",
"NO"
] |
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
| 0
|
[
{
"input": "abcheaibcdi",
"output": "YES"
},
{
"input": "hiedi",
"output": "NO"
},
{
"input": "ihied",
"output": "NO"
},
{
"input": "diehi",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "iheid",
"output": "NO"
},
{
"input": "eihdi",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "edhii",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "eufyajkssayhjhqcwxmctecaeepjwmfoscqprpcxsqfwnlgzsmmuwuoruantipholrauvxydfvftwfzhnckxswussvlidcojiciflpvkcxkkcmmvtfvxrkwcpeelwsuzqgamamdtdgzscmikvojfvqehblmjczkvtdeymgertgkwfwfukafqlfdhtedcctixhyetdypswgagrpyto",
"output": "YES"
},
{
"input": "arfbvxgdvqzuloojjrwoyqqbxamxybaqltfimofulusfebodjkwwrgwcppkwiodtpjaraglyplgerrpqjkpoggjmfxhwtqrijpijrcyxnoodvwpyjfpvqaoazllbrpzananbrvvybboedidtuvqquklkpeflfaltukjhzjgiofombhbmqbihgtapswykfvlgdoapjqntvqsaohmbvnphvyyhvhavslamczuqifxnwknkaenqmlvetrqogqxmlptgrmqvxzdxdmwobjesmgxckpmawtioavwdngyiwkzypfnxcovwzdohshwlavwsthdssiadhiwmhpvgkrbezm",
"output": "YES"
},
{
"input": "zcectngbqnejjjtsfrluummmqabzqbyccshjqbrjthzhlbmzjfxugvjouwhumsgrnopiyakfadjnbsesamhynsbfbfunupwbxvohfmpwlcpxhovwpfpciclatgmiufwdvtsqrsdcymvkldpnhfeisrzhyhhlkwdzthgprvkpyldeysvbmcibqkpudyrraqdlxpjecvwcvuiklcrsbgvqasmxmtxqzmawcjtozioqlfflinnxpeexbzloaeqjvglbdeufultpjqexvjjjkzemtzuzmxvawilcqdrcjzpqyhtwfphuonzwkotthsaxrmwtnlmcdylxqcfffyndqeouztluqwlhnkkvzwcfiscikv",
"output": "YES"
},
{
"input": "plqaykgovxkvsiahdbglktdlhcqwelxxmtlyymrsyubxdskvyjkrowvcbpdofpjqspsrgpakdczletxujzlsegepzleipiyycpinzxgwjsgslnxsotouddgfcybozfpjhhocpybfjbaywsehbcfrayvancbrumdfngqytnhihyxnlvilrqyhnxeckprqafofelospffhtwguzjbbjlzbqrtiielbvzutzgpqxosiaqznndgobcluuqlhmffiowkjdlkokehtjdyjvmxsiyxureflmdomerfekxdvtitvwzmdsdzplkpbtafxqfpudnhfqpoiwvjnylanunmagoweobdvfjgepbsymfutrjarlxclhgavpytiiqwvojrptofuvlohzeguxdsrihsbucelhhuedltnnjgzxwyblbqvnoliiydfinzlogbvucwykryzcyibnniggbkdkdcdgcsbvvnavtyhtkanrblpvomvjs",
"output": "YES"
},
{
"input": "fbldqzggeunkpwcfirxanmntbfrudijltoertsdvcvcmbwodbibsrxendzebvxwydpasaqnisrijctsuatihxxygbeovhxjdptdcppkvfytdpjspvrannxavmkmisqtygntxkdlousdypyfkrpzapysfpdbyprufwzhunlsfugojddkmxzinatiwfxdqmgyrnjnxvrclhxyuwxtshoqdjptmeecvgmrlvuwqtmnfnfeeiwcavwnqmyustawbjodzwsqmnjxhpqmgpysierlwbbdzcwprpsexyvreewcmlbvaiytjlxdqdaqftefdlmtmmjcwvfejshymhnouoshdzqcwzxpzupkbcievodzqkqvyjuuxxwepxjalvkzufnveji",
"output": "YES"
},
{
"input": "htsyljgoelbbuipivuzrhmfpkgderqpoprlxdpasxhpmxvaztccldtmujjzjmcpdvsdghzpretlsyyiljhjznseaacruriufswuvizwwuvdioazophhyytvbiogttnnouauxllbdn",
"output": "YES"
},
{
"input": "ikmxzqdzxqlvgeojsnhqzciujslwjyzzexnregabdqztpplosdakimjxmuqccbnwvzbajoiqgdobccwnrwmixohrbdarhoeeelzbpigiybtesybwefpcfx",
"output": "YES"
},
{
"input": "bpvbpjvbdfiodsmahxpcubjxdykesubnypalhypantshkjffmxjmelblqnjdmtaltneuyudyevkgedkqrdmrfeemgpghwrifcwincfixokfgurhqbcfzeajrgkgpwqwsepudxulywowwxzdxkumsicsvnzfxspmjpaixgejeaoyoibegosqoyoydmphfpbutrrewyjecowjckvpcceoamtfbitdneuwqfvnagswlskmsmkhmxyfsrpqwhxzocyffiumcy",
"output": "YES"
},
{
"input": "vllsexwrazvlfvhvrtqeohvzzresjdiuhomfpgqcxpqdevplecuaepixhlijatxzegciizpvyvxuembiplwklahlqibykfideysjygagjbgqkbhdhkatddcwlxboinfuomnpc",
"output": "YES"
},
{
"input": "pnjdwpxmvfoqkjtbhquqcuredrkwqzzfjmdvpnbqtypzdovemhhclkvigjvtprrpzbrbcbatkucaqteuciuozytsptvsskkeplaxdaqmjkmef",
"output": "NO"
},
{
"input": "jpwfhvlxvsdhtuozvlmnfiotrgapgjxtcsgcjnodcztupysvvvmjpzqkpommadppdrykuqkcpzojcwvlogvkddedwbggkrhuvtsvdiokehlkdlnukcufjvqxnikcdawvexxwffxtriqbdmkahxdtygodzohwtdmmuvmatdkvweqvaehaxiefpevkvqpyxsrhtmgjsdfcwzqobibeduooldrmglbinrepmunizheqzvgqvpdskhxfidxfnbisyizhepwyrcykcmjxnkyfjgrqlkixcvysa",
"output": "YES"
},
{
"input": "aftcrvuumeqbfvaqlltscnuhkpcifrrhnutjinxdhhdbzvizlrapzjdatuaynoplgjketupgaejciosofuhcgcjdcucarfvtsofgubtphijciswsvidnvpztlaarydkeqxzwdhfbmullkimerukusbrdnnujviydldrwhdfllsjtziwfeaiqotbiprespmxjulnyunkdtcghrzvhtcychkwatqqmladxpvmvlkzscthylbzkpgwlzfjqwarqvdeyngekqvrhrftpxnkfcibbowvnqdkulcdydspcubwlgoyinpnzgidbgunparnueddzwtzdiavbprbbg",
"output": "YES"
},
{
"input": "oagjghsidigeh",
"output": "NO"
},
{
"input": "chdhzpfzabupskiusjoefrwmjmqkbmdgboicnszkhdrlegeqjsldurmbshijadlwsycselhlnudndpdhcnhruhhvsgbthpruiqfirxkhpqhzhqdfpyozolbionodypfcqfeqbkcgmqkizgeyyelzeoothexcoaahedgrvoemqcwccbvoeqawqeuusyjxmgjkpfwcdttfmwunzuwvsihliexlzygqcgpbdiawfvqukikhbjerjkyhpcknlndaystrgsinghlmekbvhntcpypmchcwoglsmwwdulqneuabuuuvtyrnjxfcgoothalwkzzfxakneusezgnnepkpipzromqubraiggqndliz",
"output": "YES"
},
{
"input": "lgirxqkrkgjcutpqitmffvbujcljkqardlalyigxorscczuzikoylcxenryhskoavymexysvmhbsvhtycjlmzhijpuvcjshyfeycvvcfyzytzoyvxajpqdjtfiatnvxnyeqtfcagfftafllhhjhplbdsrfpctkqpinpdfrtlzyjllfbeffputywcckupyslkbbzpgcnxgbmhtqeqqehpdaokkjtatrhyiuusjhwgiiiikxpzdueasemosmmccoakafgvxduwiuflovhhfhffgnnjhoperhhjtvocpqytjxkmrknnknqeglffhfuplopmktykxuvcmbwpoeisrlyyhdpxfvzseucofyhziuiikihpqheqdyzwigeaqzhxzvporgisxgvhyicqyejovqloibhbunsvsunpvmdckkbuokitdzleilfwutcvuuytpupizinfjrzhxudsmjcjyfcpfgthujjowdwtgbvi",
"output": "YES"
},
{
"input": "uuehrvufgerqbzyzksmqnewacotuimawhlbycdbsmhshrsbqwybbkwjwsrkwptvlbbwjiivqugzrxxwgidrcrhrwsmwgeoleptfamzefgaeyxouxocrpvomjrazmxrnffdwrrmblgdiabdncvfougtmjgvvazasnygdrigbsrieoonirlivfyodvulouslxosswgpdexuldmkdbpdlgutiotvxjyecbrsvbmqxrlcpcipjjncduyqtohlzybvlemmfdeubihwlwqglkgjvnwrbgydcpwklmjeewqklmqdbajqgrpnynaxfvxjzgibqerxyhnxenrmcdqaaeksbzyrcaepozqpetaurlhjuxxhwppuhgoihxdxbmxeiahyaqkbknktlzkheaarjoqqrsyeducvoygwalgarldcdlqogfvsncejssmx",
"output": "YES"
},
{
"input": "iiopulfjxoitgiusqrhgbkiyzinphjtclodbkkydetylvuimkhdkklmyoacmekdvjpuxcrvqnjhqhhbfenlpzpwijtykqziocilvtpqhxuyrphdlamawjuzgjwiebkqyrzyqgtkcrhntjxqmcgkrqcslogjegfrivzidfedeegwbbsopvxvdoididlpypjogxaodtueebbwuwilacunqpozczcgrpaxxrtogpxgfkudtxchoravrrdtimhenwmnafxaruuojduxxglefejycfcyxllfimkszmbrhcwpnwjqgwvzysmlaaifdxfjjpgjmcksiigpanappjdloiolojmcqbnpnjjzaufdpjaknylmyvolhwypygwepmqwpiglpcnpypnudhdzpdvgzosyjthzcwtytxq",
"output": "YES"
}
] | 1,622,094,493
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 58
| 109
| 0
|
n = input()
h = n.find('h')
e = n.find('e',h+1)
i = n.find('i',e+1)
d = n.find('d',i+1)
i2 = n.find('i',d+1)
if h < e < i < d < i2:
print('YES')
else :
print('NO')
|
Title: Fake News (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
Input Specification:
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
Output Specification:
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
Demo Input:
['abcheaibcdi\n', 'hiedi\n']
Demo Output:
['YES', 'NO']
Note:
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
|
```python
n = input()
h = n.find('h')
e = n.find('e',h+1)
i = n.find('i',e+1)
d = n.find('d',i+1)
i2 = n.find('i',d+1)
if h < e < i < d < i2:
print('YES')
else :
print('NO')
```
| 3
|
|
96
|
A
|
Football
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] |
A. Football
|
2
|
256
|
Petya loves football very much. One day, as he was watching a football match, he was writing the players' current positions on a piece of paper. To simplify the situation he depicted it as a string consisting of zeroes and ones. A zero corresponds to players of one team; a one corresponds to players of another team. If there are at least 7 players of some team standing one after another, then the situation is considered dangerous. For example, the situation 00100110111111101 is dangerous and 11110111011101 is not. You are given the current situation. Determine whether it is dangerous or not.
|
The first input line contains a non-empty string consisting of characters "0" and "1", which represents players. The length of the string does not exceed 100 characters. There's at least one player from each team present on the field.
|
Print "YES" if the situation is dangerous. Otherwise, print "NO".
|
[
"001001\n",
"1000000001\n"
] |
[
"NO\n",
"YES\n"
] |
none
| 500
|
[
{
"input": "001001",
"output": "NO"
},
{
"input": "1000000001",
"output": "YES"
},
{
"input": "00100110111111101",
"output": "YES"
},
{
"input": "11110111111111111",
"output": "YES"
},
{
"input": "01",
"output": "NO"
},
{
"input": "10100101",
"output": "NO"
},
{
"input": "1010010100000000010",
"output": "YES"
},
{
"input": "101010101",
"output": "NO"
},
{
"input": "000000000100000000000110101100000",
"output": "YES"
},
{
"input": "100001000000110101100000",
"output": "NO"
},
{
"input": "100001000011010110000",
"output": "NO"
},
{
"input": "010",
"output": "NO"
},
{
"input": "10101011111111111111111111111100",
"output": "YES"
},
{
"input": "1001101100",
"output": "NO"
},
{
"input": "1001101010",
"output": "NO"
},
{
"input": "1111100111",
"output": "NO"
},
{
"input": "00110110001110001111",
"output": "NO"
},
{
"input": "11110001001111110001",
"output": "NO"
},
{
"input": "10001111001011111101",
"output": "NO"
},
{
"input": "10000010100000001000110001010100001001001010011",
"output": "YES"
},
{
"input": "01111011111010111100101100001011001010111110000010",
"output": "NO"
},
{
"input": "00100000100100101110011001011011101110110110010100",
"output": "NO"
},
{
"input": "10110100110001001011110101110010100010000000000100101010111110111110100011",
"output": "YES"
},
{
"input": "00011101010101111001011011001101101011111101000010100000111000011100101011",
"output": "NO"
},
{
"input": "01110000110100110101110100111000101101011101011110110100100111100001110111",
"output": "NO"
},
{
"input": "11110110011000100111100111101101011111110100010101011011111101110110110111",
"output": "YES"
},
{
"input": "100100010101110010001011001110100011100010011110100101100011010001001010001001101111001100",
"output": "NO"
},
{
"input": "111110010001011010010011111100110110001111000010100011011100111101111101110010101111011110000001010",
"output": "NO"
},
{
"input": "111110111100010100000100001010111011101011000111011011011010110010100010000101011111000011010011110",
"output": "NO"
},
{
"input": "1011110110111010110111111010010010100011111011110000011000110010011110111010110100011010100010111000",
"output": "NO"
},
{
"input": "0010100111100010110110000011100111110100111110001010000100111111111010111100101101010101001011010110",
"output": "YES"
},
{
"input": "1111010100010100101011101100101101110011000010100010000001111100010011100101010001101111000001011000",
"output": "NO"
},
{
"input": "0101100011001110001110100111100011010101011000000000110110010010111100101111010111100011101100100101",
"output": "YES"
},
{
"input": "0001101110011101110000000010011111101001101111100001001010110000110001100000010001111011011110001101",
"output": "YES"
},
{
"input": "1000010000100000100010000100001000010000100001000010000100001000010000100001000010000100001000010000",
"output": "NO"
},
{
"input": "1000000000100000000010000000001000000000100000000010000000001000000000100000000010000000001000000000",
"output": "YES"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "YES"
},
{
"input": "1111111111111111111111111111111111111111011111111111111111111111111111111111111111111111111111111111",
"output": "YES"
},
{
"input": "10100101000",
"output": "NO"
},
{
"input": "11110111011101",
"output": "NO"
},
{
"input": "10000000",
"output": "YES"
},
{
"input": "00000001",
"output": "YES"
},
{
"input": "01111111",
"output": "YES"
},
{
"input": "11111110",
"output": "YES"
}
] | 1,667,663,372
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 60
| 0
|
def is_Dangerous(s):
newS = s
i = 0
while len(newS) > 0:
if (1 - newS[0]) in newS:
if (newS[0: newS.index( 1-newS[0] ) ].count(newS[0])) >= 7: return "YES"
newS = s[i + 1:]
i += 1
return "NO"
if __name__ == '__main__':
s = "001001"
l = list("".join(s))
l = [int(num) for num in l]
print(l)
print(is_Dangerous(l))
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves football very much. One day, as he was watching a football match, he was writing the players' current positions on a piece of paper. To simplify the situation he depicted it as a string consisting of zeroes and ones. A zero corresponds to players of one team; a one corresponds to players of another team. If there are at least 7 players of some team standing one after another, then the situation is considered dangerous. For example, the situation 00100110111111101 is dangerous and 11110111011101 is not. You are given the current situation. Determine whether it is dangerous or not.
Input Specification:
The first input line contains a non-empty string consisting of characters "0" and "1", which represents players. The length of the string does not exceed 100 characters. There's at least one player from each team present on the field.
Output Specification:
Print "YES" if the situation is dangerous. Otherwise, print "NO".
Demo Input:
['001001\n', '1000000001\n']
Demo Output:
['NO\n', 'YES\n']
Note:
none
|
```python
def is_Dangerous(s):
newS = s
i = 0
while len(newS) > 0:
if (1 - newS[0]) in newS:
if (newS[0: newS.index( 1-newS[0] ) ].count(newS[0])) >= 7: return "YES"
newS = s[i + 1:]
i += 1
return "NO"
if __name__ == '__main__':
s = "001001"
l = list("".join(s))
l = [int(num) for num in l]
print(l)
print(is_Dangerous(l))
```
| 0
|
633
|
A
|
Ebony and Ivory
|
PROGRAMMING
| 1,100
|
[
"brute force",
"math",
"number theory"
] | null | null |
Dante is engaged in a fight with "The Savior". Before he can fight it with his sword, he needs to break its shields. He has two guns, Ebony and Ivory, each of them is able to perform any non-negative number of shots.
For every bullet that hits the shield, Ebony deals *a* units of damage while Ivory deals *b* units of damage. In order to break the shield Dante has to deal exactly *c* units of damage. Find out if this is possible.
|
The first line of the input contains three integers *a*, *b*, *c* (1<=≤<=*a*,<=*b*<=≤<=100,<=1<=≤<=*c*<=≤<=10<=000) — the number of units of damage dealt by Ebony gun and Ivory gun, and the total number of damage required to break the shield, respectively.
|
Print "Yes" (without quotes) if Dante can deal exactly *c* damage to the shield and "No" (without quotes) otherwise.
|
[
"4 6 15\n",
"3 2 7\n",
"6 11 6\n"
] |
[
"No\n",
"Yes\n",
"Yes\n"
] |
In the second sample, Dante can fire 1 bullet from Ebony and 2 from Ivory to deal exactly 1·3 + 2·2 = 7 damage. In the third sample, Dante can fire 1 bullet from ebony and no bullets from ivory to do 1·6 + 0·11 = 6 damage.
| 250
|
[
{
"input": "4 6 15",
"output": "No"
},
{
"input": "3 2 7",
"output": "Yes"
},
{
"input": "6 11 6",
"output": "Yes"
},
{
"input": "3 12 15",
"output": "Yes"
},
{
"input": "5 5 10",
"output": "Yes"
},
{
"input": "6 6 7",
"output": "No"
},
{
"input": "1 1 20",
"output": "Yes"
},
{
"input": "12 14 19",
"output": "No"
},
{
"input": "15 12 26",
"output": "No"
},
{
"input": "2 4 8",
"output": "Yes"
},
{
"input": "4 5 30",
"output": "Yes"
},
{
"input": "4 5 48",
"output": "Yes"
},
{
"input": "2 17 105",
"output": "Yes"
},
{
"input": "10 25 282",
"output": "No"
},
{
"input": "6 34 323",
"output": "No"
},
{
"input": "2 47 464",
"output": "Yes"
},
{
"input": "4 53 113",
"output": "Yes"
},
{
"input": "6 64 546",
"output": "Yes"
},
{
"input": "1 78 725",
"output": "Yes"
},
{
"input": "1 84 811",
"output": "Yes"
},
{
"input": "3 100 441",
"output": "Yes"
},
{
"input": "20 5 57",
"output": "No"
},
{
"input": "14 19 143",
"output": "No"
},
{
"input": "17 23 248",
"output": "No"
},
{
"input": "11 34 383",
"output": "Yes"
},
{
"input": "20 47 568",
"output": "Yes"
},
{
"input": "16 58 410",
"output": "Yes"
},
{
"input": "11 70 1199",
"output": "Yes"
},
{
"input": "16 78 712",
"output": "Yes"
},
{
"input": "20 84 562",
"output": "No"
},
{
"input": "19 100 836",
"output": "Yes"
},
{
"input": "23 10 58",
"output": "No"
},
{
"input": "25 17 448",
"output": "Yes"
},
{
"input": "22 24 866",
"output": "Yes"
},
{
"input": "24 35 67",
"output": "No"
},
{
"input": "29 47 264",
"output": "Yes"
},
{
"input": "23 56 45",
"output": "No"
},
{
"input": "25 66 1183",
"output": "Yes"
},
{
"input": "21 71 657",
"output": "Yes"
},
{
"input": "29 81 629",
"output": "No"
},
{
"input": "23 95 2226",
"output": "Yes"
},
{
"input": "32 4 62",
"output": "No"
},
{
"input": "37 15 789",
"output": "Yes"
},
{
"input": "39 24 999",
"output": "Yes"
},
{
"input": "38 32 865",
"output": "No"
},
{
"input": "32 50 205",
"output": "No"
},
{
"input": "31 57 1362",
"output": "Yes"
},
{
"input": "38 68 1870",
"output": "Yes"
},
{
"input": "36 76 549",
"output": "No"
},
{
"input": "35 84 1257",
"output": "No"
},
{
"input": "39 92 2753",
"output": "Yes"
},
{
"input": "44 1 287",
"output": "Yes"
},
{
"input": "42 12 830",
"output": "No"
},
{
"input": "42 27 9",
"output": "No"
},
{
"input": "49 40 1422",
"output": "No"
},
{
"input": "44 42 2005",
"output": "No"
},
{
"input": "50 55 2479",
"output": "No"
},
{
"input": "48 65 917",
"output": "No"
},
{
"input": "45 78 152",
"output": "No"
},
{
"input": "43 90 4096",
"output": "Yes"
},
{
"input": "43 94 4316",
"output": "Yes"
},
{
"input": "60 7 526",
"output": "Yes"
},
{
"input": "53 11 735",
"output": "Yes"
},
{
"input": "52 27 609",
"output": "Yes"
},
{
"input": "57 32 992",
"output": "Yes"
},
{
"input": "52 49 421",
"output": "No"
},
{
"input": "57 52 2634",
"output": "Yes"
},
{
"input": "54 67 3181",
"output": "Yes"
},
{
"input": "52 73 638",
"output": "No"
},
{
"input": "57 84 3470",
"output": "No"
},
{
"input": "52 100 5582",
"output": "No"
},
{
"input": "62 1 501",
"output": "Yes"
},
{
"input": "63 17 858",
"output": "Yes"
},
{
"input": "70 24 1784",
"output": "Yes"
},
{
"input": "65 32 1391",
"output": "Yes"
},
{
"input": "62 50 2775",
"output": "No"
},
{
"input": "62 58 88",
"output": "No"
},
{
"input": "66 68 3112",
"output": "Yes"
},
{
"input": "61 71 1643",
"output": "No"
},
{
"input": "69 81 3880",
"output": "No"
},
{
"input": "63 100 1960",
"output": "Yes"
},
{
"input": "73 6 431",
"output": "Yes"
},
{
"input": "75 19 736",
"output": "Yes"
},
{
"input": "78 25 247",
"output": "No"
},
{
"input": "79 36 2854",
"output": "Yes"
},
{
"input": "80 43 1864",
"output": "Yes"
},
{
"input": "76 55 2196",
"output": "Yes"
},
{
"input": "76 69 4122",
"output": "Yes"
},
{
"input": "76 76 4905",
"output": "No"
},
{
"input": "75 89 3056",
"output": "Yes"
},
{
"input": "73 100 3111",
"output": "Yes"
},
{
"input": "84 9 530",
"output": "No"
},
{
"input": "82 18 633",
"output": "No"
},
{
"input": "85 29 2533",
"output": "Yes"
},
{
"input": "89 38 2879",
"output": "Yes"
},
{
"input": "89 49 2200",
"output": "Yes"
},
{
"input": "88 60 4140",
"output": "Yes"
},
{
"input": "82 68 1299",
"output": "No"
},
{
"input": "90 76 2207",
"output": "No"
},
{
"input": "83 84 4923",
"output": "Yes"
},
{
"input": "89 99 7969",
"output": "Yes"
},
{
"input": "94 9 168",
"output": "No"
},
{
"input": "91 20 1009",
"output": "No"
},
{
"input": "93 23 2872",
"output": "Yes"
},
{
"input": "97 31 3761",
"output": "Yes"
},
{
"input": "99 46 1341",
"output": "Yes"
},
{
"input": "98 51 2845",
"output": "No"
},
{
"input": "93 66 3412",
"output": "No"
},
{
"input": "95 76 3724",
"output": "Yes"
},
{
"input": "91 87 6237",
"output": "Yes"
},
{
"input": "98 97 7886",
"output": "Yes"
},
{
"input": "12 17 15",
"output": "No"
},
{
"input": "93 94 95",
"output": "No"
},
{
"input": "27 43 27",
"output": "Yes"
},
{
"input": "17 43 68",
"output": "Yes"
},
{
"input": "44 12 12",
"output": "Yes"
},
{
"input": "44 50 150",
"output": "Yes"
},
{
"input": "1 1 10000",
"output": "Yes"
},
{
"input": "2 3 10000",
"output": "Yes"
},
{
"input": "100 1 10",
"output": "Yes"
},
{
"input": "3 2 1",
"output": "No"
},
{
"input": "1 1 1",
"output": "Yes"
},
{
"input": "9 9 10000",
"output": "No"
},
{
"input": "2 3 9995",
"output": "Yes"
},
{
"input": "3 5 4",
"output": "No"
},
{
"input": "99 98 100",
"output": "No"
},
{
"input": "6 10 2",
"output": "No"
},
{
"input": "1 6 5",
"output": "Yes"
},
{
"input": "1 4 3",
"output": "Yes"
},
{
"input": "3 2 3",
"output": "Yes"
},
{
"input": "1 7 6",
"output": "Yes"
},
{
"input": "2 3 9871",
"output": "Yes"
},
{
"input": "10 5 5",
"output": "Yes"
},
{
"input": "10 8 2",
"output": "No"
}
] | 1,456,507,885
| 985
|
Python 3
|
CHALLENGED
|
CHALLENGES
| 11
| 62
| 0
|
A, B, C = map(int, input().split())
op = False
for a in range(1, C//A+1):
if (C-A*a)%B==0:
op = True
if op == True:
print("Yes")
else:
print("No")
|
Title: Ebony and Ivory
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dante is engaged in a fight with "The Savior". Before he can fight it with his sword, he needs to break its shields. He has two guns, Ebony and Ivory, each of them is able to perform any non-negative number of shots.
For every bullet that hits the shield, Ebony deals *a* units of damage while Ivory deals *b* units of damage. In order to break the shield Dante has to deal exactly *c* units of damage. Find out if this is possible.
Input Specification:
The first line of the input contains three integers *a*, *b*, *c* (1<=≤<=*a*,<=*b*<=≤<=100,<=1<=≤<=*c*<=≤<=10<=000) — the number of units of damage dealt by Ebony gun and Ivory gun, and the total number of damage required to break the shield, respectively.
Output Specification:
Print "Yes" (without quotes) if Dante can deal exactly *c* damage to the shield and "No" (without quotes) otherwise.
Demo Input:
['4 6 15\n', '3 2 7\n', '6 11 6\n']
Demo Output:
['No\n', 'Yes\n', 'Yes\n']
Note:
In the second sample, Dante can fire 1 bullet from Ebony and 2 from Ivory to deal exactly 1·3 + 2·2 = 7 damage. In the third sample, Dante can fire 1 bullet from ebony and no bullets from ivory to do 1·6 + 0·11 = 6 damage.
|
```python
A, B, C = map(int, input().split())
op = False
for a in range(1, C//A+1):
if (C-A*a)%B==0:
op = True
if op == True:
print("Yes")
else:
print("No")
```
| -1
|
|
450
|
A
|
Jzzhu and Children
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
There are *n* children in Jzzhu's school. Jzzhu is going to give some candies to them. Let's number all the children from 1 to *n*. The *i*-th child wants to get at least *a**i* candies.
Jzzhu asks children to line up. Initially, the *i*-th child stands at the *i*-th place of the line. Then Jzzhu start distribution of the candies. He follows the algorithm:
1. Give *m* candies to the first child of the line. 1. If this child still haven't got enough candies, then the child goes to the end of the line, else the child go home. 1. Repeat the first two steps while the line is not empty.
Consider all the children in the order they go home. Jzzhu wants to know, which child will be the last in this order?
|
The first line contains two integers *n*,<=*m* (1<=≤<=*n*<=≤<=100; 1<=≤<=*m*<=≤<=100). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100).
|
Output a single integer, representing the number of the last child.
|
[
"5 2\n1 3 1 4 2\n",
"6 4\n1 1 2 2 3 3\n"
] |
[
"4\n",
"6\n"
] |
Let's consider the first sample.
Firstly child 1 gets 2 candies and go home. Then child 2 gets 2 candies and go to the end of the line. Currently the line looks like [3, 4, 5, 2] (indices of the children in order of the line). Then child 3 gets 2 candies and go home, and then child 4 gets 2 candies and goes to the end of the line. Currently the line looks like [5, 2, 4]. Then child 5 gets 2 candies and goes home. Then child 2 gets two candies and goes home, and finally child 4 gets 2 candies and goes home.
Child 4 is the last one who goes home.
| 500
|
[
{
"input": "5 2\n1 3 1 4 2",
"output": "4"
},
{
"input": "6 4\n1 1 2 2 3 3",
"output": "6"
},
{
"input": "7 3\n6 1 5 4 2 3 1",
"output": "4"
},
{
"input": "10 5\n2 7 3 6 2 5 1 3 4 5",
"output": "4"
},
{
"input": "100 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "100"
},
{
"input": "9 3\n9 5 2 3 7 1 8 4 6",
"output": "7"
},
{
"input": "20 10\n58 4 32 10 73 7 30 39 47 6 59 21 24 66 79 79 46 13 29 58",
"output": "16"
},
{
"input": "50 5\n89 56 3 2 40 37 56 52 83 59 43 83 43 59 29 74 22 58 53 41 53 67 78 30 57 32 58 29 95 46 45 85 60 49 41 82 8 71 52 40 45 26 6 71 84 91 4 93 40 54",
"output": "48"
},
{
"input": "50 1\n4 3 9 7 6 8 3 7 10 9 8 8 10 2 9 3 2 4 4 10 4 6 8 10 9 9 4 2 8 9 4 4 9 5 1 5 2 4 4 9 10 2 5 10 7 2 8 6 8 1",
"output": "44"
},
{
"input": "50 5\n3 9 10 8 3 3 4 6 8 2 9 9 3 1 2 10 6 8 7 2 7 4 2 7 5 10 2 2 2 5 10 5 6 6 8 7 10 4 3 2 10 8 6 6 8 6 4 4 1 3",
"output": "46"
},
{
"input": "50 2\n56 69 72 15 95 92 51 1 74 87 100 29 46 54 18 81 84 72 84 83 20 63 71 27 45 74 50 89 48 8 21 15 47 3 39 73 80 84 6 99 17 25 56 3 74 64 71 39 89 78",
"output": "40"
},
{
"input": "50 3\n31 39 64 16 86 3 1 9 25 54 98 42 20 3 49 41 73 37 55 62 33 77 64 22 33 82 26 13 10 13 7 40 48 18 46 79 94 72 19 12 11 61 16 37 10 49 14 94 48 69",
"output": "11"
},
{
"input": "50 100\n67 67 61 68 42 29 70 77 12 61 71 27 4 73 87 52 59 38 93 90 31 27 87 47 26 57 76 6 28 72 81 68 50 84 69 79 39 93 52 6 88 12 46 13 90 68 71 38 90 95",
"output": "50"
},
{
"input": "100 3\n4 14 20 11 19 11 14 20 5 7 6 12 11 17 5 11 7 6 2 10 13 5 12 8 5 17 20 18 7 19 11 7 7 20 20 8 10 17 17 19 20 5 15 16 19 7 11 16 4 17 2 10 1 20 20 16 19 9 9 11 5 7 12 9 9 6 20 18 13 19 8 4 8 1 2 4 10 11 15 14 1 7 17 12 13 19 12 2 3 14 15 15 5 17 14 12 17 14 16 9",
"output": "86"
},
{
"input": "100 5\n16 8 14 16 12 11 17 19 19 2 8 9 5 6 19 9 11 18 6 9 14 16 14 18 17 17 17 5 15 20 19 7 7 10 10 5 14 20 5 19 11 16 16 19 17 9 7 12 14 10 2 11 14 5 20 8 10 11 19 2 14 14 19 17 5 10 8 8 4 2 1 10 20 12 14 11 7 6 6 15 1 5 9 15 3 17 16 17 5 14 11 9 16 15 1 11 10 6 15 7",
"output": "93"
},
{
"input": "100 1\n58 94 18 50 17 14 96 62 83 80 75 5 9 22 25 41 3 96 74 45 66 37 2 37 13 85 68 54 77 11 85 19 25 21 52 59 90 61 72 89 82 22 10 16 3 68 61 29 55 76 28 85 65 76 27 3 14 10 56 37 86 18 35 38 56 68 23 88 33 38 52 87 55 83 94 34 100 41 83 56 91 77 32 74 97 13 67 31 57 81 53 39 5 88 46 1 79 4 49 42",
"output": "77"
},
{
"input": "100 2\n1 51 76 62 34 93 90 43 57 59 52 78 3 48 11 60 57 48 5 54 28 81 87 23 44 77 67 61 14 73 29 53 21 89 67 41 47 9 63 37 1 71 40 85 4 14 77 40 78 75 89 74 4 70 32 65 81 95 49 90 72 41 76 55 69 83 73 84 85 93 46 6 74 90 62 37 97 7 7 37 83 30 37 88 34 16 11 59 85 19 57 63 85 20 63 97 97 65 61 48",
"output": "97"
},
{
"input": "100 3\n30 83 14 55 61 66 34 98 90 62 89 74 45 93 33 31 75 35 82 100 63 69 48 18 99 2 36 71 14 30 70 76 96 85 97 90 49 36 6 76 37 94 70 3 63 73 75 48 39 29 13 2 46 26 9 56 1 18 54 53 85 34 2 12 1 93 75 67 77 77 14 26 33 25 55 9 57 70 75 6 87 66 18 3 41 69 73 24 49 2 20 72 39 58 91 54 74 56 66 78",
"output": "20"
},
{
"input": "100 4\n69 92 76 3 32 50 15 38 21 22 14 3 67 41 95 12 10 62 83 52 78 1 18 58 94 35 62 71 58 75 13 73 60 34 50 97 50 70 19 96 53 10 100 26 20 39 62 59 88 26 24 83 70 68 66 8 6 38 16 93 2 91 81 89 78 74 21 8 31 56 28 53 77 5 81 5 94 42 77 75 92 15 59 36 61 18 55 45 69 68 81 51 12 42 85 74 98 31 17 41",
"output": "97"
},
{
"input": "100 5\n2 72 10 60 6 50 72 34 97 77 35 43 80 64 40 53 46 6 90 22 29 70 26 68 52 19 72 88 83 18 55 32 99 81 11 21 39 42 41 63 60 97 30 23 55 78 89 35 24 50 99 52 27 76 24 8 20 27 51 37 17 82 69 18 46 19 26 77 52 83 76 65 43 66 84 84 13 30 66 88 84 23 37 1 17 26 11 50 73 56 54 37 40 29 35 8 1 39 50 82",
"output": "51"
},
{
"input": "100 7\n6 73 7 54 92 33 66 65 80 47 2 53 28 59 61 16 54 89 37 48 77 40 49 59 27 52 17 22 78 80 81 80 8 93 50 7 87 57 29 16 89 55 20 7 51 54 30 98 44 96 27 70 1 1 32 61 22 92 84 98 31 89 91 90 28 56 49 25 86 49 55 16 19 1 18 8 88 47 16 18 73 86 2 96 16 91 74 49 38 98 94 25 34 85 29 27 99 31 31 58",
"output": "97"
},
{
"input": "100 9\n36 4 45 16 19 6 10 87 44 82 71 49 70 35 83 19 40 76 45 94 44 96 10 54 82 77 86 63 11 37 21 3 15 89 80 88 89 16 72 23 25 9 51 25 10 45 96 5 6 18 51 31 42 57 41 51 42 15 89 61 45 82 16 48 61 67 19 40 9 33 90 36 78 36 79 79 16 10 83 87 9 22 84 12 23 76 36 14 2 81 56 33 56 23 57 84 76 55 35 88",
"output": "47"
},
{
"input": "100 10\n75 81 39 64 90 58 92 28 75 9 96 78 92 83 77 68 76 71 14 46 58 60 80 25 78 11 13 63 22 82 65 68 47 6 33 63 90 50 85 43 73 94 80 48 67 11 83 17 22 15 94 80 66 99 66 4 46 35 52 1 62 39 96 57 37 47 97 49 64 12 36 63 90 16 4 75 85 82 85 56 13 4 92 45 44 93 17 35 22 46 18 44 29 7 52 4 100 98 87 51",
"output": "98"
},
{
"input": "100 20\n21 19 61 70 54 97 98 14 61 72 25 94 24 56 55 25 12 80 76 11 35 17 80 26 11 94 52 47 84 61 10 2 74 25 10 21 2 79 55 50 30 75 10 64 44 5 60 96 52 16 74 41 20 77 20 44 8 86 74 36 49 61 99 13 54 64 19 99 50 43 12 73 48 48 83 55 72 73 63 81 30 27 95 9 97 82 24 3 89 90 33 14 47 88 22 78 12 75 58 67",
"output": "94"
},
{
"input": "100 30\n56 79 59 23 11 23 67 82 81 80 99 79 8 58 93 36 98 81 46 39 34 67 3 50 4 68 70 71 2 21 52 30 75 23 33 21 16 100 56 43 8 27 40 8 56 24 17 40 94 10 67 49 61 36 95 87 17 41 7 94 33 19 17 50 26 11 94 54 38 46 77 9 53 35 98 42 50 20 43 6 78 6 38 24 100 45 43 16 1 50 16 46 14 91 95 88 10 1 50 19",
"output": "95"
},
{
"input": "100 40\n86 11 97 17 38 95 11 5 13 83 67 75 50 2 46 39 84 68 22 85 70 23 64 46 59 93 39 80 35 78 93 21 83 19 64 1 49 59 99 83 44 81 70 58 15 82 83 47 55 65 91 10 2 92 4 77 37 32 12 57 78 11 42 8 59 21 96 69 61 30 44 29 12 70 91 14 10 83 11 75 14 10 19 39 8 98 5 81 66 66 79 55 36 29 22 45 19 24 55 49",
"output": "88"
},
{
"input": "100 50\n22 39 95 69 94 53 80 73 33 90 40 60 2 4 84 50 70 38 92 12 36 74 87 70 51 36 57 5 54 6 35 81 52 17 55 100 95 81 32 76 21 1 100 1 95 1 40 91 98 59 84 19 11 51 79 19 47 86 45 15 62 2 59 77 31 68 71 92 17 33 10 33 85 57 5 2 88 97 91 99 63 20 63 54 79 93 24 62 46 27 30 87 3 64 95 88 16 50 79 1",
"output": "99"
},
{
"input": "100 70\n61 48 89 17 97 6 93 13 64 50 66 88 24 52 46 99 6 65 93 64 82 37 57 41 47 1 84 5 97 83 79 46 16 35 40 7 64 15 44 96 37 17 30 92 51 67 26 3 14 56 27 68 66 93 36 39 51 6 40 55 79 26 71 54 8 48 18 2 71 12 55 60 29 37 31 97 26 37 25 68 67 70 3 87 100 41 5 82 65 92 24 66 76 48 89 8 40 93 31 95",
"output": "100"
},
{
"input": "100 90\n87 32 30 15 10 52 93 63 84 1 82 41 27 51 75 32 42 94 39 53 70 13 4 22 99 35 44 38 5 23 18 100 61 80 9 12 42 93 9 77 3 7 60 95 66 78 95 42 69 8 1 88 93 66 96 20 76 63 15 36 92 52 2 72 36 57 48 63 29 20 74 88 49 47 81 61 94 74 70 93 47 3 19 52 59 41 5 40 22 3 76 97 91 37 95 88 91 99 76 15",
"output": "98"
},
{
"input": "100 100\n79 75 7 28 6 96 38 35 57 95 41 74 24 96 32 78 81 13 63 84 24 95 3 23 66 1 60 6 96 49 41 5 14 18 31 97 66 19 49 89 49 70 51 28 20 99 18 1 28 77 24 46 69 21 40 32 31 66 28 6 66 97 9 16 70 90 91 30 34 82 93 41 65 11 39 52 1 88 63 43 80 50 60 49 28 56 18 76 24 57 74 1 28 99 36 35 79 54 18 16",
"output": "100"
},
{
"input": "1 3\n5",
"output": "1"
},
{
"input": "1 1\n100",
"output": "1"
},
{
"input": "2 3\n4 2",
"output": "1"
},
{
"input": "2 5\n99 97",
"output": "2"
},
{
"input": "3 4\n7 5 2",
"output": "2"
},
{
"input": "3 50\n47 86 51",
"output": "3"
},
{
"input": "5 100\n82 100 85 1 37",
"output": "5"
},
{
"input": "5 20\n40 39 21 5 20",
"output": "3"
},
{
"input": "1 27\n81",
"output": "1"
},
{
"input": "20 13\n7 8 29 83 74 28 93 85 7 8 3 9 8 70 49 50 39 41 57 1",
"output": "7"
},
{
"input": "2 1\n100 2",
"output": "1"
},
{
"input": "2 2\n6 4",
"output": "1"
},
{
"input": "5 2\n6 4 4 1 1",
"output": "1"
},
{
"input": "1 4\n3",
"output": "1"
},
{
"input": "3 2\n1 5 3",
"output": "2"
},
{
"input": "3 1\n3 2 2",
"output": "1"
},
{
"input": "3 1\n2 3 2",
"output": "2"
},
{
"input": "5 1\n5 1 1 1 1",
"output": "1"
},
{
"input": "2 3\n7 4",
"output": "1"
}
] | 1,686,527,216
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 49
| 46
| 0
|
import math
n,d=map(int,input().split())
c=list(map(int,input().split()))
maxi=0
for i in range(len(c)):
if math.ceil(c[i]/d)>=maxi:
maxi=math.ceil(c[i]/d)
id=i
print(id+1)
|
Title: Jzzhu and Children
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* children in Jzzhu's school. Jzzhu is going to give some candies to them. Let's number all the children from 1 to *n*. The *i*-th child wants to get at least *a**i* candies.
Jzzhu asks children to line up. Initially, the *i*-th child stands at the *i*-th place of the line. Then Jzzhu start distribution of the candies. He follows the algorithm:
1. Give *m* candies to the first child of the line. 1. If this child still haven't got enough candies, then the child goes to the end of the line, else the child go home. 1. Repeat the first two steps while the line is not empty.
Consider all the children in the order they go home. Jzzhu wants to know, which child will be the last in this order?
Input Specification:
The first line contains two integers *n*,<=*m* (1<=≤<=*n*<=≤<=100; 1<=≤<=*m*<=≤<=100). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100).
Output Specification:
Output a single integer, representing the number of the last child.
Demo Input:
['5 2\n1 3 1 4 2\n', '6 4\n1 1 2 2 3 3\n']
Demo Output:
['4\n', '6\n']
Note:
Let's consider the first sample.
Firstly child 1 gets 2 candies and go home. Then child 2 gets 2 candies and go to the end of the line. Currently the line looks like [3, 4, 5, 2] (indices of the children in order of the line). Then child 3 gets 2 candies and go home, and then child 4 gets 2 candies and goes to the end of the line. Currently the line looks like [5, 2, 4]. Then child 5 gets 2 candies and goes home. Then child 2 gets two candies and goes home, and finally child 4 gets 2 candies and goes home.
Child 4 is the last one who goes home.
|
```python
import math
n,d=map(int,input().split())
c=list(map(int,input().split()))
maxi=0
for i in range(len(c)):
if math.ceil(c[i]/d)>=maxi:
maxi=math.ceil(c[i]/d)
id=i
print(id+1)
```
| 3
|
|
260
|
A
|
Adding Digits
|
PROGRAMMING
| 1,400
|
[
"implementation",
"math"
] | null | null |
Vasya has got two number: *a* and *b*. However, Vasya finds number *a* too short. So he decided to repeat the operation of lengthening number *a* *n* times.
One operation of lengthening a number means adding exactly one digit to the number (in the decimal notation) to the right provided that the resulting number is divisible by Vasya's number *b*. If it is impossible to obtain the number which is divisible by *b*, then the lengthening operation cannot be performed.
Your task is to help Vasya and print the number he can get after applying the lengthening operation to number *a* *n* times.
|
The first line contains three integers: *a*,<=*b*,<=*n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=105).
|
In a single line print the integer without leading zeros, which Vasya can get when he applies the lengthening operations to number *a* *n* times. If no such number exists, then print number -1. If there are multiple possible answers, print any of them.
|
[
"5 4 5\n",
"12 11 1\n",
"260 150 10\n"
] |
[
"524848\n",
"121\n",
"-1\n"
] |
none
| 500
|
[
{
"input": "5 4 5",
"output": "524848"
},
{
"input": "12 11 1",
"output": "121"
},
{
"input": "260 150 10",
"output": "-1"
},
{
"input": "78843 5684 42717",
"output": "-1"
},
{
"input": "93248 91435 1133",
"output": "-1"
},
{
"input": "100000 10 64479",
"output": "1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99999 21 73839",
"output": "9999990000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99991 623 36438",
"output": "9999150000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99999 334 94854",
"output": "9999960000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99252 9827 84849",
"output": "9925270000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99313 9833 10561",
"output": "9931330000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "94885 55815 11417",
"output": "9488550000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99492 58525 53481",
"output": "9949250000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99858 28531 79193",
"output": "9985850000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99136 47208 42607",
"output": "9913680000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "63270 19953 5555",
"output": "-1"
},
{
"input": "10240 128 100000",
"output": "1024000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "12 11 3",
"output": "12100"
},
{
"input": "14 12 99998",
"output": "1440000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "1 11 3",
"output": "1100"
},
{
"input": "3 40 1",
"output": "-1"
},
{
"input": "150 100 10",
"output": "1500000000000"
},
{
"input": "5 10 1",
"output": "50"
},
{
"input": "1 15 10",
"output": "15000000000"
},
{
"input": "3 13 2",
"output": "390"
}
] | 1,641,659,122
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 5
| 2,000
| 8,601,600
|
a1, b, n = [int(x) for x in input().split()]
a = a1
for i in range(n):
for j in range(10):
if(10*a+j)%b==0:
a = 10*a + j
break
if a==a1:
print(-1)
else:
print(a)
|
Title: Adding Digits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has got two number: *a* and *b*. However, Vasya finds number *a* too short. So he decided to repeat the operation of lengthening number *a* *n* times.
One operation of lengthening a number means adding exactly one digit to the number (in the decimal notation) to the right provided that the resulting number is divisible by Vasya's number *b*. If it is impossible to obtain the number which is divisible by *b*, then the lengthening operation cannot be performed.
Your task is to help Vasya and print the number he can get after applying the lengthening operation to number *a* *n* times.
Input Specification:
The first line contains three integers: *a*,<=*b*,<=*n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=105).
Output Specification:
In a single line print the integer without leading zeros, which Vasya can get when he applies the lengthening operations to number *a* *n* times. If no such number exists, then print number -1. If there are multiple possible answers, print any of them.
Demo Input:
['5 4 5\n', '12 11 1\n', '260 150 10\n']
Demo Output:
['524848\n', '121\n', '-1\n']
Note:
none
|
```python
a1, b, n = [int(x) for x in input().split()]
a = a1
for i in range(n):
for j in range(10):
if(10*a+j)%b==0:
a = 10*a + j
break
if a==a1:
print(-1)
else:
print(a)
```
| 0
|
|
23
|
B
|
Party
|
PROGRAMMING
| 1,600
|
[
"constructive algorithms",
"graphs",
"math"
] |
B. Party
|
2
|
256
|
*n* people came to a party. Then those, who had no friends among people at the party, left. Then those, who had exactly 1 friend among those who stayed, left as well. Then those, who had exactly 2,<=3,<=...,<=*n*<=-<=1 friends among those who stayed by the moment of their leaving, did the same.
What is the maximum amount of people that could stay at the party in the end?
|
The first input line contains one number *t* — amount of tests (1<=≤<=*t*<=≤<=105). Each of the following *t* lines contains one integer number *n* (1<=≤<=*n*<=≤<=105).
|
For each test output in a separate line one number — the maximum amount of people that could stay in the end.
|
[
"1\n3\n"
] |
[
"1\n"
] |
none
| 0
|
[
{
"input": "1\n3",
"output": "1"
}
] | 1,468,904,179
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
n=int(raw_input())
for i in range(n):
k=int(raw_input())
print k-2
|
Title: Party
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
*n* people came to a party. Then those, who had no friends among people at the party, left. Then those, who had exactly 1 friend among those who stayed, left as well. Then those, who had exactly 2,<=3,<=...,<=*n*<=-<=1 friends among those who stayed by the moment of their leaving, did the same.
What is the maximum amount of people that could stay at the party in the end?
Input Specification:
The first input line contains one number *t* — amount of tests (1<=≤<=*t*<=≤<=105). Each of the following *t* lines contains one integer number *n* (1<=≤<=*n*<=≤<=105).
Output Specification:
For each test output in a separate line one number — the maximum amount of people that could stay in the end.
Demo Input:
['1\n3\n']
Demo Output:
['1\n']
Note:
none
|
```python
n=int(raw_input())
for i in range(n):
k=int(raw_input())
print k-2
```
| -1
|
667
|
A
|
Pouring Rain
|
PROGRAMMING
| 1,100
|
[
"geometry",
"math"
] | null | null |
A lot of people in Berland hates rain, but you do not. Rain pacifies, puts your thoughts in order. By these years you have developed a good tradition — when it rains, you go on the street and stay silent for a moment, contemplate all around you, enjoy freshness, think about big deeds you have to do.
Today everything had changed quietly. You went on the street with a cup contained water, your favorite drink. In a moment when you were drinking a water you noticed that the process became quite long: the cup still contained water because of rain. You decided to make a formal model of what was happening and to find if it was possible to drink all water in that situation.
Thus, your cup is a cylinder with diameter equals *d* centimeters. Initial level of water in cup equals *h* centimeters from the bottom.
You drink a water with a speed equals *v* milliliters per second. But rain goes with such speed that if you do not drink a water from the cup, the level of water increases on *e* centimeters per second. The process of drinking water from the cup and the addition of rain to the cup goes evenly and continuously.
Find the time needed to make the cup empty or find that it will never happen. It is guaranteed that if it is possible to drink all water, it will happen not later than after 104 seconds.
Note one milliliter equals to one cubic centimeter.
|
The only line of the input contains four integer numbers *d*,<=*h*,<=*v*,<=*e* (1<=≤<=*d*,<=*h*,<=*v*,<=*e*<=≤<=104), where:
- *d* — the diameter of your cylindrical cup, - *h* — the initial level of water in the cup, - *v* — the speed of drinking process from the cup in milliliters per second, - *e* — the growth of water because of rain if you do not drink from the cup.
|
If it is impossible to make the cup empty, print "NO" (without quotes).
Otherwise print "YES" (without quotes) in the first line. In the second line print a real number — time in seconds needed the cup will be empty. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=4. It is guaranteed that if the answer exists, it doesn't exceed 104.
|
[
"1 2 3 100\n",
"1 1 1 1\n"
] |
[
"NO\n",
"YES\n3.659792366325\n"
] |
In the first example the water fills the cup faster than you can drink from it.
In the second example area of the cup's bottom equals to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/419dc74dcd7bc392019c9fe748fe1fdb08ab521a.png" style="max-width: 100.0%;max-height: 100.0%;"/>, thus we can conclude that you decrease the level of water by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e8edb237e1f805fe83c2f47e48d3a9d03f2ee304.png" style="max-width: 100.0%;max-height: 100.0%;"/> centimeters per second. At the same time water level increases by 1 centimeter per second due to rain. Thus, cup will be empty in <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9dae615d7e2c5c7c03cb478848fb06aba1a8942e.png" style="max-width: 100.0%;max-height: 100.0%;"/> seconds.
| 500
|
[
{
"input": "1 2 3 100",
"output": "NO"
},
{
"input": "1 1 1 1",
"output": "YES\n3.659792366325"
},
{
"input": "48 7946 7992 72",
"output": "NO"
},
{
"input": "72 6791 8546 46",
"output": "NO"
},
{
"input": "100 5635 9099 23",
"output": "NO"
},
{
"input": "20 287 3845 5",
"output": "YES\n39.646277165210"
},
{
"input": "48 6428 9807 83",
"output": "NO"
},
{
"input": "72 5272 4552 64",
"output": "NO"
},
{
"input": "100 4117 5106 34",
"output": "NO"
},
{
"input": "20 2961 9852 15",
"output": "YES\n180.991437129723"
},
{
"input": "48 1805 3109 93",
"output": "NO"
},
{
"input": "72 8534 7042 65",
"output": "NO"
},
{
"input": "1 47 80 68",
"output": "YES\n1.388102806810"
},
{
"input": "4 495 8813 1",
"output": "YES\n0.706823517575"
},
{
"input": "5 2797 5925 9",
"output": "YES\n9.553973511669"
},
{
"input": "1 8324 4362 23",
"output": "YES\n1.505007106354"
},
{
"input": "6 1976 8455 3",
"output": "YES\n6.674898722265"
},
{
"input": "7 2644 8080 5",
"output": "YES\n12.900417790197"
},
{
"input": "3 4183 5491 98",
"output": "YES\n6.162185601824"
},
{
"input": "2 8591 320 101",
"output": "YES\n9999.259991757254"
},
{
"input": "10000 10000 10000 10000",
"output": "NO"
},
{
"input": "2 5000 12 3",
"output": "YES\n6099.653943875812"
},
{
"input": "10 1000 100 1",
"output": "YES\n3659.792366325487"
}
] | 1,462,255,354
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 46
| 4,608,000
|
import math
a = input()
a= a.split()
d = int(a[0])
h = int(a[1])
v = int(a[2])
e = int(a[3])
t = (math.pi*d*d)/(4*d-math.pi*d*d*e)
if(t > 10000):
print('NO')
elif(t<0):
print('NO')
else:
print('YES')
print(t)
|
Title: Pouring Rain
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A lot of people in Berland hates rain, but you do not. Rain pacifies, puts your thoughts in order. By these years you have developed a good tradition — when it rains, you go on the street and stay silent for a moment, contemplate all around you, enjoy freshness, think about big deeds you have to do.
Today everything had changed quietly. You went on the street with a cup contained water, your favorite drink. In a moment when you were drinking a water you noticed that the process became quite long: the cup still contained water because of rain. You decided to make a formal model of what was happening and to find if it was possible to drink all water in that situation.
Thus, your cup is a cylinder with diameter equals *d* centimeters. Initial level of water in cup equals *h* centimeters from the bottom.
You drink a water with a speed equals *v* milliliters per second. But rain goes with such speed that if you do not drink a water from the cup, the level of water increases on *e* centimeters per second. The process of drinking water from the cup and the addition of rain to the cup goes evenly and continuously.
Find the time needed to make the cup empty or find that it will never happen. It is guaranteed that if it is possible to drink all water, it will happen not later than after 104 seconds.
Note one milliliter equals to one cubic centimeter.
Input Specification:
The only line of the input contains four integer numbers *d*,<=*h*,<=*v*,<=*e* (1<=≤<=*d*,<=*h*,<=*v*,<=*e*<=≤<=104), where:
- *d* — the diameter of your cylindrical cup, - *h* — the initial level of water in the cup, - *v* — the speed of drinking process from the cup in milliliters per second, - *e* — the growth of water because of rain if you do not drink from the cup.
Output Specification:
If it is impossible to make the cup empty, print "NO" (without quotes).
Otherwise print "YES" (without quotes) in the first line. In the second line print a real number — time in seconds needed the cup will be empty. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=4. It is guaranteed that if the answer exists, it doesn't exceed 104.
Demo Input:
['1 2 3 100\n', '1 1 1 1\n']
Demo Output:
['NO\n', 'YES\n3.659792366325\n']
Note:
In the first example the water fills the cup faster than you can drink from it.
In the second example area of the cup's bottom equals to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/419dc74dcd7bc392019c9fe748fe1fdb08ab521a.png" style="max-width: 100.0%;max-height: 100.0%;"/>, thus we can conclude that you decrease the level of water by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e8edb237e1f805fe83c2f47e48d3a9d03f2ee304.png" style="max-width: 100.0%;max-height: 100.0%;"/> centimeters per second. At the same time water level increases by 1 centimeter per second due to rain. Thus, cup will be empty in <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9dae615d7e2c5c7c03cb478848fb06aba1a8942e.png" style="max-width: 100.0%;max-height: 100.0%;"/> seconds.
|
```python
import math
a = input()
a= a.split()
d = int(a[0])
h = int(a[1])
v = int(a[2])
e = int(a[3])
t = (math.pi*d*d)/(4*d-math.pi*d*d*e)
if(t > 10000):
print('NO')
elif(t<0):
print('NO')
else:
print('YES')
print(t)
```
| 0
|
|
719
|
B
|
Anatoly and Cockroaches
|
PROGRAMMING
| 1,400
|
[
"greedy"
] | null | null |
Anatoly lives in the university dorm as many other students do. As you know, cockroaches are also living there together with students. Cockroaches might be of two colors: black and red. There are *n* cockroaches living in Anatoly's room.
Anatoly just made all his cockroaches to form a single line. As he is a perfectionist, he would like the colors of cockroaches in the line to alternate. He has a can of black paint and a can of red paint. In one turn he can either swap any two cockroaches, or take any single cockroach and change it's color.
Help Anatoly find out the minimum number of turns he needs to make the colors of cockroaches in the line alternate.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of cockroaches.
The second line contains a string of length *n*, consisting of characters 'b' and 'r' that denote black cockroach and red cockroach respectively.
|
Print one integer — the minimum number of moves Anatoly has to perform in order to make the colors of cockroaches in the line to alternate.
|
[
"5\nrbbrr\n",
"5\nbbbbb\n",
"3\nrbr\n"
] |
[
"1\n",
"2\n",
"0\n"
] |
In the first sample, Anatoly has to swap third and fourth cockroaches. He needs 1 turn to do this.
In the second sample, the optimum answer is to paint the second and the fourth cockroaches red. This requires 2 turns.
In the third sample, the colors of cockroaches in the line are alternating already, thus the answer is 0.
| 1,000
|
[
{
"input": "5\nrbbrr",
"output": "1"
},
{
"input": "5\nbbbbb",
"output": "2"
},
{
"input": "3\nrbr",
"output": "0"
},
{
"input": "13\nrbbbrbrrbrrbb",
"output": "3"
},
{
"input": "18\nrrrrrrrrrrrrrrrrrb",
"output": "8"
},
{
"input": "100\nbrbbbrrrbbrbrbbrbbrbbbbrbbrrbbbrrbbbbrbrbbbbbbbbbbbbbbbbrrrrbbbbrrrbbbbbbbrbrrbrbbbbrrrbbbbrbbrbbbrb",
"output": "34"
},
{
"input": "166\nrbbbbbbbbbbbbrbrrbbrbbbrbbbbbbbbbbrbbbbbbrbbbrbbbbbrbbbbbbbrbbbbbbbrbbrbbbbbbbbrbbbbbbbbbbbbbbrrbbbrbbbbbbbbbbbbbbrbrbbbbbbbbbbbrbbbbbbbbbbbbbbrbbbbbbbbbbbbbbbbbbbbbb",
"output": "70"
},
{
"input": "1\nr",
"output": "0"
},
{
"input": "1\nb",
"output": "0"
},
{
"input": "2\nrb",
"output": "0"
},
{
"input": "2\nbr",
"output": "0"
},
{
"input": "2\nrr",
"output": "1"
},
{
"input": "2\nbb",
"output": "1"
},
{
"input": "8\nrbbrbrbr",
"output": "1"
},
{
"input": "7\nrrbrbrb",
"output": "1"
}
] | 1,479,592,862
| 1,262
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include <bits/stdc++.h>
#define all(v) v.begin(), v.end()
#define sz(v) (int)(v.size())
#define clr(v, d) memset(v, d, sizeof(v))
#define pb push_back
#define mp make_pair
#define F first
#define S second
#define MAX 110
using namespace std;
typedef long long ll;
typedef vector<int> vi;
typedef vector< vector<int> > vvi;
typedef pair<int, int> ii;
typedef vector<ii> vii;
const ll OO = (ll)1e14+7;
const int MX = (int)1e3+7;
const int mod = (int)1e9+7;
int main(void){
ios_base::sync_with_stdio(false);
int n;
string s;
while(cin>>n>>s){
int res = n;
int r=0, b=0;
for(int i=0; i<n; i++){
if(s[i]!='r' && i%2==0){
r++;
}
if(s[i]!='b' && i%2!=0){
b++;
}
}
int ch = min(r, b);
res = min(res, max(r, b));
int r1=0, b1=0;
for(int i=0; i<n; i++){
if(s[i]!='r' && i%2!=0){
r1++;
}
if(s[i]!='b' && i%2==0){
b1++;
}
}
int ch1 = min(r1, b1);
res = min(res, max(r1, b1));
cout<<res<<"\n";
}
return 0;
}
|
Title: Anatoly and Cockroaches
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anatoly lives in the university dorm as many other students do. As you know, cockroaches are also living there together with students. Cockroaches might be of two colors: black and red. There are *n* cockroaches living in Anatoly's room.
Anatoly just made all his cockroaches to form a single line. As he is a perfectionist, he would like the colors of cockroaches in the line to alternate. He has a can of black paint and a can of red paint. In one turn he can either swap any two cockroaches, or take any single cockroach and change it's color.
Help Anatoly find out the minimum number of turns he needs to make the colors of cockroaches in the line alternate.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of cockroaches.
The second line contains a string of length *n*, consisting of characters 'b' and 'r' that denote black cockroach and red cockroach respectively.
Output Specification:
Print one integer — the minimum number of moves Anatoly has to perform in order to make the colors of cockroaches in the line to alternate.
Demo Input:
['5\nrbbrr\n', '5\nbbbbb\n', '3\nrbr\n']
Demo Output:
['1\n', '2\n', '0\n']
Note:
In the first sample, Anatoly has to swap third and fourth cockroaches. He needs 1 turn to do this.
In the second sample, the optimum answer is to paint the second and the fourth cockroaches red. This requires 2 turns.
In the third sample, the colors of cockroaches in the line are alternating already, thus the answer is 0.
|
```python
#include <bits/stdc++.h>
#define all(v) v.begin(), v.end()
#define sz(v) (int)(v.size())
#define clr(v, d) memset(v, d, sizeof(v))
#define pb push_back
#define mp make_pair
#define F first
#define S second
#define MAX 110
using namespace std;
typedef long long ll;
typedef vector<int> vi;
typedef vector< vector<int> > vvi;
typedef pair<int, int> ii;
typedef vector<ii> vii;
const ll OO = (ll)1e14+7;
const int MX = (int)1e3+7;
const int mod = (int)1e9+7;
int main(void){
ios_base::sync_with_stdio(false);
int n;
string s;
while(cin>>n>>s){
int res = n;
int r=0, b=0;
for(int i=0; i<n; i++){
if(s[i]!='r' && i%2==0){
r++;
}
if(s[i]!='b' && i%2!=0){
b++;
}
}
int ch = min(r, b);
res = min(res, max(r, b));
int r1=0, b1=0;
for(int i=0; i<n; i++){
if(s[i]!='r' && i%2!=0){
r1++;
}
if(s[i]!='b' && i%2==0){
b1++;
}
}
int ch1 = min(r1, b1);
res = min(res, max(r1, b1));
cout<<res<<"\n";
}
return 0;
}
```
| -1
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,650,133,591
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 1
| 154
| 0
|
word = input()
new_word = list(word)
low = 0
up = 0
for i in new_word:
if i >= 'A' or i <= 'Z':
up += 1
else:
low += 1
if low > up:
word = word.upper()
print(word)
else:
word = word.lower()
print(word)
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
word = input()
new_word = list(word)
low = 0
up = 0
for i in new_word:
if i >= 'A' or i <= 'Z':
up += 1
else:
low += 1
if low > up:
word = word.upper()
print(word)
else:
word = word.lower()
print(word)
```
| 0
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,585,126,644
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 93
| 204,800
|
import sys
a = str(input())
mass = []
for i in range (0, len(a)):
if a[i] == 'h':
mass.append('h')
break
else:
print ('NO')
sys.exit()
if a[i] == 'e':
mass.append('e')
break
else:
print ('NO')
sys.exit()
if a[i] == 'l':
mass.append('l')
break
else:
print ('NO')
sys.exit()
if a[i] == 'l':
mass.append('l')
break
else:
print ('NO')
sys.exit()
if a[i] == 'o':
mass.append('o')
break
else:
print ('NO')
sys.exit()
print ('YES')
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
import sys
a = str(input())
mass = []
for i in range (0, len(a)):
if a[i] == 'h':
mass.append('h')
break
else:
print ('NO')
sys.exit()
if a[i] == 'e':
mass.append('e')
break
else:
print ('NO')
sys.exit()
if a[i] == 'l':
mass.append('l')
break
else:
print ('NO')
sys.exit()
if a[i] == 'l':
mass.append('l')
break
else:
print ('NO')
sys.exit()
if a[i] == 'o':
mass.append('o')
break
else:
print ('NO')
sys.exit()
print ('YES')
```
| 0
|
794
|
A
|
Bank Robbery
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
A robber has attempted to rob a bank but failed to complete his task. However, he had managed to open all the safes.
Oleg the bank client loves money (who doesn't), and decides to take advantage of this failed robbery and steal some money from the safes. There are many safes arranged in a line, where the *i*-th safe from the left is called safe *i*. There are *n* banknotes left in all the safes in total. The *i*-th banknote is in safe *x**i*. Oleg is now at safe *a*. There are two security guards, one of which guards the safe *b* such that *b*<=<<=*a*, i.e. the first guard is to the left of Oleg. The other guard guards the safe *c* so that *c*<=><=*a*, i.e. he is to the right of Oleg.
The two guards are very lazy, so they do not move. In every second, Oleg can either take all the banknotes from the current safe or move to any of the neighboring safes. However, he cannot visit any safe that is guarded by security guards at any time, becaues he might be charged for stealing. Determine the maximum amount of banknotes Oleg can gather.
|
The first line of input contains three space-separated integers, *a*, *b* and *c* (1<=≤<=*b*<=<<=*a*<=<<=*c*<=≤<=109), denoting the positions of Oleg, the first security guard and the second security guard, respectively.
The next line of input contains a single integer *n* (1<=≤<=*n*<=≤<=105), denoting the number of banknotes.
The next line of input contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109), denoting that the *i*-th banknote is located in the *x**i*-th safe. Note that *x**i* are not guaranteed to be distinct.
|
Output a single integer: the maximum number of banknotes Oleg can take.
|
[
"5 3 7\n8\n4 7 5 5 3 6 2 8\n",
"6 5 7\n5\n1 5 7 92 3\n"
] |
[
"4\n",
"0\n"
] |
In the first example Oleg can take the banknotes in positions 4, 5, 6 (note that there are 2 banknotes at position 5). Oleg can't take the banknotes in safes 7 and 8 because he can't run into the second security guard. Similarly, Oleg cannot take the banknotes at positions 3 and 2 because he can't run into the first security guard. Thus, he can take a maximum of 4 banknotes.
For the second sample, Oleg can't take any banknotes without bumping into any of the security guards.
| 500
|
[
{
"input": "5 3 7\n8\n4 7 5 5 3 6 2 8",
"output": "4"
},
{
"input": "6 5 7\n5\n1 5 7 92 3",
"output": "0"
},
{
"input": "3 2 4\n1\n3",
"output": "1"
},
{
"input": "5 3 8\n12\n8 3 4 5 7 6 8 3 5 4 7 6",
"output": "8"
},
{
"input": "7 3 10\n5\n3 3 3 3 3",
"output": "0"
},
{
"input": "3 2 5\n4\n1 3 4 5",
"output": "2"
},
{
"input": "3 2 4\n1\n1",
"output": "0"
},
{
"input": "6 4 8\n1\n4",
"output": "0"
},
{
"input": "2 1 3\n1\n3",
"output": "0"
}
] | 1,682,520,495
| 195
|
PyPy 3
|
OK
|
TESTS
| 46
| 186
| 9,420,800
|
import sys, os, io
input = io.BytesIO(os.read(0, os.fstat(0).st_size)).readline
a, b, c = map(int, input().split())
n = int(input())
x = list(map(int, input().split()))
ans = 0
for i in x:
if b < i < c:
ans += 1
print(ans)
|
Title: Bank Robbery
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A robber has attempted to rob a bank but failed to complete his task. However, he had managed to open all the safes.
Oleg the bank client loves money (who doesn't), and decides to take advantage of this failed robbery and steal some money from the safes. There are many safes arranged in a line, where the *i*-th safe from the left is called safe *i*. There are *n* banknotes left in all the safes in total. The *i*-th banknote is in safe *x**i*. Oleg is now at safe *a*. There are two security guards, one of which guards the safe *b* such that *b*<=<<=*a*, i.e. the first guard is to the left of Oleg. The other guard guards the safe *c* so that *c*<=><=*a*, i.e. he is to the right of Oleg.
The two guards are very lazy, so they do not move. In every second, Oleg can either take all the banknotes from the current safe or move to any of the neighboring safes. However, he cannot visit any safe that is guarded by security guards at any time, becaues he might be charged for stealing. Determine the maximum amount of banknotes Oleg can gather.
Input Specification:
The first line of input contains three space-separated integers, *a*, *b* and *c* (1<=≤<=*b*<=<<=*a*<=<<=*c*<=≤<=109), denoting the positions of Oleg, the first security guard and the second security guard, respectively.
The next line of input contains a single integer *n* (1<=≤<=*n*<=≤<=105), denoting the number of banknotes.
The next line of input contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109), denoting that the *i*-th banknote is located in the *x**i*-th safe. Note that *x**i* are not guaranteed to be distinct.
Output Specification:
Output a single integer: the maximum number of banknotes Oleg can take.
Demo Input:
['5 3 7\n8\n4 7 5 5 3 6 2 8\n', '6 5 7\n5\n1 5 7 92 3\n']
Demo Output:
['4\n', '0\n']
Note:
In the first example Oleg can take the banknotes in positions 4, 5, 6 (note that there are 2 banknotes at position 5). Oleg can't take the banknotes in safes 7 and 8 because he can't run into the second security guard. Similarly, Oleg cannot take the banknotes at positions 3 and 2 because he can't run into the first security guard. Thus, he can take a maximum of 4 banknotes.
For the second sample, Oleg can't take any banknotes without bumping into any of the security guards.
|
```python
import sys, os, io
input = io.BytesIO(os.read(0, os.fstat(0).st_size)).readline
a, b, c = map(int, input().split())
n = int(input())
x = list(map(int, input().split()))
ans = 0
for i in x:
if b < i < c:
ans += 1
print(ans)
```
| 3
|
|
248
|
A
|
Cupboards
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house.
Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find.
And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open.
Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position.
Your task is to write a program that will determine the required number of seconds *t*.
|
The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero.
The numbers in the lines are separated by single spaces.
|
In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs.
|
[
"5\n0 1\n1 0\n0 1\n1 1\n0 1\n"
] |
[
"3\n"
] |
none
| 500
|
[
{
"input": "5\n0 1\n1 0\n0 1\n1 1\n0 1",
"output": "3"
},
{
"input": "2\n0 0\n0 0",
"output": "0"
},
{
"input": "3\n0 1\n1 1\n1 1",
"output": "1"
},
{
"input": "8\n0 1\n1 0\n0 1\n1 1\n0 1\n1 0\n0 1\n1 0",
"output": "7"
},
{
"input": "8\n1 0\n1 0\n1 0\n0 1\n0 1\n1 1\n1 1\n0 1",
"output": "6"
},
{
"input": "15\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "5\n1 0\n1 0\n1 0\n0 1\n0 1",
"output": "4"
}
] | 1,595,306,323
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 57
| 248
| 7,168,000
|
import sys
def input(): return sys.stdin.readline().strip()
def iinput(): return int(input())
def rinput(): return map(int, sys.stdin.readline().strip().split())
def get_list(): return list(map(int, sys.stdin.readline().strip().split()))
n=iinput()
col1 = []
col2 = []
for i in range (n):
temp = get_list()
col1.append(temp[0])
col2.append(temp[1])
#print(a)
z1 = col1.count(0)
o1 = col1.count(1)
z2 = col2.count(0)
o2 = col2.count(1)
count=0
if (z1>=o1):
count += o1
else:
count += z1
if (z2>=o2):
count += o2
else:
count += z2
print(count)
|
Title: Cupboards
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house.
Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find.
And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open.
Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position.
Your task is to write a program that will determine the required number of seconds *t*.
Input Specification:
The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero.
The numbers in the lines are separated by single spaces.
Output Specification:
In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs.
Demo Input:
['5\n0 1\n1 0\n0 1\n1 1\n0 1\n']
Demo Output:
['3\n']
Note:
none
|
```python
import sys
def input(): return sys.stdin.readline().strip()
def iinput(): return int(input())
def rinput(): return map(int, sys.stdin.readline().strip().split())
def get_list(): return list(map(int, sys.stdin.readline().strip().split()))
n=iinput()
col1 = []
col2 = []
for i in range (n):
temp = get_list()
col1.append(temp[0])
col2.append(temp[1])
#print(a)
z1 = col1.count(0)
o1 = col1.count(1)
z2 = col2.count(0)
o2 = col2.count(1)
count=0
if (z1>=o1):
count += o1
else:
count += z1
if (z2>=o2):
count += o2
else:
count += z2
print(count)
```
| 3
|
|
560
|
A
|
Currency System in Geraldion
|
PROGRAMMING
| 1,000
|
[
"implementation",
"sortings"
] | null | null |
A magic island Geraldion, where Gerald lives, has its own currency system. It uses banknotes of several values. But the problem is, the system is not perfect and sometimes it happens that Geraldionians cannot express a certain sum of money with any set of banknotes. Of course, they can use any number of banknotes of each value. Such sum is called unfortunate. Gerald wondered: what is the minimum unfortunate sum?
|
The first line contains number *n* (1<=≤<=*n*<=≤<=1000) — the number of values of the banknotes that used in Geraldion.
The second line contains *n* distinct space-separated numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=106) — the values of the banknotes.
|
Print a single line — the minimum unfortunate sum. If there are no unfortunate sums, print <=-<=1.
|
[
"5\n1 2 3 4 5\n"
] |
[
"-1\n"
] |
none
| 500
|
[
{
"input": "5\n1 2 3 4 5",
"output": "-1"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "10\n371054 506438 397130 1 766759 208409 769264 549213 641270 771837",
"output": "-1"
},
{
"input": "10\n635370 154890 909382 220996 276501 716105 538714 140162 171960 271264",
"output": "1"
},
{
"input": "50\n110876 835020 859879 999908 712969 788264 287153 921820 330355 499311 209594 484829 296329 940051 174081 931503 1 780512 390075 97866 124255 950067 697612 244256 782385 789882 37608 82153 399889 598867 416717 377988 535636 511221 792568 683271 131077 290194 496712 330720 587436 563481 645817 942562 654093 980561 382937 48293 582608 116156",
"output": "-1"
},
{
"input": "50\n474421 421097 217233 156339 27075 733996 281778 863492 184707 956857 288561 70997 393786 337382 663642 131184 637 273801 799870 295017 392338 842567 161819 297705 102013 930684 375703 838048 154915 138503 629056 256591 893619 19263 787927 684541 320265 841090 421423 490879 394582 493952 619247 633202 612928 50907 276653 407819 489945 153173",
"output": "1"
},
{
"input": "1\n1",
"output": "-1"
},
{
"input": "1\n1000000",
"output": "1"
},
{
"input": "2\n3 2",
"output": "1"
},
{
"input": "2\n2 3",
"output": "1"
}
] | 1,629,489,116
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 16
| 62
| 6,963,200
|
n = int(input())
a = input().split()
ans = -1
if not '1' in a:
ans = 1
print(ans)
|
Title: Currency System in Geraldion
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A magic island Geraldion, where Gerald lives, has its own currency system. It uses banknotes of several values. But the problem is, the system is not perfect and sometimes it happens that Geraldionians cannot express a certain sum of money with any set of banknotes. Of course, they can use any number of banknotes of each value. Such sum is called unfortunate. Gerald wondered: what is the minimum unfortunate sum?
Input Specification:
The first line contains number *n* (1<=≤<=*n*<=≤<=1000) — the number of values of the banknotes that used in Geraldion.
The second line contains *n* distinct space-separated numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=106) — the values of the banknotes.
Output Specification:
Print a single line — the minimum unfortunate sum. If there are no unfortunate sums, print <=-<=1.
Demo Input:
['5\n1 2 3 4 5\n']
Demo Output:
['-1\n']
Note:
none
|
```python
n = int(input())
a = input().split()
ans = -1
if not '1' in a:
ans = 1
print(ans)
```
| 3
|
|
152
|
C
|
Pocket Book
|
PROGRAMMING
| 1,400
|
[
"combinatorics"
] | null | null |
One day little Vasya found mom's pocket book. The book had *n* names of her friends and unusually enough, each name was exactly *m* letters long. Let's number the names from 1 to *n* in the order in which they are written.
As mom wasn't home, Vasya decided to play with names: he chose three integers *i*, *j*, *k* (1<=≤<=*i*<=<<=*j*<=≤<=*n*, 1<=≤<=*k*<=≤<=*m*), then he took names number *i* and *j* and swapped their prefixes of length *k*. For example, if we take names "CBDAD" and "AABRD" and swap their prefixes with the length of 3, the result will be names "AABAD" and "CBDRD".
You wonder how many different names Vasya can write instead of name number 1, if Vasya is allowed to perform any number of the described actions. As Vasya performs each action, he chooses numbers *i*, *j*, *k* independently from the previous moves and his choice is based entirely on his will. The sought number can be very large, so you should only find it modulo 1000000007 (109<=+<=7).
|
The first input line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of names and the length of each name, correspondingly. Then *n* lines contain names, each name consists of exactly *m* uppercase Latin letters.
|
Print the single number — the number of different names that could end up in position number 1 in the pocket book after the applying the procedures described above. Print the number modulo 1000000007 (109<=+<=7).
|
[
"2 3\nAAB\nBAA\n",
"4 5\nABABA\nBCGDG\nAAAAA\nYABSA\n"
] |
[
"4\n",
"216\n"
] |
In the first sample Vasya can get the following names in the position number 1: "AAB", "AAA", "BAA" and "BAB".
| 1,500
|
[
{
"input": "2 3\nAAB\nBAA",
"output": "4"
},
{
"input": "4 5\nABABA\nBCGDG\nAAAAA\nYABSA",
"output": "216"
},
{
"input": "1 1\nE",
"output": "1"
},
{
"input": "2 2\nNS\nPD",
"output": "4"
},
{
"input": "3 4\nPJKD\nNFJX\nFGFK",
"output": "81"
},
{
"input": "4 5\nSXFMY\nATHLM\nKDDQW\nZWGDS",
"output": "1024"
},
{
"input": "20 14\nJNFKBBBJYZHWQE\nLBOKZCPFNKDBJY\nXKNWGHQHIOXUPF\nDDNRUKVUGHWMXW\nMTIZFNAAFEAPHX\nIXBQOOHEULZYHU\nMRCSREUEOOMUUN\nHJTSQWKUFYZDQU\nGMCMUZCOPRVEIQ\nXBKKGGJECOBLTH\nXXHTLXCNJZJUAF\nVLJRKXXXWMTPKZ\nPTYMNPTBBCWKAD\nQYJGOBUBHMEDYE\nGTKUUVVNKAHTUI\nZNKXYZPCYLBZFP\nQCBLJTRMBDWNNE\nTDOKJOBKEOVNLZ\nFKZUITYAFJOQIM\nUWQNSGLXEEIRWF",
"output": "515139391"
},
{
"input": "5 14\nAQRXUQQNSKZPGC\nDTTKSPFGGVCLPT\nVLZQWWESCHDTAZ\nCOKOWDWDRUOMHP\nXDTRBIZTTCIDGS",
"output": "124999979"
},
{
"input": "9 23\nOILBYKHRGMPENVFNHLSIUOW\nLPJFHTUQUINAALRDGLSQUXR\nLYYJJEBNZATAFQWTDZSPUNZ\nHSJPIQKKWWERJZIEMLCZUKI\nOJYIEYDGPFWRHCMISJCCUEM\nLMGKZVFYIVDRTIHBWPCNUTG\nUBGGNCITVHAIPKXCLTSAULQ\nOWSAWUOXQDBSXXBHTLSXUVD\nUGQTIZQPBGMASRQPVPSFUWK",
"output": "454717784"
},
{
"input": "25 4\nLVKG\nMICU\nZHKW\nLFGG\nOWQO\nLCQG\nLVXU\nOUKB\nLNQX\nZJTO\nOOQX\nLVQP\nMFQB\nMRQV\nOIQH\nOPXX\nXFKU\nFCQB\nZPKH\nLVCH\nNFCU\nOVQW\nOZKU\nLFHX\nLPXO",
"output": "5733"
},
{
"input": "30 10\nUTNTGOKZYJ\nQHOUHNYZVW\nLTVGHJRZVW\nMZHYHOLZYJ\nERYEUEPZYE\nUZDBFTURYJ\nRVSMQTIZGW\nWDJQHMIRYY\nKCORHQPZYE\nRRPLFOZZVY\nJTXMFNNNYJ\nMVTGGOZZVV\nEHAFFNUZVF\nLBRNWJZNYE\nJVMOHTPZYJ\nWTARFJLZVV\nLVJCWOURVW\nLCLQFJYRVV\nQVBVGNJRYF\nNTZGHOLRYE\nMGQKHOUPYJ\nRRSSBXPZYJ\nRYCRGTLZYJ\nJRDEGNKRVW\nRZKFGHYRVG\nMDJBFNIZYG\nMPLWHXIZYE\nSRZMHMURVE\nMTEBBMRZYJ\nJPJIFOLZYM",
"output": "919913906"
},
{
"input": "40 7\nPNTVVER\nPAHTQDR\nRXMJVAS\nVIQNLYC\nILPUSVX\nYJOXQDJ\nSEFODTO\nOTJMREL\nLIQRZGD\nLBJJPOR\nRUTYHQO\nRIWEPBD\nKQUMFIB\nISTRRYH\nXBTOTGK\nRFQODEY\nHDSTZTP\nYCXFAGL\nAREGRFU\nLELZUYU\nGVABDKH\nFJAMMME\nACVULXE\nJHVPJAS\nAAQNMBX\nJJGUCXG\nOQATILQ\nNEOSHJM\nHFLWOFM\nICYEQHY\nFACGLYP\nPLLXJEQ\nDCHXYPB\nAGDDZJJ\nLSQRXTN\nHDQZXIY\nNAHDDWW\nQCMXRQN\nFDUDSZO\nHKBEVTW",
"output": "206575993"
},
{
"input": "2 2\nAA\nBB",
"output": "4"
},
{
"input": "1 10\nAAAAAAAAAA",
"output": "1"
},
{
"input": "2 8\nAAAAAAAA\nBBBBBBBB",
"output": "256"
},
{
"input": "10 10\nAAAAAAAAAA\nBBBBBBBBBB\nCCCCCCCCCC\nDDDDDDDDDD\nAAAAAAAAAA\nBBBBBBBBBB\nCCCCCCCCCC\nDDDDDDDDDD\nAAAAAAAAAA\nBBBBBBBBBB",
"output": "1048576"
},
{
"input": "1 20\nAAAAAAAAAAAAAAAAAAAA",
"output": "1"
},
{
"input": "20 1\nA\nB\nC\nD\nE\nF\nG\nA\nB\nC\nD\nE\nF\nG\nA\nB\nC\nD\nE\nF",
"output": "7"
},
{
"input": "5 60\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC\nDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD\nEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE",
"output": "449874206"
},
{
"input": "50 4\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ",
"output": "10000"
},
{
"input": "1 100\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "1"
},
{
"input": "100 1\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA",
"output": "1"
},
{
"input": "100 1\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB",
"output": "2"
},
{
"input": "100 1\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB",
"output": "14"
},
{
"input": "100 1\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV",
"output": "26"
}
] | 1,622,825,696
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 60
| 248
| 0
|
# find the unique set of string for all prefix length
n, m = list(map(int, input().split()))
names = []
for _ in range(n):
names.append(input())
mod = int(1e9+7)
ans = 1
for l in range(m):
uniques = set()
for name in names:
uniques.add(name[l])
ans = (ans%mod * len(uniques)%mod)%mod
print(ans)
|
Title: Pocket Book
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day little Vasya found mom's pocket book. The book had *n* names of her friends and unusually enough, each name was exactly *m* letters long. Let's number the names from 1 to *n* in the order in which they are written.
As mom wasn't home, Vasya decided to play with names: he chose three integers *i*, *j*, *k* (1<=≤<=*i*<=<<=*j*<=≤<=*n*, 1<=≤<=*k*<=≤<=*m*), then he took names number *i* and *j* and swapped their prefixes of length *k*. For example, if we take names "CBDAD" and "AABRD" and swap their prefixes with the length of 3, the result will be names "AABAD" and "CBDRD".
You wonder how many different names Vasya can write instead of name number 1, if Vasya is allowed to perform any number of the described actions. As Vasya performs each action, he chooses numbers *i*, *j*, *k* independently from the previous moves and his choice is based entirely on his will. The sought number can be very large, so you should only find it modulo 1000000007 (109<=+<=7).
Input Specification:
The first input line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of names and the length of each name, correspondingly. Then *n* lines contain names, each name consists of exactly *m* uppercase Latin letters.
Output Specification:
Print the single number — the number of different names that could end up in position number 1 in the pocket book after the applying the procedures described above. Print the number modulo 1000000007 (109<=+<=7).
Demo Input:
['2 3\nAAB\nBAA\n', '4 5\nABABA\nBCGDG\nAAAAA\nYABSA\n']
Demo Output:
['4\n', '216\n']
Note:
In the first sample Vasya can get the following names in the position number 1: "AAB", "AAA", "BAA" and "BAB".
|
```python
# find the unique set of string for all prefix length
n, m = list(map(int, input().split()))
names = []
for _ in range(n):
names.append(input())
mod = int(1e9+7)
ans = 1
for l in range(m):
uniques = set()
for name in names:
uniques.add(name[l])
ans = (ans%mod * len(uniques)%mod)%mod
print(ans)
```
| 3
|
|
772
|
A
|
Voltage Keepsake
|
PROGRAMMING
| 1,800
|
[
"binary search",
"math"
] | null | null |
You have *n* devices that you want to use simultaneously.
The *i*-th device uses *a**i* units of power per second. This usage is continuous. That is, in λ seconds, the device will use λ·*a**i* units of power. The *i*-th device currently has *b**i* units of power stored. All devices can store an arbitrary amount of power.
You have a single charger that can plug to any single device. The charger will add *p* units of power per second to a device. This charging is continuous. That is, if you plug in a device for λ seconds, it will gain λ·*p* units of power. You can switch which device is charging at any arbitrary unit of time (including real numbers), and the time it takes to switch is negligible.
You are wondering, what is the maximum amount of time you can use the devices until one of them hits 0 units of power.
If you can use the devices indefinitely, print -1. Otherwise, print the maximum amount of time before any one device hits 0 power.
|
The first line contains two integers, *n* and *p* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*p*<=≤<=109) — the number of devices and the power of the charger.
This is followed by *n* lines which contain two integers each. Line *i* contains the integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=100<=000) — the power of the device and the amount of power stored in the device in the beginning.
|
If you can use the devices indefinitely, print -1. Otherwise, print the maximum amount of time before any one device hits 0 power.
Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=4.
Namely, let's assume that your answer is *a* and the answer of the jury is *b*. The checker program will consider your answer correct if .
|
[
"2 1\n2 2\n2 1000\n",
"1 100\n1 1\n",
"3 5\n4 3\n5 2\n6 1\n"
] |
[
"2.0000000000",
"-1\n",
"0.5000000000"
] |
In sample test 1, you can charge the first device for the entire time until it hits zero power. The second device has enough power to last this time without being charged.
In sample test 2, you can use the device indefinitely.
In sample test 3, we can charge the third device for 2 / 5 of a second, then switch to charge the second device for a 1 / 10 of a second.
| 500
|
[
{
"input": "2 1\n2 2\n2 1000",
"output": "2.0000000000"
},
{
"input": "1 100\n1 1",
"output": "-1"
},
{
"input": "3 5\n4 3\n5 2\n6 1",
"output": "0.5000000000"
},
{
"input": "1 1\n1 87",
"output": "-1"
},
{
"input": "1 1\n100 77",
"output": "0.7777777778"
},
{
"input": "5 10\n3 81\n3 49\n1 20\n1 12\n1 30",
"output": "-1"
},
{
"input": "5 10\n4 3\n1 54\n2 57\n2 31\n1 99",
"output": "-1"
},
{
"input": "5 10\n2 81\n3 31\n4 49\n1 35\n1 67",
"output": "263.0000000000"
},
{
"input": "10 1\n1 92\n1 92\n1 92\n1 92\n1 92\n1 92\n1 92\n1 92\n1 92\n1 92",
"output": "102.2222222222"
},
{
"input": "10 1\n1 16\n1 16\n1 16\n1 16\n1 16\n1 16\n1 16\n1 16\n1 16\n1 16",
"output": "17.7777777778"
},
{
"input": "10 1\n1 40\n1 40\n1 40\n1 40\n1 40\n1 40\n1 40\n1 40\n1 40\n1 40",
"output": "44.4444444444"
},
{
"input": "2 1\n1 10\n1 10",
"output": "20.0000000000"
},
{
"input": "20 16807\n75250 50074\n43659 8931\n11273 27545\n50879 77924\n37710 64441\n38166 84493\n43043 7988\n22504 82328\n31730 78841\n42613 44304\n33170 17710\n97158 29561\n70934 93100\n80279 51817\n95336 99098\n7827 13513\n29268 23811\n77634 80980\n79150 36580\n58822 11968",
"output": "0.2244225704"
}
] | 1,692,205,979
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 20
| 2,000
| 11,980,800
|
def can_last_time(t, devices, p):
power_needed = 0
for a, b in devices:
power_used = a * t
if power_used > b:
power_needed += power_used - b
remaining_power = p * t - power_needed
return remaining_power >= 0
def binary_search(n, p, devices):
left, right = 0, 10**18
while right - left > 1e-9:
mid = (left + right) / 2
if can_last_time(mid, devices, p):
left = mid
else:
right = mid
return left
n, p = map(int, input().split())
devices = [tuple(map(int, input().split())) for _ in range(n)]
result = binary_search(n, p, devices)
if result >= 1e18:
print(-1)
else:
print("{:.10f}".format(result))
|
Title: Voltage Keepsake
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have *n* devices that you want to use simultaneously.
The *i*-th device uses *a**i* units of power per second. This usage is continuous. That is, in λ seconds, the device will use λ·*a**i* units of power. The *i*-th device currently has *b**i* units of power stored. All devices can store an arbitrary amount of power.
You have a single charger that can plug to any single device. The charger will add *p* units of power per second to a device. This charging is continuous. That is, if you plug in a device for λ seconds, it will gain λ·*p* units of power. You can switch which device is charging at any arbitrary unit of time (including real numbers), and the time it takes to switch is negligible.
You are wondering, what is the maximum amount of time you can use the devices until one of them hits 0 units of power.
If you can use the devices indefinitely, print -1. Otherwise, print the maximum amount of time before any one device hits 0 power.
Input Specification:
The first line contains two integers, *n* and *p* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*p*<=≤<=109) — the number of devices and the power of the charger.
This is followed by *n* lines which contain two integers each. Line *i* contains the integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=100<=000) — the power of the device and the amount of power stored in the device in the beginning.
Output Specification:
If you can use the devices indefinitely, print -1. Otherwise, print the maximum amount of time before any one device hits 0 power.
Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=4.
Namely, let's assume that your answer is *a* and the answer of the jury is *b*. The checker program will consider your answer correct if .
Demo Input:
['2 1\n2 2\n2 1000\n', '1 100\n1 1\n', '3 5\n4 3\n5 2\n6 1\n']
Demo Output:
['2.0000000000', '-1\n', '0.5000000000']
Note:
In sample test 1, you can charge the first device for the entire time until it hits zero power. The second device has enough power to last this time without being charged.
In sample test 2, you can use the device indefinitely.
In sample test 3, we can charge the third device for 2 / 5 of a second, then switch to charge the second device for a 1 / 10 of a second.
|
```python
def can_last_time(t, devices, p):
power_needed = 0
for a, b in devices:
power_used = a * t
if power_used > b:
power_needed += power_used - b
remaining_power = p * t - power_needed
return remaining_power >= 0
def binary_search(n, p, devices):
left, right = 0, 10**18
while right - left > 1e-9:
mid = (left + right) / 2
if can_last_time(mid, devices, p):
left = mid
else:
right = mid
return left
n, p = map(int, input().split())
devices = [tuple(map(int, input().split())) for _ in range(n)]
result = binary_search(n, p, devices)
if result >= 1e18:
print(-1)
else:
print("{:.10f}".format(result))
```
| 0
|
|
110
|
A
|
Nearly Lucky Number
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Nearly Lucky Number
|
2
|
256
|
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Unfortunately, not all numbers are lucky. Petya calls a number nearly lucky if the number of lucky digits in it is a lucky number. He wonders whether number *n* is a nearly lucky number.
|
The only line contains an integer *n* (1<=≤<=*n*<=≤<=1018).
Please do not use the %lld specificator to read or write 64-bit numbers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
|
Print on the single line "YES" if *n* is a nearly lucky number. Otherwise, print "NO" (without the quotes).
|
[
"40047\n",
"7747774\n",
"1000000000000000000\n"
] |
[
"NO\n",
"YES\n",
"NO\n"
] |
In the first sample there are 3 lucky digits (first one and last two), so the answer is "NO".
In the second sample there are 7 lucky digits, 7 is lucky number, so the answer is "YES".
In the third sample there are no lucky digits, so the answer is "NO".
| 500
|
[
{
"input": "40047",
"output": "NO"
},
{
"input": "7747774",
"output": "YES"
},
{
"input": "1000000000000000000",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "4",
"output": "NO"
},
{
"input": "474404774",
"output": "NO"
},
{
"input": "4744000695826",
"output": "YES"
},
{
"input": "10000000004744744",
"output": "YES"
},
{
"input": "446486416781684178",
"output": "YES"
},
{
"input": "999999999",
"output": "NO"
},
{
"input": "7777",
"output": "YES"
},
{
"input": "87414417444",
"output": "NO"
},
{
"input": "111222333444555667",
"output": "YES"
},
{
"input": "1",
"output": "NO"
},
{
"input": "4700",
"output": "NO"
},
{
"input": "3794555488744477",
"output": "NO"
},
{
"input": "444444444444444444",
"output": "NO"
},
{
"input": "474447447774444774",
"output": "NO"
},
{
"input": "777777777777777",
"output": "NO"
},
{
"input": "34777745021000000",
"output": "NO"
},
{
"input": "963",
"output": "NO"
},
{
"input": "855474448854788540",
"output": "NO"
},
{
"input": "999999999999994744",
"output": "YES"
},
{
"input": "400000000474",
"output": "YES"
},
{
"input": "123456789123456789",
"output": "YES"
},
{
"input": "740577777584945874",
"output": "NO"
},
{
"input": "7777777",
"output": "YES"
},
{
"input": "4444000111222333",
"output": "YES"
},
{
"input": "9847745885202111",
"output": "YES"
},
{
"input": "123456000000",
"output": "NO"
},
{
"input": "4744447444444",
"output": "NO"
},
{
"input": "7477",
"output": "YES"
},
{
"input": "4747477",
"output": "YES"
},
{
"input": "777777777444444444",
"output": "NO"
}
] | 1,696,348,589
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 124
| 921,600
|
import sys
import math
import bisect
import heapq
import itertools
from sys import stdin,stdout
from math import gcd,floor,sqrt,log
from collections import defaultdict, Counter, deque
from bisect import bisect_left,bisect_right, insort_left, insort_right
import re
mod=1000000007
def get_ints(): return map(int, sys.stdin.readline().strip().split())
def get_list(): return list(map(int, sys.stdin.readline().strip().split()))
def get_string(): return sys.stdin.readline().strip()
def get_int(): return int(sys.stdin.readline().strip())
def get_list_strings(): return list(map(str, sys.stdin.readline().strip().split()))
def solve():
n = get_string()
lucky = 0
for i in range(len(n)):
if n[i] == "7" or n[i] == "4":
lucky += 1
if lucky == 7 or lucky == 4:
return "YES"
return "NO"
if __name__ == "__main__":
print(solve())
|
Title: Nearly Lucky Number
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Unfortunately, not all numbers are lucky. Petya calls a number nearly lucky if the number of lucky digits in it is a lucky number. He wonders whether number *n* is a nearly lucky number.
Input Specification:
The only line contains an integer *n* (1<=≤<=*n*<=≤<=1018).
Please do not use the %lld specificator to read or write 64-bit numbers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
Output Specification:
Print on the single line "YES" if *n* is a nearly lucky number. Otherwise, print "NO" (without the quotes).
Demo Input:
['40047\n', '7747774\n', '1000000000000000000\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
In the first sample there are 3 lucky digits (first one and last two), so the answer is "NO".
In the second sample there are 7 lucky digits, 7 is lucky number, so the answer is "YES".
In the third sample there are no lucky digits, so the answer is "NO".
|
```python
import sys
import math
import bisect
import heapq
import itertools
from sys import stdin,stdout
from math import gcd,floor,sqrt,log
from collections import defaultdict, Counter, deque
from bisect import bisect_left,bisect_right, insort_left, insort_right
import re
mod=1000000007
def get_ints(): return map(int, sys.stdin.readline().strip().split())
def get_list(): return list(map(int, sys.stdin.readline().strip().split()))
def get_string(): return sys.stdin.readline().strip()
def get_int(): return int(sys.stdin.readline().strip())
def get_list_strings(): return list(map(str, sys.stdin.readline().strip().split()))
def solve():
n = get_string()
lucky = 0
for i in range(len(n)):
if n[i] == "7" or n[i] == "4":
lucky += 1
if lucky == 7 or lucky == 4:
return "YES"
return "NO"
if __name__ == "__main__":
print(solve())
```
| 3.967283
|
1,005
|
A
|
Tanya and Stairways
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Little girl Tanya climbs the stairs inside a multi-storey building. Every time Tanya climbs a stairway, she starts counting steps from $1$ to the number of steps in this stairway. She speaks every number aloud. For example, if she climbs two stairways, the first of which contains $3$ steps, and the second contains $4$ steps, she will pronounce the numbers $1, 2, 3, 1, 2, 3, 4$.
You are given all the numbers pronounced by Tanya. How many stairways did she climb? Also, output the number of steps in each stairway.
The given sequence will be a valid sequence that Tanya could have pronounced when climbing one or more stairways.
|
The first line contains $n$ ($1 \le n \le 1000$) — the total number of numbers pronounced by Tanya.
The second line contains integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 1000$) — all the numbers Tanya pronounced while climbing the stairs, in order from the first to the last pronounced number. Passing a stairway with $x$ steps, she will pronounce the numbers $1, 2, \dots, x$ in that order.
The given sequence will be a valid sequence that Tanya could have pronounced when climbing one or more stairways.
|
In the first line, output $t$ — the number of stairways that Tanya climbed. In the second line, output $t$ numbers — the number of steps in each stairway she climbed. Write the numbers in the correct order of passage of the stairways.
|
[
"7\n1 2 3 1 2 3 4\n",
"4\n1 1 1 1\n",
"5\n1 2 3 4 5\n",
"5\n1 2 1 2 1\n"
] |
[
"2\n3 4 ",
"4\n1 1 1 1 ",
"1\n5 ",
"3\n2 2 1 "
] |
none
| 0
|
[
{
"input": "7\n1 2 3 1 2 3 4",
"output": "2\n3 4 "
},
{
"input": "4\n1 1 1 1",
"output": "4\n1 1 1 1 "
},
{
"input": "5\n1 2 3 4 5",
"output": "1\n5 "
},
{
"input": "5\n1 2 1 2 1",
"output": "3\n2 2 1 "
},
{
"input": "1\n1",
"output": "1\n1 "
},
{
"input": "48\n1 2 3 4 1 2 3 1 1 2 3 1 2 3 4 1 1 2 3 4 1 2 3 4 1 2 3 4 1 1 2 1 2 1 2 1 1 2 1 2 1 2 3 1 2 1 2 1",
"output": "20\n4 3 1 3 4 1 4 4 4 1 2 2 2 1 2 2 3 2 2 1 "
},
{
"input": "2\n1 2",
"output": "1\n2 "
},
{
"input": "3\n1 1 2",
"output": "2\n1 2 "
},
{
"input": "4\n1 1 2 3",
"output": "2\n1 3 "
},
{
"input": "8\n1 2 3 1 2 3 4 5",
"output": "2\n3 5 "
},
{
"input": "5\n1 1 1 2 3",
"output": "3\n1 1 3 "
}
] | 1,640,243,253
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 16
| 62
| 0
|
n=int(input())
stairs=input().split()
stairs_int=[]
count=0
stairs_climbed=[]
for i in stairs:
stairs_int.append(int(i))
for i in range(0,len(stairs_int)):
if stairs_int[i]==1:
count+=1
for i in range(1,len(stairs_int)):
if stairs_int[i]==1:
stairs_climbed.append(stairs_int[i-1])
stairs_climbed.append(stairs_int[len(stairs_int)-1])
print(count)
print(*stairs_climbed,sep=" ")
|
Title: Tanya and Stairways
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little girl Tanya climbs the stairs inside a multi-storey building. Every time Tanya climbs a stairway, she starts counting steps from $1$ to the number of steps in this stairway. She speaks every number aloud. For example, if she climbs two stairways, the first of which contains $3$ steps, and the second contains $4$ steps, she will pronounce the numbers $1, 2, 3, 1, 2, 3, 4$.
You are given all the numbers pronounced by Tanya. How many stairways did she climb? Also, output the number of steps in each stairway.
The given sequence will be a valid sequence that Tanya could have pronounced when climbing one or more stairways.
Input Specification:
The first line contains $n$ ($1 \le n \le 1000$) — the total number of numbers pronounced by Tanya.
The second line contains integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 1000$) — all the numbers Tanya pronounced while climbing the stairs, in order from the first to the last pronounced number. Passing a stairway with $x$ steps, she will pronounce the numbers $1, 2, \dots, x$ in that order.
The given sequence will be a valid sequence that Tanya could have pronounced when climbing one or more stairways.
Output Specification:
In the first line, output $t$ — the number of stairways that Tanya climbed. In the second line, output $t$ numbers — the number of steps in each stairway she climbed. Write the numbers in the correct order of passage of the stairways.
Demo Input:
['7\n1 2 3 1 2 3 4\n', '4\n1 1 1 1\n', '5\n1 2 3 4 5\n', '5\n1 2 1 2 1\n']
Demo Output:
['2\n3 4 ', '4\n1 1 1 1 ', '1\n5 ', '3\n2 2 1 ']
Note:
none
|
```python
n=int(input())
stairs=input().split()
stairs_int=[]
count=0
stairs_climbed=[]
for i in stairs:
stairs_int.append(int(i))
for i in range(0,len(stairs_int)):
if stairs_int[i]==1:
count+=1
for i in range(1,len(stairs_int)):
if stairs_int[i]==1:
stairs_climbed.append(stairs_int[i-1])
stairs_climbed.append(stairs_int[len(stairs_int)-1])
print(count)
print(*stairs_climbed,sep=" ")
```
| 3
|
|
245
|
A
|
System Administrator
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Polycarpus is a system administrator. There are two servers under his strict guidance — *a* and *b*. To stay informed about the servers' performance, Polycarpus executes commands "ping a" and "ping b". Each ping command sends exactly ten packets to the server specified in the argument of the command. Executing a program results in two integers *x* and *y* (*x*<=+<=*y*<==<=10; *x*,<=*y*<=≥<=0). These numbers mean that *x* packets successfully reached the corresponding server through the network and *y* packets were lost.
Today Polycarpus has performed overall *n* ping commands during his workday. Now for each server Polycarpus wants to know whether the server is "alive" or not. Polycarpus thinks that the server is "alive", if at least half of the packets that we send to this server reached it successfully along the network.
Help Polycarpus, determine for each server, whether it is "alive" or not by the given commands and their results.
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of commands Polycarpus has fulfilled. Each of the following *n* lines contains three integers — the description of the commands. The *i*-th of these lines contains three space-separated integers *t**i*, *x**i*, *y**i* (1<=≤<=*t**i*<=≤<=2; *x**i*,<=*y**i*<=≥<=0; *x**i*<=+<=*y**i*<==<=10). If *t**i*<==<=1, then the *i*-th command is "ping a", otherwise the *i*-th command is "ping b". Numbers *x**i*, *y**i* represent the result of executing this command, that is, *x**i* packets reached the corresponding server successfully and *y**i* packets were lost.
It is guaranteed that the input has at least one "ping a" command and at least one "ping b" command.
|
In the first line print string "LIVE" (without the quotes) if server *a* is "alive", otherwise print "DEAD" (without the quotes).
In the second line print the state of server *b* in the similar format.
|
[
"2\n1 5 5\n2 6 4\n",
"3\n1 0 10\n2 0 10\n1 10 0\n"
] |
[
"LIVE\nLIVE\n",
"LIVE\nDEAD\n"
] |
Consider the first test case. There 10 packets were sent to server *a*, 5 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network. Overall there were 10 packets sent to server *b*, 6 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network.
Consider the second test case. There were overall 20 packages sent to server *a*, 10 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network. Overall 10 packets were sent to server *b*, 0 of them reached it. Therefore, less than half of all packets sent to this server successfully reached it through the network.
| 0
|
[
{
"input": "2\n1 5 5\n2 6 4",
"output": "LIVE\nLIVE"
},
{
"input": "3\n1 0 10\n2 0 10\n1 10 0",
"output": "LIVE\nDEAD"
},
{
"input": "10\n1 3 7\n2 4 6\n1 2 8\n2 5 5\n2 10 0\n2 10 0\n1 8 2\n2 2 8\n2 10 0\n1 1 9",
"output": "DEAD\nLIVE"
},
{
"input": "11\n1 8 2\n1 6 4\n1 9 1\n1 7 3\n2 0 10\n2 0 10\n1 8 2\n2 2 8\n2 6 4\n2 7 3\n2 9 1",
"output": "LIVE\nDEAD"
},
{
"input": "12\n1 5 5\n1 0 10\n1 4 6\n1 2 8\n1 2 8\n1 5 5\n1 9 1\n2 9 1\n1 5 5\n1 1 9\n2 9 1\n2 7 3",
"output": "DEAD\nLIVE"
},
{
"input": "13\n1 8 2\n1 4 6\n1 5 5\n1 5 5\n2 10 0\n2 9 1\n1 3 7\n2 6 4\n2 6 4\n2 5 5\n1 7 3\n2 3 7\n2 9 1",
"output": "LIVE\nLIVE"
},
{
"input": "14\n1 7 3\n1 0 10\n1 7 3\n1 1 9\n2 2 8\n2 0 10\n1 1 9\n2 8 2\n2 6 4\n1 3 7\n1 3 7\n2 6 4\n2 1 9\n2 7 3",
"output": "DEAD\nDEAD"
}
] | 1,542,794,430
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 216
| 0
|
n = int(input())
d = 0
g = 0
h = 0
j = 0
for i in range(n):
a,b,c = map(int,input().split())
if a == 1:
if b > 0:
d += 1
elif a == 2:
j += 1
if c > 0:
g += 1
if d > 0 and g >= j:
print("LIVE")
print("LIVE")
elif d > h and g == j:
print("LIVE")
print("DEAD")
elif d == h and g >= j:
print("DEAD")
print("LIVE")
else:
print("DEAD")
print("DEAD")
|
Title: System Administrator
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus is a system administrator. There are two servers under his strict guidance — *a* and *b*. To stay informed about the servers' performance, Polycarpus executes commands "ping a" and "ping b". Each ping command sends exactly ten packets to the server specified in the argument of the command. Executing a program results in two integers *x* and *y* (*x*<=+<=*y*<==<=10; *x*,<=*y*<=≥<=0). These numbers mean that *x* packets successfully reached the corresponding server through the network and *y* packets were lost.
Today Polycarpus has performed overall *n* ping commands during his workday. Now for each server Polycarpus wants to know whether the server is "alive" or not. Polycarpus thinks that the server is "alive", if at least half of the packets that we send to this server reached it successfully along the network.
Help Polycarpus, determine for each server, whether it is "alive" or not by the given commands and their results.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of commands Polycarpus has fulfilled. Each of the following *n* lines contains three integers — the description of the commands. The *i*-th of these lines contains three space-separated integers *t**i*, *x**i*, *y**i* (1<=≤<=*t**i*<=≤<=2; *x**i*,<=*y**i*<=≥<=0; *x**i*<=+<=*y**i*<==<=10). If *t**i*<==<=1, then the *i*-th command is "ping a", otherwise the *i*-th command is "ping b". Numbers *x**i*, *y**i* represent the result of executing this command, that is, *x**i* packets reached the corresponding server successfully and *y**i* packets were lost.
It is guaranteed that the input has at least one "ping a" command and at least one "ping b" command.
Output Specification:
In the first line print string "LIVE" (without the quotes) if server *a* is "alive", otherwise print "DEAD" (without the quotes).
In the second line print the state of server *b* in the similar format.
Demo Input:
['2\n1 5 5\n2 6 4\n', '3\n1 0 10\n2 0 10\n1 10 0\n']
Demo Output:
['LIVE\nLIVE\n', 'LIVE\nDEAD\n']
Note:
Consider the first test case. There 10 packets were sent to server *a*, 5 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network. Overall there were 10 packets sent to server *b*, 6 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network.
Consider the second test case. There were overall 20 packages sent to server *a*, 10 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network. Overall 10 packets were sent to server *b*, 0 of them reached it. Therefore, less than half of all packets sent to this server successfully reached it through the network.
|
```python
n = int(input())
d = 0
g = 0
h = 0
j = 0
for i in range(n):
a,b,c = map(int,input().split())
if a == 1:
if b > 0:
d += 1
elif a == 2:
j += 1
if c > 0:
g += 1
if d > 0 and g >= j:
print("LIVE")
print("LIVE")
elif d > h and g == j:
print("LIVE")
print("DEAD")
elif d == h and g >= j:
print("DEAD")
print("LIVE")
else:
print("DEAD")
print("DEAD")
```
| 0
|
|
38
|
A
|
Army
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Army
|
2
|
256
|
The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank.
One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible.
Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream.
|
The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=<<=*b*<=≤<=*n*). The numbers on the lines are space-separated.
|
Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*.
|
[
"3\n5 6\n1 2\n",
"3\n5 6\n1 3\n"
] |
[
"5\n",
"11\n"
] |
none
| 0
|
[
{
"input": "3\n5 6\n1 2",
"output": "5"
},
{
"input": "3\n5 6\n1 3",
"output": "11"
},
{
"input": "2\n55\n1 2",
"output": "55"
},
{
"input": "3\n85 78\n1 3",
"output": "163"
},
{
"input": "4\n63 4 49\n2 3",
"output": "4"
},
{
"input": "5\n93 83 42 56\n2 5",
"output": "181"
},
{
"input": "6\n22 9 87 89 57\n1 6",
"output": "264"
},
{
"input": "7\n52 36 31 23 74 78\n2 7",
"output": "242"
},
{
"input": "8\n82 14 24 5 91 49 94\n3 8",
"output": "263"
},
{
"input": "9\n12 40 69 39 59 21 59 5\n4 6",
"output": "98"
},
{
"input": "10\n95 81 32 59 71 30 50 61 100\n1 6",
"output": "338"
},
{
"input": "15\n89 55 94 4 15 69 19 60 91 77 3 94 91 62\n3 14",
"output": "617"
},
{
"input": "20\n91 1 41 51 95 67 92 35 23 70 44 91 57 50 21 8 9 71 40\n8 17",
"output": "399"
},
{
"input": "25\n70 95 21 84 97 39 12 98 53 24 78 29 84 65 70 22 100 17 69 27 62 48 35 80\n8 23",
"output": "846"
},
{
"input": "30\n35 69 50 44 19 56 86 56 98 24 21 2 61 24 85 30 2 22 57 35 59 84 12 77 92 53 50 92 9\n1 16",
"output": "730"
},
{
"input": "35\n2 34 47 15 27 61 6 88 67 20 53 65 29 68 77 5 78 86 44 98 32 81 91 79 54 84 95 23 65 97 22 33 42 87\n8 35",
"output": "1663"
},
{
"input": "40\n32 88 59 36 95 45 28 78 73 30 97 13 13 47 48 100 43 21 22 45 88 25 15 13 63 25 72 92 29 5 25 11 50 5 54 51 48 84 23\n7 26",
"output": "862"
},
{
"input": "45\n83 74 73 95 10 31 100 26 29 15 80 100 22 70 31 88 9 56 19 70 2 62 48 30 27 47 52 50 94 44 21 94 23 85 15 3 95 72 43 62 94 89 68 88\n17 40",
"output": "1061"
},
{
"input": "50\n28 8 16 29 19 82 70 51 96 84 74 72 17 69 12 21 37 21 39 3 18 66 19 49 86 96 94 93 2 90 96 84 59 88 58 15 61 33 55 22 35 54 51 29 64 68 29 38 40\n23 28",
"output": "344"
},
{
"input": "60\n24 28 25 21 43 71 64 73 71 90 51 83 69 43 75 43 78 72 56 61 99 7 23 86 9 16 16 94 23 74 18 56 20 72 13 31 75 34 35 86 61 49 4 72 84 7 65 70 66 52 21 38 6 43 69 40 73 46 5\n28 60",
"output": "1502"
},
{
"input": "70\n69 95 34 14 67 61 6 95 94 44 28 94 73 66 39 13 19 71 73 71 28 48 26 22 32 88 38 95 43 59 88 77 80 55 17 95 40 83 67 1 38 95 58 63 56 98 49 2 41 4 73 8 78 41 64 71 60 71 41 61 67 4 4 19 97 14 39 20 27\n9 41",
"output": "1767"
},
{
"input": "80\n65 15 43 6 43 98 100 16 69 98 4 54 25 40 2 35 12 23 38 29 10 89 30 6 4 8 7 96 64 43 11 49 89 38 20 59 54 85 46 16 16 89 60 54 28 37 32 34 67 9 78 30 50 87 58 53 99 48 77 3 5 6 19 99 16 20 31 10 80 76 82 56 56 83 72 81 84 60 28\n18 24",
"output": "219"
},
{
"input": "90\n61 35 100 99 67 87 42 90 44 4 81 65 29 63 66 56 53 22 55 87 39 30 34 42 27 80 29 97 85 28 81 22 50 22 24 75 67 86 78 79 94 35 13 97 48 76 68 66 94 13 82 1 22 85 5 36 86 73 65 97 43 56 35 26 87 25 74 47 81 67 73 75 99 75 53 38 70 21 66 78 38 17 57 40 93 57 68 55 1\n12 44",
"output": "1713"
},
{
"input": "95\n37 74 53 96 65 84 65 72 95 45 6 77 91 35 58 50 51 51 97 30 51 20 79 81 92 10 89 34 40 76 71 54 26 34 73 72 72 28 53 19 95 64 97 10 44 15 12 38 5 63 96 95 86 8 36 96 45 53 81 5 18 18 47 97 65 9 33 53 41 86 37 53 5 40 15 76 83 45 33 18 26 5 19 90 46 40 100 42 10 90 13 81 40 53\n6 15",
"output": "570"
},
{
"input": "96\n51 32 95 75 23 54 70 89 67 3 1 51 4 100 97 30 9 35 56 38 54 77 56 98 43 17 60 43 72 46 87 61 100 65 81 22 74 38 16 96 5 10 54 22 23 22 10 91 9 54 49 82 29 73 33 98 75 8 4 26 24 90 71 42 90 24 94 74 94 10 41 98 56 63 18 43 56 21 26 64 74 33 22 38 67 66 38 60 64 76 53 10 4 65 76\n21 26",
"output": "328"
},
{
"input": "97\n18 90 84 7 33 24 75 55 86 10 96 72 16 64 37 9 19 71 62 97 5 34 85 15 46 72 82 51 52 16 55 68 27 97 42 72 76 97 32 73 14 56 11 86 2 81 59 95 60 93 1 22 71 37 77 100 6 16 78 47 78 62 94 86 16 91 56 46 47 35 93 44 7 86 70 10 29 45 67 62 71 61 74 39 36 92 24 26 65 14 93 92 15 28 79 59\n6 68",
"output": "3385"
},
{
"input": "98\n32 47 26 86 43 42 79 72 6 68 40 46 29 80 24 89 29 7 21 56 8 92 13 33 50 79 5 7 84 85 24 23 1 80 51 21 26 55 96 51 24 2 68 98 81 88 57 100 64 84 54 10 14 2 74 1 89 71 1 20 84 85 17 31 42 58 69 67 48 60 97 90 58 10 21 29 2 21 60 61 68 89 77 39 57 18 61 44 67 100 33 74 27 40 83 29 6\n8 77",
"output": "3319"
},
{
"input": "99\n46 5 16 66 53 12 84 89 26 27 35 68 41 44 63 17 88 43 80 15 59 1 42 50 53 34 75 16 16 55 92 30 28 11 12 71 27 65 11 28 86 47 24 10 60 47 7 53 16 75 6 49 56 66 70 3 20 78 75 41 38 57 89 23 16 74 30 39 1 32 49 84 9 33 25 95 75 45 54 59 17 17 29 40 79 96 47 11 69 86 73 56 91 4 87 47 31 24\n23 36",
"output": "514"
},
{
"input": "100\n63 65 21 41 95 23 3 4 12 23 95 50 75 63 58 34 71 27 75 31 23 94 96 74 69 34 43 25 25 55 44 19 43 86 68 17 52 65 36 29 72 96 84 25 84 23 71 54 6 7 71 7 21 100 99 58 93 35 62 47 36 70 68 9 75 13 35 70 76 36 62 22 52 51 2 87 66 41 54 35 78 62 30 35 65 44 74 93 78 37 96 70 26 32 71 27 85 85 63\n43 92",
"output": "2599"
},
{
"input": "51\n85 38 22 38 42 36 55 24 36 80 49 15 66 91 88 61 46 82 1 61 89 92 6 56 28 8 46 80 56 90 91 38 38 17 69 64 57 68 13 44 45 38 8 72 61 39 87 2 73 88\n15 27",
"output": "618"
},
{
"input": "2\n3\n1 2",
"output": "3"
},
{
"input": "5\n6 8 22 22\n2 3",
"output": "8"
},
{
"input": "6\n3 12 27 28 28\n3 4",
"output": "27"
},
{
"input": "9\n1 2 2 2 2 3 3 5\n3 7",
"output": "9"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1\n6 8",
"output": "2"
},
{
"input": "20\n1 1 1 1 1 1 1 1 2 2 2 2 2 3 3 3 3 3 3\n5 17",
"output": "23"
},
{
"input": "25\n1 1 1 4 5 6 8 11 11 11 11 12 13 14 14 14 15 16 16 17 17 17 19 19\n4 8",
"output": "23"
},
{
"input": "35\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2\n30 31",
"output": "2"
},
{
"input": "45\n1 1 1 1 2 2 2 2 2 2 2 3 3 3 3 3 3 4 5 5 5 5 6 6 6 6 6 6 6 7 7 7 7 8 8 8 9 9 9 9 9 10 10 10\n42 45",
"output": "30"
},
{
"input": "50\n1 8 8 13 14 15 15 16 19 21 22 24 26 31 32 37 45 47 47 47 50 50 51 54 55 56 58 61 61 61 63 63 64 66 66 67 67 70 71 80 83 84 85 92 92 94 95 95 100\n4 17",
"output": "285"
},
{
"input": "60\n1 2 4 4 4 6 6 8 9 10 10 13 14 18 20 20 21 22 23 23 26 29 30 32 33 34 35 38 40 42 44 44 46 48 52 54 56 56 60 60 66 67 68 68 69 73 73 74 80 80 81 81 82 84 86 86 87 89 89\n56 58",
"output": "173"
},
{
"input": "70\n1 2 3 3 4 5 5 7 7 7 8 8 8 8 9 9 10 12 12 12 12 13 16 16 16 16 16 16 17 17 18 18 20 20 21 23 24 25 25 26 29 29 29 29 31 32 32 34 35 36 36 37 37 38 39 39 40 40 40 40 41 41 42 43 44 44 44 45 45\n62 65",
"output": "126"
},
{
"input": "80\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 4 4 4 4 5 5 5 5 5 5 5 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12\n17 65",
"output": "326"
},
{
"input": "90\n1 1 3 5 8 9 10 11 11 11 11 12 13 14 15 15 15 16 16 19 19 20 22 23 24 25 25 28 29 29 30 31 33 34 35 37 37 38 41 43 43 44 45 47 51 54 55 56 58 58 59 59 60 62 66 67 67 67 68 68 69 70 71 72 73 73 76 77 77 78 78 78 79 79 79 82 83 84 85 85 87 87 89 93 93 93 95 99 99\n28 48",
"output": "784"
},
{
"input": "95\n2 2 3 3 4 6 6 7 7 7 9 10 12 12 12 12 13 14 15 16 17 18 20 20 20 20 21 21 21 21 22 22 22 22 22 23 23 23 25 26 26 27 27 27 28 29 29 30 30 31 32 33 34 36 37 37 38 39 39 39 42 43 43 43 45 47 48 50 50 51 52 53 54 54 54 55 55 55 58 59 60 61 61 61 61 62 62 63 64 65 66 67 67 67\n64 93",
"output": "1636"
},
{
"input": "96\n1 1 2 3 3 5 8 9 9 10 10 10 11 11 11 11 11 12 13 13 13 14 15 15 16 16 17 17 17 17 18 18 20 20 20 21 21 21 23 24 24 25 25 26 27 27 27 27 29 29 29 30 30 30 32 32 32 32 32 32 33 33 34 34 34 35 35 35 36 36 37 37 37 38 39 40 41 41 41 41 42 42 43 43 45 45 45 46 46 47 47 49 50 52 52\n76 96",
"output": "898"
},
{
"input": "98\n2 3 4 4 5 7 8 10 10 10 11 11 12 12 12 12 13 14 15 15 16 16 18 19 19 20 21 21 21 21 22 23 24 25 26 26 27 27 27 27 29 29 30 30 31 31 37 40 40 40 41 41 41 42 43 44 44 44 46 46 47 49 49 50 50 50 51 53 55 55 56 56 56 56 56 57 57 58 59 60 60 60 62 62 63 64 64 64 65 66 66 67 68 70 70 71 71\n8 90",
"output": "3016"
},
{
"input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n66 95",
"output": "29"
},
{
"input": "100\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 10 10 10 10 11 11 11 11 12 12 12 13 13 13 13 13 13 13 13 13 13 14 14 14 14 14 14 15 15 15 15 15 15 16 16 16 17 17\n39 52",
"output": "82"
},
{
"input": "51\n5 7 9 16 19 25 26 29 29 30 31 32 32 41 43 44 47 49 50 50 51 52 54 55 56 63 64 66 67 70 74 74 77 78 79 80 80 85 86 87 89 89 90 92 93 94 94 95 95 97\n3 44",
"output": "2268"
}
] | 1,509,279,971
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 50
| 124
| 0
|
n=int(input())
t=list(map(int,input().split()))
a,b=map(int,input().split())
d=0
for i in range(a,b):
d+=t[i-1]
print(d)
|
Title: Army
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank.
One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible.
Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream.
Input Specification:
The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=<<=*b*<=≤<=*n*). The numbers on the lines are space-separated.
Output Specification:
Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*.
Demo Input:
['3\n5 6\n1 2\n', '3\n5 6\n1 3\n']
Demo Output:
['5\n', '11\n']
Note:
none
|
```python
n=int(input())
t=list(map(int,input().split()))
a,b=map(int,input().split())
d=0
for i in range(a,b):
d+=t[i-1]
print(d)
```
| 3.969
|
629
|
A
|
Far Relative’s Birthday Cake
|
PROGRAMMING
| 800
|
[
"brute force",
"combinatorics",
"constructive algorithms",
"implementation"
] | null | null |
Door's family is going celebrate Famil Doors's birthday party. They love Famil Door so they are planning to make his birthday cake weird!
The cake is a *n*<=×<=*n* square consisting of equal squares with side length 1. Each square is either empty or consists of a single chocolate. They bought the cake and randomly started to put the chocolates on the cake. The value of Famil Door's happiness will be equal to the number of pairs of cells with chocolates that are in the same row or in the same column of the cake. Famil Doors's family is wondering what is the amount of happiness of Famil going to be?
Please, note that any pair can be counted no more than once, as two different cells can't share both the same row and the same column.
|
In the first line of the input, you are given a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the side of the cake.
Then follow *n* lines, each containing *n* characters. Empty cells are denoted with '.', while cells that contain chocolates are denoted by 'C'.
|
Print the value of Famil Door's happiness, i.e. the number of pairs of chocolate pieces that share the same row or the same column.
|
[
"3\n.CC\nC..\nC.C\n",
"4\nCC..\nC..C\n.CC.\n.CC.\n"
] |
[
"4\n",
"9\n"
] |
If we number rows from top to bottom and columns from left to right, then, pieces that share the same row in the first sample are:
1. (1, 2) and (1, 3) 1. (3, 1) and (3, 3) 1. (2, 1) and (3, 1) 1. (1, 3) and (3, 3)
| 500
|
[
{
"input": "3\n.CC\nC..\nC.C",
"output": "4"
},
{
"input": "4\nCC..\nC..C\n.CC.\n.CC.",
"output": "9"
},
{
"input": "5\n.CCCC\nCCCCC\n.CCC.\nCC...\n.CC.C",
"output": "46"
},
{
"input": "7\n.CC..CC\nCC.C..C\nC.C..C.\nC...C.C\nCCC.CCC\n.CC...C\n.C.CCC.",
"output": "84"
},
{
"input": "8\n..C....C\nC.CCC.CC\n.C..C.CC\nCC......\nC..C..CC\nC.C...C.\nC.C..C..\nC...C.C.",
"output": "80"
},
{
"input": "9\n.C...CCCC\nC.CCCC...\n....C..CC\n.CC.CCC..\n.C.C..CC.\nC...C.CCC\nCCC.C...C\nCCCC....C\n..C..C..C",
"output": "144"
},
{
"input": "10\n..C..C.C..\n..CC..C.CC\n.C.C...C.C\n..C.CC..CC\n....C..C.C\n...C..C..C\nCC.CC....C\n..CCCC.C.C\n..CC.CCC..\nCCCC..C.CC",
"output": "190"
},
{
"input": "11\nC.CC...C.CC\nCC.C....C.C\n.....C..CCC\n....C.CC.CC\nC..C..CC...\nC...C...C..\nCC..CCC.C.C\n..C.CC.C..C\nC...C.C..CC\n.C.C..CC..C\n.C.C.CC.C..",
"output": "228"
},
{
"input": "21\n...CCC.....CC..C..C.C\n..CCC...CC...CC.CCC.C\n....C.C.C..CCC..C.C.C\n....CCC..C..C.CC.CCC.\n...CCC.C..C.C.....CCC\n.CCC.....CCC..C...C.C\nCCCC.C...CCC.C...C.CC\nC..C...C.CCC..CC..C..\nC...CC..C.C.CC..C.CC.\nCC..CCCCCCCCC..C....C\n.C..CCCC.CCCC.CCC...C\nCCC...CCC...CCC.C..C.\n.CCCCCCCC.CCCC.CC.C..\n.C.C..C....C.CCCCCC.C\n...C...C.CCC.C.CC..C.\nCCC...CC..CC...C..C.C\n.CCCCC...C.C..C.CC.C.\n..CCC.C.C..CCC.CCC...\n..C..C.C.C.....CC.C..\n.CC.C...C.CCC.C....CC\n...C..CCCC.CCC....C..",
"output": "2103"
},
{
"input": "20\nC.C.CCC.C....C.CCCCC\nC.CC.C..CCC....CCCC.\n.CCC.CC...CC.CCCCCC.\n.C...CCCC..C....CCC.\n.C..CCCCCCC.C.C.....\nC....C.C..CCC.C..CCC\n...C.C.CC..CC..CC...\nC...CC.C.CCCCC....CC\n.CC.C.CCC....C.CCC.C\nCC...CC...CC..CC...C\nC.C..CC.C.CCCC.C.CC.\n..CCCCC.C.CCC..CCCC.\n....C..C..C.CC...C.C\nC..CCC..CC..C.CC..CC\n...CC......C.C..C.C.\nCC.CCCCC.CC.CC...C.C\n.C.CC..CC..CCC.C.CCC\nC..C.CC....C....C...\n..CCC..CCC...CC..C.C\n.C.CCC.CCCCCCCCC..CC",
"output": "2071"
},
{
"input": "17\nCCC..C.C....C.C.C\n.C.CC.CC...CC..C.\n.CCCC.CC.C..CCC.C\n...CCC.CC.CCC.C.C\nCCCCCCCC..C.CC.CC\n...C..C....C.CC.C\nCC....CCC...C.CC.\n.CC.C.CC..C......\n.CCCCC.C.CC.CCCCC\n..CCCC...C..CC..C\nC.CC.C.CC..C.C.C.\nC..C..C..CCC.C...\n.C..CCCC..C......\n.CC.C...C..CC.CC.\nC..C....CC...CC..\nC.CC.CC..C.C..C..\nCCCC...C.C..CCCC.",
"output": "1160"
},
{
"input": "15\nCCCC.C..CCC....\nCCCCCC.CC.....C\n...C.CC.C.C.CC.\nCCCCCCC..C..C..\nC..CCC..C.CCCC.\n.CC..C.C.C.CC.C\n.C.C..C..C.C..C\n...C...C..CCCC.\n.....C.C..CC...\nCC.C.C..CC.C..C\n..CCCCC..CCC...\nCC.CC.C..CC.CCC\n..CCC...CC.C..C\nCC..C.C..CCC..C\n.C.C....CCC...C",
"output": "789"
},
{
"input": "1\n.",
"output": "0"
},
{
"input": "3\n.CC\nC..\nC.C",
"output": "4"
},
{
"input": "13\nC.C...C.C.C..\nCC.CCCC.CC..C\n.C.CCCCC.CC..\nCCCC..C...C..\n...CC.C.C...C\n.CC.CCC...CC.\nCC.CCCCCC....\n.C...C..CC..C\nCCCC.CC...C..\n.C.CCC..C.CC.\n..C...CC..C.C\n..C.CCC..CC.C\n.C...CCC.CC.C",
"output": "529"
},
{
"input": "16\n.C.C.C.C.C...C.C\n..C..C.CCCCCC...\n..C.C.C.C..C..C.\n.CC....C.CCC..C.\n.C.CCC..C....CCC\nCC..C.CC..C.C.CC\n...C..C..CC..CC.\n.CCC..C.CC.C.C..\n.CC.C..........C\nC...C....CC..C..\nC.CCC.C..C..C...\n.CCCCCCCCCCCC..C\n..C.C.CC.CC.CCC.\nCC..C.C....C..CC\nC.CCC..C..C.C.CC\n.C.CCC.CC..CCC.C",
"output": "874"
},
{
"input": "2\nCC\nCC",
"output": "4"
},
{
"input": "3\nC..\nC..\nC..",
"output": "3"
}
] | 1,554,206,228
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 93
| 0
|
n = int(input())
a = []
h = 0
for i in range(n):
b = [i for i in input().split("")]
b.append(".")
a.append(b)
a.append(["."] * (n +1))
for i in range(n):
for j in range(n):
if a[i][j] == "C" and (a[i +1][j] == "C" or a[i][j + 1] == "C"):
h += 1
print(h)
|
Title: Far Relative’s Birthday Cake
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Door's family is going celebrate Famil Doors's birthday party. They love Famil Door so they are planning to make his birthday cake weird!
The cake is a *n*<=×<=*n* square consisting of equal squares with side length 1. Each square is either empty or consists of a single chocolate. They bought the cake and randomly started to put the chocolates on the cake. The value of Famil Door's happiness will be equal to the number of pairs of cells with chocolates that are in the same row or in the same column of the cake. Famil Doors's family is wondering what is the amount of happiness of Famil going to be?
Please, note that any pair can be counted no more than once, as two different cells can't share both the same row and the same column.
Input Specification:
In the first line of the input, you are given a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the side of the cake.
Then follow *n* lines, each containing *n* characters. Empty cells are denoted with '.', while cells that contain chocolates are denoted by 'C'.
Output Specification:
Print the value of Famil Door's happiness, i.e. the number of pairs of chocolate pieces that share the same row or the same column.
Demo Input:
['3\n.CC\nC..\nC.C\n', '4\nCC..\nC..C\n.CC.\n.CC.\n']
Demo Output:
['4\n', '9\n']
Note:
If we number rows from top to bottom and columns from left to right, then, pieces that share the same row in the first sample are:
1. (1, 2) and (1, 3) 1. (3, 1) and (3, 3) 1. (2, 1) and (3, 1) 1. (1, 3) and (3, 3)
|
```python
n = int(input())
a = []
h = 0
for i in range(n):
b = [i for i in input().split("")]
b.append(".")
a.append(b)
a.append(["."] * (n +1))
for i in range(n):
for j in range(n):
if a[i][j] == "C" and (a[i +1][j] == "C" or a[i][j + 1] == "C"):
h += 1
print(h)
```
| -1
|
|
37
|
A
|
Towers
|
PROGRAMMING
| 1,000
|
[
"sortings"
] |
A. Towers
|
2
|
256
|
Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same.
Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible.
|
The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000.
|
In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars.
|
[
"3\n1 2 3\n",
"4\n6 5 6 7\n"
] |
[
"1 3\n",
"2 3\n"
] |
none
| 500
|
[
{
"input": "3\n1 2 3",
"output": "1 3"
},
{
"input": "4\n6 5 6 7",
"output": "2 3"
},
{
"input": "4\n3 2 1 1",
"output": "2 3"
},
{
"input": "4\n1 2 3 3",
"output": "2 3"
},
{
"input": "3\n20 22 36",
"output": "1 3"
},
{
"input": "25\n47 30 94 41 45 20 96 51 110 129 24 116 9 47 32 82 105 114 116 75 154 151 70 42 162",
"output": "2 23"
},
{
"input": "45\n802 664 442 318 318 827 417 878 711 291 231 414 807 553 657 392 279 202 386 606 465 655 658 112 887 15 25 502 95 44 679 775 942 609 209 871 31 234 4 231 150 110 22 823 193",
"output": "2 43"
},
{
"input": "63\n93 180 116 7 8 179 268 279 136 94 221 153 264 190 278 19 19 63 153 26 158 225 25 49 89 218 111 149 255 225 197 122 243 80 3 224 107 178 202 17 53 92 69 42 228 24 81 205 95 8 265 82 228 156 127 241 172 159 106 60 67 155 111",
"output": "2 57"
},
{
"input": "83\n246 535 994 33 390 927 321 97 223 922 812 705 79 80 977 457 476 636 511 137 6 360 815 319 717 674 368 551 714 628 278 713 761 553 184 414 623 753 428 214 581 115 439 61 677 216 772 592 187 603 658 310 439 559 870 376 109 321 189 337 277 26 70 734 796 907 979 693 570 227 345 650 737 633 701 914 134 403 972 940 371 6 642",
"output": "2 80"
},
{
"input": "105\n246 57 12 204 165 123 246 68 191 310 3 152 386 333 374 257 158 104 333 50 80 290 8 340 101 76 221 316 388 289 138 359 316 26 93 290 105 178 81 195 41 196 218 180 244 292 187 97 315 323 174 119 248 239 92 312 31 2 101 180 307 170 338 314 163 281 217 31 142 238 280 190 190 156 70 74 329 113 151 8 141 313 366 40 253 116 168 124 135 230 294 266 353 389 371 359 195 200 183 237 93 102 315 118 188",
"output": "2 92"
},
{
"input": "123\n112 277 170 247 252 115 157 293 256 143 196 90 12 164 164 42 8 223 167 109 175 232 239 111 148 51 9 254 93 32 268 162 231 91 47 162 161 191 195 145 247 292 129 199 230 94 144 217 18 205 176 20 143 198 121 243 211 262 230 277 195 255 108 290 220 275 158 2 286 200 60 267 278 207 123 150 123 116 131 13 12 226 33 244 30 275 263 45 158 192 254 149 242 176 62 224 221 288 250 160 155 225 132 143 276 293 218 145 197 175 33 129 79 206 210 192 222 262 190 52 274 243 233",
"output": "3 101"
},
{
"input": "5\n5 5 5 5 5",
"output": "5 1"
},
{
"input": "3\n1000 1000 1000",
"output": "3 1"
},
{
"input": "1\n1000",
"output": "1 1"
},
{
"input": "1\n1",
"output": "1 1"
},
{
"input": "5\n1 1000 1000 1000 1000",
"output": "4 2"
},
{
"input": "5\n1000 1000 1000 8 7",
"output": "3 3"
}
] | 1,482,880,730
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 92
| 4,608,000
|
n=int(input())
t=list(map(int,input().split()))
h=len(set(t))
t.sort()
a=1
b=0
for i in range(n-1):
if t[i]==t[i+1]:
a+=1
else:
b=a
a=1
b=max(b,a)
print(b,h)
|
Title: Towers
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same.
Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible.
Input Specification:
The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000.
Output Specification:
In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars.
Demo Input:
['3\n1 2 3\n', '4\n6 5 6 7\n']
Demo Output:
['1 3\n', '2 3\n']
Note:
none
|
```python
n=int(input())
t=list(map(int,input().split()))
h=len(set(t))
t.sort()
a=1
b=0
for i in range(n-1):
if t[i]==t[i+1]:
a+=1
else:
b=a
a=1
b=max(b,a)
print(b,h)
```
| 0
|
770
|
A
|
New Password
|
PROGRAMMING
| 800
|
[
"*special",
"implementation"
] | null | null |
Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help.
Innokentiy decides that new password should satisfy the following conditions:
- the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct.
Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions.
|
The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it.
Pay attention that a desired new password always exists.
|
Print any password which satisfies all conditions given by Innokentiy.
|
[
"4 3\n",
"6 6\n",
"5 2\n"
] |
[
"java\n",
"python\n",
"phphp\n"
] |
In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it.
In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters.
In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it.
Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests.
| 500
|
[
{
"input": "4 3",
"output": "abca"
},
{
"input": "6 6",
"output": "abcdef"
},
{
"input": "5 2",
"output": "ababa"
},
{
"input": "3 2",
"output": "aba"
},
{
"input": "10 2",
"output": "ababababab"
},
{
"input": "26 13",
"output": "abcdefghijklmabcdefghijklm"
},
{
"input": "100 2",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababab"
},
{
"input": "100 10",
"output": "abcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij"
},
{
"input": "3 3",
"output": "abc"
},
{
"input": "6 3",
"output": "abcabc"
},
{
"input": "10 3",
"output": "abcabcabca"
},
{
"input": "50 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab"
},
{
"input": "90 2",
"output": "ababababababababababababababababababababababababababababababababababababababababababababab"
},
{
"input": "6 2",
"output": "ababab"
},
{
"input": "99 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabc"
},
{
"input": "4 2",
"output": "abab"
},
{
"input": "100 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca"
},
{
"input": "40 22",
"output": "abcdefghijklmnopqrstuvabcdefghijklmnopqr"
},
{
"input": "13 8",
"output": "abcdefghabcde"
},
{
"input": "16 15",
"output": "abcdefghijklmnoa"
},
{
"input": "17 17",
"output": "abcdefghijklmnopq"
},
{
"input": "19 4",
"output": "abcdabcdabcdabcdabc"
},
{
"input": "100 26",
"output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv"
},
{
"input": "100 25",
"output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxy"
},
{
"input": "26 26",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "27 26",
"output": "abcdefghijklmnopqrstuvwxyza"
},
{
"input": "2 2",
"output": "ab"
},
{
"input": "26 25",
"output": "abcdefghijklmnopqrstuvwxya"
},
{
"input": "99 2",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababa"
},
{
"input": "99 26",
"output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstu"
},
{
"input": "4 4",
"output": "abcd"
},
{
"input": "5 3",
"output": "abcab"
},
{
"input": "5 4",
"output": "abcda"
},
{
"input": "5 5",
"output": "abcde"
},
{
"input": "24 22",
"output": "abcdefghijklmnopqrstuvab"
},
{
"input": "26 14",
"output": "abcdefghijklmnabcdefghijkl"
},
{
"input": "26 15",
"output": "abcdefghijklmnoabcdefghijk"
},
{
"input": "30 12",
"output": "abcdefghijklabcdefghijklabcdef"
},
{
"input": "35 4",
"output": "abcdabcdabcdabcdabcdabcdabcdabcdabc"
},
{
"input": "79 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca"
},
{
"input": "79 14",
"output": "abcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghi"
},
{
"input": "85 13",
"output": "abcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefg"
},
{
"input": "90 25",
"output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmno"
},
{
"input": "90 19",
"output": "abcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmn"
},
{
"input": "26 24",
"output": "abcdefghijklmnopqrstuvwxab"
},
{
"input": "100 17",
"output": "abcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmno"
},
{
"input": "26 2",
"output": "ababababababababababababab"
}
] | 1,641,370,891
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 31
| 0
|
# import sys
# sys.stdout = open('DSA/Stacks/output.txt', 'w')
# sys.stdin = open('DSA/Stacks/input.txt', 'r')
alphs = [chr(i) for i in range(97,123)]
n, k = map(int, input().split())
ss = ""
for i in range(k):
ss+=alphs[i]
i = 1
while i<n-k:
ss+=ss[len(ss)%(i)]
i+=1
if len(ss)!=n:
ss+=ss[0]
print(ss)
|
Title: New Password
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help.
Innokentiy decides that new password should satisfy the following conditions:
- the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct.
Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions.
Input Specification:
The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it.
Pay attention that a desired new password always exists.
Output Specification:
Print any password which satisfies all conditions given by Innokentiy.
Demo Input:
['4 3\n', '6 6\n', '5 2\n']
Demo Output:
['java\n', 'python\n', 'phphp\n']
Note:
In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it.
In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters.
In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it.
Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests.
|
```python
# import sys
# sys.stdout = open('DSA/Stacks/output.txt', 'w')
# sys.stdin = open('DSA/Stacks/input.txt', 'r')
alphs = [chr(i) for i in range(97,123)]
n, k = map(int, input().split())
ss = ""
for i in range(k):
ss+=alphs[i]
i = 1
while i<n-k:
ss+=ss[len(ss)%(i)]
i+=1
if len(ss)!=n:
ss+=ss[0]
print(ss)
```
| 0
|
|
186
|
A
|
Comparing Strings
|
PROGRAMMING
| 1,100
|
[
"implementation",
"strings"
] | null | null |
Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters.
Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not.
|
The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length.
|
Print "YES", if the dwarves belong to the same race. Otherwise, print "NO".
|
[
"ab\nba\n",
"aa\nab\n"
] |
[
"YES\n",
"NO\n"
] |
- First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b".
| 500
|
[
{
"input": "ab\nba",
"output": "YES"
},
{
"input": "aa\nab",
"output": "NO"
},
{
"input": "a\nza",
"output": "NO"
},
{
"input": "vvea\nvvae",
"output": "YES"
},
{
"input": "rtfabanpc\natfabrnpc",
"output": "YES"
},
{
"input": "mt\ntm",
"output": "YES"
},
{
"input": "qxolmbkkt\naovlajmlf",
"output": "NO"
},
{
"input": "b\ng",
"output": "NO"
},
{
"input": "ab\naba",
"output": "NO"
},
{
"input": "ba\na",
"output": "NO"
},
{
"input": "a\nab",
"output": "NO"
},
{
"input": "a\naa",
"output": "NO"
},
{
"input": "a\nz",
"output": "NO"
},
{
"input": "aabb\nbbaa",
"output": "NO"
},
{
"input": "ab\nbd",
"output": "NO"
},
{
"input": "bac\ndae",
"output": "NO"
},
{
"input": "abc\nakl",
"output": "NO"
},
{
"input": "cb\naa",
"output": "NO"
},
{
"input": "abaab\naabba",
"output": "NO"
},
{
"input": "aab\naaa",
"output": "NO"
},
{
"input": "abcde\nedcba",
"output": "NO"
},
{
"input": "abab\nbaba",
"output": "NO"
},
{
"input": "ab\nbac",
"output": "NO"
},
{
"input": "abcd\naqcb",
"output": "NO"
},
{
"input": "abc\nbad",
"output": "NO"
},
{
"input": "ab\nca",
"output": "NO"
},
{
"input": "abc\nab",
"output": "NO"
},
{
"input": "ab\nbae",
"output": "NO"
},
{
"input": "aaaabcccca\naaaadccccb",
"output": "NO"
},
{
"input": "acaa\nabca",
"output": "NO"
},
{
"input": "aba\naab",
"output": "YES"
},
{
"input": "ah\nla",
"output": "NO"
},
{
"input": "aab\naa",
"output": "NO"
},
{
"input": "abab\nabcd",
"output": "NO"
},
{
"input": "ed\nab",
"output": "NO"
}
] | 1,626,363,541
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 6,963,200
|
def swap_check():
global flag
global genome_1, genome_2
local_flag = 1
i = 0
while i < len(genome_1)-1:
print(i)
if genome_1[i]+genome_1[i+1] != genome_2[i]+genome_2[i+1]:
if genome_1[i]+genome_1[i+1] != genome_2[i+1]+genome_2[i]:
local_flag = 0
break
else:
i += 2
continue
else:
i += 2
continue
if local_flag == 0:
print('NO')
else:
print('YES')
flag = 1
def same_string_check(str1, str2):
if len(str1) == len(str2):
if all([True if str1[i]==str2[i] else False for i in range(len(str1))]):
return True
else:
return False
else:
return True
if __name__ == '__main__':
MAX_SIZE = 10**5
flag = 0
while flag == 0:
genome_1 = input()
genome_2 = input()
if ((len(genome_1) <= MAX_SIZE) & (len(genome_1) > 0)) & ((len(genome_2) <= MAX_SIZE) & (len(genome_2) > 0)):
if (genome_1.isalpha()) & (genome_2.isalpha()) & (genome_1.islower()) & (genome_2.islower()):
if not same_string_check(genome_1+'\\', genome_2+'\\'):
swap_check()
else:
print('The two genome strings are either same of differ in length. Genomes should be different but of same length.\n')
continue
else:
print('The genome strings should be in lower case Latin letters.\n')
continue
else:
print('The genome strings should be non-empty and of at max 10^5 length.\n')
continue
|
Title: Comparing Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters.
Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not.
Input Specification:
The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length.
Output Specification:
Print "YES", if the dwarves belong to the same race. Otherwise, print "NO".
Demo Input:
['ab\nba\n', 'aa\nab\n']
Demo Output:
['YES\n', 'NO\n']
Note:
- First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b".
|
```python
def swap_check():
global flag
global genome_1, genome_2
local_flag = 1
i = 0
while i < len(genome_1)-1:
print(i)
if genome_1[i]+genome_1[i+1] != genome_2[i]+genome_2[i+1]:
if genome_1[i]+genome_1[i+1] != genome_2[i+1]+genome_2[i]:
local_flag = 0
break
else:
i += 2
continue
else:
i += 2
continue
if local_flag == 0:
print('NO')
else:
print('YES')
flag = 1
def same_string_check(str1, str2):
if len(str1) == len(str2):
if all([True if str1[i]==str2[i] else False for i in range(len(str1))]):
return True
else:
return False
else:
return True
if __name__ == '__main__':
MAX_SIZE = 10**5
flag = 0
while flag == 0:
genome_1 = input()
genome_2 = input()
if ((len(genome_1) <= MAX_SIZE) & (len(genome_1) > 0)) & ((len(genome_2) <= MAX_SIZE) & (len(genome_2) > 0)):
if (genome_1.isalpha()) & (genome_2.isalpha()) & (genome_1.islower()) & (genome_2.islower()):
if not same_string_check(genome_1+'\\', genome_2+'\\'):
swap_check()
else:
print('The two genome strings are either same of differ in length. Genomes should be different but of same length.\n')
continue
else:
print('The genome strings should be in lower case Latin letters.\n')
continue
else:
print('The genome strings should be non-empty and of at max 10^5 length.\n')
continue
```
| 0
|
|
44
|
A
|
Indian Summer
|
PROGRAMMING
| 900
|
[
"implementation"
] |
A. Indian Summer
|
2
|
256
|
Indian summer is such a beautiful time of the year! A girl named Alyona is walking in the forest and picking a bouquet from fallen leaves. Alyona is very choosy — she doesn't take a leaf if it matches the color and the species of the tree of one of the leaves she already has. Find out how many leaves Alyona has picked.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of leaves Alyona has found. The next *n* lines contain the leaves' descriptions. Each leaf is characterized by the species of the tree it has fallen from and by the color. The species of the trees and colors are given in names, consisting of no more than 10 lowercase Latin letters. A name can not be an empty string. The species of a tree and the color are given in each line separated by a space.
|
Output the single number — the number of Alyona's leaves.
|
[
"5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green\n",
"3\noak yellow\noak yellow\noak yellow\n"
] |
[
"4\n",
"1\n"
] |
none
| 0
|
[
{
"input": "5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green",
"output": "4"
},
{
"input": "3\noak yellow\noak yellow\noak yellow",
"output": "1"
},
{
"input": "5\nxbnbkzn hp\nkaqkl vrgzbvqstu\nj aqidx\nhos gyul\nwefxmh tygpluae",
"output": "5"
},
{
"input": "1\nqvwli hz",
"output": "1"
},
{
"input": "4\nsrhk x\nsrhk x\nqfoe vnrjuab\nqfoe vnrjuab",
"output": "2"
},
{
"input": "4\nsddqllmmpk syded\nfprsq fnenjnaz\nn hdej\nsddqllmmpk syded",
"output": "3"
},
{
"input": "17\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw",
"output": "1"
},
{
"input": "18\nb d\nrfdb esp\nrfdb esp\nb d\nrfdb esp\nrfdb esp\nb d\nb d\nrfdb esp\nrfdb esp\nb d\nrfdb esp\nb d\nrfdb esp\nb d\nb d\nrfdb esp\nrfdb esp",
"output": "2"
},
{
"input": "13\nsvpzwtwn rykzfdce\nqweiyeck jkreouy\nhk nnli\ntwxrnbbdt vtuv\nxokqjtylly sz\nesdt dbfidjslq\ng ybqgomvw\nxcpfjmf zcqvz\nifajadhj invzueip\nvdemdnxifb hckwebmi\nsdpnhipam wvowzavh\nuqdlfskhgo vunbpghae\ne dtigwnb",
"output": "13"
},
{
"input": "20\nm vkfh\nvptikamead mvx\nitu mf\nklruxckw aqega\nekqkd enjllwol\ncc uybfdh\nimrfdngvo u\ne uh\ntwt jsslcfuogk\nbljwqsag tuqbdn\nqcv q\nasx gzhvwwmajj\nqcv q\nekqkd enjllwol\nasx gzhvwwmajj\nks vv\nkzyfi cn\ncc uybfdh\nitu mf\ncjbjhtbyvk vatwfmux",
"output": "15"
},
{
"input": "2\nab ab\na bab",
"output": "2"
}
] | 1,589,102,770
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 29
| 280
| 20,172,800
|
check = {}
count = 0
for i in range(int(input())):
species, colour = map(str, input().split())
if species not in check:
check[species] = []
if colour not in check[species]:
check[species].append(colour)
count = count +1
print(count)
|
Title: Indian Summer
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Indian summer is such a beautiful time of the year! A girl named Alyona is walking in the forest and picking a bouquet from fallen leaves. Alyona is very choosy — she doesn't take a leaf if it matches the color and the species of the tree of one of the leaves she already has. Find out how many leaves Alyona has picked.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of leaves Alyona has found. The next *n* lines contain the leaves' descriptions. Each leaf is characterized by the species of the tree it has fallen from and by the color. The species of the trees and colors are given in names, consisting of no more than 10 lowercase Latin letters. A name can not be an empty string. The species of a tree and the color are given in each line separated by a space.
Output Specification:
Output the single number — the number of Alyona's leaves.
Demo Input:
['5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green\n', '3\noak yellow\noak yellow\noak yellow\n']
Demo Output:
['4\n', '1\n']
Note:
none
|
```python
check = {}
count = 0
for i in range(int(input())):
species, colour = map(str, input().split())
if species not in check:
check[species] = []
if colour not in check[species]:
check[species].append(colour)
count = count +1
print(count)
```
| 3.892425
|
761
|
A
|
Dasha and Stairs
|
PROGRAMMING
| 1,000
|
[
"brute force",
"constructive algorithms",
"implementation",
"math"
] | null | null |
On her way to programming school tiger Dasha faced her first test — a huge staircase!
The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers.
You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct.
|
In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly.
|
In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise.
|
[
"2 3\n",
"3 1\n"
] |
[
"YES\n",
"NO\n"
] |
In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5.
| 500
|
[
{
"input": "2 3",
"output": "YES"
},
{
"input": "3 1",
"output": "NO"
},
{
"input": "5 4",
"output": "YES"
},
{
"input": "9 9",
"output": "YES"
},
{
"input": "85 95",
"output": "NO"
},
{
"input": "0 1",
"output": "YES"
},
{
"input": "89 25",
"output": "NO"
},
{
"input": "74 73",
"output": "YES"
},
{
"input": "62 39",
"output": "NO"
},
{
"input": "57 57",
"output": "YES"
},
{
"input": "100 99",
"output": "YES"
},
{
"input": "0 0",
"output": "NO"
},
{
"input": "98 100",
"output": "NO"
},
{
"input": "99 100",
"output": "YES"
},
{
"input": "1 0",
"output": "YES"
},
{
"input": "100 0",
"output": "NO"
},
{
"input": "0 100",
"output": "NO"
},
{
"input": "100 98",
"output": "NO"
},
{
"input": "100 100",
"output": "YES"
},
{
"input": "0 5",
"output": "NO"
},
{
"input": "2 2",
"output": "YES"
}
] | 1,485,971,376
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 77
| 4,608,000
|
a,b=(int(z) for z in input().split())
if a-b in [0,1,-1] and a+b>0 and a>=0 and b>=0:
print("YES")
else:
print("NO")
|
Title: Dasha and Stairs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
On her way to programming school tiger Dasha faced her first test — a huge staircase!
The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers.
You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct.
Input Specification:
In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly.
Output Specification:
In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise.
Demo Input:
['2 3\n', '3 1\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5.
|
```python
a,b=(int(z) for z in input().split())
if a-b in [0,1,-1] and a+b>0 and a>=0 and b>=0:
print("YES")
else:
print("NO")
```
| 3
|
|
600
|
D
|
Area of Two Circles' Intersection
|
PROGRAMMING
| 2,000
|
[
"geometry"
] | null | null |
You are given two circles. Find the area of their intersection.
|
The first line contains three integers *x*1,<=*y*1,<=*r*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109,<=1<=≤<=*r*1<=≤<=109) — the position of the center and the radius of the first circle.
The second line contains three integers *x*2,<=*y*2,<=*r*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109,<=1<=≤<=*r*2<=≤<=109) — the position of the center and the radius of the second circle.
|
Print the area of the intersection of the circles. The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6.
|
[
"0 0 4\n6 0 4\n",
"0 0 5\n11 0 5\n"
] |
[
"7.25298806364175601379\n",
"0.00000000000000000000\n"
] |
none
| 0
|
[
{
"input": "0 0 4\n6 0 4",
"output": "7.25298806364175601379"
},
{
"input": "0 0 5\n11 0 5",
"output": "0.00000000000000000000"
},
{
"input": "0 0 10\n9 0 1",
"output": "3.14159265358979311600"
},
{
"input": "0 0 2\n2 2 2",
"output": "2.28318530717958647659"
},
{
"input": "0 0 10\n5 0 5",
"output": "78.53981633974482789995"
},
{
"input": "-9 8 7\n-9 8 5",
"output": "78.53981633974482789995"
},
{
"input": "-60 -85 95\n-69 -94 95",
"output": "25936.37843115316246844770"
},
{
"input": "159 111 998\n161 121 1023",
"output": "3129038.84934604830277748988"
},
{
"input": "6008 8591 6693\n5310 8351 7192",
"output": "138921450.46886559338599909097"
},
{
"input": "-13563 -6901 22958\n-19316 -16534 18514",
"output": "868466038.83295116270892322063"
},
{
"input": "-875463 79216 524620\n-891344 76571 536598",
"output": "862534134678.47474157810211181641"
},
{
"input": "-8907963 -8149654 8808560\n-8893489 -8125053 8830600",
"output": "243706233220003.66226196289062500000"
},
{
"input": "-56452806 56199829 45467742\n-56397667 56292048 45489064",
"output": "6487743741270471.46582031250000000000"
},
{
"input": "-11786939 388749051 844435993\n-11696460 388789113 844535886",
"output": "2240182216213578196.25000000000000000000"
},
{
"input": "-944341103 -3062765 891990581\n-943884414 -3338765 891882754",
"output": "2498325849744150942.00000000000000000000"
},
{
"input": "808468733 166975547 650132512\n807140196 169714842 655993403",
"output": "1327864139649690571.00000000000000000000"
},
{
"input": "-16 -107 146\n75 25 19",
"output": "75.73941676175987183783"
},
{
"input": "468534418 -876402362 779510\n392125478 -856995174 1",
"output": "0.00000000000000000000"
},
{
"input": "368831644 125127030 959524552\n690900461 -368007601 1000000000",
"output": "1877639096067727828.75000000000000000000"
},
{
"input": "638572730 86093565 553198855\n-151099010 -5582761 1000000000",
"output": "648156847022339121.87500000000000000000"
},
{
"input": "567845488 379750385 112902105\n567845488 379750385 112902105",
"output": "40045521256826535.57031250000000000000"
},
{
"input": "817163584 -145230792 164258581\n826720200 -149804696 98",
"output": "30171.85584507637308604444"
},
{
"input": "-812130546 -209199732 799576707\n-728169661 -278950375 4385",
"output": "60407250.40157159973750822246"
},
{
"input": "-36140638 -933845433 250828868\n90789911 -245130908 328547",
"output": "0.00000000000000000000"
},
{
"input": "34537868 -531411810 591044372\n34536968 -531411968 58",
"output": "10568.31768667606404221715"
},
{
"input": "-410889750 -716765873 303980004\n-410889749 -716765874 7",
"output": "153.93804002589986268390"
},
{
"input": "-304 -310 476\n120 -294 1",
"output": "3.14159265358979311600"
},
{
"input": "-999999999 0 1000000000\n999999999 0 1000000000",
"output": "119256.95877838134765625000"
},
{
"input": "-1000000000 0 1000000000\n999999999 0 1000000000",
"output": "42163.70213317871093750000"
},
{
"input": "-99999999 0 100000000\n99999999 0 100000000",
"output": "37712.36160683631896972656"
},
{
"input": "-999999999 0 1000000000\n999999999 1 1000000000",
"output": "119256.95874786376953125000"
},
{
"input": "-1000000000 0 999999999\n999999997 0 999999999",
"output": "42163.70211410522460937500"
},
{
"input": "0 1000000000 1\n0 0 1000000000",
"output": "1.57079632649338855020"
},
{
"input": "10000000 0 10000001\n-10000000 0 10000000",
"output": "4216.37028734199702739716"
},
{
"input": "1000000000 0 1000000000\n-999999999 1 1000000000",
"output": "42163.70212173461914062500"
},
{
"input": "44721 999999999 400000000\n0 0 600000000",
"output": "0.00188343226909637451"
},
{
"input": "-1000000000 1 1000000000\n999999998 0 1000000000",
"output": "119256.95874786376953125000"
},
{
"input": "0 0 500000000\n431276 999999907 500000000",
"output": "0.33492207527160644531"
},
{
"input": "1000000000 0 1000000000\n-999999998 -87334 1000000000",
"output": "1199.53919601440429687500"
},
{
"input": "0 0 10\n0 0 25",
"output": "314.15926535897931159980"
},
{
"input": "0 0 1000000000\n707106781 707106781 1",
"output": "2.09224628662147114737"
},
{
"input": "100 10 10\n100 20 10",
"output": "122.83696986087568455565"
},
{
"input": "1000000000 0 1000000000\n-999999998 -88334 1000000000",
"output": "461.20431423187255859375"
},
{
"input": "0 0 999999999\n1000000000 0 2",
"output": "2.45673939563023624650"
},
{
"input": "-99999999 0 100000000\n99999999 1 100000000",
"output": "37712.36153602600097656250"
},
{
"input": "1000000000 0 1000000000\n-999999999 60333 1000000000",
"output": "1138.08371162414550781250"
},
{
"input": "1000000000 0 1000000000\n-999999999 58333 1000000000",
"output": "2432.73669052124023437500"
},
{
"input": "1000000000 0 1000000000\n-999999998 -85334 1000000000",
"output": "3207.25725555419921875000"
},
{
"input": "0 0 1000000000\n999999999 1 2",
"output": "10.10963121370591567653"
},
{
"input": "0 0 1000000000\n999999998 0 3",
"output": "25.17685179846658691770"
},
{
"input": "141 9999 5000\n0 0 5000",
"output": "0.04272695172407026121"
},
{
"input": "-1000000000 0 1000000000\n999999998 0 1000000000",
"output": "119256.95877838134765625000"
},
{
"input": "0 0 10\n1 0 10",
"output": "294.16760182010623145277"
},
{
"input": "0 0 1000000000\n707106782 707106781 2",
"output": "4.52465731000908907454"
}
] | 1,698,341,339
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 35
| 61
| 0
|
from math import pi, acos, sin
import sys
x1, y1, r1 = [int(x) for x in input().split()]
x2, y2, r2 = [int(x) for x in input().split()]
if (x1, y1) == (x2, y2):
print(pi*min(r1, r2)**2)
sys.exit(0)
x2 -= x1
y2 -= y1
AC = abs(x2+y2*(1j))
r1, r2 = max(r1, r2), min(r1, r2)
EPS = 1e-9
if AC + r2 < r1 + EPS:
print(pi*min(r1, r2)**2)
sys.exit(0)
if AC + EPS > r1 + r2:
print(0)
sys.exit(0)
# triangel med sidor r1, C, r2
# har hörn A, E, C
# r2**2 = r1**2 + |AC|**2 - 2*r1 * |AC| * cos A
cosA = ((r1**2 + AC**2) - r2**2) / (2*r1*AC)
assert cosA > 0
A2 = 2*acos(cosA)
sector1 = A2 / 2 * r1**2
triangle1 = r1**2 * sin(A2) / 2
isec1 = sector1 - triangle1
# triangel med sidor r1, AC, r2
# har hörn A, E, C
# r1**2 = r2**2 + AC**2 - 2*r2*AC*cos C
cosC = ((r2**2 + AC**2) - r1**2) / (2*r2*AC)
if cosC+EPS > 0:
# assert cosC > 0
C2 = 2*acos(cosC)
sector2 = C2 / 2 * r2**2
triangle2 = r2**2 * sin(C2) / 2
isec2 = sector2 - triangle2
print(isec1 + isec2)
sys.exit(0)
big_angle = 2*acos(cosC)
small_angle = 2*pi - big_angle
big_sector = big_angle / 2 * r2**2
small_triangle = r2**2 * sin(small_angle) / 2
print(isec1 + big_sector + small_triangle)
# halva basen = r1 * sin(A)
# höjden = r1 * cos(A)
# bas x höjd / 2 = r1**2 * sin(A) * cos(A)
# sin(2A)/2 = sin(A) cos(A)
# # bas x höjd / 2 = r1**2 * sin(A) * cos(A)
# = r1**2 * sin(2A) / 2
|
Title: Area of Two Circles' Intersection
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two circles. Find the area of their intersection.
Input Specification:
The first line contains three integers *x*1,<=*y*1,<=*r*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109,<=1<=≤<=*r*1<=≤<=109) — the position of the center and the radius of the first circle.
The second line contains three integers *x*2,<=*y*2,<=*r*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109,<=1<=≤<=*r*2<=≤<=109) — the position of the center and the radius of the second circle.
Output Specification:
Print the area of the intersection of the circles. The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6.
Demo Input:
['0 0 4\n6 0 4\n', '0 0 5\n11 0 5\n']
Demo Output:
['7.25298806364175601379\n', '0.00000000000000000000\n']
Note:
none
|
```python
from math import pi, acos, sin
import sys
x1, y1, r1 = [int(x) for x in input().split()]
x2, y2, r2 = [int(x) for x in input().split()]
if (x1, y1) == (x2, y2):
print(pi*min(r1, r2)**2)
sys.exit(0)
x2 -= x1
y2 -= y1
AC = abs(x2+y2*(1j))
r1, r2 = max(r1, r2), min(r1, r2)
EPS = 1e-9
if AC + r2 < r1 + EPS:
print(pi*min(r1, r2)**2)
sys.exit(0)
if AC + EPS > r1 + r2:
print(0)
sys.exit(0)
# triangel med sidor r1, C, r2
# har hörn A, E, C
# r2**2 = r1**2 + |AC|**2 - 2*r1 * |AC| * cos A
cosA = ((r1**2 + AC**2) - r2**2) / (2*r1*AC)
assert cosA > 0
A2 = 2*acos(cosA)
sector1 = A2 / 2 * r1**2
triangle1 = r1**2 * sin(A2) / 2
isec1 = sector1 - triangle1
# triangel med sidor r1, AC, r2
# har hörn A, E, C
# r1**2 = r2**2 + AC**2 - 2*r2*AC*cos C
cosC = ((r2**2 + AC**2) - r1**2) / (2*r2*AC)
if cosC+EPS > 0:
# assert cosC > 0
C2 = 2*acos(cosC)
sector2 = C2 / 2 * r2**2
triangle2 = r2**2 * sin(C2) / 2
isec2 = sector2 - triangle2
print(isec1 + isec2)
sys.exit(0)
big_angle = 2*acos(cosC)
small_angle = 2*pi - big_angle
big_sector = big_angle / 2 * r2**2
small_triangle = r2**2 * sin(small_angle) / 2
print(isec1 + big_sector + small_triangle)
# halva basen = r1 * sin(A)
# höjden = r1 * cos(A)
# bas x höjd / 2 = r1**2 * sin(A) * cos(A)
# sin(2A)/2 = sin(A) cos(A)
# # bas x höjd / 2 = r1**2 * sin(A) * cos(A)
# = r1**2 * sin(2A) / 2
```
| 0
|
|
463
|
B
|
Caisa and Pylons
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation",
"math"
] | null | null |
Caisa solved the problem with the sugar and now he is on the way back to home.
Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=><=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time.
Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game?
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=≤<=<=*h**i*<=<=≤<=<=105) representing the heights of the pylons.
|
Print a single number representing the minimum number of dollars paid by Caisa.
|
[
"5\n3 4 3 2 4\n",
"3\n4 4 4\n"
] |
[
"4\n",
"4\n"
] |
In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon.
| 1,000
|
[
{
"input": "5\n3 4 3 2 4",
"output": "4"
},
{
"input": "3\n4 4 4",
"output": "4"
},
{
"input": "99\n1401 2019 1748 3785 3236 3177 3443 3772 2138 1049 353 908 310 2388 1322 88 2160 2783 435 2248 1471 706 2468 2319 3156 3506 2794 1999 1983 2519 2597 3735 537 344 3519 3772 3872 2961 3895 2010 10 247 3269 671 2986 942 758 1146 77 1545 3745 1547 2250 2565 217 1406 2070 3010 3404 404 1528 2352 138 2065 3047 3656 2188 2919 2616 2083 1280 2977 2681 548 4000 1667 1489 1109 3164 1565 2653 3260 3463 903 1824 3679 2308 245 2689 2063 648 568 766 785 2984 3812 440 1172 2730",
"output": "4000"
},
{
"input": "68\n477 1931 3738 3921 2306 1823 3328 2057 661 3993 2967 3520 171 1739 1525 1817 209 3475 1902 2666 518 3283 3412 3040 3383 2331 1147 1460 1452 1800 1327 2280 82 1416 2200 2388 3238 1879 796 250 1872 114 121 2042 1853 1645 211 2061 1472 2464 726 1989 1746 489 1380 1128 2819 2527 2939 622 678 265 2902 1111 2032 1453 3850 1621",
"output": "3993"
},
{
"input": "30\n30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "30"
},
{
"input": "3\n3 2 1",
"output": "3"
},
{
"input": "1\n69",
"output": "69"
}
] | 1,666,165,344
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 46
| 134,860,800
|
import sys
import threading
from functools import lru_cache
from bisect import bisect_left
from collections import defaultdict, deque
from heapq import *
def main():
n = int(input())
h = [int(i) for i in input().split()]
ans = h[0]
cur = 0
for index in range(n-1):
if h[index] >= h[index+1]:
cur += h[index]-h[index+1]
else:
if cur+h[index] < h[index+1]:
ans += h[index+1]-h[index]
cur += h[index+1]-h[index]
else:
cur -= h[index+1] - h[index]
print(ans)
if __name__ == '__main__':
sys.setrecursionlimit(1 << 30)
threading.stack_size(1 << 27)
main_thread = threading.Thread(target=main)
main_thread.start()
main_thread.join()
|
Title: Caisa and Pylons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Caisa solved the problem with the sugar and now he is on the way back to home.
Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=><=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time.
Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=≤<=<=*h**i*<=<=≤<=<=105) representing the heights of the pylons.
Output Specification:
Print a single number representing the minimum number of dollars paid by Caisa.
Demo Input:
['5\n3 4 3 2 4\n', '3\n4 4 4\n']
Demo Output:
['4\n', '4\n']
Note:
In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon.
|
```python
import sys
import threading
from functools import lru_cache
from bisect import bisect_left
from collections import defaultdict, deque
from heapq import *
def main():
n = int(input())
h = [int(i) for i in input().split()]
ans = h[0]
cur = 0
for index in range(n-1):
if h[index] >= h[index+1]:
cur += h[index]-h[index+1]
else:
if cur+h[index] < h[index+1]:
ans += h[index+1]-h[index]
cur += h[index+1]-h[index]
else:
cur -= h[index+1] - h[index]
print(ans)
if __name__ == '__main__':
sys.setrecursionlimit(1 << 30)
threading.stack_size(1 << 27)
main_thread = threading.Thread(target=main)
main_thread.start()
main_thread.join()
```
| 0
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,659,519,500
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
numbers = int(input())
array = [int(x) for x in input().split(' ')
even = 0
odd = 0
tab = []
for i in range(number):
if x % 2 == 0:
if odd > 1:
print(i + 1)
else:
even += 1
else:
if even > 1:
print(i + 1)
else:
odd += 1
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
numbers = int(input())
array = [int(x) for x in input().split(' ')
even = 0
odd = 0
tab = []
for i in range(number):
if x % 2 == 0:
if odd > 1:
print(i + 1)
else:
even += 1
else:
if even > 1:
print(i + 1)
else:
odd += 1
```
| -1
|
637
|
A
|
Voting for Photos
|
PROGRAMMING
| 1,000
|
[
"*special",
"constructive algorithms",
"implementation"
] | null | null |
After celebrating the midcourse the students of one of the faculties of the Berland State University decided to conduct a vote for the best photo. They published the photos in the social network and agreed on the rules to choose a winner: the photo which gets most likes wins. If multiple photoes get most likes, the winner is the photo that gets this number first.
Help guys determine the winner photo by the records of likes.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the total likes to the published photoes.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1<=000<=000), where *a**i* is the identifier of the photo which got the *i*-th like.
|
Print the identifier of the photo which won the elections.
|
[
"5\n1 3 2 2 1\n",
"9\n100 200 300 200 100 300 300 100 200\n"
] |
[
"2\n",
"300\n"
] |
In the first test sample the photo with id 1 got two likes (first and fifth), photo with id 2 got two likes (third and fourth), and photo with id 3 got one like (second).
Thus, the winner is the photo with identifier 2, as it got:
- more likes than the photo with id 3; - as many likes as the photo with id 1, but the photo with the identifier 2 got its second like earlier.
| 500
|
[
{
"input": "5\n1 3 2 2 1",
"output": "2"
},
{
"input": "9\n100 200 300 200 100 300 300 100 200",
"output": "300"
},
{
"input": "1\n5",
"output": "5"
},
{
"input": "1\n1000000",
"output": "1000000"
},
{
"input": "5\n1 3 4 2 2",
"output": "2"
},
{
"input": "10\n2 1 2 3 1 5 8 7 4 8",
"output": "2"
},
{
"input": "7\n1 1 2 2 2 3 3",
"output": "2"
},
{
"input": "12\n2 3 1 2 3 3 3 2 1 1 2 1",
"output": "3"
},
{
"input": "15\n7 6 8 4 9 8 7 3 4 6 7 5 4 2 8",
"output": "7"
},
{
"input": "15\n100 200 300 500 300 400 600 300 100 200 400 300 600 200 100",
"output": "300"
},
{
"input": "10\n677171 677171 677171 677171 672280 677171 677171 672280 672280 677171",
"output": "677171"
},
{
"input": "15\n137419 137419 531977 438949 137419 438949 438949 137419 438949 531977 531977 531977 438949 438949 438949",
"output": "438949"
},
{
"input": "20\n474463 517819 640039 640039 640039 640039 474463 474463 474463 640039 640039 474463 474463 425567 474463 517819 640039 474463 517819 517819",
"output": "474463"
},
{
"input": "40\n119631 119631 772776 119631 658661 119631 108862 524470 125132 700668 69196 844949 154577 108862 108862 108862 597344 940938 989698 108862 154577 69196 125132 687080 940938 125132 69196 69196 125132 566152 953083 406319 380068 119631 154577 125132 413984 69196 154577 154577",
"output": "108862"
},
{
"input": "5\n1 1 1000000 1000000 1000000",
"output": "1000000"
},
{
"input": "5\n1000000 1 1 1000000 1",
"output": "1"
},
{
"input": "10\n1 1 1000000 1000000 1000000 1 1000000 1 1 1000000",
"output": "1"
},
{
"input": "8\n1000000 1000000 1 1 1 1000000 1000000 1",
"output": "1000000"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n1000000 1",
"output": "1000000"
},
{
"input": "2\n1 1000000",
"output": "1"
},
{
"input": "2\n1000000 1000000",
"output": "1000000"
},
{
"input": "3\n1 1 1",
"output": "1"
},
{
"input": "3\n1 1 2",
"output": "1"
},
{
"input": "3\n1 2 1",
"output": "1"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "4\n1 1000000 1000000 1",
"output": "1000000"
}
] | 1,611,406,550
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 65
| 93
| 307,200
|
a = int(input())
b = list(map(int,input().split()))
d = []
e = []
c = 0
for x in b:
if b.count(x) > c:
c = b.count(x)
for x in b:
if b.count(x) == c:
d.append(x)
for x in range(len(d)):
a = 0
if d.count(d[a]) != 1:
d.pop(d.index(d[a]))
else:
a += 1
print(d[0])
|
Title: Voting for Photos
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After celebrating the midcourse the students of one of the faculties of the Berland State University decided to conduct a vote for the best photo. They published the photos in the social network and agreed on the rules to choose a winner: the photo which gets most likes wins. If multiple photoes get most likes, the winner is the photo that gets this number first.
Help guys determine the winner photo by the records of likes.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the total likes to the published photoes.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1<=000<=000), where *a**i* is the identifier of the photo which got the *i*-th like.
Output Specification:
Print the identifier of the photo which won the elections.
Demo Input:
['5\n1 3 2 2 1\n', '9\n100 200 300 200 100 300 300 100 200\n']
Demo Output:
['2\n', '300\n']
Note:
In the first test sample the photo with id 1 got two likes (first and fifth), photo with id 2 got two likes (third and fourth), and photo with id 3 got one like (second).
Thus, the winner is the photo with identifier 2, as it got:
- more likes than the photo with id 3; - as many likes as the photo with id 1, but the photo with the identifier 2 got its second like earlier.
|
```python
a = int(input())
b = list(map(int,input().split()))
d = []
e = []
c = 0
for x in b:
if b.count(x) > c:
c = b.count(x)
for x in b:
if b.count(x) == c:
d.append(x)
for x in range(len(d)):
a = 0
if d.count(d[a]) != 1:
d.pop(d.index(d[a]))
else:
a += 1
print(d[0])
```
| 3
|
|
739
|
B
|
Alyona and a tree
|
PROGRAMMING
| 1,900
|
[
"binary search",
"data structures",
"dfs and similar",
"graphs",
"trees"
] | null | null |
Alyona has a tree with *n* vertices. The root of the tree is the vertex 1. In each vertex Alyona wrote an positive integer, in the vertex *i* she wrote *a**i*. Moreover, the girl wrote a positive integer to every edge of the tree (possibly, different integers on different edges).
Let's define *dist*(*v*,<=*u*) as the sum of the integers written on the edges of the simple path from *v* to *u*.
The vertex *v* controls the vertex *u* (*v*<=≠<=*u*) if and only if *u* is in the subtree of *v* and *dist*(*v*,<=*u*)<=≤<=*a**u*.
Alyona wants to settle in some vertex. In order to do this, she wants to know for each vertex *v* what is the number of vertices *u* such that *v* controls *u*.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105).
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the integers written in the vertices.
The next (*n*<=-<=1) lines contain two integers each. The *i*-th of these lines contains integers *p**i* and *w**i* (1<=≤<=*p**i*<=≤<=*n*, 1<=≤<=*w**i*<=≤<=109) — the parent of the (*i*<=+<=1)-th vertex in the tree and the number written on the edge between *p**i* and (*i*<=+<=1).
It is guaranteed that the given graph is a tree.
|
Print *n* integers — the *i*-th of these numbers should be equal to the number of vertices that the *i*-th vertex controls.
|
[
"5\n2 5 1 4 6\n1 7\n1 1\n3 5\n3 6\n",
"5\n9 7 8 6 5\n1 1\n2 1\n3 1\n4 1\n"
] |
[
"1 0 1 0 0\n",
"4 3 2 1 0\n"
] |
In the example test case the vertex 1 controls the vertex 3, the vertex 3 controls the vertex 5 (note that is doesn't mean the vertex 1 controls the vertex 5).
| 1,000
|
[
{
"input": "5\n2 5 1 4 6\n1 7\n1 1\n3 5\n3 6",
"output": "1 0 1 0 0"
},
{
"input": "5\n9 7 8 6 5\n1 1\n2 1\n3 1\n4 1",
"output": "4 3 2 1 0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "2\n1 1\n1 1",
"output": "1 0"
},
{
"input": "10\n40 77 65 14 86 16 2 51 62 79\n1 75\n10 86\n3 52\n6 51\n10 8\n3 61\n3 53\n5 98\n2 7",
"output": "1 3 0 0 0 1 0 0 0 2"
},
{
"input": "10\n52 1 84 16 59 26 56 74 52 97\n5 7\n7 13\n3 98\n7 22\n7 19\n9 54\n4 45\n10 95\n1 94",
"output": "1 0 0 1 0 0 3 0 2 0"
},
{
"input": "10\n68 29 12 14 27 47 95 100 45 14\n10 42\n9 52\n3 44\n2 81\n5 34\n3 46\n6 40\n8 89\n1 85",
"output": "0 0 1 0 2 1 0 0 0 0"
},
{
"input": "10\n84 65 39 20 8 52 49 18 35 32\n3 70\n9 79\n1 99\n3 49\n4 41\n3 43\n3 35\n4 83\n2 72",
"output": "0 0 1 1 0 0 0 0 0 0"
},
{
"input": "10\n96 92 63 25 80 74 95 41 28 54\n6 98\n1 11\n5 45\n3 12\n7 63\n4 39\n7 31\n8 81\n2 59",
"output": "2 0 1 1 1 0 2 0 0 0"
},
{
"input": "10\n4 24 86 31 49 87 42 75 18 71\n4 37\n5 46\n9 88\n1 75\n10 74\n5 32\n4 22\n7 79\n8 50",
"output": "0 0 0 1 2 0 0 1 0 1"
},
{
"input": "10\n19 48 18 37 34 1 96 98 3 85\n7 65\n2 77\n6 34\n3 39\n1 85\n6 24\n2 9\n3 73\n2 41",
"output": "0 2 0 0 0 3 1 0 0 0"
},
{
"input": "10\n31 83 37 43 2 14 39 24 93 7\n6 1\n9 17\n8 84\n3 6\n4 100\n5 21\n1 9\n6 67\n2 29",
"output": "1 0 1 0 1 2 0 0 1 0"
},
{
"input": "10\n47 7 65 49 75 36 93 47 86 24\n3 28\n4 40\n1 35\n3 65\n3 11\n2 17\n5 96\n2 60\n8 24",
"output": "1 2 3 2 0 0 0 1 0 0"
},
{
"input": "10\n1 65 76 59 21 58 97 37 30 84\n6 4\n7 28\n9 19\n2 65\n1 53\n5 10\n5 42\n10 72\n2 89",
"output": "2 1 0 0 2 2 1 0 1 0"
},
{
"input": "5\n1 1 1 1 1\n1 1000000000\n2 1000000000\n3 1000000000\n4 1000000000",
"output": "0 0 0 0 0"
},
{
"input": "6\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000\n1 1000000000\n2 1000000000\n3 1000000000\n4 1000000000\n5 1000000000",
"output": "1 1 1 1 1 0"
},
{
"input": "10\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000\n1 1000000000\n2 1000000000\n3 1000000000\n4 1000000000\n5 1000000000\n6 1000000000\n7 1000000000\n8 1000000000\n9 1000000000",
"output": "1 1 1 1 1 1 1 1 1 0"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1\n1 1000000000\n2 1000000000\n3 1000000000\n4 1000000000\n5 1000000000\n6 1000000000\n7 1000000000\n8 1000000000\n9 1000000000",
"output": "0 0 0 0 0 0 0 0 0 0"
},
{
"input": "10\n500000000 500000000 500000000 500000000 500000000 500000000 500000000 500000000 500000000 500000000\n1 1000000000\n2 1000000000\n3 1000000000\n4 1000000000\n5 1000000000\n6 1000000000\n7 1000000000\n8 1000000000\n9 1000000000",
"output": "0 0 0 0 0 0 0 0 0 0"
},
{
"input": "5\n1000000000 1000000000 1000000000 1000000000 1000000000\n1 1000000000\n2 1000000000\n3 1000000000\n4 1000000000",
"output": "1 1 1 1 0"
}
] | 1,692,609,043
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 31
| 0
|
print("_RANDOM_GUESS_1692609043.635667")# 1692609043.6356852
|
Title: Alyona and a tree
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alyona has a tree with *n* vertices. The root of the tree is the vertex 1. In each vertex Alyona wrote an positive integer, in the vertex *i* she wrote *a**i*. Moreover, the girl wrote a positive integer to every edge of the tree (possibly, different integers on different edges).
Let's define *dist*(*v*,<=*u*) as the sum of the integers written on the edges of the simple path from *v* to *u*.
The vertex *v* controls the vertex *u* (*v*<=≠<=*u*) if and only if *u* is in the subtree of *v* and *dist*(*v*,<=*u*)<=≤<=*a**u*.
Alyona wants to settle in some vertex. In order to do this, she wants to know for each vertex *v* what is the number of vertices *u* such that *v* controls *u*.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105).
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the integers written in the vertices.
The next (*n*<=-<=1) lines contain two integers each. The *i*-th of these lines contains integers *p**i* and *w**i* (1<=≤<=*p**i*<=≤<=*n*, 1<=≤<=*w**i*<=≤<=109) — the parent of the (*i*<=+<=1)-th vertex in the tree and the number written on the edge between *p**i* and (*i*<=+<=1).
It is guaranteed that the given graph is a tree.
Output Specification:
Print *n* integers — the *i*-th of these numbers should be equal to the number of vertices that the *i*-th vertex controls.
Demo Input:
['5\n2 5 1 4 6\n1 7\n1 1\n3 5\n3 6\n', '5\n9 7 8 6 5\n1 1\n2 1\n3 1\n4 1\n']
Demo Output:
['1 0 1 0 0\n', '4 3 2 1 0\n']
Note:
In the example test case the vertex 1 controls the vertex 3, the vertex 3 controls the vertex 5 (note that is doesn't mean the vertex 1 controls the vertex 5).
|
```python
print("_RANDOM_GUESS_1692609043.635667")# 1692609043.6356852
```
| 0
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,693,734,798
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 15
| 0
|
(l,b,a)=map(int,input().split())
c=0
if(b%a==0):
c=b//a
else:
c=b//a+1
if(l%a==0):
c=c+l//a
else:
c=c+l//a+1
print(c)
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
(l,b,a)=map(int,input().split())
c=0
if(b%a==0):
c=b//a
else:
c=b//a+1
if(l%a==0):
c=c+l//a
else:
c=c+l//a+1
print(c)
```
| 0
|
750
|
A
|
New Year and Hurry
|
PROGRAMMING
| 800
|
[
"binary search",
"brute force",
"implementation",
"math"
] | null | null |
Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5·*i* minutes to solve the *i*-th problem.
Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first.
How many problems can Limak solve if he wants to make it to the party?
|
The only line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=10, 1<=≤<=*k*<=≤<=240) — the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house.
|
Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier.
|
[
"3 222\n",
"4 190\n",
"7 1\n"
] |
[
"2\n",
"4\n",
"7\n"
] |
In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2.
In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight.
In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
| 500
|
[
{
"input": "3 222",
"output": "2"
},
{
"input": "4 190",
"output": "4"
},
{
"input": "7 1",
"output": "7"
},
{
"input": "10 135",
"output": "6"
},
{
"input": "10 136",
"output": "5"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 240",
"output": "0"
},
{
"input": "10 1",
"output": "9"
},
{
"input": "10 240",
"output": "0"
},
{
"input": "9 240",
"output": "0"
},
{
"input": "9 1",
"output": "9"
},
{
"input": "9 235",
"output": "1"
},
{
"input": "9 236",
"output": "0"
},
{
"input": "5 225",
"output": "2"
},
{
"input": "5 226",
"output": "1"
},
{
"input": "4 210",
"output": "3"
},
{
"input": "4 211",
"output": "2"
},
{
"input": "4 191",
"output": "3"
},
{
"input": "10 165",
"output": "5"
},
{
"input": "10 166",
"output": "4"
},
{
"input": "8 100",
"output": "7"
},
{
"input": "8 101",
"output": "6"
},
{
"input": "8 60",
"output": "8"
},
{
"input": "8 61",
"output": "7"
},
{
"input": "10 15",
"output": "9"
},
{
"input": "10 16",
"output": "8"
},
{
"input": "4 100",
"output": "4"
},
{
"input": "4 101",
"output": "4"
},
{
"input": "7 167",
"output": "4"
},
{
"input": "10 164",
"output": "5"
},
{
"input": "9 170",
"output": "4"
},
{
"input": "8 160",
"output": "5"
},
{
"input": "1 100",
"output": "1"
},
{
"input": "8 123",
"output": "6"
},
{
"input": "2 99",
"output": "2"
},
{
"input": "10 88",
"output": "7"
},
{
"input": "1 235",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "4 240",
"output": "0"
},
{
"input": "1 55",
"output": "1"
},
{
"input": "1 240",
"output": "0"
},
{
"input": "3 240",
"output": "0"
},
{
"input": "10 240",
"output": "0"
},
{
"input": "2 240",
"output": "0"
},
{
"input": "10 1",
"output": "9"
},
{
"input": "9 1",
"output": "9"
},
{
"input": "2 236",
"output": "0"
},
{
"input": "10 2",
"output": "9"
},
{
"input": "3 239",
"output": "0"
},
{
"input": "1 237",
"output": "0"
},
{
"input": "7 8",
"output": "7"
},
{
"input": "10 235",
"output": "1"
}
] | 1,682,686,385
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 52
| 46
| 0
|
a, b = map(int, input().split())
muxs = 240 - b
sum1 = 0
f = False
for i in range(1, a + 1):
if muxs - (5 * i) == 0:
sum1 += 1
break
elif muxs - (5 * i) < 0:
print(sum1)
f = True
break
else:
muxs -= 5 * i
sum1 += 1
if f is False:
print(sum1)
|
Title: New Year and Hurry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5·*i* minutes to solve the *i*-th problem.
Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first.
How many problems can Limak solve if he wants to make it to the party?
Input Specification:
The only line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=10, 1<=≤<=*k*<=≤<=240) — the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house.
Output Specification:
Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier.
Demo Input:
['3 222\n', '4 190\n', '7 1\n']
Demo Output:
['2\n', '4\n', '7\n']
Note:
In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2.
In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight.
In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
|
```python
a, b = map(int, input().split())
muxs = 240 - b
sum1 = 0
f = False
for i in range(1, a + 1):
if muxs - (5 * i) == 0:
sum1 += 1
break
elif muxs - (5 * i) < 0:
print(sum1)
f = True
break
else:
muxs -= 5 * i
sum1 += 1
if f is False:
print(sum1)
```
| 3
|
|
814
|
C
|
An impassioned circulation of affection
|
PROGRAMMING
| 1,600
|
[
"brute force",
"dp",
"strings",
"two pointers"
] | null | null |
Nadeko's birthday is approaching! As she decorated the room for the party, a long garland of Dianthus-shaped paper pieces was placed on a prominent part of the wall. Brother Koyomi will like it!
Still unsatisfied with the garland, Nadeko decided to polish it again. The garland has *n* pieces numbered from 1 to *n* from left to right, and the *i*-th piece has a colour *s**i*, denoted by a lowercase English letter. Nadeko will repaint at most *m* of the pieces to give each of them an arbitrary new colour (still denoted by a lowercase English letter). After this work, she finds out all subsegments of the garland containing pieces of only colour *c* — Brother Koyomi's favourite one, and takes the length of the longest among them to be the Koyomity of the garland.
For instance, let's say the garland is represented by "kooomo", and Brother Koyomi's favourite colour is "o". Among all subsegments containing pieces of "o" only, "ooo" is the longest, with a length of 3. Thus the Koyomity of this garland equals 3.
But problem arises as Nadeko is unsure about Brother Koyomi's favourite colour, and has swaying ideas on the amount of work to do. She has *q* plans on this, each of which can be expressed as a pair of an integer *m**i* and a lowercase letter *c**i*, meanings of which are explained above. You are to find out the maximum Koyomity achievable after repainting the garland according to each plan.
|
The first line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=1<=500) — the length of the garland.
The second line contains *n* lowercase English letters *s*1*s*2... *s**n* as a string — the initial colours of paper pieces on the garland.
The third line contains a positive integer *q* (1<=≤<=*q*<=≤<=200<=000) — the number of plans Nadeko has.
The next *q* lines describe one plan each: the *i*-th among them contains an integer *m**i* (1<=≤<=*m**i*<=≤<=*n*) — the maximum amount of pieces to repaint, followed by a space, then by a lowercase English letter *c**i* — Koyomi's possible favourite colour.
|
Output *q* lines: for each work plan, output one line containing an integer — the largest Koyomity achievable after repainting the garland according to it.
|
[
"6\nkoyomi\n3\n1 o\n4 o\n4 m\n",
"15\nyamatonadeshiko\n10\n1 a\n2 a\n3 a\n4 a\n5 a\n1 b\n2 b\n3 b\n4 b\n5 b\n",
"10\naaaaaaaaaa\n2\n10 b\n10 z\n"
] |
[
"3\n6\n5\n",
"3\n4\n5\n7\n8\n1\n2\n3\n4\n5\n",
"10\n10\n"
] |
In the first sample, there are three plans:
- In the first plan, at most 1 piece can be repainted. Repainting the "y" piece to become "o" results in "kooomi", whose Koyomity of 3 is the best achievable; - In the second plan, at most 4 pieces can be repainted, and "oooooo" results in a Koyomity of 6; - In the third plan, at most 4 pieces can be repainted, and "mmmmmi" and "kmmmmm" both result in a Koyomity of 5.
| 1,750
|
[
{
"input": "6\nkoyomi\n3\n1 o\n4 o\n4 m",
"output": "3\n6\n5"
},
{
"input": "15\nyamatonadeshiko\n10\n1 a\n2 a\n3 a\n4 a\n5 a\n1 b\n2 b\n3 b\n4 b\n5 b",
"output": "3\n4\n5\n7\n8\n1\n2\n3\n4\n5"
},
{
"input": "10\naaaaaaaaaa\n2\n10 b\n10 z",
"output": "10\n10"
},
{
"input": "1\nc\n4\n1 x\n1 a\n1 e\n1 t",
"output": "1\n1\n1\n1"
},
{
"input": "20\naaaaaaaaaaaaaaaaaaaa\n1\n11 a",
"output": "20"
},
{
"input": "4\ncbcc\n12\n4 b\n4 c\n1 b\n2 a\n3 b\n2 c\n4 a\n1 a\n2 b\n3 a\n1 c\n3 c",
"output": "4\n4\n2\n2\n4\n4\n4\n1\n3\n3\n4\n4"
},
{
"input": "4\nddbb\n16\n3 c\n3 b\n1 a\n1 b\n4 d\n4 a\n3 d\n2 a\n2 d\n4 c\n3 a\n2 c\n4 b\n1 c\n2 b\n1 d",
"output": "3\n4\n1\n3\n4\n4\n4\n2\n4\n4\n3\n2\n4\n1\n4\n3"
},
{
"input": "4\nabcc\n24\n1 c\n4 d\n3 c\n1 d\n1 c\n1 b\n3 b\n2 c\n3 d\n3 d\n4 c\n2 a\n4 d\n1 a\n1 b\n4 a\n4 d\n3 b\n4 b\n3 c\n3 a\n2 d\n1 a\n2 b",
"output": "3\n4\n4\n1\n3\n2\n4\n4\n3\n3\n4\n3\n4\n2\n2\n4\n4\n4\n4\n4\n4\n2\n2\n3"
},
{
"input": "40\ncbbcbcccccacccccbbacbaabccbbabbaaaaacccc\n10\n40 a\n28 c\n25 c\n21 a\n18 c\n27 a\n9 c\n37 c\n15 a\n18 b",
"output": "40\n40\n40\n31\n35\n37\n23\n40\n24\n27"
},
{
"input": "100\ndddddccccdddddaaaaabbbbbbbbbbbbbaaacdcabbacccacccccbdbbadddbbddddbdaaccacdddbbbaddddbbbbdcbbbdddddda\n50\n54 b\n48 d\n45 b\n52 c\n52 a\n48 a\n54 b\n45 a\n47 d\n50 d\n53 a\n34 a\n51 b\n48 d\n47 d\n47 a\n48 d\n53 b\n52 d\n54 d\n46 a\n38 a\n52 b\n49 a\n49 b\n46 c\n54 a\n45 b\n35 c\n55 c\n51 c\n46 d\n54 d\n50 a\n33 c\n46 a\n50 b\n50 a\n54 a\n32 b\n55 b\n49 c\n53 d\n49 a\n46 b\n48 c\n47 b\n47 b\n47 a\n46 b",
"output": "85\n72\n76\n69\n68\n63\n85\n60\n71\n74\n69\n46\n82\n72\n71\n62\n72\n84\n76\n78\n61\n50\n83\n64\n80\n60\n70\n76\n49\n72\n68\n70\n78\n66\n47\n61\n81\n66\n70\n53\n86\n63\n77\n64\n77\n62\n78\n78\n62\n77"
},
{
"input": "200\nddeecdbbbeeeeebbbbbaaaaaaaaaaaaaaaaaaaaaaabbcaacccbeeeeddddddddddddccccccdffeeeeecccccbbbbaaaaedfffffaadeeeeeeeedddddaaaaaaaaaaaaaabbbbbcaadddeefffbbbbcccccccccccbbbbbbeeeeeeeffffffdffffffffffffaaaaab\n10\n43 f\n118 d\n165 f\n72 f\n48 f\n2 a\n61 e\n94 d\n109 f\n16 a",
"output": "64\n144\n193\n98\n69\n25\n79\n117\n137\n41"
},
{
"input": "5\naaaaa\n1\n1 b",
"output": "1"
}
] | 1,615,302,682
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 37
| 1,684
| 14,233,600
|
import sys
# sys.stdin = open('input.txt', 'r')
# sys.stdout = open('output.txt', 'w')
input = sys.stdin.readline
def getCons(string, m, c):
n = len(string)
ans = 0
st, end = 0, 0
while end < n:
if string[end] == c:
end += 1
elif m:
m -= 1
end += 1
else:
while st < end and string[st] == c:
st += 1
st += 1
m += 1
ans = max(ans, end-st)
return ans
t = 1
while t:
t -= 1
n = int(input())
s = input().strip()
dp = {}
q = int(input())
for _ in range(q):
m, c = input().split()
if (m, c) in dp:
print(dp[(m, c)])
continue
dp[(m, c)] = getCons(s, int(m), c)
print(dp[(m, c)])
|
Title: An impassioned circulation of affection
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nadeko's birthday is approaching! As she decorated the room for the party, a long garland of Dianthus-shaped paper pieces was placed on a prominent part of the wall. Brother Koyomi will like it!
Still unsatisfied with the garland, Nadeko decided to polish it again. The garland has *n* pieces numbered from 1 to *n* from left to right, and the *i*-th piece has a colour *s**i*, denoted by a lowercase English letter. Nadeko will repaint at most *m* of the pieces to give each of them an arbitrary new colour (still denoted by a lowercase English letter). After this work, she finds out all subsegments of the garland containing pieces of only colour *c* — Brother Koyomi's favourite one, and takes the length of the longest among them to be the Koyomity of the garland.
For instance, let's say the garland is represented by "kooomo", and Brother Koyomi's favourite colour is "o". Among all subsegments containing pieces of "o" only, "ooo" is the longest, with a length of 3. Thus the Koyomity of this garland equals 3.
But problem arises as Nadeko is unsure about Brother Koyomi's favourite colour, and has swaying ideas on the amount of work to do. She has *q* plans on this, each of which can be expressed as a pair of an integer *m**i* and a lowercase letter *c**i*, meanings of which are explained above. You are to find out the maximum Koyomity achievable after repainting the garland according to each plan.
Input Specification:
The first line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=1<=500) — the length of the garland.
The second line contains *n* lowercase English letters *s*1*s*2... *s**n* as a string — the initial colours of paper pieces on the garland.
The third line contains a positive integer *q* (1<=≤<=*q*<=≤<=200<=000) — the number of plans Nadeko has.
The next *q* lines describe one plan each: the *i*-th among them contains an integer *m**i* (1<=≤<=*m**i*<=≤<=*n*) — the maximum amount of pieces to repaint, followed by a space, then by a lowercase English letter *c**i* — Koyomi's possible favourite colour.
Output Specification:
Output *q* lines: for each work plan, output one line containing an integer — the largest Koyomity achievable after repainting the garland according to it.
Demo Input:
['6\nkoyomi\n3\n1 o\n4 o\n4 m\n', '15\nyamatonadeshiko\n10\n1 a\n2 a\n3 a\n4 a\n5 a\n1 b\n2 b\n3 b\n4 b\n5 b\n', '10\naaaaaaaaaa\n2\n10 b\n10 z\n']
Demo Output:
['3\n6\n5\n', '3\n4\n5\n7\n8\n1\n2\n3\n4\n5\n', '10\n10\n']
Note:
In the first sample, there are three plans:
- In the first plan, at most 1 piece can be repainted. Repainting the "y" piece to become "o" results in "kooomi", whose Koyomity of 3 is the best achievable; - In the second plan, at most 4 pieces can be repainted, and "oooooo" results in a Koyomity of 6; - In the third plan, at most 4 pieces can be repainted, and "mmmmmi" and "kmmmmm" both result in a Koyomity of 5.
|
```python
import sys
# sys.stdin = open('input.txt', 'r')
# sys.stdout = open('output.txt', 'w')
input = sys.stdin.readline
def getCons(string, m, c):
n = len(string)
ans = 0
st, end = 0, 0
while end < n:
if string[end] == c:
end += 1
elif m:
m -= 1
end += 1
else:
while st < end and string[st] == c:
st += 1
st += 1
m += 1
ans = max(ans, end-st)
return ans
t = 1
while t:
t -= 1
n = int(input())
s = input().strip()
dp = {}
q = int(input())
for _ in range(q):
m, c = input().split()
if (m, c) in dp:
print(dp[(m, c)])
continue
dp[(m, c)] = getCons(s, int(m), c)
print(dp[(m, c)])
```
| 3
|
|
171
|
B
|
Star
|
PROGRAMMING
| 1,300
|
[
"*special",
"combinatorics"
] | null | null |
The input contains a single integer *a* (1<=≤<=*a*<=≤<=18257).
|
Print a single integer *output* (1<=≤<=*output*<=≤<=2·109).
|
[
"2\n"
] |
[
"13"
] |
none
| 0
|
[
{
"input": "2",
"output": "13"
},
{
"input": "1",
"output": "1"
},
{
"input": "3",
"output": "37"
},
{
"input": "4",
"output": "73"
},
{
"input": "5",
"output": "121"
},
{
"input": "6",
"output": "181"
},
{
"input": "7",
"output": "253"
},
{
"input": "8",
"output": "337"
},
{
"input": "9",
"output": "433"
},
{
"input": "15000",
"output": "1349910001"
},
{
"input": "4845",
"output": "140815081"
},
{
"input": "6914",
"output": "286778893"
},
{
"input": "3994",
"output": "95688253"
},
{
"input": "12504",
"output": "938025073"
},
{
"input": "13170",
"output": "1040614381"
},
{
"input": "427",
"output": "1091413"
},
{
"input": "11877",
"output": "846307513"
},
{
"input": "3202",
"output": "61497613"
},
{
"input": "5689",
"output": "194154193"
},
{
"input": "15302",
"output": "1404815413"
},
{
"input": "17042",
"output": "1742476333"
},
{
"input": "1481",
"output": "13151281"
},
{
"input": "15592",
"output": "1458569233"
},
{
"input": "16344",
"output": "1602659953"
},
{
"input": "4222",
"output": "106926373"
},
{
"input": "11808",
"output": "836502337"
},
{
"input": "13366",
"output": "1071819541"
},
{
"input": "3823",
"output": "87669037"
},
{
"input": "581",
"output": "2021881"
},
{
"input": "15479",
"output": "1437503773"
},
{
"input": "6543",
"output": "256825837"
},
{
"input": "11136",
"output": "743996161"
},
{
"input": "16331",
"output": "1600111381"
},
{
"input": "8543",
"output": "437845837"
},
{
"input": "7530",
"output": "340160221"
},
{
"input": "3154",
"output": "59667373"
},
{
"input": "11501",
"output": "793569001"
},
{
"input": "12038",
"output": "869408437"
},
{
"input": "13082",
"output": "1026753853"
},
{
"input": "18257",
"output": "1999798753"
}
] | 1,585,568,773
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 186
| 0
|
a = input()
s = []
for i in a:
s.append(i-1,i+1)
z = ''.join(s)
print(z)
|
Title: Star
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Input Specification:
The input contains a single integer *a* (1<=≤<=*a*<=≤<=18257).
Output Specification:
Print a single integer *output* (1<=≤<=*output*<=≤<=2·109).
Demo Input:
['2\n']
Demo Output:
['13']
Note:
none
|
```python
a = input()
s = []
for i in a:
s.append(i-1,i+1)
z = ''.join(s)
print(z)
```
| -1
|
||
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
International Abbreviation Olympiad takes place annually starting from 1989. Each year the competition receives an abbreviation of form IAO'y, where *y* stands for some number of consequent last digits of the current year. Organizers always pick an abbreviation with non-empty string *y* that has never been used before. Among all such valid abbreviations they choose the shortest one and announce it to be the abbreviation of this year's competition.
For example, the first three Olympiads (years 1989, 1990 and 1991, respectively) received the abbreviations IAO'9, IAO'0 and IAO'1, while the competition in 2015 received an abbreviation IAO'15, as IAO'5 has been already used in 1995.
You are given a list of abbreviations. For each of them determine the year it stands for.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of abbreviations to process.
Then *n* lines follow, each containing a single abbreviation. It's guaranteed that each abbreviation contains at most nine digits.
|
For each abbreviation given in the input, find the year of the corresponding Olympiad.
|
[
"5\nIAO'15\nIAO'2015\nIAO'1\nIAO'9\nIAO'0\n",
"4\nIAO'9\nIAO'99\nIAO'999\nIAO'9999\n"
] |
[
"2015\n12015\n1991\n1989\n1990\n",
"1989\n1999\n2999\n9999\n"
] |
none
| 0
|
[
{
"input": "5\nIAO'15\nIAO'2015\nIAO'1\nIAO'9\nIAO'0",
"output": "2015\n12015\n1991\n1989\n1990"
},
{
"input": "4\nIAO'9\nIAO'99\nIAO'999\nIAO'9999",
"output": "1989\n1999\n2999\n9999"
},
{
"input": "1\nIAO'111110",
"output": "1111110"
},
{
"input": "2\nIAO'0\nIAO'00",
"output": "1990\n2000"
},
{
"input": "1\nIAO'111111",
"output": "1111111"
},
{
"input": "1\nIAO'111111111",
"output": "1111111111"
},
{
"input": "1\nIAO'001",
"output": "3001"
},
{
"input": "1\nIAO'2000",
"output": "12000"
},
{
"input": "1\nIAO'11109999",
"output": "111109999"
},
{
"input": "1\nIAO'11111",
"output": "111111"
},
{
"input": "1\nIAO'100000",
"output": "1100000"
},
{
"input": "1\nIAO'18999990",
"output": "18999990"
},
{
"input": "1\nIAO'113098",
"output": "1113098"
},
{
"input": "1\nIAO'111122",
"output": "1111122"
},
{
"input": "1\nIAO'1110222",
"output": "11110222"
},
{
"input": "1\nIAO'11133333",
"output": "11133333"
},
{
"input": "1\nIAO'000000000",
"output": "1000000000"
},
{
"input": "4\nIAO'3098\nIAO'99\nIAO'999\nIAO'9999",
"output": "13098\n1999\n2999\n9999"
},
{
"input": "1\nIAO'11100000",
"output": "111100000"
},
{
"input": "2\nIAO'15\nIAO'15",
"output": "2015\n2015"
},
{
"input": "1\nIAO'999999999",
"output": "999999999"
},
{
"input": "1\nIAO'1112121",
"output": "11112121"
},
{
"input": "1\nIAO'111113098",
"output": "1111113098"
},
{
"input": "1\nIAO'10005000",
"output": "110005000"
},
{
"input": "1\nIAO'111378",
"output": "1111378"
},
{
"input": "1\nIAO'112222",
"output": "1112222"
},
{
"input": "1\nIAO'021113099",
"output": "1021113099"
},
{
"input": "1\nIAO'123456789",
"output": "123456789"
},
{
"input": "1\nIAO'000000001",
"output": "1000000001"
},
{
"input": "1\nIAO'089",
"output": "3089"
},
{
"input": "9\nIAO'0\nIAO'00\nIAO'000\nIAO'0000\nIAO'00000\nIAO'000000\nIAO'0000000\nIAO'00000000\nIAO'000000000",
"output": "1990\n2000\n3000\n10000\n100000\n1000000\n10000000\n100000000\n1000000000"
},
{
"input": "2\nIAO'999999999\nIAO'999999999",
"output": "999999999\n999999999"
},
{
"input": "1\nIAO'2015",
"output": "12015"
},
{
"input": "1\nIAO'113097",
"output": "1113097"
},
{
"input": "1\nIAO'11378",
"output": "111378"
}
] | 1,460,958,559
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 77
| 5,120,000
|
tn=[0]*10000
ts=[0]*10000
a=1989
tn[1]=1989
ts[1]=9
for i in range(1,12):
a=a+(10**i)
tn[i+1]=a
ts[i+1]=int(str(a)[-i-1:])
noc=int(input())
for fk in range(noc):
a=input()[4:]
temp=len(a)
a=int(a)
print((a-ts[temp])%(10**temp)+tn[temp])
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
International Abbreviation Olympiad takes place annually starting from 1989. Each year the competition receives an abbreviation of form IAO'y, where *y* stands for some number of consequent last digits of the current year. Organizers always pick an abbreviation with non-empty string *y* that has never been used before. Among all such valid abbreviations they choose the shortest one and announce it to be the abbreviation of this year's competition.
For example, the first three Olympiads (years 1989, 1990 and 1991, respectively) received the abbreviations IAO'9, IAO'0 and IAO'1, while the competition in 2015 received an abbreviation IAO'15, as IAO'5 has been already used in 1995.
You are given a list of abbreviations. For each of them determine the year it stands for.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of abbreviations to process.
Then *n* lines follow, each containing a single abbreviation. It's guaranteed that each abbreviation contains at most nine digits.
Output Specification:
For each abbreviation given in the input, find the year of the corresponding Olympiad.
Demo Input:
["5\nIAO'15\nIAO'2015\nIAO'1\nIAO'9\nIAO'0\n", "4\nIAO'9\nIAO'99\nIAO'999\nIAO'9999\n"]
Demo Output:
['2015\n12015\n1991\n1989\n1990\n', '1989\n1999\n2999\n9999\n']
Note:
none
|
```python
tn=[0]*10000
ts=[0]*10000
a=1989
tn[1]=1989
ts[1]=9
for i in range(1,12):
a=a+(10**i)
tn[i+1]=a
ts[i+1]=int(str(a)[-i-1:])
noc=int(input())
for fk in range(noc):
a=input()[4:]
temp=len(a)
a=int(a)
print((a-ts[temp])%(10**temp)+tn[temp])
```
| 3
|
|
496
|
A
|
Minimum Difficulty
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"math"
] | null | null |
Mike is trying rock climbing but he is awful at it.
There are *n* holds on the wall, *i*-th hold is at height *a**i* off the ground. Besides, let the sequence *a**i* increase, that is, *a**i*<=<<=*a**i*<=+<=1 for all *i* from 1 to *n*<=-<=1; we will call such sequence a track. Mike thinks that the track *a*1, ..., *a**n* has difficulty . In other words, difficulty equals the maximum distance between two holds that are adjacent in height.
Today Mike decided to cover the track with holds hanging on heights *a*1, ..., *a**n*. To make the problem harder, Mike decided to remove one hold, that is, remove one element of the sequence (for example, if we take the sequence (1,<=2,<=3,<=4,<=5) and remove the third element from it, we obtain the sequence (1,<=2,<=4,<=5)). However, as Mike is awful at climbing, he wants the final difficulty (i.e. the maximum difference of heights between adjacent holds after removing the hold) to be as small as possible among all possible options of removing a hold. The first and last holds must stay at their positions.
Help Mike determine the minimum difficulty of the track after removing one hold.
|
The first line contains a single integer *n* (3<=≤<=*n*<=≤<=100) — the number of holds.
The next line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=1000), where *a**i* is the height where the hold number *i* hangs. The sequence *a**i* is increasing (i.e. each element except for the first one is strictly larger than the previous one).
|
Print a single number — the minimum difficulty of the track after removing a single hold.
|
[
"3\n1 4 6\n",
"5\n1 2 3 4 5\n",
"5\n1 2 3 7 8\n"
] |
[
"5\n",
"2\n",
"4\n"
] |
In the first sample you can remove only the second hold, then the sequence looks like (1, 6), the maximum difference of the neighboring elements equals 5.
In the second test after removing every hold the difficulty equals 2.
In the third test you can obtain sequences (1, 3, 7, 8), (1, 2, 7, 8), (1, 2, 3, 8), for which the difficulty is 4, 5 and 5, respectively. Thus, after removing the second element we obtain the optimal answer — 4.
| 500
|
[
{
"input": "3\n1 4 6",
"output": "5"
},
{
"input": "5\n1 2 3 4 5",
"output": "2"
},
{
"input": "5\n1 2 3 7 8",
"output": "4"
},
{
"input": "3\n1 500 1000",
"output": "999"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "2"
},
{
"input": "10\n1 4 9 16 25 36 49 64 81 100",
"output": "19"
},
{
"input": "10\n300 315 325 338 350 365 379 391 404 416",
"output": "23"
},
{
"input": "15\n87 89 91 92 93 95 97 99 101 103 105 107 109 111 112",
"output": "2"
},
{
"input": "60\n3 5 7 8 15 16 18 21 24 26 40 41 43 47 48 49 50 51 52 54 55 60 62 71 74 84 85 89 91 96 406 407 409 412 417 420 423 424 428 431 432 433 436 441 445 446 447 455 458 467 469 471 472 475 480 485 492 493 497 500",
"output": "310"
},
{
"input": "3\n159 282 405",
"output": "246"
},
{
"input": "81\n6 7 22 23 27 38 40 56 59 71 72 78 80 83 86 92 95 96 101 122 125 127 130 134 154 169 170 171 172 174 177 182 184 187 195 197 210 211 217 223 241 249 252 253 256 261 265 269 274 277 291 292 297 298 299 300 302 318 338 348 351 353 381 386 387 397 409 410 419 420 428 430 453 460 461 473 478 493 494 500 741",
"output": "241"
},
{
"input": "10\n218 300 388 448 535 629 680 740 836 925",
"output": "111"
},
{
"input": "100\n6 16 26 36 46 56 66 76 86 96 106 116 126 136 146 156 166 176 186 196 206 216 226 236 246 256 266 276 286 296 306 316 326 336 346 356 366 376 386 396 406 416 426 436 446 456 466 476 486 496 506 516 526 536 546 556 566 576 586 596 606 616 626 636 646 656 666 676 686 696 706 716 726 736 746 756 766 776 786 796 806 816 826 836 846 856 866 876 886 896 906 916 926 936 946 956 966 976 986 996",
"output": "20"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000",
"output": "901"
},
{
"input": "100\n1 9 15 17 28 29 30 31 32 46 48 49 52 56 62 77 82 85 90 91 94 101 102 109 111 113 116 118 124 125 131 132 136 138 139 143 145 158 161 162 165 167 171 173 175 177 179 183 189 196 801 802 804 806 817 819 827 830 837 840 842 846 850 855 858 862 863 866 869 870 878 881 883 884 896 898 899 901 904 906 908 909 910 911 912 917 923 924 925 935 939 943 945 956 963 964 965 972 976 978",
"output": "605"
},
{
"input": "100\n2 43 47 49 50 57 59 67 74 98 901 903 904 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 938 939 940 942 943 944 945 946 947 948 949 950 952 953 954 956 957 958 959 960 961 962 963 965 966 967 968 969 970 971 972 973 974 975 976 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 998 999",
"output": "803"
},
{
"input": "72\n178 186 196 209 217 226 236 248 260 273 281 291 300 309 322 331 343 357 366 377 389 399 409 419 429 442 450 459 469 477 491 501 512 524 534 548 557 568 582 593 602 616 630 643 652 660 670 679 693 707 715 728 737 750 759 768 776 789 797 807 815 827 837 849 863 873 881 890 901 910 920 932",
"output": "17"
},
{
"input": "38\n1 28 55 82 109 136 163 190 217 244 271 298 325 352 379 406 433 460 487 514 541 568 595 622 649 676 703 730 757 784 811 838 865 892 919 946 973 1000",
"output": "54"
},
{
"input": "28\n1 38 75 112 149 186 223 260 297 334 371 408 445 482 519 556 593 630 667 704 741 778 815 852 889 926 963 1000",
"output": "74"
}
] | 1,589,478,392
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 77
| 6,963,200
|
import sys
def data():
return sys.stdin.readline().strip()
def sp(): return map(int, data().split())
def l(): return list(sp())
n=int(data())
temp=l()
res=[]
for i in temp[1:-1]:
res.append(temp.remove(i))
ans=0
for i,val in enumerate(res):
for x in range(1,len(val)+1):
if val[x]-val[x-1]>ans:
ans=val[x]-val[x-1]
print(ans)
|
Title: Minimum Difficulty
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mike is trying rock climbing but he is awful at it.
There are *n* holds on the wall, *i*-th hold is at height *a**i* off the ground. Besides, let the sequence *a**i* increase, that is, *a**i*<=<<=*a**i*<=+<=1 for all *i* from 1 to *n*<=-<=1; we will call such sequence a track. Mike thinks that the track *a*1, ..., *a**n* has difficulty . In other words, difficulty equals the maximum distance between two holds that are adjacent in height.
Today Mike decided to cover the track with holds hanging on heights *a*1, ..., *a**n*. To make the problem harder, Mike decided to remove one hold, that is, remove one element of the sequence (for example, if we take the sequence (1,<=2,<=3,<=4,<=5) and remove the third element from it, we obtain the sequence (1,<=2,<=4,<=5)). However, as Mike is awful at climbing, he wants the final difficulty (i.e. the maximum difference of heights between adjacent holds after removing the hold) to be as small as possible among all possible options of removing a hold. The first and last holds must stay at their positions.
Help Mike determine the minimum difficulty of the track after removing one hold.
Input Specification:
The first line contains a single integer *n* (3<=≤<=*n*<=≤<=100) — the number of holds.
The next line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=1000), where *a**i* is the height where the hold number *i* hangs. The sequence *a**i* is increasing (i.e. each element except for the first one is strictly larger than the previous one).
Output Specification:
Print a single number — the minimum difficulty of the track after removing a single hold.
Demo Input:
['3\n1 4 6\n', '5\n1 2 3 4 5\n', '5\n1 2 3 7 8\n']
Demo Output:
['5\n', '2\n', '4\n']
Note:
In the first sample you can remove only the second hold, then the sequence looks like (1, 6), the maximum difference of the neighboring elements equals 5.
In the second test after removing every hold the difficulty equals 2.
In the third test you can obtain sequences (1, 3, 7, 8), (1, 2, 7, 8), (1, 2, 3, 8), for which the difficulty is 4, 5 and 5, respectively. Thus, after removing the second element we obtain the optimal answer — 4.
|
```python
import sys
def data():
return sys.stdin.readline().strip()
def sp(): return map(int, data().split())
def l(): return list(sp())
n=int(data())
temp=l()
res=[]
for i in temp[1:-1]:
res.append(temp.remove(i))
ans=0
for i,val in enumerate(res):
for x in range(1,len(val)+1):
if val[x]-val[x-1]>ans:
ans=val[x]-val[x-1]
print(ans)
```
| -1
|
|
2
|
B
|
The least round way
|
PROGRAMMING
| 2,000
|
[
"dp",
"math"
] |
B. The least round way
|
2
|
64
|
There is a square matrix *n*<=×<=*n*, consisting of non-negative integer numbers. You should find such a way on it that
- starts in the upper left cell of the matrix; - each following cell is to the right or down from the current cell; - the way ends in the bottom right cell.
Moreover, if we multiply together all the numbers along the way, the result should be the least "round". In other words, it should end in the least possible number of zeros.
|
The first line contains an integer number *n* (2<=≤<=*n*<=≤<=1000), *n* is the size of the matrix. Then follow *n* lines containing the matrix elements (non-negative integer numbers not exceeding 109).
|
In the first line print the least number of trailing zeros. In the second line print the correspondent way itself.
|
[
"3\n1 2 3\n4 5 6\n7 8 9\n"
] |
[
"0\nDDRR\n"
] |
none
| 0
|
[
{
"input": "3\n1 2 3\n4 5 6\n7 8 9",
"output": "0\nDDRR"
},
{
"input": "2\n7 6\n3 8",
"output": "0\nDR"
},
{
"input": "3\n4 10 5\n10 9 4\n6 5 3",
"output": "1\nDRRD"
},
{
"input": "4\n1 1 9 9\n3 4 7 3\n7 9 1 7\n1 7 1 5",
"output": "0\nDDDRRR"
},
{
"input": "5\n8 3 2 1 4\n3 7 2 4 8\n9 2 8 9 10\n2 3 6 10 1\n8 2 2 8 4",
"output": "0\nDDDDRRRR"
},
{
"input": "6\n5 5 4 10 5 5\n7 10 8 7 6 6\n7 1 7 9 7 8\n5 5 3 3 10 9\n5 8 10 6 3 8\n3 10 5 4 3 4",
"output": "1\nDDRRDRDDRR"
},
{
"input": "7\n2 9 8 2 7 4 8\n9 5 4 4 8 5 3\n5 7 2 10 8 1 8\n2 7 10 7 5 7 7\n9 2 7 6 4 8 4\n7 2 4 7 4 1 8\n9 5 3 10 1 6 2",
"output": "0\nRRDRRDRDDDDR"
},
{
"input": "8\n1 1 10 1 8 4 8 7\n9 3 3 2 2 6 2 4\n7 4 3 5 10 3 5 1\n8 4 4 10 4 5 9 4\n5 5 5 2 6 7 1 8\n4 10 1 3 2 4 8 3\n8 1 10 2 8 2 2 4\n2 10 6 8 10 2 8 4",
"output": "0\nDRRRRRRRDDDDDD"
},
{
"input": "9\n8 3 3 3 10 3 10 5 6\n2 1 6 1 8 1 9 1 6\n6 1 5 4 2 2 10 4 9\n1 9 1 3 10 6 10 5 5\n1 10 5 4 7 2 5 9 10\n6 6 1 3 1 9 4 9 9\n5 3 7 6 4 6 2 10 2\n9 3 3 10 5 6 7 6 4\n4 9 6 7 4 3 7 6 5",
"output": "1\nDDDDDRDDDRRRRRRR"
},
{
"input": "10\n10 8 6 5 9 8 2 5 3 2\n3 1 8 6 8 10 5 5 7 8\n5 9 7 7 4 9 7 2 5 2\n5 9 9 5 4 2 6 6 8 1\n10 6 9 9 10 5 6 3 5 9\n6 7 10 3 1 4 3 6 7 6\n10 10 4 7 4 4 8 6 7 4\n10 5 8 2 2 7 4 4 1 4\n8 4 6 10 10 6 1 3 3 1\n9 9 7 2 9 5 1 8 6 3",
"output": "1\nDRDDDRRDDDRRDRDRRR"
}
] | 1,690,105,073
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 5
| 62
| 0
|
def cntn(a):
a1 = str(a)
for i in range(-1, -(len(str(a)) + 1), -1):
if a1[i] != '0':
return -(i + 1)
return 1 if a == 0 else 0
n = int(input())
field = [list(map(int, input().split())) for _ in range(n)]
dp = [[0] * n for i in range(n)]
dps = [[''] * n for i in range(n)]
dp[0][0] = field[0][0]
for i in range(1, n):
dp[0][i] = dp[0][i - 1] * field[0][i]
dps[0][i] = dps[0][i - 1] + 'R'
dp[i][0] = dp[i - 1][0] * field[i][0]
dps[i][0] = dps[i - 1][0] + 'D'
for i in range(1, n):
for j in range(1, n):
if cntn(dp[i - 1][j]) < cntn(dp[i][j - 1]):
dp[i][j] = dp[i - 1][j] * field[i][j]
dps[i][j] = dps[i - 1][j] + "D"
else:
dp[i][j] = dp[i][j - 1] * field[i][j]
dps[i][j] = dps[i][j - 1] + "R"
print(cntn(dp[n - 1][n - 1]))
print(dps[n - 1][n - 1])
|
Title: The least round way
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
There is a square matrix *n*<=×<=*n*, consisting of non-negative integer numbers. You should find such a way on it that
- starts in the upper left cell of the matrix; - each following cell is to the right or down from the current cell; - the way ends in the bottom right cell.
Moreover, if we multiply together all the numbers along the way, the result should be the least "round". In other words, it should end in the least possible number of zeros.
Input Specification:
The first line contains an integer number *n* (2<=≤<=*n*<=≤<=1000), *n* is the size of the matrix. Then follow *n* lines containing the matrix elements (non-negative integer numbers not exceeding 109).
Output Specification:
In the first line print the least number of trailing zeros. In the second line print the correspondent way itself.
Demo Input:
['3\n1 2 3\n4 5 6\n7 8 9\n']
Demo Output:
['0\nDDRR\n']
Note:
none
|
```python
def cntn(a):
a1 = str(a)
for i in range(-1, -(len(str(a)) + 1), -1):
if a1[i] != '0':
return -(i + 1)
return 1 if a == 0 else 0
n = int(input())
field = [list(map(int, input().split())) for _ in range(n)]
dp = [[0] * n for i in range(n)]
dps = [[''] * n for i in range(n)]
dp[0][0] = field[0][0]
for i in range(1, n):
dp[0][i] = dp[0][i - 1] * field[0][i]
dps[0][i] = dps[0][i - 1] + 'R'
dp[i][0] = dp[i - 1][0] * field[i][0]
dps[i][0] = dps[i - 1][0] + 'D'
for i in range(1, n):
for j in range(1, n):
if cntn(dp[i - 1][j]) < cntn(dp[i][j - 1]):
dp[i][j] = dp[i - 1][j] * field[i][j]
dps[i][j] = dps[i - 1][j] + "D"
else:
dp[i][j] = dp[i][j - 1] * field[i][j]
dps[i][j] = dps[i][j - 1] + "R"
print(cntn(dp[n - 1][n - 1]))
print(dps[n - 1][n - 1])
```
| 0
|
463
|
B
|
Caisa and Pylons
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation",
"math"
] | null | null |
Caisa solved the problem with the sugar and now he is on the way back to home.
Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=><=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time.
Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game?
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=≤<=<=*h**i*<=<=≤<=<=105) representing the heights of the pylons.
|
Print a single number representing the minimum number of dollars paid by Caisa.
|
[
"5\n3 4 3 2 4\n",
"3\n4 4 4\n"
] |
[
"4\n",
"4\n"
] |
In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon.
| 1,000
|
[
{
"input": "5\n3 4 3 2 4",
"output": "4"
},
{
"input": "3\n4 4 4",
"output": "4"
},
{
"input": "99\n1401 2019 1748 3785 3236 3177 3443 3772 2138 1049 353 908 310 2388 1322 88 2160 2783 435 2248 1471 706 2468 2319 3156 3506 2794 1999 1983 2519 2597 3735 537 344 3519 3772 3872 2961 3895 2010 10 247 3269 671 2986 942 758 1146 77 1545 3745 1547 2250 2565 217 1406 2070 3010 3404 404 1528 2352 138 2065 3047 3656 2188 2919 2616 2083 1280 2977 2681 548 4000 1667 1489 1109 3164 1565 2653 3260 3463 903 1824 3679 2308 245 2689 2063 648 568 766 785 2984 3812 440 1172 2730",
"output": "4000"
},
{
"input": "68\n477 1931 3738 3921 2306 1823 3328 2057 661 3993 2967 3520 171 1739 1525 1817 209 3475 1902 2666 518 3283 3412 3040 3383 2331 1147 1460 1452 1800 1327 2280 82 1416 2200 2388 3238 1879 796 250 1872 114 121 2042 1853 1645 211 2061 1472 2464 726 1989 1746 489 1380 1128 2819 2527 2939 622 678 265 2902 1111 2032 1453 3850 1621",
"output": "3993"
},
{
"input": "30\n30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "30"
},
{
"input": "3\n3 2 1",
"output": "3"
},
{
"input": "1\n69",
"output": "69"
}
] | 1,643,419,024
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 49
| 155
| 12,390,400
|
#For fast I/O
import sys
input = lambda: sys.stdin.readline().strip()
n = int(input())
l = [int(i) for i in input().split()]
print(max(l))
|
Title: Caisa and Pylons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Caisa solved the problem with the sugar and now he is on the way back to home.
Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=><=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time.
Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=≤<=<=*h**i*<=<=≤<=<=105) representing the heights of the pylons.
Output Specification:
Print a single number representing the minimum number of dollars paid by Caisa.
Demo Input:
['5\n3 4 3 2 4\n', '3\n4 4 4\n']
Demo Output:
['4\n', '4\n']
Note:
In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon.
|
```python
#For fast I/O
import sys
input = lambda: sys.stdin.readline().strip()
n = int(input())
l = [int(i) for i in input().split()]
print(max(l))
```
| 3
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,634,041,985
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
m,n=map(int,input().split())
if m==1andn==1:
print(0)
else:
print(int(m*n0//2)
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
m,n=map(int,input().split())
if m==1andn==1:
print(0)
else:
print(int(m*n0//2)
```
| -1
|
471
|
A
|
MUH and Sticks
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
Two polar bears Menshykov and Uslada from the St.Petersburg zoo and elephant Horace from the Kiev zoo got six sticks to play with and assess the animals' creativity. Menshykov, Uslada and Horace decided to make either an elephant or a bear from those sticks. They can make an animal from sticks in the following way:
- Four sticks represent the animal's legs, these sticks should have the same length. - Two remaining sticks represent the animal's head and body. The bear's head stick must be shorter than the body stick. The elephant, however, has a long trunk, so his head stick must be as long as the body stick. Note that there are no limits on the relations between the leg sticks and the head and body sticks.
Your task is to find out which animal can be made from the given stick set. The zoo keeper wants the sticks back after the game, so they must never be broken, even bears understand it.
|
The single line contains six space-separated integers *l**i* (1<=≤<=*l**i*<=≤<=9) — the lengths of the six sticks. It is guaranteed that the input is such that you cannot make both animals from the sticks.
|
If you can make a bear from the given set, print string "Bear" (without the quotes). If you can make an elephant, print string "Elephant" (wıthout the quotes). If you can make neither a bear nor an elephant, print string "Alien" (without the quotes).
|
[
"4 2 5 4 4 4\n",
"4 4 5 4 4 5\n",
"1 2 3 4 5 6\n"
] |
[
"Bear",
"Elephant",
"Alien"
] |
If you're out of creative ideas, see instructions below which show how to make a bear and an elephant in the first two samples. The stick of length 2 is in red, the sticks of length 4 are in green, the sticks of length 5 are in blue.
| 500
|
[
{
"input": "4 2 5 4 4 4",
"output": "Bear"
},
{
"input": "4 4 5 4 4 5",
"output": "Elephant"
},
{
"input": "1 2 3 4 5 6",
"output": "Alien"
},
{
"input": "5 5 5 5 5 5",
"output": "Elephant"
},
{
"input": "1 1 1 2 3 5",
"output": "Alien"
},
{
"input": "1 1 1 1 1 1",
"output": "Elephant"
},
{
"input": "9 9 9 9 9 9",
"output": "Elephant"
},
{
"input": "1 8 9 1 1 1",
"output": "Bear"
},
{
"input": "9 9 9 1 9 9",
"output": "Bear"
},
{
"input": "1 2 3 8 9 7",
"output": "Alien"
},
{
"input": "5 5 5 6 6 6",
"output": "Alien"
},
{
"input": "1 1 2 2 3 4",
"output": "Alien"
},
{
"input": "4 4 4 4 4 2",
"output": "Bear"
},
{
"input": "2 2 3 3 4 4",
"output": "Alien"
},
{
"input": "4 4 4 4 4 5",
"output": "Bear"
},
{
"input": "1 1 2 2 2 2",
"output": "Elephant"
},
{
"input": "1 2 5 5 5 5",
"output": "Bear"
},
{
"input": "4 4 2 2 2 2",
"output": "Elephant"
},
{
"input": "1 1 1 1 1 2",
"output": "Bear"
},
{
"input": "2 2 4 4 4 4",
"output": "Elephant"
},
{
"input": "4 4 4 4 4 3",
"output": "Bear"
},
{
"input": "4 4 5 6 7 8",
"output": "Alien"
},
{
"input": "4 4 4 4 2 2",
"output": "Elephant"
},
{
"input": "1 1 1 1 2 2",
"output": "Elephant"
},
{
"input": "1 1 3 3 3 5",
"output": "Alien"
},
{
"input": "1 2 2 3 3 3",
"output": "Alien"
},
{
"input": "1 2 2 2 2 2",
"output": "Bear"
},
{
"input": "1 3 3 3 4 5",
"output": "Alien"
},
{
"input": "5 1 1 1 1 1",
"output": "Bear"
}
] | 1,411,749,408
| 4,008
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 0
| 31
| 409,600
|
#!/usr/bin/env python3
from collections import Counter
sticks = Counter([int(number) for number in input("Sticks: ").split(" ")])
have_legs = False
legs_lenght = 0
for key in sticks:
if sticks[key] >= 4:
have_legs = True
legs_lenght = key
legs = Counter({legs_lenght:4})
rest = sticks - legs
if have_legs:
if len(rest) == 2:
print("Bear")
else:
print("Elephant")
else:
print("Alien")
|
Title: MUH and Sticks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two polar bears Menshykov and Uslada from the St.Petersburg zoo and elephant Horace from the Kiev zoo got six sticks to play with and assess the animals' creativity. Menshykov, Uslada and Horace decided to make either an elephant or a bear from those sticks. They can make an animal from sticks in the following way:
- Four sticks represent the animal's legs, these sticks should have the same length. - Two remaining sticks represent the animal's head and body. The bear's head stick must be shorter than the body stick. The elephant, however, has a long trunk, so his head stick must be as long as the body stick. Note that there are no limits on the relations between the leg sticks and the head and body sticks.
Your task is to find out which animal can be made from the given stick set. The zoo keeper wants the sticks back after the game, so they must never be broken, even bears understand it.
Input Specification:
The single line contains six space-separated integers *l**i* (1<=≤<=*l**i*<=≤<=9) — the lengths of the six sticks. It is guaranteed that the input is such that you cannot make both animals from the sticks.
Output Specification:
If you can make a bear from the given set, print string "Bear" (without the quotes). If you can make an elephant, print string "Elephant" (wıthout the quotes). If you can make neither a bear nor an elephant, print string "Alien" (without the quotes).
Demo Input:
['4 2 5 4 4 4\n', '4 4 5 4 4 5\n', '1 2 3 4 5 6\n']
Demo Output:
['Bear', 'Elephant', 'Alien']
Note:
If you're out of creative ideas, see instructions below which show how to make a bear and an elephant in the first two samples. The stick of length 2 is in red, the sticks of length 4 are in green, the sticks of length 5 are in blue.
|
```python
#!/usr/bin/env python3
from collections import Counter
sticks = Counter([int(number) for number in input("Sticks: ").split(" ")])
have_legs = False
legs_lenght = 0
for key in sticks:
if sticks[key] >= 4:
have_legs = True
legs_lenght = key
legs = Counter({legs_lenght:4})
rest = sticks - legs
if have_legs:
if len(rest) == 2:
print("Bear")
else:
print("Elephant")
else:
print("Alien")
```
| 0
|
|
898
|
E
|
Squares and not squares
|
PROGRAMMING
| 1,600
|
[
"constructive algorithms",
"greedy"
] | null | null |
Ann and Borya have *n* piles with candies and *n* is even number. There are *a**i* candies in pile with number *i*.
Ann likes numbers which are square of some integer and Borya doesn't like numbers which are square of any integer. During one move guys can select some pile with candies and add one candy to it (this candy is new and doesn't belong to any other pile) or remove one candy (if there is at least one candy in this pile).
Find out minimal number of moves that is required to make exactly *n*<=/<=2 piles contain number of candies that is a square of some integer and exactly *n*<=/<=2 piles contain number of candies that is not a square of any integer.
|
First line contains one even integer *n* (2<=≤<=*n*<=≤<=200<=000) — number of piles with candies.
Second line contains sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — amounts of candies in each pile.
|
Output minimal number of steps required to make exactly *n*<=/<=2 piles contain number of candies that is a square of some integer and exactly *n*<=/<=2 piles contain number of candies that is not a square of any integer. If condition is already satisfied output 0.
|
[
"4\n12 14 30 4\n",
"6\n0 0 0 0 0 0\n",
"6\n120 110 23 34 25 45\n",
"10\n121 56 78 81 45 100 1 0 54 78\n"
] |
[
"2\n",
"6\n",
"3\n",
"0\n"
] |
In first example you can satisfy condition in two moves. During each move you should add one candy to second pile. After it size of second pile becomes 16. After that Borya and Ann will have two piles with number of candies which is a square of integer (second and fourth pile) and two piles with number of candies which is not a square of any integer (first and third pile).
In second example you should add two candies to any three piles.
| 2,000
|
[
{
"input": "4\n12 14 30 4",
"output": "2"
},
{
"input": "6\n0 0 0 0 0 0",
"output": "6"
},
{
"input": "6\n120 110 23 34 25 45",
"output": "3"
},
{
"input": "10\n121 56 78 81 45 100 1 0 54 78",
"output": "0"
},
{
"input": "10\n0 675178538 310440616 608075179 0 0 0 0 0 0",
"output": "4"
},
{
"input": "10\n49727640 89440577 0 957792200 0 0 0 0 623726477 0",
"output": "2"
},
{
"input": "20\n4 595258838 0 305922562 0 471450344 1 1 29794053 307197649 0 32960227 1 0 0 1 1 0 0 1",
"output": "4"
},
{
"input": "100\n444272562 25 25 0 49 73291074 64 100 638092144 756033694 0 700405846 16 25 25 100 36 25 269573395 288578186 366853675 36 81 49 4 0 25 49 9 64 0 4 36 36 49 0 64 64 532899768 1 64 9 549673690 25 64 4 817183855 25 146555318 36 495564252 100 49 9 36 100 49 100 4 100 9 64 9 432227412 756728309 25 0 332072516 100 64 0 92286436 49 0 81 49 0 49 0 100 409473792 25 814343057 81 1 16 0 16 886097466 64 492116229 81 270298243 64 81 100 0 49 16 16",
"output": "28"
},
{
"input": "2\n0 0",
"output": "2"
},
{
"input": "2\n1 0",
"output": "1"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "2\n0 2",
"output": "0"
},
{
"input": "2\n2 0",
"output": "0"
},
{
"input": "2\n0 1000000000",
"output": "0"
},
{
"input": "2\n31622 31623",
"output": "61"
},
{
"input": "2\n31622 31622",
"output": "62"
}
] | 1,615,241,037
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 8
| 2,000
| 17,305,600
|
sqrs =[-1] + [i*i for i in range(31625)]
from bisect import bisect_left, insort
n = int(input())
na, nb, A, B = 0, 0, list(), list()
for v in map(int, input().split()):
i = bisect_left(sqrs, v)
dist = min(v-sqrs[i-1], sqrs[i]-v)
if dist == 0:
na += 1
dist = (2 if v==0 else 1)
insort(A, dist)
else:
nb += 1
insort(B, dist)
ans = 0
if na > nb:
ans = sum(A[:(na-nb)//2])
elif nb > na:
ans = sum(B[:(nb-na)//2])
print(ans)
|
Title: Squares and not squares
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ann and Borya have *n* piles with candies and *n* is even number. There are *a**i* candies in pile with number *i*.
Ann likes numbers which are square of some integer and Borya doesn't like numbers which are square of any integer. During one move guys can select some pile with candies and add one candy to it (this candy is new and doesn't belong to any other pile) or remove one candy (if there is at least one candy in this pile).
Find out minimal number of moves that is required to make exactly *n*<=/<=2 piles contain number of candies that is a square of some integer and exactly *n*<=/<=2 piles contain number of candies that is not a square of any integer.
Input Specification:
First line contains one even integer *n* (2<=≤<=*n*<=≤<=200<=000) — number of piles with candies.
Second line contains sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — amounts of candies in each pile.
Output Specification:
Output minimal number of steps required to make exactly *n*<=/<=2 piles contain number of candies that is a square of some integer and exactly *n*<=/<=2 piles contain number of candies that is not a square of any integer. If condition is already satisfied output 0.
Demo Input:
['4\n12 14 30 4\n', '6\n0 0 0 0 0 0\n', '6\n120 110 23 34 25 45\n', '10\n121 56 78 81 45 100 1 0 54 78\n']
Demo Output:
['2\n', '6\n', '3\n', '0\n']
Note:
In first example you can satisfy condition in two moves. During each move you should add one candy to second pile. After it size of second pile becomes 16. After that Borya and Ann will have two piles with number of candies which is a square of integer (second and fourth pile) and two piles with number of candies which is not a square of any integer (first and third pile).
In second example you should add two candies to any three piles.
|
```python
sqrs =[-1] + [i*i for i in range(31625)]
from bisect import bisect_left, insort
n = int(input())
na, nb, A, B = 0, 0, list(), list()
for v in map(int, input().split()):
i = bisect_left(sqrs, v)
dist = min(v-sqrs[i-1], sqrs[i]-v)
if dist == 0:
na += 1
dist = (2 if v==0 else 1)
insort(A, dist)
else:
nb += 1
insort(B, dist)
ans = 0
if na > nb:
ans = sum(A[:(na-nb)//2])
elif nb > na:
ans = sum(B[:(nb-na)//2])
print(ans)
```
| 0
|
|
171
|
B
|
Star
|
PROGRAMMING
| 1,300
|
[
"*special",
"combinatorics"
] | null | null |
The input contains a single integer *a* (1<=≤<=*a*<=≤<=18257).
|
Print a single integer *output* (1<=≤<=*output*<=≤<=2·109).
|
[
"2\n"
] |
[
"13"
] |
none
| 0
|
[
{
"input": "2",
"output": "13"
},
{
"input": "1",
"output": "1"
},
{
"input": "3",
"output": "37"
},
{
"input": "4",
"output": "73"
},
{
"input": "5",
"output": "121"
},
{
"input": "6",
"output": "181"
},
{
"input": "7",
"output": "253"
},
{
"input": "8",
"output": "337"
},
{
"input": "9",
"output": "433"
},
{
"input": "15000",
"output": "1349910001"
},
{
"input": "4845",
"output": "140815081"
},
{
"input": "6914",
"output": "286778893"
},
{
"input": "3994",
"output": "95688253"
},
{
"input": "12504",
"output": "938025073"
},
{
"input": "13170",
"output": "1040614381"
},
{
"input": "427",
"output": "1091413"
},
{
"input": "11877",
"output": "846307513"
},
{
"input": "3202",
"output": "61497613"
},
{
"input": "5689",
"output": "194154193"
},
{
"input": "15302",
"output": "1404815413"
},
{
"input": "17042",
"output": "1742476333"
},
{
"input": "1481",
"output": "13151281"
},
{
"input": "15592",
"output": "1458569233"
},
{
"input": "16344",
"output": "1602659953"
},
{
"input": "4222",
"output": "106926373"
},
{
"input": "11808",
"output": "836502337"
},
{
"input": "13366",
"output": "1071819541"
},
{
"input": "3823",
"output": "87669037"
},
{
"input": "581",
"output": "2021881"
},
{
"input": "15479",
"output": "1437503773"
},
{
"input": "6543",
"output": "256825837"
},
{
"input": "11136",
"output": "743996161"
},
{
"input": "16331",
"output": "1600111381"
},
{
"input": "8543",
"output": "437845837"
},
{
"input": "7530",
"output": "340160221"
},
{
"input": "3154",
"output": "59667373"
},
{
"input": "11501",
"output": "793569001"
},
{
"input": "12038",
"output": "869408437"
},
{
"input": "13082",
"output": "1026753853"
},
{
"input": "18257",
"output": "1999798753"
}
] | 1,669,448,291
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 40
| 124
| 1,331,200
|
a = int(input())
ans = 1
z = 12
for i in range(a-1):
ans += z
z += 12
print(ans)
|
Title: Star
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Input Specification:
The input contains a single integer *a* (1<=≤<=*a*<=≤<=18257).
Output Specification:
Print a single integer *output* (1<=≤<=*output*<=≤<=2·109).
Demo Input:
['2\n']
Demo Output:
['13']
Note:
none
|
```python
a = int(input())
ans = 1
z = 12
for i in range(a-1):
ans += z
z += 12
print(ans)
```
| 3
|
||
817
|
A
|
Treasure Hunt
|
PROGRAMMING
| 1,200
|
[
"implementation",
"math",
"number theory"
] | null | null |
Captain Bill the Hummingbird and his crew recieved an interesting challenge offer. Some stranger gave them a map, potion of teleportation and said that only this potion might help them to reach the treasure.
Bottle with potion has two values *x* and *y* written on it. These values define four moves which can be performed using the potion:
- - - -
Map shows that the position of Captain Bill the Hummingbird is (*x*1,<=*y*1) and the position of the treasure is (*x*2,<=*y*2).
You task is to tell Captain Bill the Hummingbird whether he should accept this challenge or decline. If it is possible for Captain to reach the treasure using the potion then output "YES", otherwise "NO" (without quotes).
The potion can be used infinite amount of times.
|
The first line contains four integer numbers *x*1,<=*y*1,<=*x*2,<=*y*2 (<=-<=105<=≤<=*x*1,<=*y*1,<=*x*2,<=*y*2<=≤<=105) — positions of Captain Bill the Hummingbird and treasure respectively.
The second line contains two integer numbers *x*,<=*y* (1<=≤<=*x*,<=*y*<=≤<=105) — values on the potion bottle.
|
Print "YES" if it is possible for Captain to reach the treasure using the potion, otherwise print "NO" (without quotes).
|
[
"0 0 0 6\n2 3\n",
"1 1 3 6\n1 5\n"
] |
[
"YES\n",
"NO\n"
] |
In the first example there exists such sequence of moves:
1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7c939890fb4ed35688177327dac981bfa9216c00.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the first type of move 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/afbfa42fbac4e0641e7466e3aac74cbbb08ed597.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the third type of move
| 0
|
[
{
"input": "0 0 0 6\n2 3",
"output": "YES"
},
{
"input": "1 1 3 6\n1 5",
"output": "NO"
},
{
"input": "5 4 6 -10\n1 1",
"output": "NO"
},
{
"input": "6 -3 -7 -7\n1 2",
"output": "NO"
},
{
"input": "2 -5 -8 8\n2 1",
"output": "YES"
},
{
"input": "70 -81 -17 80\n87 23",
"output": "YES"
},
{
"input": "41 366 218 -240\n3456 1234",
"output": "NO"
},
{
"input": "-61972 -39646 -42371 -24854\n573 238",
"output": "NO"
},
{
"input": "-84870 -42042 94570 98028\n8972 23345",
"output": "YES"
},
{
"input": "-58533 -50999 -1007 -59169\n8972 23345",
"output": "NO"
},
{
"input": "-100000 -100000 100000 100000\n100000 100000",
"output": "YES"
},
{
"input": "-100000 -100000 100000 100000\n1 1",
"output": "YES"
},
{
"input": "5 2 5 3\n1 1",
"output": "NO"
},
{
"input": "5 5 5 5\n5 5",
"output": "YES"
},
{
"input": "0 0 1000 1000\n1 1",
"output": "YES"
},
{
"input": "0 0 0 1\n1 1",
"output": "NO"
},
{
"input": "1 1 4 4\n2 2",
"output": "NO"
},
{
"input": "100000 100000 99999 99999\n100000 100000",
"output": "NO"
},
{
"input": "1 1 1 6\n1 5",
"output": "NO"
},
{
"input": "2 9 4 0\n2 3",
"output": "YES"
},
{
"input": "0 0 0 9\n2 3",
"output": "NO"
},
{
"input": "14 88 14 88\n100 500",
"output": "YES"
},
{
"input": "-1 0 3 0\n4 4",
"output": "NO"
},
{
"input": "0 0 8 9\n2 3",
"output": "NO"
},
{
"input": "-2 5 7 -6\n1 1",
"output": "YES"
},
{
"input": "3 7 -8 8\n2 2",
"output": "NO"
},
{
"input": "-4 -8 -6 -1\n1 3",
"output": "NO"
},
{
"input": "0 8 6 2\n1 1",
"output": "YES"
},
{
"input": "-5 -2 -8 -2\n1 1",
"output": "NO"
},
{
"input": "1 4 -5 0\n1 1",
"output": "YES"
},
{
"input": "8 -4 4 -7\n1 2",
"output": "NO"
},
{
"input": "5 2 2 4\n2 2",
"output": "NO"
},
{
"input": "2 0 -4 6\n1 2",
"output": "NO"
},
{
"input": "-2 6 -5 -4\n1 2",
"output": "YES"
},
{
"input": "-6 5 10 6\n2 4",
"output": "NO"
},
{
"input": "3 -7 1 -8\n1 2",
"output": "NO"
},
{
"input": "4 1 4 -4\n9 4",
"output": "NO"
},
{
"input": "9 -3 -9 -3\n2 2",
"output": "NO"
},
{
"input": "-6 -6 -10 -5\n6 7",
"output": "NO"
},
{
"input": "-5 -2 2 2\n1 7",
"output": "NO"
},
{
"input": "9 0 8 1\n7 10",
"output": "NO"
},
{
"input": "-1 6 -7 -6\n6 4",
"output": "YES"
},
{
"input": "2 2 -3 -3\n3 1",
"output": "NO"
},
{
"input": "2 -6 7 2\n2 1",
"output": "NO"
},
{
"input": "-6 2 -7 -7\n1 2",
"output": "NO"
},
{
"input": "-5 -5 -1 -5\n2 2",
"output": "YES"
},
{
"input": "0 5 3 -6\n2 2",
"output": "NO"
},
{
"input": "0 -6 2 -1\n1 1",
"output": "NO"
},
{
"input": "-6 6 -5 -4\n1 2",
"output": "YES"
},
{
"input": "7 -7 1 -7\n2 2",
"output": "NO"
},
{
"input": "99966 -99952 -99966 99923\n1 1",
"output": "NO"
},
{
"input": "99921 99980 -99956 -99907\n3 4",
"output": "NO"
},
{
"input": "100000 100000 -100000 -100000\n1 1",
"output": "YES"
},
{
"input": "1 0 2 0\n5 1",
"output": "NO"
},
{
"input": "-3 0 -8 0\n7 2",
"output": "NO"
},
{
"input": "-9 4 -5 -1\n8 2",
"output": "NO"
},
{
"input": "-99999 -100000 100000 100000\n1 1",
"output": "NO"
},
{
"input": "0 0 -100 -100\n2 2",
"output": "YES"
},
{
"input": "9 -5 -3 -2\n1 4",
"output": "NO"
},
{
"input": "1 -10 -10 5\n7 5",
"output": "NO"
},
{
"input": "6 -9 -1 -9\n1 9",
"output": "NO"
}
] | 1,667,942,601
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
x1, y1, x2, y2 = map(int, input().strip().split())
dx, dy = map(int, input().strip().split())
delta_x, delta_y = x2-x1, y2-y1
if delta_x == 0 and delta_y == 0:
print("YES")
return
if delta_x == 0:
print("YES\n" if delta_y % dy == 0 else "NO\n")
return
elif delta_y == 0:
print("YES\n" if delta_x % dx == 0 else "NO\n")
return
print("YES\n" if (delta_x % dx== 0) and (delta_y % dy == 0) and (delta_x // dx) == (delta_y // dy) else "NO\n")
|
Title: Treasure Hunt
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Captain Bill the Hummingbird and his crew recieved an interesting challenge offer. Some stranger gave them a map, potion of teleportation and said that only this potion might help them to reach the treasure.
Bottle with potion has two values *x* and *y* written on it. These values define four moves which can be performed using the potion:
- - - -
Map shows that the position of Captain Bill the Hummingbird is (*x*1,<=*y*1) and the position of the treasure is (*x*2,<=*y*2).
You task is to tell Captain Bill the Hummingbird whether he should accept this challenge or decline. If it is possible for Captain to reach the treasure using the potion then output "YES", otherwise "NO" (without quotes).
The potion can be used infinite amount of times.
Input Specification:
The first line contains four integer numbers *x*1,<=*y*1,<=*x*2,<=*y*2 (<=-<=105<=≤<=*x*1,<=*y*1,<=*x*2,<=*y*2<=≤<=105) — positions of Captain Bill the Hummingbird and treasure respectively.
The second line contains two integer numbers *x*,<=*y* (1<=≤<=*x*,<=*y*<=≤<=105) — values on the potion bottle.
Output Specification:
Print "YES" if it is possible for Captain to reach the treasure using the potion, otherwise print "NO" (without quotes).
Demo Input:
['0 0 0 6\n2 3\n', '1 1 3 6\n1 5\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first example there exists such sequence of moves:
1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7c939890fb4ed35688177327dac981bfa9216c00.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the first type of move 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/afbfa42fbac4e0641e7466e3aac74cbbb08ed597.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the third type of move
|
```python
x1, y1, x2, y2 = map(int, input().strip().split())
dx, dy = map(int, input().strip().split())
delta_x, delta_y = x2-x1, y2-y1
if delta_x == 0 and delta_y == 0:
print("YES")
return
if delta_x == 0:
print("YES\n" if delta_y % dy == 0 else "NO\n")
return
elif delta_y == 0:
print("YES\n" if delta_x % dx == 0 else "NO\n")
return
print("YES\n" if (delta_x % dx== 0) and (delta_y % dy == 0) and (delta_x // dx) == (delta_y // dy) else "NO\n")
```
| -1
|
|
698
|
A
|
Vacations
|
PROGRAMMING
| 1,400
|
[
"dp"
] | null | null |
Vasya has *n* days of vacations! So he decided to improve his IT skills and do sport. Vasya knows the following information about each of this *n* days: whether that gym opened and whether a contest was carried out in the Internet on that day. For the *i*-th day there are four options:
1. on this day the gym is closed and the contest is not carried out; 1. on this day the gym is closed and the contest is carried out; 1. on this day the gym is open and the contest is not carried out; 1. on this day the gym is open and the contest is carried out.
On each of days Vasya can either have a rest or write the contest (if it is carried out on this day), or do sport (if the gym is open on this day).
Find the minimum number of days on which Vasya will have a rest (it means, he will not do sport and write the contest at the same time). The only limitation that Vasya has — he does not want to do the same activity on two consecutive days: it means, he will not do sport on two consecutive days, and write the contest on two consecutive days.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of days of Vasya's vacations.
The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=3) separated by space, where:
- *a**i* equals 0, if on the *i*-th day of vacations the gym is closed and the contest is not carried out; - *a**i* equals 1, if on the *i*-th day of vacations the gym is closed, but the contest is carried out; - *a**i* equals 2, if on the *i*-th day of vacations the gym is open and the contest is not carried out; - *a**i* equals 3, if on the *i*-th day of vacations the gym is open and the contest is carried out.
|
Print the minimum possible number of days on which Vasya will have a rest. Remember that Vasya refuses:
- to do sport on any two consecutive days, - to write the contest on any two consecutive days.
|
[
"4\n1 3 2 0\n",
"7\n1 3 3 2 1 2 3\n",
"2\n2 2\n"
] |
[
"2\n",
"0\n",
"1\n"
] |
In the first test Vasya can write the contest on the day number 1 and do sport on the day number 3. Thus, he will have a rest for only 2 days.
In the second test Vasya should write contests on days number 1, 3, 5 and 7, in other days do sport. Thus, he will not have a rest for a single day.
In the third test Vasya can do sport either on a day number 1 or number 2. He can not do sport in two days, because it will be contrary to the his limitation. Thus, he will have a rest for only one day.
| 500
|
[
{
"input": "4\n1 3 2 0",
"output": "2"
},
{
"input": "7\n1 3 3 2 1 2 3",
"output": "0"
},
{
"input": "2\n2 2",
"output": "1"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "10\n0 0 1 1 0 0 0 0 1 0",
"output": "8"
},
{
"input": "100\n3 2 3 3 3 2 3 1 3 2 2 3 2 3 3 3 3 3 3 1 2 2 3 1 3 3 2 2 2 3 1 0 3 3 3 2 3 3 1 1 3 1 3 3 3 1 3 1 3 0 1 3 2 3 2 1 1 3 2 3 3 3 2 3 1 3 3 3 3 2 2 2 1 3 1 3 3 3 3 1 3 2 3 3 0 3 3 3 3 3 1 0 2 1 3 3 0 2 3 3",
"output": "16"
},
{
"input": "10\n2 3 0 1 3 1 2 2 1 0",
"output": "3"
},
{
"input": "45\n3 3 2 3 2 3 3 3 0 3 3 3 3 3 3 3 1 3 2 3 2 3 2 2 2 3 2 3 3 3 3 3 1 2 3 3 2 2 2 3 3 3 3 1 3",
"output": "6"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n3",
"output": "0"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n1 3",
"output": "0"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "2\n0 0",
"output": "2"
},
{
"input": "2\n3 3",
"output": "0"
},
{
"input": "3\n3 3 3",
"output": "0"
},
{
"input": "2\n3 2",
"output": "0"
},
{
"input": "2\n0 2",
"output": "1"
},
{
"input": "10\n2 2 3 3 3 3 2 1 3 2",
"output": "2"
},
{
"input": "15\n0 1 0 0 0 2 0 1 0 0 0 2 0 0 0",
"output": "11"
},
{
"input": "15\n1 3 2 2 2 3 3 3 3 2 3 2 2 1 1",
"output": "4"
},
{
"input": "15\n3 1 3 2 3 2 2 2 3 3 3 3 2 3 2",
"output": "3"
},
{
"input": "20\n0 2 0 1 0 0 0 1 2 0 1 1 1 0 1 1 0 1 1 0",
"output": "12"
},
{
"input": "20\n2 3 2 3 3 3 3 2 0 3 1 1 2 3 0 3 2 3 0 3",
"output": "5"
},
{
"input": "20\n3 3 3 3 2 3 3 2 1 3 3 2 2 2 3 2 2 2 2 2",
"output": "4"
},
{
"input": "25\n0 0 1 0 0 1 0 0 1 0 0 1 0 2 0 0 2 0 0 1 0 2 0 1 1",
"output": "16"
},
{
"input": "25\n1 3 3 2 2 3 3 3 3 3 1 2 2 3 2 0 2 1 0 1 3 2 2 3 3",
"output": "5"
},
{
"input": "25\n2 3 1 3 3 2 1 3 3 3 1 3 3 1 3 2 3 3 1 3 3 3 2 3 3",
"output": "3"
},
{
"input": "30\n0 0 1 0 1 0 1 1 0 0 0 0 0 0 1 0 0 1 1 0 0 2 0 0 1 1 2 0 0 0",
"output": "22"
},
{
"input": "30\n1 1 3 2 2 0 3 2 3 3 1 2 0 1 1 2 3 3 2 3 1 3 2 3 0 2 0 3 3 2",
"output": "9"
},
{
"input": "30\n1 2 3 2 2 3 3 3 3 3 3 3 3 3 3 1 2 2 3 2 3 3 3 2 1 3 3 3 1 3",
"output": "2"
},
{
"input": "35\n0 1 1 0 0 2 0 0 1 0 0 0 1 0 1 0 1 0 0 0 1 2 1 0 2 2 1 0 1 0 1 1 1 0 0",
"output": "21"
},
{
"input": "35\n2 2 0 3 2 2 0 3 3 1 1 3 3 1 2 2 0 2 2 2 2 3 1 0 2 1 3 2 2 3 2 3 3 1 2",
"output": "11"
},
{
"input": "35\n1 2 2 3 3 3 3 3 2 2 3 3 2 3 3 2 3 2 3 3 2 2 2 3 3 2 3 3 3 1 3 3 2 2 2",
"output": "7"
},
{
"input": "40\n2 0 1 1 0 0 0 0 2 0 1 1 1 0 0 1 0 0 0 0 0 2 0 0 0 2 1 1 1 3 0 0 0 0 0 0 0 1 1 0",
"output": "28"
},
{
"input": "40\n2 2 3 2 0 2 3 2 1 2 3 0 2 3 2 1 1 3 1 1 0 2 3 1 3 3 1 1 3 3 2 2 1 3 3 3 2 3 3 1",
"output": "10"
},
{
"input": "40\n1 3 2 3 3 2 3 3 2 2 3 1 2 1 2 2 3 1 2 2 1 2 2 2 1 2 2 3 2 3 2 3 2 3 3 3 1 3 2 3",
"output": "8"
},
{
"input": "45\n2 1 0 0 0 2 1 0 1 0 0 2 2 1 1 0 0 2 0 0 0 0 0 0 1 0 0 2 0 0 1 1 0 0 1 0 0 1 1 2 0 0 2 0 2",
"output": "29"
},
{
"input": "45\n3 3 2 3 3 3 2 2 3 2 3 1 3 2 3 2 2 1 1 3 2 3 2 1 3 1 2 3 2 2 0 3 3 2 3 2 3 2 3 2 0 3 1 1 3",
"output": "8"
},
{
"input": "50\n3 0 0 0 2 0 0 0 0 0 0 0 2 1 0 2 0 1 0 1 3 0 2 1 1 0 0 1 1 0 0 1 2 1 1 2 1 1 0 0 0 0 0 0 0 1 2 2 0 0",
"output": "32"
},
{
"input": "50\n3 3 3 3 1 0 3 3 0 2 3 1 1 1 3 2 3 3 3 3 3 1 0 1 2 2 3 3 2 3 0 0 0 2 1 0 1 2 2 2 2 0 2 2 2 1 2 3 3 2",
"output": "16"
},
{
"input": "50\n3 2 3 1 2 1 2 3 3 2 3 3 2 1 3 3 3 3 3 3 2 3 2 3 2 2 3 3 3 2 3 3 3 3 2 3 1 2 3 3 2 3 3 1 2 2 1 1 3 3",
"output": "7"
},
{
"input": "55\n0 0 1 1 0 1 0 0 1 0 1 0 0 0 2 0 0 1 0 0 0 1 0 0 0 0 3 1 0 0 0 1 0 0 0 0 2 0 0 0 2 0 2 1 0 0 0 0 0 0 0 0 2 0 0",
"output": "40"
},
{
"input": "55\n3 0 3 3 3 2 0 2 3 0 3 2 3 3 0 3 3 1 3 3 1 2 3 2 0 3 3 2 1 2 3 2 3 0 3 2 2 1 2 3 2 2 1 3 2 2 3 1 3 2 2 3 3 2 2",
"output": "13"
},
{
"input": "55\n3 3 1 3 2 3 2 3 2 2 3 3 3 3 3 1 1 3 3 2 3 2 3 2 0 1 3 3 3 3 2 3 2 3 1 1 2 2 2 3 3 3 3 3 2 2 2 3 2 3 3 3 3 1 3",
"output": "7"
},
{
"input": "60\n0 1 0 0 0 0 0 0 0 2 1 1 3 0 0 0 0 0 1 0 1 1 0 0 0 3 0 1 0 1 0 2 0 0 0 0 0 1 0 0 0 0 1 1 0 1 0 0 0 0 0 1 0 0 1 0 1 0 0 0",
"output": "44"
},
{
"input": "60\n3 2 1 3 2 2 3 3 3 1 1 3 2 2 3 3 1 3 2 2 3 3 2 2 2 2 0 2 2 3 2 3 0 3 3 3 2 3 3 0 1 3 2 1 3 1 1 2 1 3 1 1 2 2 1 3 3 3 2 2",
"output": "15"
},
{
"input": "60\n3 2 2 3 2 3 2 3 3 2 3 2 3 3 2 3 3 3 3 3 3 2 3 3 1 2 3 3 3 2 1 3 3 1 3 1 3 0 3 3 3 2 3 2 3 2 3 3 1 1 2 3 3 3 3 2 1 3 2 3",
"output": "8"
},
{
"input": "65\n1 0 2 1 1 0 1 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 0 1 2 0 2 1 0 2 1 0 1 0 1 1 0 1 1 1 2 1 0 1 0 0 0 0 1 2 2 1 0 0 1 2 1 2 0 2 0 0 0 1 1",
"output": "35"
},
{
"input": "65\n2 2 2 3 0 2 1 2 3 3 1 3 1 2 1 3 2 3 2 2 2 1 2 0 3 1 3 1 1 3 1 3 3 3 3 3 1 3 0 3 1 3 1 2 2 3 2 0 3 1 3 2 1 2 2 2 3 3 2 3 3 3 2 2 3",
"output": "13"
},
{
"input": "65\n3 2 3 3 3 2 3 2 3 3 3 3 3 3 3 3 3 2 3 2 3 2 2 3 3 3 3 3 2 2 2 3 3 2 3 3 2 3 3 3 3 2 3 3 3 2 2 3 3 3 3 3 3 2 2 3 3 2 3 3 1 3 3 3 3",
"output": "6"
},
{
"input": "70\n1 0 0 0 1 0 1 0 0 0 1 1 0 1 0 0 1 1 1 0 1 1 0 0 1 1 1 3 1 1 0 1 2 0 2 1 0 0 0 1 1 1 1 1 0 0 1 0 0 0 1 1 1 3 0 0 1 0 0 0 1 0 0 0 0 0 1 0 1 1",
"output": "43"
},
{
"input": "70\n2 3 3 3 1 3 3 1 2 1 1 2 2 3 0 2 3 3 1 3 3 2 2 3 3 3 2 2 2 2 1 3 3 0 2 1 1 3 2 3 3 2 2 3 1 3 1 2 3 2 3 3 2 2 2 3 1 1 2 1 3 3 2 2 3 3 3 1 1 1",
"output": "16"
},
{
"input": "70\n3 3 2 2 1 2 1 2 2 2 2 2 3 3 2 3 3 3 3 2 2 2 2 3 3 3 1 3 3 3 2 3 3 3 3 2 3 3 1 3 1 3 2 3 3 2 3 3 3 2 3 2 3 3 1 2 3 3 2 2 2 3 2 3 3 3 3 3 3 1",
"output": "10"
},
{
"input": "75\n1 0 0 1 1 0 0 1 0 1 2 0 0 2 1 1 0 0 0 0 0 0 2 1 1 0 0 0 0 1 0 1 0 1 1 1 0 1 0 0 1 0 0 0 0 0 0 1 1 0 0 1 2 1 0 0 0 0 0 0 0 1 0 0 0 1 0 0 0 1 1 1 0 1 0",
"output": "51"
},
{
"input": "75\n1 3 3 3 1 1 3 2 3 3 1 3 3 3 2 1 3 2 2 3 1 1 1 1 1 1 2 3 3 3 3 3 3 2 3 3 3 3 3 2 3 3 2 2 2 1 2 3 3 2 2 3 0 1 1 3 3 0 0 1 1 3 2 3 3 3 3 1 2 2 3 3 3 3 1",
"output": "16"
},
{
"input": "75\n3 3 3 3 2 2 3 2 2 3 2 2 1 2 3 3 2 2 3 3 1 2 2 2 1 3 3 3 1 2 2 3 3 3 2 3 2 2 2 3 3 1 3 2 2 3 3 3 0 3 2 1 3 3 2 3 3 3 3 1 2 3 3 3 2 2 3 3 3 3 2 2 3 3 1",
"output": "11"
},
{
"input": "80\n0 0 0 0 2 0 1 1 1 1 1 0 0 0 0 2 0 0 1 0 0 0 0 1 1 0 2 2 1 1 0 1 0 1 0 1 1 1 0 1 2 1 1 0 0 0 1 1 0 1 1 0 1 0 0 1 0 0 1 0 0 0 0 0 0 0 2 2 0 1 1 0 0 0 0 0 0 0 0 1",
"output": "56"
},
{
"input": "80\n2 2 3 3 2 1 0 1 0 3 2 2 3 2 1 3 1 3 3 2 3 3 3 2 3 3 3 2 1 3 3 1 3 3 3 3 3 3 2 2 2 1 3 2 1 3 2 1 1 0 1 1 2 1 3 0 1 2 3 2 2 3 2 3 1 3 3 2 1 1 0 3 3 3 3 1 2 1 2 0",
"output": "17"
},
{
"input": "80\n2 3 3 2 2 2 3 3 2 3 3 3 3 3 2 3 2 3 2 3 3 3 3 3 3 3 3 3 2 3 1 3 2 3 3 0 3 1 2 3 3 1 2 3 2 3 3 2 3 3 3 3 3 2 2 3 0 3 3 3 3 3 2 2 3 2 3 3 3 3 3 2 3 2 3 3 3 3 2 3",
"output": "9"
},
{
"input": "85\n0 1 1 0 0 0 0 0 0 1 0 0 0 1 0 0 0 0 2 0 1 0 0 2 0 1 1 0 0 0 0 2 2 0 0 0 1 0 0 0 1 2 0 1 0 0 0 2 1 1 2 0 3 1 0 2 2 1 0 0 1 1 0 0 0 0 1 0 2 1 1 2 1 0 0 1 2 1 2 0 0 1 0 1 0",
"output": "54"
},
{
"input": "85\n2 3 1 3 2 3 1 3 3 2 1 2 1 2 2 3 2 2 3 2 0 3 3 2 1 2 2 2 3 3 2 3 3 3 2 1 1 3 1 3 2 2 2 3 3 2 3 2 3 1 1 3 2 3 1 3 3 2 3 3 2 2 3 0 1 1 2 2 2 2 1 2 3 1 3 3 1 3 2 2 3 2 3 3 3",
"output": "19"
},
{
"input": "85\n1 2 1 2 3 2 3 3 3 3 3 3 3 2 1 3 2 3 3 3 3 2 3 3 3 1 3 3 3 3 2 3 3 3 3 3 3 2 2 1 3 3 3 3 2 2 3 1 1 2 3 3 3 2 3 3 3 3 3 2 3 3 3 2 2 3 3 1 1 1 3 3 3 3 1 3 3 3 1 3 3 1 3 2 3",
"output": "9"
},
{
"input": "90\n2 0 1 0 0 0 0 0 0 1 1 2 0 0 0 0 0 0 0 2 2 0 2 0 0 2 1 0 2 0 1 0 1 0 0 1 2 2 0 0 1 0 0 1 0 1 0 2 0 1 1 1 0 1 1 0 1 0 2 0 1 0 1 0 0 0 1 0 0 1 2 0 0 0 1 0 0 2 2 0 0 0 0 0 1 3 1 1 0 1",
"output": "57"
},
{
"input": "90\n2 3 3 3 2 3 2 1 3 0 3 2 3 3 2 1 3 3 2 3 2 3 3 2 1 3 1 3 3 1 2 2 3 3 2 1 2 3 2 3 0 3 3 2 2 3 1 0 3 3 1 3 3 3 3 2 1 2 2 1 3 2 1 3 3 1 2 0 2 2 3 2 2 3 3 3 1 3 2 1 2 3 3 2 3 2 3 3 2 1",
"output": "17"
},
{
"input": "90\n2 3 2 3 2 2 3 3 2 3 2 1 2 3 3 3 2 3 2 3 3 2 3 3 3 1 3 3 1 3 2 3 2 2 1 3 3 3 3 3 3 3 3 3 3 2 3 2 3 2 1 3 3 3 3 2 2 3 3 3 3 3 3 3 3 3 3 3 3 2 2 3 3 3 3 1 3 2 3 3 3 2 2 3 2 3 2 1 3 2",
"output": "9"
},
{
"input": "95\n0 0 3 0 2 0 1 0 0 2 0 0 0 0 0 0 0 1 0 0 0 2 0 0 0 0 0 1 0 0 2 1 0 0 1 0 0 0 1 0 0 0 0 1 0 1 0 0 1 0 1 2 0 1 2 2 0 0 1 0 2 0 0 0 1 0 2 1 2 1 0 1 0 0 0 1 0 0 1 1 2 1 1 1 1 2 0 0 0 0 0 1 1 0 1",
"output": "61"
},
{
"input": "95\n2 3 3 2 1 1 3 3 3 2 3 3 3 2 3 2 3 3 3 2 3 2 2 3 3 2 1 2 3 3 3 1 3 0 3 3 1 3 3 1 0 1 3 3 3 0 2 1 3 3 3 3 0 1 3 2 3 3 2 1 3 1 2 1 1 2 3 0 3 3 2 1 3 2 1 3 3 3 2 2 3 2 3 3 3 2 1 3 3 3 2 3 3 1 2",
"output": "15"
},
{
"input": "95\n2 3 3 2 3 2 2 1 3 1 2 1 2 3 1 2 3 3 1 3 3 3 1 2 3 2 2 2 2 3 3 3 2 2 3 3 3 3 3 1 2 2 3 3 3 3 2 3 2 2 2 3 3 2 3 3 3 3 3 3 3 0 3 2 0 3 3 1 3 3 3 2 3 2 3 2 3 3 3 3 2 2 1 1 3 3 3 3 3 1 3 3 3 3 2",
"output": "14"
},
{
"input": "100\n1 0 2 0 0 0 0 2 0 0 0 1 0 1 0 0 1 0 1 2 0 1 1 0 0 1 0 1 1 0 0 0 2 0 1 0 0 2 0 0 0 0 0 1 1 1 0 0 1 0 2 0 0 0 0 1 0 1 0 1 0 1 0 1 2 2 0 0 2 0 1 0 1 0 1 0 0 0 1 0 0 2 1 1 1 0 0 1 0 0 0 2 0 0 2 1 1 0 0 2",
"output": "63"
},
{
"input": "100\n3 2 1 3 2 3 2 3 2 2 3 1 3 3 3 3 3 2 2 3 2 2 3 2 3 3 3 2 3 1 2 1 3 3 3 3 1 3 3 3 3 3 2 3 2 1 3 3 1 2 2 3 1 3 3 1 2 2 1 3 1 3 2 2 3 3 1 3 2 3 1 2 1 2 3 3 2 2 1 2 3 3 3 3 3 1 3 3 3 3 2 1 3 0 3 3 3 2 3 3",
"output": "15"
},
{
"input": "100\n1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2",
"output": "0"
},
{
"input": "100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "0"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "50"
},
{
"input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "49"
},
{
"input": "100\n2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1",
"output": "0"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "100"
},
{
"input": "2\n0 3",
"output": "1"
},
{
"input": "2\n1 0",
"output": "1"
},
{
"input": "2\n1 2",
"output": "0"
},
{
"input": "2\n2 0",
"output": "1"
},
{
"input": "2\n2 1",
"output": "0"
},
{
"input": "2\n2 3",
"output": "0"
},
{
"input": "2\n3 0",
"output": "1"
},
{
"input": "2\n3 1",
"output": "0"
},
{
"input": "100\n3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0",
"output": "50"
}
] | 1,688,112,444
| 2,147,483,647
|
PyPy 3-64
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
n = int(input())
schedule = list(map(int, input().split(" ")))
d = [[0 for i in range(3)] for j in range(n+1)]
# first row both
# second row it
# third row gym
for i, v in enumerate(schedule):
if v == 1 or v == 3:
d[i+1][1] = max(d[i][0] + 1, d[i][2] + 1)
if v == 2 or v == 3:
d[i+1][2] = max(d[i][0] + 1, d[i][1] + 1)
d[i+1][0] = max(d[i][0], max(d[i][1], d[i][2]))
#print(d)
r = n - max(d[n][0], max(d[n][1], d[n][2]))
print(r)
|
Title: Vacations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has *n* days of vacations! So he decided to improve his IT skills and do sport. Vasya knows the following information about each of this *n* days: whether that gym opened and whether a contest was carried out in the Internet on that day. For the *i*-th day there are four options:
1. on this day the gym is closed and the contest is not carried out; 1. on this day the gym is closed and the contest is carried out; 1. on this day the gym is open and the contest is not carried out; 1. on this day the gym is open and the contest is carried out.
On each of days Vasya can either have a rest or write the contest (if it is carried out on this day), or do sport (if the gym is open on this day).
Find the minimum number of days on which Vasya will have a rest (it means, he will not do sport and write the contest at the same time). The only limitation that Vasya has — he does not want to do the same activity on two consecutive days: it means, he will not do sport on two consecutive days, and write the contest on two consecutive days.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of days of Vasya's vacations.
The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=3) separated by space, where:
- *a**i* equals 0, if on the *i*-th day of vacations the gym is closed and the contest is not carried out; - *a**i* equals 1, if on the *i*-th day of vacations the gym is closed, but the contest is carried out; - *a**i* equals 2, if on the *i*-th day of vacations the gym is open and the contest is not carried out; - *a**i* equals 3, if on the *i*-th day of vacations the gym is open and the contest is carried out.
Output Specification:
Print the minimum possible number of days on which Vasya will have a rest. Remember that Vasya refuses:
- to do sport on any two consecutive days, - to write the contest on any two consecutive days.
Demo Input:
['4\n1 3 2 0\n', '7\n1 3 3 2 1 2 3\n', '2\n2 2\n']
Demo Output:
['2\n', '0\n', '1\n']
Note:
In the first test Vasya can write the contest on the day number 1 and do sport on the day number 3. Thus, he will have a rest for only 2 days.
In the second test Vasya should write contests on days number 1, 3, 5 and 7, in other days do sport. Thus, he will not have a rest for a single day.
In the third test Vasya can do sport either on a day number 1 or number 2. He can not do sport in two days, because it will be contrary to the his limitation. Thus, he will have a rest for only one day.
|
```python
n = int(input())
schedule = list(map(int, input().split(" ")))
d = [[0 for i in range(3)] for j in range(n+1)]
# first row both
# second row it
# third row gym
for i, v in enumerate(schedule):
if v == 1 or v == 3:
d[i+1][1] = max(d[i][0] + 1, d[i][2] + 1)
if v == 2 or v == 3:
d[i+1][2] = max(d[i][0] + 1, d[i][1] + 1)
d[i+1][0] = max(d[i][0], max(d[i][1], d[i][2]))
#print(d)
r = n - max(d[n][0], max(d[n][1], d[n][2]))
print(r)
```
| -1
|
|
443
|
A
|
Anton and Letters
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
Recently, Anton has found a set. The set consists of small English letters. Anton carefully wrote out all the letters from the set in one line, separated by a comma. He also added an opening curved bracket at the beginning of the line and a closing curved bracket at the end of the line.
Unfortunately, from time to time Anton would forget writing some letter and write it again. He asks you to count the total number of distinct letters in his set.
|
The first and the single line contains the set of letters. The length of the line doesn't exceed 1000. It is guaranteed that the line starts from an opening curved bracket and ends with a closing curved bracket. Between them, small English letters are listed, separated by a comma. Each comma is followed by a space.
|
Print a single number — the number of distinct letters in Anton's set.
|
[
"{a, b, c}\n",
"{b, a, b, a}\n",
"{}\n"
] |
[
"3\n",
"2\n",
"0\n"
] |
none
| 500
|
[
{
"input": "{a, b, c}",
"output": "3"
},
{
"input": "{b, a, b, a}",
"output": "2"
},
{
"input": "{}",
"output": "0"
},
{
"input": "{a, a, c, b, b, b, c, c, c, c}",
"output": "3"
},
{
"input": "{a, c, b, b}",
"output": "3"
},
{
"input": "{a, b}",
"output": "2"
},
{
"input": "{a}",
"output": "1"
},
{
"input": "{b, a, b, a, b, c, c, b, c, b}",
"output": "3"
},
{
"input": "{e, g, c, e}",
"output": "3"
},
{
"input": "{a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a}",
"output": "1"
},
{
"input": "{a, a, b}",
"output": "2"
},
{
"input": "{a, b, b, b, a, b, a, a, a, a, a, a, b, a, b, a, a, a, a, a, b, a, b, a}",
"output": "2"
},
{
"input": "{j, u, a, c, f, w, e, w, x, t, h, p, v, n, i, l, x, n, i, b, u, c, a, a}",
"output": "16"
},
{
"input": "{x, i, w, c, p, e, h, z, k, i}",
"output": "9"
},
{
"input": "{t, k, o, x, r, d, q, j, k, e, z, w, y, r, z, s, s, e, s, b, k, i}",
"output": "15"
},
{
"input": "{y}",
"output": "1"
},
{
"input": "{x}",
"output": "1"
},
{
"input": "{b, z, a, z}",
"output": "3"
},
{
"input": "{z}",
"output": "1"
},
{
"input": "{a, z}",
"output": "2"
},
{
"input": "{a, b, z}",
"output": "3"
},
{
"input": "{s, q, z, r, t, a, b, h, j, i, o, z, r, q}",
"output": "11"
}
] | 1,690,521,894
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 27
| 62
| 0
|
import sys
input = sys.stdin.readline
letters = set()
s = input().strip()
for c in s:
if c in " ,{}":
continue
letters.add(c)
print(len(letters))
|
Title: Anton and Letters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, Anton has found a set. The set consists of small English letters. Anton carefully wrote out all the letters from the set in one line, separated by a comma. He also added an opening curved bracket at the beginning of the line and a closing curved bracket at the end of the line.
Unfortunately, from time to time Anton would forget writing some letter and write it again. He asks you to count the total number of distinct letters in his set.
Input Specification:
The first and the single line contains the set of letters. The length of the line doesn't exceed 1000. It is guaranteed that the line starts from an opening curved bracket and ends with a closing curved bracket. Between them, small English letters are listed, separated by a comma. Each comma is followed by a space.
Output Specification:
Print a single number — the number of distinct letters in Anton's set.
Demo Input:
['{a, b, c}\n', '{b, a, b, a}\n', '{}\n']
Demo Output:
['3\n', '2\n', '0\n']
Note:
none
|
```python
import sys
input = sys.stdin.readline
letters = set()
s = input().strip()
for c in s:
if c in " ,{}":
continue
letters.add(c)
print(len(letters))
```
| 3
|
|
4
|
A
|
Watermelon
|
PROGRAMMING
| 800
|
[
"brute force",
"math"
] |
A. Watermelon
|
1
|
64
|
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
|
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
|
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
|
[
"8\n"
] |
[
"YES\n"
] |
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
| 0
|
[
{
"input": "8",
"output": "YES"
},
{
"input": "5",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "3",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "1",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "10",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "53",
"output": "NO"
},
{
"input": "77",
"output": "NO"
},
{
"input": "32",
"output": "YES"
},
{
"input": "44",
"output": "YES"
},
{
"input": "98",
"output": "YES"
},
{
"input": "99",
"output": "NO"
},
{
"input": "90",
"output": "YES"
},
{
"input": "67",
"output": "NO"
},
{
"input": "100",
"output": "YES"
},
{
"input": "88",
"output": "YES"
}
] | 1,695,061,638
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 62
| 0
|
w = int(input())
c=0
for i in range(2, w+1, 2):
if ((w-i)%2==0):
c = c + 1
if ((w-i)==0):
c = c + 1
if c>0:
print("YES")
else:
print("NO")
|
Title: Watermelon
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
Input Specification:
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Output Specification:
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
Demo Input:
['8\n']
Demo Output:
['YES\n']
Note:
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
|
```python
w = int(input())
c=0
for i in range(2, w+1, 2):
if ((w-i)%2==0):
c = c + 1
if ((w-i)==0):
c = c + 1
if c>0:
print("YES")
else:
print("NO")
```
| 0
|
248
|
A
|
Cupboards
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house.
Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find.
And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open.
Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position.
Your task is to write a program that will determine the required number of seconds *t*.
|
The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero.
The numbers in the lines are separated by single spaces.
|
In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs.
|
[
"5\n0 1\n1 0\n0 1\n1 1\n0 1\n"
] |
[
"3\n"
] |
none
| 500
|
[
{
"input": "5\n0 1\n1 0\n0 1\n1 1\n0 1",
"output": "3"
},
{
"input": "2\n0 0\n0 0",
"output": "0"
},
{
"input": "3\n0 1\n1 1\n1 1",
"output": "1"
},
{
"input": "8\n0 1\n1 0\n0 1\n1 1\n0 1\n1 0\n0 1\n1 0",
"output": "7"
},
{
"input": "8\n1 0\n1 0\n1 0\n0 1\n0 1\n1 1\n1 1\n0 1",
"output": "6"
},
{
"input": "15\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "5\n1 0\n1 0\n1 0\n0 1\n0 1",
"output": "4"
}
] | 1,630,517,101
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 57
| 186
| 7,577,600
|
n = int(input())
arr = []
l,r =0,0
for i in range(n):
v = list(map(int,input().split()))
arr.append(v)
for i in range(n):
if arr[i][0] == 1:
l += 1
if arr[i][1] == 1:
r += 1
print(min(l,n-l)+min(r,n-r))
|
Title: Cupboards
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house.
Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find.
And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open.
Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position.
Your task is to write a program that will determine the required number of seconds *t*.
Input Specification:
The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero.
The numbers in the lines are separated by single spaces.
Output Specification:
In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs.
Demo Input:
['5\n0 1\n1 0\n0 1\n1 1\n0 1\n']
Demo Output:
['3\n']
Note:
none
|
```python
n = int(input())
arr = []
l,r =0,0
for i in range(n):
v = list(map(int,input().split()))
arr.append(v)
for i in range(n):
if arr[i][0] == 1:
l += 1
if arr[i][1] == 1:
r += 1
print(min(l,n-l)+min(r,n-r))
```
| 3
|
|
727
|
D
|
T-shirts Distribution
|
PROGRAMMING
| 1,800
|
[
"constructive algorithms",
"flows",
"greedy"
] | null | null |
The organizers of a programming contest have decided to present t-shirts to participants. There are six different t-shirts sizes in this problem: S, M, L, XL, XXL, XXXL (sizes are listed in increasing order). The t-shirts are already prepared. For each size from S to XXXL you are given the number of t-shirts of this size.
During the registration, the organizers asked each of the *n* participants about the t-shirt size he wants. If a participant hesitated between two sizes, he could specify two neighboring sizes — this means that any of these two sizes suits him.
Write a program that will determine whether it is possible to present a t-shirt to each participant of the competition, or not. Of course, each participant should get a t-shirt of proper size:
- the size he wanted, if he specified one size; - any of the two neibouring sizes, if he specified two sizes.
If it is possible, the program should find any valid distribution of the t-shirts.
|
The first line of the input contains six non-negative integers — the number of t-shirts of each size. The numbers are given for the sizes S, M, L, XL, XXL, XXXL, respectively. The total number of t-shirts doesn't exceed 100<=000.
The second line contains positive integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of participants.
The following *n* lines contain the sizes specified by the participants, one line per participant. The *i*-th line contains information provided by the *i*-th participant: single size or two sizes separated by comma (without any spaces). If there are two sizes, the sizes are written in increasing order. It is guaranteed that two sizes separated by comma are neighboring.
|
If it is not possible to present a t-shirt to each participant, print «NO» (without quotes).
Otherwise, print *n*<=+<=1 lines. In the first line print «YES» (without quotes). In the following *n* lines print the t-shirt sizes the orginizers should give to participants, one per line. The order of the participants should be the same as in the input.
If there are multiple solutions, print any of them.
|
[
"0 1 0 1 1 0\n3\nXL\nS,M\nXL,XXL\n",
"1 1 2 0 1 1\n5\nS\nM\nS,M\nXXL,XXXL\nXL,XXL\n"
] |
[
"YES\nXL\nM\nXXL\n",
"NO\n"
] |
none
| 1,500
|
[
{
"input": "0 1 0 1 1 0\n3\nXL\nS,M\nXL,XXL",
"output": "YES\nXL\nM\nXXL"
},
{
"input": "1 1 2 0 1 1\n5\nS\nM\nS,M\nXXL,XXXL\nXL,XXL",
"output": "NO"
},
{
"input": "1 2 4 4 1 1\n10\nXL\nXL\nS,M\nL\nM,L\nL\nS,M\nM\nXL,XXL\nXL",
"output": "YES\nXL\nXL\nS\nL\nL\nL\nM\nM\nXL\nXL"
},
{
"input": "1 3 0 2 2 2\n10\nL,XL\nS,M\nXXL,XXXL\nS,M\nS,M\nXXXL\nXL,XXL\nXXL\nS,M\nXL",
"output": "YES\nXL\nS\nXXXL\nM\nM\nXXXL\nXXL\nXXL\nM\nXL"
},
{
"input": "5 1 5 2 4 3\n20\nL,XL\nS,M\nL,XL\nXXL,XXXL\nS,M\nS,M\nXL,XXL\nL,XL\nS,M\nL,XL\nS,M\nM,L\nXXL,XXXL\nXXL,XXXL\nL\nXXL,XXXL\nXL,XXL\nM,L\nS,M\nXXL",
"output": "YES\nL\nS\nL\nXXL\nS\nS\nXXL\nXL\nS\nXL\nS\nL\nXXXL\nXXXL\nL\nXXXL\nXXL\nL\nM\nXXL"
},
{
"input": "4 8 8 1 6 3\n30\nS,M\nM,L\nM\nXXL,XXXL\nXXL\nM,L\nS,M\nS,M\nXXL,XXXL\nL\nL\nS,M\nM\nL,XL\nS,M\nM,L\nL\nXXL,XXXL\nS,M\nXXL\nM,L\nM,L\nM,L\nXXL\nXXL,XXXL\nM,L\nS,M\nXXL\nM,L\nXXL,XXXL",
"output": "YES\nS\nM\nM\nXXL\nXXL\nM\nS\nS\nXXL\nL\nL\nS\nM\nXL\nM\nM\nL\nXXXL\nM\nXXL\nL\nL\nL\nXXL\nXXXL\nL\nM\nXXL\nL\nXXXL"
},
{
"input": "1 0 0 0 0 0\n1\nS",
"output": "YES\nS"
},
{
"input": "0 1 0 0 0 0\n1\nS",
"output": "NO"
},
{
"input": "1 0 0 0 0 0\n1\nM",
"output": "NO"
},
{
"input": "0 1 0 0 0 0\n1\nM",
"output": "YES\nM"
},
{
"input": "0 0 0 0 0 1\n1\nL",
"output": "NO"
},
{
"input": "0 0 1 0 0 0\n1\nL",
"output": "YES\nL"
},
{
"input": "0 0 0 1 0 0\n1\nXL",
"output": "YES\nXL"
},
{
"input": "1 0 0 0 0 0\n1\nXL",
"output": "NO"
},
{
"input": "0 0 0 0 1 0\n1\nXXL",
"output": "YES\nXXL"
},
{
"input": "0 1 0 0 0 0\n1\nXXL",
"output": "NO"
},
{
"input": "0 0 0 0 0 1\n1\nXXXL",
"output": "YES\nXXXL"
},
{
"input": "0 0 1 0 0 0\n1\nXXXL",
"output": "NO"
},
{
"input": "1 2 3 6 1 2\n10\nXL\nXL\nM\nL,XL\nL,XL\nL,XL\nS\nS,M\nXL\nL,XL",
"output": "YES\nXL\nXL\nM\nL\nL\nL\nS\nM\nXL\nXL"
},
{
"input": "9 8 1 7 2 3\n20\nL,XL\nM,L\nS\nXL,XXL\nM,L\nXL,XXL\nS\nL,XL\nS,M\nS,M\nXXL,XXXL\nS,M\nS,M\nS,M\nXL,XXL\nL\nXXL,XXXL\nS,M\nXL,XXL\nM,L",
"output": "YES\nXL\nM\nS\nXL\nM\nXL\nS\nXL\nS\nS\nXXL\nS\nS\nS\nXL\nL\nXXL\nS\nXL\nM"
},
{
"input": "9 12 3 8 4 14\n30\nS,M\nS,M\nXL\nXXXL\nXXL,XXXL\nXXL,XXXL\nXXXL\nS,M\nXXL,XXXL\nM,L\nXXL\nXXL,XXXL\nXL,XXL\nL,XL\nXXL,XXXL\nM\nS,M\nXXXL\nXXL,XXXL\nXXL,XXXL\nM\nM,L\nS,M\nS,M\nXXL,XXXL\nXL,XXL\nXXL,XXXL\nXXL,XXXL\nS,M\nM,L",
"output": "YES\nS\nS\nXL\nXXXL\nXXL\nXXL\nXXXL\nS\nXXL\nM\nXXL\nXXXL\nXL\nL\nXXXL\nM\nS\nXXXL\nXXXL\nXXXL\nM\nM\nS\nS\nXXXL\nXL\nXXXL\nXXXL\nS\nM"
},
{
"input": "1 3 0 0 4 2\n10\nXXL\nS,M\nXXXL\nS,M\nS\nXXL,XXXL\nXXL\nXXL,XXXL\nM\nXXL,XXXL",
"output": "YES\nXXL\nM\nXXXL\nM\nS\nXXL\nXXL\nXXL\nM\nXXXL"
},
{
"input": "5 6 0 0 6 3\n20\nXXL,XXXL\nS,M\nS,M\nXXL,XXXL\nS\nS\nXXL,XXXL\nM\nS,M\nXXL,XXXL\nS\nM\nXXXL\nXXL,XXXL\nS,M\nXXXL\nXXL,XXXL\nS,M\nS\nXXL,XXXL",
"output": "YES\nXXL\nS\nM\nXXL\nS\nS\nXXL\nM\nM\nXXL\nS\nM\nXXXL\nXXL\nM\nXXXL\nXXL\nM\nS\nXXXL"
}
] | 1,656,838,544
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 125
| 483
| 20,889,600
|
from bisect import *
from collections import *
import sys
import io, os
import math
import random
from heapq import *
gcd = math.gcd
sqrt = math.sqrt
maxint=10**21
def ceil(a, b):
if(b==0):
return maxint
a = -a
k = a // b
k = -k
return k
# arr=list(map(int, input().split()))
# n,m=map(int,input().split())
input = io.BytesIO(os.read(0, os.fstat(0).st_size)).readline
def strinp(testcases):
k = 5
if (testcases == -1 or testcases == 1):
k = 1
f = str(input())
f = f[2:len(f) - k]
return f
def main():
dic={'S':'0','M':'1','L':'2','XL':'3','XXL':'4','XXXL':'5'}
arr=list(map(int, input().split()))
n=int(input())
lis=[0]*n
for i in range(n):
s=strinp(90).split(',')
if(len(s)==1):
lis[i]=[dic[s[0]],i]
else:
lis[i]=[dic[s[0]]+dic[s[1]],i]
lis.sort()
trig=False
ans=[0]*n
for i in range(n):
no=lis[i][1]
req=lis[i][0]
a=int(req[0])
b=int(req[-1])
if(arr[a]!=0):
ans[no]=a
arr[a]-=1
elif(a!=b and arr[b]!=0):
ans[no]=b
arr[b]-=1
else:
trig=True
break
if(trig):
print('NO')
return()
dic={0:'S',1:'M',2:'L',3:'XL',4:'XXL',5:'XXXL'}
print('YES')
for i in range(n):
print(dic[ans[i]])
main()
|
Title: T-shirts Distribution
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The organizers of a programming contest have decided to present t-shirts to participants. There are six different t-shirts sizes in this problem: S, M, L, XL, XXL, XXXL (sizes are listed in increasing order). The t-shirts are already prepared. For each size from S to XXXL you are given the number of t-shirts of this size.
During the registration, the organizers asked each of the *n* participants about the t-shirt size he wants. If a participant hesitated between two sizes, he could specify two neighboring sizes — this means that any of these two sizes suits him.
Write a program that will determine whether it is possible to present a t-shirt to each participant of the competition, or not. Of course, each participant should get a t-shirt of proper size:
- the size he wanted, if he specified one size; - any of the two neibouring sizes, if he specified two sizes.
If it is possible, the program should find any valid distribution of the t-shirts.
Input Specification:
The first line of the input contains six non-negative integers — the number of t-shirts of each size. The numbers are given for the sizes S, M, L, XL, XXL, XXXL, respectively. The total number of t-shirts doesn't exceed 100<=000.
The second line contains positive integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of participants.
The following *n* lines contain the sizes specified by the participants, one line per participant. The *i*-th line contains information provided by the *i*-th participant: single size or two sizes separated by comma (without any spaces). If there are two sizes, the sizes are written in increasing order. It is guaranteed that two sizes separated by comma are neighboring.
Output Specification:
If it is not possible to present a t-shirt to each participant, print «NO» (without quotes).
Otherwise, print *n*<=+<=1 lines. In the first line print «YES» (without quotes). In the following *n* lines print the t-shirt sizes the orginizers should give to participants, one per line. The order of the participants should be the same as in the input.
If there are multiple solutions, print any of them.
Demo Input:
['0 1 0 1 1 0\n3\nXL\nS,M\nXL,XXL\n', '1 1 2 0 1 1\n5\nS\nM\nS,M\nXXL,XXXL\nXL,XXL\n']
Demo Output:
['YES\nXL\nM\nXXL\n', 'NO\n']
Note:
none
|
```python
from bisect import *
from collections import *
import sys
import io, os
import math
import random
from heapq import *
gcd = math.gcd
sqrt = math.sqrt
maxint=10**21
def ceil(a, b):
if(b==0):
return maxint
a = -a
k = a // b
k = -k
return k
# arr=list(map(int, input().split()))
# n,m=map(int,input().split())
input = io.BytesIO(os.read(0, os.fstat(0).st_size)).readline
def strinp(testcases):
k = 5
if (testcases == -1 or testcases == 1):
k = 1
f = str(input())
f = f[2:len(f) - k]
return f
def main():
dic={'S':'0','M':'1','L':'2','XL':'3','XXL':'4','XXXL':'5'}
arr=list(map(int, input().split()))
n=int(input())
lis=[0]*n
for i in range(n):
s=strinp(90).split(',')
if(len(s)==1):
lis[i]=[dic[s[0]],i]
else:
lis[i]=[dic[s[0]]+dic[s[1]],i]
lis.sort()
trig=False
ans=[0]*n
for i in range(n):
no=lis[i][1]
req=lis[i][0]
a=int(req[0])
b=int(req[-1])
if(arr[a]!=0):
ans[no]=a
arr[a]-=1
elif(a!=b and arr[b]!=0):
ans[no]=b
arr[b]-=1
else:
trig=True
break
if(trig):
print('NO')
return()
dic={0:'S',1:'M',2:'L',3:'XL',4:'XXL',5:'XXXL'}
print('YES')
for i in range(n):
print(dic[ans[i]])
main()
```
| 3
|
|
735
|
A
|
Ostap and Grasshopper
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
On the way to Rio de Janeiro Ostap kills time playing with a grasshopper he took with him in a special box. Ostap builds a line of length *n* such that some cells of this line are empty and some contain obstacles. Then, he places his grasshopper to one of the empty cells and a small insect in another empty cell. The grasshopper wants to eat the insect.
Ostap knows that grasshopper is able to jump to any empty cell that is exactly *k* cells away from the current (to the left or to the right). Note that it doesn't matter whether intermediate cells are empty or not as the grasshopper makes a jump over them. For example, if *k*<==<=1 the grasshopper can jump to a neighboring cell only, and if *k*<==<=2 the grasshopper can jump over a single cell.
Your goal is to determine whether there is a sequence of jumps such that grasshopper will get from his initial position to the cell with an insect.
|
The first line of the input contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=*n*<=-<=1) — the number of cells in the line and the length of one grasshopper's jump.
The second line contains a string of length *n* consisting of characters '.', '#', 'G' and 'T'. Character '.' means that the corresponding cell is empty, character '#' means that the corresponding cell contains an obstacle and grasshopper can't jump there. Character 'G' means that the grasshopper starts at this position and, finally, 'T' means that the target insect is located at this cell. It's guaranteed that characters 'G' and 'T' appear in this line exactly once.
|
If there exists a sequence of jumps (each jump of length *k*), such that the grasshopper can get from his initial position to the cell with the insect, print "YES" (without quotes) in the only line of the input. Otherwise, print "NO" (without quotes).
|
[
"5 2\n#G#T#\n",
"6 1\nT....G\n",
"7 3\nT..#..G\n",
"6 2\n..GT..\n"
] |
[
"YES\n",
"YES\n",
"NO\n",
"NO\n"
] |
In the first sample, the grasshopper can make one jump to the right in order to get from cell 2 to cell 4.
In the second sample, the grasshopper is only able to jump to neighboring cells but the way to the insect is free — he can get there by jumping left 5 times.
In the third sample, the grasshopper can't make a single jump.
In the fourth sample, the grasshopper can only jump to the cells with odd indices, thus he won't be able to reach the insect.
| 500
|
[
{
"input": "5 2\n#G#T#",
"output": "YES"
},
{
"input": "6 1\nT....G",
"output": "YES"
},
{
"input": "7 3\nT..#..G",
"output": "NO"
},
{
"input": "6 2\n..GT..",
"output": "NO"
},
{
"input": "2 1\nGT",
"output": "YES"
},
{
"input": "100 5\nG####.####.####.####.####.####.####.####.####.####.####.####.####.####.####.####.####.####.####T####",
"output": "YES"
},
{
"input": "100 5\nG####.####.####.####.####.####.####.####.####.####.####.####.####.#########.####.####.####.####T####",
"output": "NO"
},
{
"input": "2 1\nTG",
"output": "YES"
},
{
"input": "99 1\n...T.............................................................................................G.",
"output": "YES"
},
{
"input": "100 2\nG............#.....#...........#....#...........##............#............#......................T.",
"output": "NO"
},
{
"input": "100 1\n#.#.#.##..#..##.#....##.##.##.#....####..##.#.##..GT..##...###.#.##.#..#..##.###..#.####..#.#.##..##",
"output": "YES"
},
{
"input": "100 2\n..#####.#.#.......#.#.#...##..####..###..#.#######GT####.#.#...##...##.#..###....##.#.#..#.###....#.",
"output": "NO"
},
{
"input": "100 3\nG..................................................................................................T",
"output": "YES"
},
{
"input": "100 3\nG..................................................................................................T",
"output": "YES"
},
{
"input": "100 3\nG..................................#......#......#.......#.#..........#........#......#..........#.T",
"output": "NO"
},
{
"input": "100 3\nG..............#..........#...#..............#.#.....................#......#........#.........#...T",
"output": "NO"
},
{
"input": "100 3\nG##################################################################################################T",
"output": "NO"
},
{
"input": "100 33\nG..................................................................................................T",
"output": "YES"
},
{
"input": "100 33\nG..................................................................................................T",
"output": "YES"
},
{
"input": "100 33\nG.........#........#..........#..............#.................#............................#.#....T",
"output": "YES"
},
{
"input": "100 33\nG.......#..................#..............................#............................#..........T.",
"output": "NO"
},
{
"input": "100 33\nG#..........##...#.#.....................#.#.#.........##..#...........#....#...........##...#..###T",
"output": "YES"
},
{
"input": "100 33\nG..#.#..#..####......#......##...##...#.##........#...#...#.##....###..#...###..##.#.....#......#.T.",
"output": "NO"
},
{
"input": "100 33\nG#....#..#..##.##..#.##.#......#.#.##..##.#.#.##.##....#.#.....####..##...#....##..##..........#...T",
"output": "NO"
},
{
"input": "100 33\nG#######.#..##.##.#...#..#.###.#.##.##.#..#.###..####.##.#.##....####...##..####.#..##.##.##.#....#T",
"output": "NO"
},
{
"input": "100 33\nG#####.#.##.###########.##..##..#######..########..###.###..#.####.######.############..####..#####T",
"output": "NO"
},
{
"input": "100 99\nT..................................................................................................G",
"output": "YES"
},
{
"input": "100 99\nT..................................................................................................G",
"output": "YES"
},
{
"input": "100 99\nT.#...............................#............#..............................##...................G",
"output": "YES"
},
{
"input": "100 99\nT..#....#.##...##########.#.#.#.#...####..#.....#..##..#######.######..#.....###..###...#.......#.#G",
"output": "YES"
},
{
"input": "100 99\nG##################################################################################################T",
"output": "YES"
},
{
"input": "100 9\nT..................................................................................................G",
"output": "YES"
},
{
"input": "100 9\nT.................................................................................................G.",
"output": "NO"
},
{
"input": "100 9\nT................................................................................................G..",
"output": "NO"
},
{
"input": "100 1\nG..................................................................................................T",
"output": "YES"
},
{
"input": "100 1\nT..................................................................................................G",
"output": "YES"
},
{
"input": "100 1\n##########G.........T###############################################################################",
"output": "YES"
},
{
"input": "100 1\n#################################################################################################G.T",
"output": "YES"
},
{
"input": "100 17\n##########G################.################.################.################T#####################",
"output": "YES"
},
{
"input": "100 17\n####.#..#.G######.#########.##..##########.#.################.################T######.####.#########",
"output": "YES"
},
{
"input": "100 17\n.########.G##.####.#.######.###############..#.###########.##.#####.##.#####.#T.###..###.########.##",
"output": "YES"
},
{
"input": "100 1\nG.............................................#....................................................T",
"output": "NO"
},
{
"input": "100 1\nT.#................................................................................................G",
"output": "NO"
},
{
"input": "100 1\n##########G....#....T###############################################################################",
"output": "NO"
},
{
"input": "100 1\n#################################################################################################G#T",
"output": "NO"
},
{
"input": "100 17\nG################.#################################.################T###############################",
"output": "NO"
},
{
"input": "100 17\nG################.###############..###.######.#######.###.#######.##T######################.###.####",
"output": "NO"
},
{
"input": "100 17\nG####.##.##.#####.####....##.####.#########.##.#..#.###############.T############.#########.#.####.#",
"output": "NO"
},
{
"input": "48 1\nT..............................................G",
"output": "YES"
},
{
"input": "23 1\nT.....................G",
"output": "YES"
},
{
"input": "49 1\nG...............................................T",
"output": "YES"
},
{
"input": "3 1\nTG#",
"output": "YES"
},
{
"input": "6 2\n..TG..",
"output": "NO"
},
{
"input": "14 3\n...G.....#..T.",
"output": "NO"
},
{
"input": "5 4\n##GT#",
"output": "NO"
},
{
"input": "6 2\nT#..G.",
"output": "YES"
},
{
"input": "5 2\nT.G.#",
"output": "YES"
},
{
"input": "6 1\nT...G#",
"output": "YES"
},
{
"input": "5 1\nTG###",
"output": "YES"
},
{
"input": "5 4\n.G..T",
"output": "NO"
},
{
"input": "7 2\nT#...#G",
"output": "YES"
},
{
"input": "7 1\n##TG###",
"output": "YES"
},
{
"input": "7 1\n###GT##",
"output": "YES"
},
{
"input": "5 2\nG..T.",
"output": "NO"
},
{
"input": "5 1\nG.T##",
"output": "YES"
},
{
"input": "6 2\nG.T###",
"output": "YES"
},
{
"input": "6 2\nG#T###",
"output": "YES"
},
{
"input": "10 2\n####T..G..",
"output": "NO"
},
{
"input": "3 1\nGT#",
"output": "YES"
},
{
"input": "4 1\nTG##",
"output": "YES"
},
{
"input": "6 1\n.G..T.",
"output": "YES"
},
{
"input": "10 3\n......G..T",
"output": "YES"
},
{
"input": "3 2\nG.T",
"output": "YES"
},
{
"input": "4 1\n#G.T",
"output": "YES"
},
{
"input": "5 2\nT#G##",
"output": "YES"
},
{
"input": "4 2\nG#.T",
"output": "NO"
},
{
"input": "4 1\nGT##",
"output": "YES"
}
] | 1,485,083,652
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 83
| 109
| 4,608,000
|
def solve(s, k):
i = min(s.index('G'), s.index('T')) + k
while i < len(s):
if s[i] == '#': return "NO"
if s[i] in ['G', 'T']: return "YES"
i += k
return "NO"
n, k = map(int, input().split())
print(solve(input(), k))
|
Title: Ostap and Grasshopper
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
On the way to Rio de Janeiro Ostap kills time playing with a grasshopper he took with him in a special box. Ostap builds a line of length *n* such that some cells of this line are empty and some contain obstacles. Then, he places his grasshopper to one of the empty cells and a small insect in another empty cell. The grasshopper wants to eat the insect.
Ostap knows that grasshopper is able to jump to any empty cell that is exactly *k* cells away from the current (to the left or to the right). Note that it doesn't matter whether intermediate cells are empty or not as the grasshopper makes a jump over them. For example, if *k*<==<=1 the grasshopper can jump to a neighboring cell only, and if *k*<==<=2 the grasshopper can jump over a single cell.
Your goal is to determine whether there is a sequence of jumps such that grasshopper will get from his initial position to the cell with an insect.
Input Specification:
The first line of the input contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=*n*<=-<=1) — the number of cells in the line and the length of one grasshopper's jump.
The second line contains a string of length *n* consisting of characters '.', '#', 'G' and 'T'. Character '.' means that the corresponding cell is empty, character '#' means that the corresponding cell contains an obstacle and grasshopper can't jump there. Character 'G' means that the grasshopper starts at this position and, finally, 'T' means that the target insect is located at this cell. It's guaranteed that characters 'G' and 'T' appear in this line exactly once.
Output Specification:
If there exists a sequence of jumps (each jump of length *k*), such that the grasshopper can get from his initial position to the cell with the insect, print "YES" (without quotes) in the only line of the input. Otherwise, print "NO" (without quotes).
Demo Input:
['5 2\n#G#T#\n', '6 1\nT....G\n', '7 3\nT..#..G\n', '6 2\n..GT..\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n', 'NO\n']
Note:
In the first sample, the grasshopper can make one jump to the right in order to get from cell 2 to cell 4.
In the second sample, the grasshopper is only able to jump to neighboring cells but the way to the insect is free — he can get there by jumping left 5 times.
In the third sample, the grasshopper can't make a single jump.
In the fourth sample, the grasshopper can only jump to the cells with odd indices, thus he won't be able to reach the insect.
|
```python
def solve(s, k):
i = min(s.index('G'), s.index('T')) + k
while i < len(s):
if s[i] == '#': return "NO"
if s[i] in ['G', 'T']: return "YES"
i += k
return "NO"
n, k = map(int, input().split())
print(solve(input(), k))
```
| 3
|
|
55
|
B
|
Smallest number
|
PROGRAMMING
| 1,600
|
[
"brute force"
] |
B. Smallest number
|
2
|
256
|
Recently, Vladimir got bad mark in algebra again. To avoid such unpleasant events in future he decided to train his arithmetic skills. He wrote four integer numbers *a*, *b*, *c*, *d* on the blackboard. During each of the next three minutes he took two numbers from the blackboard (not necessarily adjacent) and replaced them with their sum or their product. In the end he got one number. Unfortunately, due to the awful memory he forgot that number, but he remembers four original numbers, sequence of the operations and his surprise because of the very small result. Help Vladimir remember the forgotten number: find the smallest number that can be obtained from the original numbers by the given sequence of operations.
|
First line contains four integers separated by space: 0<=≤<=*a*,<=*b*,<=*c*,<=*d*<=≤<=1000 — the original numbers. Second line contains three signs ('+' or '*' each) separated by space — the sequence of the operations in the order of performing. ('+' stands for addition, '*' — multiplication)
|
Output one integer number — the minimal result which can be obtained.
Please, do not use %lld specificator to read or write 64-bit integers in C++. It is preffered to use cin (also you may use %I64d).
|
[
"1 1 1 1\n+ + *\n",
"2 2 2 2\n* * +\n",
"1 2 3 4\n* + +\n"
] |
[
"3\n",
"8\n",
"9\n"
] |
none
| 1,000
|
[
{
"input": "1 1 1 1\n+ + *",
"output": "3"
},
{
"input": "2 2 2 2\n* * +",
"output": "8"
},
{
"input": "1 2 3 4\n* + +",
"output": "9"
},
{
"input": "15 1 3 1\n* * +",
"output": "18"
},
{
"input": "8 1 7 14\n+ + +",
"output": "30"
},
{
"input": "7 17 3 25\n+ * +",
"output": "63"
},
{
"input": "13 87 4 17\n* * *",
"output": "76908"
},
{
"input": "7 0 8 15\n+ + *",
"output": "0"
},
{
"input": "52 0 43 239\n+ + +",
"output": "334"
},
{
"input": "1000 1000 999 1000\n* * *",
"output": "999000000000"
},
{
"input": "720 903 589 804\n* * *",
"output": "307887168960"
},
{
"input": "631 149 496 892\n* * +",
"output": "445884"
},
{
"input": "220 127 597 394\n* + +",
"output": "28931"
},
{
"input": "214 862 466 795\n+ + +",
"output": "2337"
},
{
"input": "346 290 587 525\n* * *",
"output": "30922279500"
},
{
"input": "323 771 559 347\n+ * *",
"output": "149067730"
},
{
"input": "633 941 836 254\n* + +",
"output": "162559"
},
{
"input": "735 111 769 553\n+ * *",
"output": "92320032"
},
{
"input": "622 919 896 120\n* * +",
"output": "667592"
},
{
"input": "652 651 142 661\n+ + +",
"output": "2106"
},
{
"input": "450 457 975 35\n* * *",
"output": "7017806250"
},
{
"input": "883 954 804 352\n* * +",
"output": "1045740"
},
{
"input": "847 206 949 358\n* + *",
"output": "62660050"
},
{
"input": "663 163 339 76\n+ + +",
"output": "1241"
},
{
"input": "990 330 253 553\n+ * +",
"output": "85033"
},
{
"input": "179 346 525 784\n* * *",
"output": "25492034400"
},
{
"input": "780 418 829 778\n+ + *",
"output": "997766"
},
{
"input": "573 598 791 124\n* * *",
"output": "33608874936"
},
{
"input": "112 823 202 223\n* * +",
"output": "137222"
},
{
"input": "901 166 994 315\n* + *",
"output": "47278294"
},
{
"input": "393 342 840 486\n+ * *",
"output": "178222356"
},
{
"input": "609 275 153 598\n+ + *",
"output": "226746"
},
{
"input": "56 828 386 57\n+ * *",
"output": "3875088"
},
{
"input": "944 398 288 986\n+ + *",
"output": "670464"
},
{
"input": "544 177 162 21\n+ + *",
"output": "18543"
},
{
"input": "105 238 316 265\n+ + +",
"output": "924"
},
{
"input": "31 353 300 911\n* * *",
"output": "2990721900"
},
{
"input": "46 378 310 194\n* * +",
"output": "77528"
},
{
"input": "702 534 357 657\n+ * *",
"output": "259077042"
},
{
"input": "492 596 219 470\n+ + *",
"output": "341202"
},
{
"input": "482 842 982 902\n+ * +",
"output": "407728"
},
{
"input": "827 578 394 351\n* * *",
"output": "66105361764"
},
{
"input": "901 884 426 451\n* + *",
"output": "170223210"
},
{
"input": "210 295 12 795\n* * +",
"output": "71490"
},
{
"input": "40 734 948 202\n+ * *",
"output": "13590560"
},
{
"input": "136 611 963 195\n+ + *",
"output": "240584"
},
{
"input": "695 74 871 760\n+ * +",
"output": "53061"
},
{
"input": "666 884 772 54\n* + +",
"output": "37620"
},
{
"input": "975 785 753 224\n+ * +",
"output": "170432"
},
{
"input": "35 187 126 596\n+ + +",
"output": "944"
},
{
"input": "243 386 431 35\n* + *",
"output": "3298015"
},
{
"input": "229 602 133 635\n* * +",
"output": "222313"
},
{
"input": "916 207 238 891\n+ + *",
"output": "423315"
},
{
"input": "922 145 883 357\n+ + *",
"output": "313490"
},
{
"input": "69 355 762 111\n* + +",
"output": "8776"
},
{
"input": "209 206 34 67\n* + *",
"output": "476374"
},
{
"input": "693 824 375 361\n* * +",
"output": "557339"
},
{
"input": "45 712 635 467\n* + +",
"output": "22362"
},
{
"input": "426 283 179 211\n+ + +",
"output": "1099"
},
{
"input": "802 387 686 12\n+ + +",
"output": "1887"
}
] | 1,667,125,294
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 122
| 0
|
l = [int(i) for i in input().split()]
o = [i for i in input().split()]
def smallnumber(l,o):
if(len(l)<=1 or len(o)<1):
return l[0]
if(o[0] == "+"):
res = l[0]+l[1]
l2 = l[2:]
l2.append(res)
o2 = o[1:]
#print(l2,o2)
result = smallnumber(l2,o2)
else:
res = l[0]*l[1]
l2 = l[2:]
l2.append(res)
o2 = o[1:]
#print(l2,o2)
result = smallnumber(l2,o2)
return result
print(smallnumber(l,o))
|
Title: Smallest number
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Recently, Vladimir got bad mark in algebra again. To avoid such unpleasant events in future he decided to train his arithmetic skills. He wrote four integer numbers *a*, *b*, *c*, *d* on the blackboard. During each of the next three minutes he took two numbers from the blackboard (not necessarily adjacent) and replaced them with their sum or their product. In the end he got one number. Unfortunately, due to the awful memory he forgot that number, but he remembers four original numbers, sequence of the operations and his surprise because of the very small result. Help Vladimir remember the forgotten number: find the smallest number that can be obtained from the original numbers by the given sequence of operations.
Input Specification:
First line contains four integers separated by space: 0<=≤<=*a*,<=*b*,<=*c*,<=*d*<=≤<=1000 — the original numbers. Second line contains three signs ('+' or '*' each) separated by space — the sequence of the operations in the order of performing. ('+' stands for addition, '*' — multiplication)
Output Specification:
Output one integer number — the minimal result which can be obtained.
Please, do not use %lld specificator to read or write 64-bit integers in C++. It is preffered to use cin (also you may use %I64d).
Demo Input:
['1 1 1 1\n+ + *\n', '2 2 2 2\n* * +\n', '1 2 3 4\n* + +\n']
Demo Output:
['3\n', '8\n', '9\n']
Note:
none
|
```python
l = [int(i) for i in input().split()]
o = [i for i in input().split()]
def smallnumber(l,o):
if(len(l)<=1 or len(o)<1):
return l[0]
if(o[0] == "+"):
res = l[0]+l[1]
l2 = l[2:]
l2.append(res)
o2 = o[1:]
#print(l2,o2)
result = smallnumber(l2,o2)
else:
res = l[0]*l[1]
l2 = l[2:]
l2.append(res)
o2 = o[1:]
#print(l2,o2)
result = smallnumber(l2,o2)
return result
print(smallnumber(l,o))
```
| 0
|
979
|
A
|
Pizza, Pizza, Pizza!!!
|
PROGRAMMING
| 1,000
|
[
"math"
] | null | null |
Katie, Kuro and Shiro are best friends. They have known each other since kindergarten. That's why they often share everything with each other and work together on some very hard problems.
Today is Shiro's birthday. She really loves pizza so she wants to invite her friends to the pizza restaurant near her house to celebrate her birthday, including her best friends Katie and Kuro.
She has ordered a very big round pizza, in order to serve her many friends. Exactly $n$ of Shiro's friends are here. That's why she has to divide the pizza into $n + 1$ slices (Shiro also needs to eat). She wants the slices to be exactly the same size and shape. If not, some of her friends will get mad and go home early, and the party will be over.
Shiro is now hungry. She wants to cut the pizza with minimum of straight cuts. A cut is a straight segment, it might have ends inside or outside the pizza. But she is too lazy to pick up the calculator.
As usual, she will ask Katie and Kuro for help. But they haven't come yet. Could you help Shiro with this problem?
|
A single line contains one non-negative integer $n$ ($0 \le n \leq 10^{18}$) — the number of Shiro's friends. The circular pizza has to be sliced into $n + 1$ pieces.
|
A single integer — the number of straight cuts Shiro needs.
|
[
"3\n",
"4\n"
] |
[
"2",
"5"
] |
To cut the round pizza into quarters one has to make two cuts through the center with angle $90^{\circ}$ between them.
To cut the round pizza into five equal parts one has to make five cuts.
| 500
|
[
{
"input": "3",
"output": "2"
},
{
"input": "4",
"output": "5"
},
{
"input": "10",
"output": "11"
},
{
"input": "10000000000",
"output": "10000000001"
},
{
"input": "1234567891",
"output": "617283946"
},
{
"input": "7509213957",
"output": "3754606979"
},
{
"input": "99999999999999999",
"output": "50000000000000000"
},
{
"input": "21",
"output": "11"
},
{
"input": "712394453192",
"output": "712394453193"
},
{
"input": "172212168",
"output": "172212169"
},
{
"input": "822981260158260519",
"output": "411490630079130260"
},
{
"input": "28316250877914571",
"output": "14158125438957286"
},
{
"input": "779547116602436424",
"output": "779547116602436425"
},
{
"input": "578223540024979436",
"output": "578223540024979437"
},
{
"input": "335408917861648766",
"output": "335408917861648767"
},
{
"input": "74859962623690078",
"output": "74859962623690079"
},
{
"input": "252509054433933439",
"output": "126254527216966720"
},
{
"input": "760713016476190622",
"output": "760713016476190623"
},
{
"input": "919845426262703496",
"output": "919845426262703497"
},
{
"input": "585335723211047194",
"output": "585335723211047195"
},
{
"input": "522842184971407769",
"output": "261421092485703885"
},
{
"input": "148049062628894320",
"output": "148049062628894321"
},
{
"input": "84324828731963974",
"output": "84324828731963975"
},
{
"input": "354979173822804781",
"output": "177489586911402391"
},
{
"input": "1312150450968413",
"output": "656075225484207"
},
{
"input": "269587449430302150",
"output": "269587449430302151"
},
{
"input": "645762258982631926",
"output": "645762258982631927"
},
{
"input": "615812229161735895",
"output": "307906114580867948"
},
{
"input": "0",
"output": "0"
},
{
"input": "349993004923078531",
"output": "174996502461539266"
},
{
"input": "891351282707723851",
"output": "445675641353861926"
},
{
"input": "563324731189330734",
"output": "563324731189330735"
},
{
"input": "520974001910286909",
"output": "260487000955143455"
},
{
"input": "666729339802329204",
"output": "666729339802329205"
},
{
"input": "856674611404539671",
"output": "428337305702269836"
},
{
"input": "791809296303238499",
"output": "395904648151619250"
},
{
"input": "711066337317063338",
"output": "711066337317063339"
},
{
"input": "931356503492686566",
"output": "931356503492686567"
},
{
"input": "234122432773361866",
"output": "234122432773361867"
},
{
"input": "1000000000000000000",
"output": "1000000000000000001"
},
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "3"
},
{
"input": "7",
"output": "4"
},
{
"input": "63",
"output": "32"
},
{
"input": "24",
"output": "25"
},
{
"input": "8",
"output": "9"
},
{
"input": "15",
"output": "8"
}
] | 1,699,863,802
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 46
| 0
|
n = int(input())
n+=1
if(n==1):
print(0)
elif(n%2==0):
print(n//2)
else:
print(n)
|
Title: Pizza, Pizza, Pizza!!!
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Katie, Kuro and Shiro are best friends. They have known each other since kindergarten. That's why they often share everything with each other and work together on some very hard problems.
Today is Shiro's birthday. She really loves pizza so she wants to invite her friends to the pizza restaurant near her house to celebrate her birthday, including her best friends Katie and Kuro.
She has ordered a very big round pizza, in order to serve her many friends. Exactly $n$ of Shiro's friends are here. That's why she has to divide the pizza into $n + 1$ slices (Shiro also needs to eat). She wants the slices to be exactly the same size and shape. If not, some of her friends will get mad and go home early, and the party will be over.
Shiro is now hungry. She wants to cut the pizza with minimum of straight cuts. A cut is a straight segment, it might have ends inside or outside the pizza. But she is too lazy to pick up the calculator.
As usual, she will ask Katie and Kuro for help. But they haven't come yet. Could you help Shiro with this problem?
Input Specification:
A single line contains one non-negative integer $n$ ($0 \le n \leq 10^{18}$) — the number of Shiro's friends. The circular pizza has to be sliced into $n + 1$ pieces.
Output Specification:
A single integer — the number of straight cuts Shiro needs.
Demo Input:
['3\n', '4\n']
Demo Output:
['2', '5']
Note:
To cut the round pizza into quarters one has to make two cuts through the center with angle $90^{\circ}$ between them.
To cut the round pizza into five equal parts one has to make five cuts.
|
```python
n = int(input())
n+=1
if(n==1):
print(0)
elif(n%2==0):
print(n//2)
else:
print(n)
```
| 3
|
|
264
|
B
|
Good Sequences
|
PROGRAMMING
| 1,500
|
[
"dp",
"number theory"
] | null | null |
Squirrel Liss is interested in sequences. She also has preferences of integers. She thinks *n* integers *a*1,<=*a*2,<=...,<=*a**n* are good.
Now she is interested in good sequences. A sequence *x*1,<=*x*2,<=...,<=*x**k* is called good if it satisfies the following three conditions:
- The sequence is strictly increasing, i.e. *x**i*<=<<=*x**i*<=+<=1 for each *i* (1<=≤<=*i*<=≤<=*k*<=-<=1). - No two adjacent elements are coprime, i.e. *gcd*(*x**i*,<=*x**i*<=+<=1)<=><=1 for each *i* (1<=≤<=*i*<=≤<=*k*<=-<=1) (where *gcd*(*p*,<=*q*) denotes the greatest common divisor of the integers *p* and *q*). - All elements of the sequence are good integers.
Find the length of the longest good sequence.
|
The input consists of two lines. The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of good integers. The second line contains a single-space separated list of good integers *a*1,<=*a*2,<=...,<=*a**n* in strictly increasing order (1<=≤<=*a**i*<=≤<=105; *a**i*<=<<=*a**i*<=+<=1).
|
Print a single integer — the length of the longest good sequence.
|
[
"5\n2 3 4 6 9\n",
"9\n1 2 3 5 6 7 8 9 10\n"
] |
[
"4\n",
"4\n"
] |
In the first example, the following sequences are examples of good sequences: [2; 4; 6; 9], [2; 4; 6], [3; 9], [6]. The length of the longest good sequence is 4.
| 1,000
|
[
{
"input": "5\n2 3 4 6 9",
"output": "4"
},
{
"input": "9\n1 2 3 5 6 7 8 9 10",
"output": "4"
},
{
"input": "4\n1 2 4 6",
"output": "3"
},
{
"input": "7\n1 2 3 4 7 9 10",
"output": "3"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "8\n3 4 5 6 7 8 9 10",
"output": "4"
},
{
"input": "5\n2 3 7 9 10",
"output": "2"
},
{
"input": "3\n1 4 7",
"output": "1"
},
{
"input": "1\n4",
"output": "1"
},
{
"input": "9\n1 2 3 4 5 6 7 9 10",
"output": "4"
},
{
"input": "49\n10 34 58 72 126 166 176 180 198 200 208 228 238 248 302 332 340 344 350 354 380 406 418 428 438 442 482 532 536 544 546 554 596 626 642 682 684 704 714 792 804 820 862 880 906 946 954 966 970",
"output": "49"
},
{
"input": "44\n1 5 37 97 107 147 185 187 195 241 249 295 311 323 341 345 363 391 425 431 473 525 539 541 555 577 595 611 647 695 757 759 775 779 869 877 927 935 963 965 967 969 973 975",
"output": "15"
},
{
"input": "3\n21 67 243",
"output": "2"
},
{
"input": "3\n150 358 382",
"output": "3"
},
{
"input": "10\n13 2187 2197 4567 5200 29873 67866 98798 99999 100000",
"output": "6"
},
{
"input": "10\n1 2 4 8 16 32 33 64 128 256",
"output": "8"
},
{
"input": "10\n2 4 8 67 128 324 789 1296 39877 98383",
"output": "7"
},
{
"input": "10\n2 3 4 5 6 8 9 10 17 92",
"output": "6"
},
{
"input": "10\n2 3 10 40 478 3877 28787 88888 99999 100000",
"output": "6"
},
{
"input": "10\n2 3 45 67 89 101 234 567 890 1234",
"output": "5"
},
{
"input": "10\n2 3 4 5 6 7 8 9 10 11",
"output": "5"
},
{
"input": "2\n5101 10202",
"output": "2"
},
{
"input": "1\n99991",
"output": "1"
},
{
"input": "2\n1009 2018",
"output": "2"
},
{
"input": "2\n601 1202",
"output": "2"
},
{
"input": "3\n3 14 22",
"output": "2"
}
] | 1,626,664,174
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 38
| 684
| 31,948,800
|
n=int(input())
a=list(map(int, input().split(" ")))
if(a==[1]*n):
print(1)
else:
primes=[True for i in range(401)]
primes[0]=False
primes[1]=False
for k in range(1, 401):
if(primes[k]==True):
for pro in range(k*k, 401, k):
primes[pro]=False
mine=[]
for k in range(401):
if(primes[k]):
mine.append(k)
d=[0 for i in range(100001)]
dp=[0 for i in range(n)]
for k in range(n):
al=a[k]
for prime in mine:
if(al%prime==0):
dp[k]=max(d[prime]+1, dp[k])
while(al%prime==0):
al//=prime
for prime in mine:
if(a[k]%prime==0):
d[prime]=max(d[prime], dp[k])
if(al!=1):
dp[k]=max(d[al]+1, dp[k])
d[al]=dp[k]
print(dp[n-1])
|
Title: Good Sequences
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Squirrel Liss is interested in sequences. She also has preferences of integers. She thinks *n* integers *a*1,<=*a*2,<=...,<=*a**n* are good.
Now she is interested in good sequences. A sequence *x*1,<=*x*2,<=...,<=*x**k* is called good if it satisfies the following three conditions:
- The sequence is strictly increasing, i.e. *x**i*<=<<=*x**i*<=+<=1 for each *i* (1<=≤<=*i*<=≤<=*k*<=-<=1). - No two adjacent elements are coprime, i.e. *gcd*(*x**i*,<=*x**i*<=+<=1)<=><=1 for each *i* (1<=≤<=*i*<=≤<=*k*<=-<=1) (where *gcd*(*p*,<=*q*) denotes the greatest common divisor of the integers *p* and *q*). - All elements of the sequence are good integers.
Find the length of the longest good sequence.
Input Specification:
The input consists of two lines. The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of good integers. The second line contains a single-space separated list of good integers *a*1,<=*a*2,<=...,<=*a**n* in strictly increasing order (1<=≤<=*a**i*<=≤<=105; *a**i*<=<<=*a**i*<=+<=1).
Output Specification:
Print a single integer — the length of the longest good sequence.
Demo Input:
['5\n2 3 4 6 9\n', '9\n1 2 3 5 6 7 8 9 10\n']
Demo Output:
['4\n', '4\n']
Note:
In the first example, the following sequences are examples of good sequences: [2; 4; 6; 9], [2; 4; 6], [3; 9], [6]. The length of the longest good sequence is 4.
|
```python
n=int(input())
a=list(map(int, input().split(" ")))
if(a==[1]*n):
print(1)
else:
primes=[True for i in range(401)]
primes[0]=False
primes[1]=False
for k in range(1, 401):
if(primes[k]==True):
for pro in range(k*k, 401, k):
primes[pro]=False
mine=[]
for k in range(401):
if(primes[k]):
mine.append(k)
d=[0 for i in range(100001)]
dp=[0 for i in range(n)]
for k in range(n):
al=a[k]
for prime in mine:
if(al%prime==0):
dp[k]=max(d[prime]+1, dp[k])
while(al%prime==0):
al//=prime
for prime in mine:
if(a[k]%prime==0):
d[prime]=max(d[prime], dp[k])
if(al!=1):
dp[k]=max(d[al]+1, dp[k])
d[al]=dp[k]
print(dp[n-1])
```
| 0
|
|
731
|
A
|
Night at the Museum
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
|
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
|
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
|
[
"zeus\n",
"map\n",
"ares\n"
] |
[
"18\n",
"35\n",
"34\n"
] |
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
| 500
|
[
{
"input": "zeus",
"output": "18"
},
{
"input": "map",
"output": "35"
},
{
"input": "ares",
"output": "34"
},
{
"input": "l",
"output": "11"
},
{
"input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv",
"output": "99"
},
{
"input": "gngvi",
"output": "44"
},
{
"input": "aaaaa",
"output": "0"
},
{
"input": "a",
"output": "0"
},
{
"input": "z",
"output": "1"
},
{
"input": "vyadeehhikklnoqrs",
"output": "28"
},
{
"input": "jjiihhhhgggfedcccbazyxx",
"output": "21"
},
{
"input": "fyyptqqxuciqvwdewyppjdzur",
"output": "117"
},
{
"input": "fqcnzmzmbobmancqcoalzmanaobpdse",
"output": "368"
},
{
"input": "zzzzzaaaaaaazzzzzzaaaaaaazzzzzzaaaazzzza",
"output": "8"
},
{
"input": "aucnwhfixuruefkypvrvnvznwtjgwlghoqtisbkhuwxmgzuljvqhmnwzisnsgjhivnjmbknptxatdkelhzkhsuxzrmlcpeoyukiy",
"output": "644"
},
{
"input": "sssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss",
"output": "8"
},
{
"input": "nypjygrdtpzpigzyrisqeqfriwgwlengnezppgttgtndbrryjdl",
"output": "421"
},
{
"input": "pnllnnmmmmoqqqqqrrtssssuuvtsrpopqoonllmonnnpppopnonoopooqpnopppqppqstuuuwwwwvxzxzzaa",
"output": "84"
},
{
"input": "btaoahqgxnfsdmzsjxgvdwjukcvereqeskrdufqfqgzqfsftdqcthtkcnaipftcnco",
"output": "666"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeerrrrrrrrrrrrrrrrwwwwwwwwww",
"output": "22"
},
{
"input": "uyknzcrwjyzmscqucclvacmorepdgmnyhmakmmnygqwglrxkxhkpansbmruwxdeoprxzmpsvwackopujxbbkpwyeggsvjykpxh",
"output": "643"
},
{
"input": "gzwpooohffcxwtpjgfzwtooiccxsrrokezutoojdzwsrmmhecaxwrojcbyrqlfdwwrliiib",
"output": "245"
},
{
"input": "dbvnkktasjdwqsrzfwwtmjgbcxggdxsoeilecihduypktkkbwfbruxzzhlttrssicgdwqruddwrlbtxgmhdbatzvdxbbro",
"output": "468"
},
{
"input": "mdtvowlktxzzbuaeiuebfeorgbdczauxsovbucactkvyvemsknsjfhifqgycqredzchipmkvzbxdjkcbyukomjlzvxzoswumned",
"output": "523"
},
{
"input": "kkkkkkkaaaaxxaaaaaaaxxxxxxxxaaaaaaxaaaaaaaaaakkkkkkkkkaaaaaaannnnnxxxxkkkkkkkkaannnnnnna",
"output": "130"
},
{
"input": "dffiknqqrsvwzcdgjkmpqtuwxadfhkkkmpqrtwxyadfggjmpppsuuwyyzcdgghhknnpsvvvwwwyabccffiloqruwwyyzabeeehh",
"output": "163"
},
{
"input": "qpppmmkjihgecbyvvsppnnnkjiffeebaaywutrrqpmkjhgddbzzzywtssssqnmmljheddbbaxvusrqonmlifedbbzyywwtqnkheb",
"output": "155"
},
{
"input": "wvvwwwvvwxxxyyyxxwwvwwvuttttttuvvwxxwxxyxxwwwwwvvuttssrssstsssssrqpqqppqrssrsrrssrssssrrsrqqrrqpppqp",
"output": "57"
},
{
"input": "dqcpcobpcobnznamznamzlykxkxlxlylzmaobnaobpbnanbpcoaobnboaoboanzlymzmykylymylzlylymanboanaocqdqesfrfs",
"output": "1236"
},
{
"input": "nnnnnnnnnnnnnnnnnnnnaaaaaaaaaaaaaaaaaaaakkkkkkkkkkkkkkkkkkkkkkaaaaaaaaaaaaaaaaaaaaxxxxxxxxxxxxxxxxxx",
"output": "49"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "cgilqsuwzaffilptwwbgmnttyyejkorxzflqvzbddhmnrvxchijpuwaeiimosxyycejlpquuwbfkpvbgijkqvxybdjjjptxcfkqt",
"output": "331"
},
{
"input": "ufsepwgtzgtgjssxaitgpailuvgqweoppszjwhoxdhhhpwwdorwfrdjwcdekxiktwziqwbkvbknrtvajpyeqbjvhiikxxaejjpte",
"output": "692"
},
{
"input": "uhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuh",
"output": "1293"
},
{
"input": "vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvgggggggggggggggggggggggggggggggggggggggggggggggggg",
"output": "16"
},
{
"input": "lyidmjyzbszgiwkxhhpnnthfwcvvstueionspfrvqgkvngmwyhezlosrpdnbvtcjjxxsykixwnepbumaacdzadlqhnjlcejovple",
"output": "616"
},
{
"input": "etzqqbaveffalkdguunfmyyrzkccnxmlluxeasqmopxzfvlkbhipqdwjgrttoemruohgwukfisdhznqyvhswbbypoxgtxyappcrl",
"output": "605"
},
{
"input": "lizussgedcbdjhrbeskhgatyozvwwekanlggcstijrniivupmcoofbaxfqrxddyzzptwxcftlhajsmmkkriarrqtkoauhcqefyud",
"output": "549"
},
{
"input": "dvjuvgfdogpknmbowlsfjzcimnygbtjiucyeeroqwhmzwpjqxlbjkqawrdtmvxbiqufllfuqibxvmtdrwaqkjblxqjpwzmhwqore",
"output": "688"
},
{
"input": "eeycuijtbgynmiczjfslwobmnkpgodfgvujvduyfeqchuaoktqrrairkkmmsjahltfcxwtpzzyddxrqfxabfoocmpuviinrjitsc",
"output": "604"
},
{
"input": "cgglnakewwvzoytaghksebrhjdbcdegssuzilrcppayxtgxopybbwshvyqnzhdsifkuwghourmeottrgjwdqpihbklvfzxpomqsa",
"output": "572"
},
{
"input": "aexullmxncckzryymfnuugdklaffevabqqztelpvojecljnhqldazdcaamubpenwxikysxxjjctvbndprsolzehywmgnvkgqvrfp",
"output": "609"
},
{
"input": "psnoieutsvvcwfhtnnphhxkwigzsbzyjmdiyl",
"output": "223"
},
{
"input": "aa",
"output": "0"
}
] | 1,652,555,024
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 0
| 93
| 3,379,200
|
n = int(input())
print(n)
for i in range(0, n):
print(1, end=" ")
|
Title: Night at the Museum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
Input Specification:
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
Output Specification:
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
Demo Input:
['zeus\n', 'map\n', 'ares\n']
Demo Output:
['18\n', '35\n', '34\n']
Note:
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
|
```python
n = int(input())
print(n)
for i in range(0, n):
print(1, end=" ")
```
| -1
|
|
471
|
A
|
MUH and Sticks
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
Two polar bears Menshykov and Uslada from the St.Petersburg zoo and elephant Horace from the Kiev zoo got six sticks to play with and assess the animals' creativity. Menshykov, Uslada and Horace decided to make either an elephant or a bear from those sticks. They can make an animal from sticks in the following way:
- Four sticks represent the animal's legs, these sticks should have the same length. - Two remaining sticks represent the animal's head and body. The bear's head stick must be shorter than the body stick. The elephant, however, has a long trunk, so his head stick must be as long as the body stick. Note that there are no limits on the relations between the leg sticks and the head and body sticks.
Your task is to find out which animal can be made from the given stick set. The zoo keeper wants the sticks back after the game, so they must never be broken, even bears understand it.
|
The single line contains six space-separated integers *l**i* (1<=≤<=*l**i*<=≤<=9) — the lengths of the six sticks. It is guaranteed that the input is such that you cannot make both animals from the sticks.
|
If you can make a bear from the given set, print string "Bear" (without the quotes). If you can make an elephant, print string "Elephant" (wıthout the quotes). If you can make neither a bear nor an elephant, print string "Alien" (without the quotes).
|
[
"4 2 5 4 4 4\n",
"4 4 5 4 4 5\n",
"1 2 3 4 5 6\n"
] |
[
"Bear",
"Elephant",
"Alien"
] |
If you're out of creative ideas, see instructions below which show how to make a bear and an elephant in the first two samples. The stick of length 2 is in red, the sticks of length 4 are in green, the sticks of length 5 are in blue.
| 500
|
[
{
"input": "4 2 5 4 4 4",
"output": "Bear"
},
{
"input": "4 4 5 4 4 5",
"output": "Elephant"
},
{
"input": "1 2 3 4 5 6",
"output": "Alien"
},
{
"input": "5 5 5 5 5 5",
"output": "Elephant"
},
{
"input": "1 1 1 2 3 5",
"output": "Alien"
},
{
"input": "1 1 1 1 1 1",
"output": "Elephant"
},
{
"input": "9 9 9 9 9 9",
"output": "Elephant"
},
{
"input": "1 8 9 1 1 1",
"output": "Bear"
},
{
"input": "9 9 9 1 9 9",
"output": "Bear"
},
{
"input": "1 2 3 8 9 7",
"output": "Alien"
},
{
"input": "5 5 5 6 6 6",
"output": "Alien"
},
{
"input": "1 1 2 2 3 4",
"output": "Alien"
},
{
"input": "4 4 4 4 4 2",
"output": "Bear"
},
{
"input": "2 2 3 3 4 4",
"output": "Alien"
},
{
"input": "4 4 4 4 4 5",
"output": "Bear"
},
{
"input": "1 1 2 2 2 2",
"output": "Elephant"
},
{
"input": "1 2 5 5 5 5",
"output": "Bear"
},
{
"input": "4 4 2 2 2 2",
"output": "Elephant"
},
{
"input": "1 1 1 1 1 2",
"output": "Bear"
},
{
"input": "2 2 4 4 4 4",
"output": "Elephant"
},
{
"input": "4 4 4 4 4 3",
"output": "Bear"
},
{
"input": "4 4 5 6 7 8",
"output": "Alien"
},
{
"input": "4 4 4 4 2 2",
"output": "Elephant"
},
{
"input": "1 1 1 1 2 2",
"output": "Elephant"
},
{
"input": "1 1 3 3 3 5",
"output": "Alien"
},
{
"input": "1 2 2 3 3 3",
"output": "Alien"
},
{
"input": "1 2 2 2 2 2",
"output": "Bear"
},
{
"input": "1 3 3 3 4 5",
"output": "Alien"
},
{
"input": "5 1 1 1 1 1",
"output": "Bear"
}
] | 1,413,332,061
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 3
| 46
| 0
|
def main():
x = [int(y) for y in input().split()] #Lectura de datos
x.sort()
rank = [0 for y in range(1,x[5]+2)]
patas = -1
r = []
for i in range(0,len(x)):
rank[x[i]]+=1
if(rank[x[i]] == 4):
patas=x[i]
if(patas != -1):
for i in range(0,len(rank)):
if(x[i]!=patas):
r.append(x[i])
r.sort()
if(r[0] == r[1]):
print("Elephant")
elif(r[0] < r[1]):
print("Bear")
else:
print("Alien")
else:
print("Alien")
main()
|
Title: MUH and Sticks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two polar bears Menshykov and Uslada from the St.Petersburg zoo and elephant Horace from the Kiev zoo got six sticks to play with and assess the animals' creativity. Menshykov, Uslada and Horace decided to make either an elephant or a bear from those sticks. They can make an animal from sticks in the following way:
- Four sticks represent the animal's legs, these sticks should have the same length. - Two remaining sticks represent the animal's head and body. The bear's head stick must be shorter than the body stick. The elephant, however, has a long trunk, so his head stick must be as long as the body stick. Note that there are no limits on the relations between the leg sticks and the head and body sticks.
Your task is to find out which animal can be made from the given stick set. The zoo keeper wants the sticks back after the game, so they must never be broken, even bears understand it.
Input Specification:
The single line contains six space-separated integers *l**i* (1<=≤<=*l**i*<=≤<=9) — the lengths of the six sticks. It is guaranteed that the input is such that you cannot make both animals from the sticks.
Output Specification:
If you can make a bear from the given set, print string "Bear" (without the quotes). If you can make an elephant, print string "Elephant" (wıthout the quotes). If you can make neither a bear nor an elephant, print string "Alien" (without the quotes).
Demo Input:
['4 2 5 4 4 4\n', '4 4 5 4 4 5\n', '1 2 3 4 5 6\n']
Demo Output:
['Bear', 'Elephant', 'Alien']
Note:
If you're out of creative ideas, see instructions below which show how to make a bear and an elephant in the first two samples. The stick of length 2 is in red, the sticks of length 4 are in green, the sticks of length 5 are in blue.
|
```python
def main():
x = [int(y) for y in input().split()] #Lectura de datos
x.sort()
rank = [0 for y in range(1,x[5]+2)]
patas = -1
r = []
for i in range(0,len(x)):
rank[x[i]]+=1
if(rank[x[i]] == 4):
patas=x[i]
if(patas != -1):
for i in range(0,len(rank)):
if(x[i]!=patas):
r.append(x[i])
r.sort()
if(r[0] == r[1]):
print("Elephant")
elif(r[0] < r[1]):
print("Bear")
else:
print("Alien")
else:
print("Alien")
main()
```
| -1
|
|
37
|
A
|
Towers
|
PROGRAMMING
| 1,000
|
[
"sortings"
] |
A. Towers
|
2
|
256
|
Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same.
Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible.
|
The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000.
|
In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars.
|
[
"3\n1 2 3\n",
"4\n6 5 6 7\n"
] |
[
"1 3\n",
"2 3\n"
] |
none
| 500
|
[
{
"input": "3\n1 2 3",
"output": "1 3"
},
{
"input": "4\n6 5 6 7",
"output": "2 3"
},
{
"input": "4\n3 2 1 1",
"output": "2 3"
},
{
"input": "4\n1 2 3 3",
"output": "2 3"
},
{
"input": "3\n20 22 36",
"output": "1 3"
},
{
"input": "25\n47 30 94 41 45 20 96 51 110 129 24 116 9 47 32 82 105 114 116 75 154 151 70 42 162",
"output": "2 23"
},
{
"input": "45\n802 664 442 318 318 827 417 878 711 291 231 414 807 553 657 392 279 202 386 606 465 655 658 112 887 15 25 502 95 44 679 775 942 609 209 871 31 234 4 231 150 110 22 823 193",
"output": "2 43"
},
{
"input": "63\n93 180 116 7 8 179 268 279 136 94 221 153 264 190 278 19 19 63 153 26 158 225 25 49 89 218 111 149 255 225 197 122 243 80 3 224 107 178 202 17 53 92 69 42 228 24 81 205 95 8 265 82 228 156 127 241 172 159 106 60 67 155 111",
"output": "2 57"
},
{
"input": "83\n246 535 994 33 390 927 321 97 223 922 812 705 79 80 977 457 476 636 511 137 6 360 815 319 717 674 368 551 714 628 278 713 761 553 184 414 623 753 428 214 581 115 439 61 677 216 772 592 187 603 658 310 439 559 870 376 109 321 189 337 277 26 70 734 796 907 979 693 570 227 345 650 737 633 701 914 134 403 972 940 371 6 642",
"output": "2 80"
},
{
"input": "105\n246 57 12 204 165 123 246 68 191 310 3 152 386 333 374 257 158 104 333 50 80 290 8 340 101 76 221 316 388 289 138 359 316 26 93 290 105 178 81 195 41 196 218 180 244 292 187 97 315 323 174 119 248 239 92 312 31 2 101 180 307 170 338 314 163 281 217 31 142 238 280 190 190 156 70 74 329 113 151 8 141 313 366 40 253 116 168 124 135 230 294 266 353 389 371 359 195 200 183 237 93 102 315 118 188",
"output": "2 92"
},
{
"input": "123\n112 277 170 247 252 115 157 293 256 143 196 90 12 164 164 42 8 223 167 109 175 232 239 111 148 51 9 254 93 32 268 162 231 91 47 162 161 191 195 145 247 292 129 199 230 94 144 217 18 205 176 20 143 198 121 243 211 262 230 277 195 255 108 290 220 275 158 2 286 200 60 267 278 207 123 150 123 116 131 13 12 226 33 244 30 275 263 45 158 192 254 149 242 176 62 224 221 288 250 160 155 225 132 143 276 293 218 145 197 175 33 129 79 206 210 192 222 262 190 52 274 243 233",
"output": "3 101"
},
{
"input": "5\n5 5 5 5 5",
"output": "5 1"
},
{
"input": "3\n1000 1000 1000",
"output": "3 1"
},
{
"input": "1\n1000",
"output": "1 1"
},
{
"input": "1\n1",
"output": "1 1"
},
{
"input": "5\n1 1000 1000 1000 1000",
"output": "4 2"
},
{
"input": "5\n1000 1000 1000 8 7",
"output": "3 3"
}
] | 1,691,254,602
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 61
| 92
| 0
|
input();d={};t=0
for i in input().split():
if i in d:d[i]+=1
else:d[i]=1
print(max(d.values()),len(d))
|
Title: Towers
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same.
Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible.
Input Specification:
The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000.
Output Specification:
In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars.
Demo Input:
['3\n1 2 3\n', '4\n6 5 6 7\n']
Demo Output:
['1 3\n', '2 3\n']
Note:
none
|
```python
input();d={};t=0
for i in input().split():
if i in d:d[i]+=1
else:d[i]=1
print(max(d.values()),len(d))
```
| 3.977
|
988
|
A
|
Diverse Team
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
There are $n$ students in a school class, the rating of the $i$-th student on Codehorses is $a_i$. You have to form a team consisting of $k$ students ($1 \le k \le n$) such that the ratings of all team members are distinct.
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct numbers which should be the indices of students in the team you form. If there are multiple answers, print any of them.
|
The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the number of students and the size of the team you have to form.
The second line contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the rating of $i$-th student.
|
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct integers from $1$ to $n$ which should be the indices of students in the team you form. All the ratings of the students in the team should be distinct. You may print the indices in any order. If there are multiple answers, print any of them.
Assume that the students are numbered from $1$ to $n$.
|
[
"5 3\n15 13 15 15 12\n",
"5 4\n15 13 15 15 12\n",
"4 4\n20 10 40 30\n"
] |
[
"YES\n1 2 5 \n",
"NO\n",
"YES\n1 2 3 4 \n"
] |
All possible answers for the first example:
- {1 2 5} - {2 3 5} - {2 4 5}
Note that the order does not matter.
| 0
|
[
{
"input": "5 3\n15 13 15 15 12",
"output": "YES\n1 2 5 "
},
{
"input": "5 4\n15 13 15 15 12",
"output": "NO"
},
{
"input": "4 4\n20 10 40 30",
"output": "YES\n1 2 3 4 "
},
{
"input": "1 1\n1",
"output": "YES\n1 "
},
{
"input": "100 53\n16 17 1 2 27 5 9 9 53 24 17 33 35 24 20 48 56 73 12 14 39 55 58 13 59 73 29 26 40 33 22 29 34 22 55 38 63 66 36 13 60 42 10 15 21 9 11 5 23 37 79 47 26 3 79 53 44 8 71 75 42 11 34 39 79 33 10 26 23 23 17 14 54 41 60 31 83 5 45 4 14 35 6 60 28 48 23 18 60 36 21 28 7 34 9 25 52 43 54 19",
"output": "YES\n1 2 3 4 5 6 7 9 10 12 13 15 16 17 18 19 20 21 22 23 24 25 27 28 29 31 33 36 37 38 39 41 42 43 44 45 47 49 50 51 52 54 57 58 59 60 73 74 76 77 79 80 83 "
},
{
"input": "2 2\n100 100",
"output": "NO"
},
{
"input": "2 2\n100 99",
"output": "YES\n1 2 "
},
{
"input": "100 100\n63 100 75 32 53 24 73 98 76 15 70 48 8 81 88 58 95 78 27 92 14 16 72 43 46 39 66 38 64 42 59 9 22 51 4 6 10 94 28 99 68 80 35 50 45 20 47 7 30 26 49 91 77 19 96 57 65 1 11 13 31 12 82 87 93 34 62 3 21 79 56 41 89 18 44 23 74 86 2 33 69 36 61 67 25 83 5 84 90 37 40 29 97 60 52 55 54 71 17 85",
"output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "100 41\n54 16 42 3 45 6 9 72 100 13 24 57 35 5 89 13 97 27 43 9 73 89 48 16 48 55 18 15 55 28 30 6 18 41 100 61 9 42 35 54 57 25 73 15 42 54 49 5 72 48 30 55 4 43 94 5 60 92 93 23 89 75 53 92 74 93 89 28 69 6 3 49 15 28 49 57 54 55 30 57 69 18 89 6 25 23 93 74 30 13 87 53 6 42 4 54 60 30 4 35",
"output": "NO"
},
{
"input": "100 2\n70 64 70 32 70 64 32 70 64 32 32 64 70 64 64 32 64 64 64 70 70 64 64 64 64 70 32 64 70 64 32 70 70 70 64 70 64 70 64 32 70 32 70 64 64 64 32 70 64 70 70 32 70 32 32 32 70 32 70 32 64 64 70 32 32 64 70 64 32 32 64 64 32 32 70 70 32 70 32 64 32 70 64 64 32 64 32 64 70 32 70 32 70 64 64 64 70 70 64 70",
"output": "YES\n1 2 "
}
] | 1,615,704,861
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 62
| 307,200
|
while True:
try:
a, b = map(int, input().split(' '))
l = list(map(int, input().split(' ')))
idx = {idx:val for val, idx in enumerate(l)}
if len(idx) >= b:
print("YES")
for key, value in idx.items():
if b < 0 :
break
print(value+1, end=" ")
b -= 1
print()
else:
print("NO")
except:
break
|
Title: Diverse Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are $n$ students in a school class, the rating of the $i$-th student on Codehorses is $a_i$. You have to form a team consisting of $k$ students ($1 \le k \le n$) such that the ratings of all team members are distinct.
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct numbers which should be the indices of students in the team you form. If there are multiple answers, print any of them.
Input Specification:
The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the number of students and the size of the team you have to form.
The second line contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the rating of $i$-th student.
Output Specification:
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct integers from $1$ to $n$ which should be the indices of students in the team you form. All the ratings of the students in the team should be distinct. You may print the indices in any order. If there are multiple answers, print any of them.
Assume that the students are numbered from $1$ to $n$.
Demo Input:
['5 3\n15 13 15 15 12\n', '5 4\n15 13 15 15 12\n', '4 4\n20 10 40 30\n']
Demo Output:
['YES\n1 2 5 \n', 'NO\n', 'YES\n1 2 3 4 \n']
Note:
All possible answers for the first example:
- {1 2 5} - {2 3 5} - {2 4 5}
Note that the order does not matter.
|
```python
while True:
try:
a, b = map(int, input().split(' '))
l = list(map(int, input().split(' ')))
idx = {idx:val for val, idx in enumerate(l)}
if len(idx) >= b:
print("YES")
for key, value in idx.items():
if b < 0 :
break
print(value+1, end=" ")
b -= 1
print()
else:
print("NO")
except:
break
```
| 0
|
|
411
|
A
|
Password Check
|
PROGRAMMING
| 800
|
[
"*special",
"implementation"
] | null | null |
You have probably registered on Internet sites many times. And each time you should enter your invented password. Usually the registration form automatically checks the password's crypt resistance. If the user's password isn't complex enough, a message is displayed. Today your task is to implement such an automatic check.
Web-developers of the company Q assume that a password is complex enough, if it meets all of the following conditions:
- the password length is at least 5 characters; - the password contains at least one large English letter; - the password contains at least one small English letter; - the password contains at least one digit.
You are given a password. Please implement the automatic check of its complexity for company Q.
|
The first line contains a non-empty sequence of characters (at most 100 characters). Each character is either a large English letter, or a small English letter, or a digit, or one of characters: "!", "?", ".", ",", "_".
|
If the password is complex enough, print message "Correct" (without the quotes), otherwise print message "Too weak" (without the quotes).
|
[
"abacaba\n",
"X12345\n",
"CONTEST_is_STARTED!!11\n"
] |
[
"Too weak\n",
"Too weak\n",
"Correct\n"
] |
none
| 0
|
[
{
"input": "abacaba",
"output": "Too weak"
},
{
"input": "X12345",
"output": "Too weak"
},
{
"input": "CONTEST_is_STARTED!!11",
"output": "Correct"
},
{
"input": "1zA__",
"output": "Correct"
},
{
"input": "1zA_",
"output": "Too weak"
},
{
"input": "zA___",
"output": "Too weak"
},
{
"input": "1A___",
"output": "Too weak"
},
{
"input": "z1___",
"output": "Too weak"
},
{
"input": "0",
"output": "Too weak"
},
{
"input": "_",
"output": "Too weak"
},
{
"input": "a",
"output": "Too weak"
},
{
"input": "D",
"output": "Too weak"
},
{
"input": "_",
"output": "Too weak"
},
{
"input": "?",
"output": "Too weak"
},
{
"input": "?",
"output": "Too weak"
},
{
"input": "._,.!.,...?_,!.",
"output": "Too weak"
},
{
"input": "!_?_,?,?.,.,_!!!.!,.__,?!!,_!,?_,!??,?!..._!?_,?_!,?_.,._,,_.,.",
"output": "Too weak"
},
{
"input": "?..!.,,?,__.,...????_???__!,?...?.,,,,___!,.!,_,,_,??!_?_,!!?_!_??.?,.!!?_?_.,!",
"output": "Too weak"
},
{
"input": "XZX",
"output": "Too weak"
},
{
"input": "R",
"output": "Too weak"
},
{
"input": "H.FZ",
"output": "Too weak"
},
{
"input": "KSHMICWPK,LSBM_JVZ!IPDYDG_GOPCHXFJTKJBIFY,FPHMY,CB?PZEAG..,X,.GFHPIDBB,IQ?MZ",
"output": "Too weak"
},
{
"input": "EFHI,,Y?HMMUI,,FJGAY?FYPBJQMYM!DZHLFCTFWT?JOPDW,S_!OR?ATT?RWFBMAAKUHIDMHSD?LCZQY!UD_CGYGBAIRDPICYS",
"output": "Too weak"
},
{
"input": "T,NDMUYCCXH_L_FJHMCCAGX_XSCPGOUZSY?D?CNDSYRITYS,VAT!PJVKNTBMXGGRYKACLYU.RJQ_?UWKXYIDE_AE",
"output": "Too weak"
},
{
"input": "y",
"output": "Too weak"
},
{
"input": "qgw",
"output": "Too weak"
},
{
"input": "g",
"output": "Too weak"
},
{
"input": "loaray",
"output": "Too weak"
},
{
"input": "d_iymyvxolmjayhwpedocopqwmy.oalrdg!_n?.lrxpamhygps?kkzxydsbcaihfs.j?eu!oszjsy.vzu?!vs.bprz_j",
"output": "Too weak"
},
{
"input": "txguglvclyillwnono",
"output": "Too weak"
},
{
"input": "FwX",
"output": "Too weak"
},
{
"input": "Zi",
"output": "Too weak"
},
{
"input": "PodE",
"output": "Too weak"
},
{
"input": "SdoOuJ?nj_wJyf",
"output": "Too weak"
},
{
"input": "MhnfZjsUyXYw?f?ubKA",
"output": "Too weak"
},
{
"input": "CpWxDVzwHfYFfoXNtXMFuAZr",
"output": "Too weak"
},
{
"input": "9.,0",
"output": "Too weak"
},
{
"input": "5,8",
"output": "Too weak"
},
{
"input": "7",
"output": "Too weak"
},
{
"input": "34__39_02!,!,82!129!2!566",
"output": "Too weak"
},
{
"input": "96156027.65935663!_87!,44,..7914_!0_1,.4!!62!.8350!17_282!!9.2584,!!7__51.526.7",
"output": "Too weak"
},
{
"input": "90328_",
"output": "Too weak"
},
{
"input": "B9",
"output": "Too weak"
},
{
"input": "P1H",
"output": "Too weak"
},
{
"input": "J2",
"output": "Too weak"
},
{
"input": "M6BCAKW!85OSYX1D?.53KDXP42F",
"output": "Too weak"
},
{
"input": "C672F429Y8X6XU7S,.K9111UD3232YXT81S4!729ER7DZ.J7U1R_7VG6.FQO,LDH",
"output": "Too weak"
},
{
"input": "W2PI__!.O91H8OFY6AB__R30L9XOU8800?ZUD84L5KT99818NFNE35V.8LJJ5P2MM.B6B",
"output": "Too weak"
},
{
"input": "z1",
"output": "Too weak"
},
{
"input": "p1j",
"output": "Too weak"
},
{
"input": "j9",
"output": "Too weak"
},
{
"input": "v8eycoylzv0qkix5mfs_nhkn6k!?ovrk9!b69zy!4frc?k",
"output": "Too weak"
},
{
"input": "l4!m_44kpw8.jg!?oh,?y5oraw1tg7_x1.osl0!ny?_aihzhtt0e2!mr92tnk0es!1f,9he40_usa6c50l",
"output": "Too weak"
},
{
"input": "d4r!ak.igzhnu!boghwd6jl",
"output": "Too weak"
},
{
"input": "It0",
"output": "Too weak"
},
{
"input": "Yb1x",
"output": "Too weak"
},
{
"input": "Qf7",
"output": "Too weak"
},
{
"input": "Vu7jQU8.!FvHBYTsDp6AphaGfnEmySP9te",
"output": "Correct"
},
{
"input": "Ka4hGE,vkvNQbNolnfwp",
"output": "Correct"
},
{
"input": "Ee9oluD?amNItsjeQVtOjwj4w_ALCRh7F3eaZah",
"output": "Correct"
},
{
"input": "Um3Fj?QLhNuRE_Gx0cjMLOkGCm",
"output": "Correct"
},
{
"input": "Oq2LYmV9HmlaW",
"output": "Correct"
},
{
"input": "Cq7r3Wrb.lDb_0wsf7!ruUUGSf08RkxD?VsBEDdyE?SHK73TFFy0f8gmcATqGafgTv8OOg8or2HyMPIPiQ2Hsx8q5rn3_WZe",
"output": "Correct"
},
{
"input": "Wx4p1fOrEMDlQpTlIx0p.1cnFD7BnX2K8?_dNLh4cQBx_Zqsv83BnL5hGKNcBE9g3QB,!fmSvgBeQ_qiH7",
"output": "Correct"
},
{
"input": "k673,",
"output": "Too weak"
},
{
"input": "LzuYQ",
"output": "Too weak"
},
{
"input": "Pasq!",
"output": "Too weak"
},
{
"input": "x5hve",
"output": "Too weak"
},
{
"input": "b27fk",
"output": "Too weak"
},
{
"input": "h6y1l",
"output": "Too weak"
},
{
"input": "i9nij",
"output": "Too weak"
},
{
"input": "Gf5Q6",
"output": "Correct"
},
{
"input": "Uf24o",
"output": "Correct"
},
{
"input": "Oj9vu",
"output": "Correct"
},
{
"input": "c7jqaudcqmv8o7zvb5x_gp6zcgl6nwr7tz5or!28.tj8s1m2.wxz5a4id03!rq07?662vy.7.p5?vk2f2mc7ag8q3861rgd0rmbr",
"output": "Too weak"
},
{
"input": "i6a.,8jb,n0kv4.1!7h?p.96pnhhgy6cl7dg7e4o6o384ys3z.t71kkq,,w,oqi4?u,,m5!rzu6wym_4hm,ohjy!.vvksl?pt,,1",
"output": "Too weak"
},
{
"input": "M10V_MN_1K8YX2LA!89EYV7!5V9?,.IDHDP6JEC.OGLY.180LMZ6KW3Z5E17IT94ZNHS!79GN09Q6LH0,F3AYNKP?KM,QP_?XRD6",
"output": "Too weak"
},
{
"input": "Hi7zYuVXCPhaho68YgCMzzgLILM6toQTJq8akMqqrnUn6ZCD36iA1yVVpvlsIiMpCu!1QZd4ycIrQ5Kcrhk5k0jTrwdAAEEP_T2f",
"output": "Correct"
},
{
"input": "Bk2Q38vDSW5JqYu.077iYC.9YoiPc!Dh6FJWOVze6?YXiFjPNa4F1RG?154m9mY2jQobBnbxM,cDV8l1UX1?v?p.tTYIyJO!NYmE",
"output": "Correct"
},
{
"input": "Ro1HcZ.piN,JRR88DLh,WtW!pbFM076?wCSbqfK7N2s5zUySFBtzk7HV,BxHXR0zALAr016z5jvvB.WUdEcKgYFav5TygwHQC..C",
"output": "Correct"
},
{
"input": "!?.,_",
"output": "Too weak"
}
] | 1,589,431,340
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 81
| 156
| 20,172,800
|
s=input()
x,y,z=0,0,0
n=len(s)
if(n<5):
print("Too weak")
else:
for i in s:
if(i.isupper()):
x=1
break
for i in s:
if(i.islower()):
y=1
break
for i in s:
if(i.isdigit()):
z=1
break
if(x==1 and y==1 and z==1):
print("Correct")
else:
print("Too weak")
|
Title: Password Check
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have probably registered on Internet sites many times. And each time you should enter your invented password. Usually the registration form automatically checks the password's crypt resistance. If the user's password isn't complex enough, a message is displayed. Today your task is to implement such an automatic check.
Web-developers of the company Q assume that a password is complex enough, if it meets all of the following conditions:
- the password length is at least 5 characters; - the password contains at least one large English letter; - the password contains at least one small English letter; - the password contains at least one digit.
You are given a password. Please implement the automatic check of its complexity for company Q.
Input Specification:
The first line contains a non-empty sequence of characters (at most 100 characters). Each character is either a large English letter, or a small English letter, or a digit, or one of characters: "!", "?", ".", ",", "_".
Output Specification:
If the password is complex enough, print message "Correct" (without the quotes), otherwise print message "Too weak" (without the quotes).
Demo Input:
['abacaba\n', 'X12345\n', 'CONTEST_is_STARTED!!11\n']
Demo Output:
['Too weak\n', 'Too weak\n', 'Correct\n']
Note:
none
|
```python
s=input()
x,y,z=0,0,0
n=len(s)
if(n<5):
print("Too weak")
else:
for i in s:
if(i.isupper()):
x=1
break
for i in s:
if(i.islower()):
y=1
break
for i in s:
if(i.isdigit()):
z=1
break
if(x==1 and y==1 and z==1):
print("Correct")
else:
print("Too weak")
```
| 3
|
|
282
|
A
|
Bit++
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
The classic programming language of Bitland is Bit++. This language is so peculiar and complicated.
The language is that peculiar as it has exactly one variable, called *x*. Also, there are two operations:
- Operation ++ increases the value of variable *x* by 1. - Operation -- decreases the value of variable *x* by 1.
A statement in language Bit++ is a sequence, consisting of exactly one operation and one variable *x*. The statement is written without spaces, that is, it can only contain characters "+", "-", "X". Executing a statement means applying the operation it contains.
A programme in Bit++ is a sequence of statements, each of them needs to be executed. Executing a programme means executing all the statements it contains.
You're given a programme in language Bit++. The initial value of *x* is 0. Execute the programme and find its final value (the value of the variable when this programme is executed).
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=150) — the number of statements in the programme.
Next *n* lines contain a statement each. Each statement contains exactly one operation (++ or --) and exactly one variable *x* (denoted as letter «X»). Thus, there are no empty statements. The operation and the variable can be written in any order.
|
Print a single integer — the final value of *x*.
|
[
"1\n++X\n",
"2\nX++\n--X\n"
] |
[
"1\n",
"0\n"
] |
none
| 500
|
[
{
"input": "1\n++X",
"output": "1"
},
{
"input": "2\nX++\n--X",
"output": "0"
},
{
"input": "3\n++X\n++X\n++X",
"output": "3"
},
{
"input": "2\n--X\n--X",
"output": "-2"
},
{
"input": "5\n++X\n--X\n++X\n--X\n--X",
"output": "-1"
},
{
"input": "28\nX--\n++X\nX++\nX++\nX++\n--X\n--X\nX++\nX--\n++X\nX++\n--X\nX--\nX++\nX--\n++X\n++X\nX++\nX++\nX++\nX++\n--X\n++X\n--X\n--X\n--X\n--X\nX++",
"output": "4"
},
{
"input": "94\nX++\nX++\n++X\n++X\nX--\n--X\nX++\n--X\nX++\n++X\nX++\n++X\n--X\n--X\n++X\nX++\n--X\nX--\nX--\n--X\nX--\nX--\n--X\n++X\n--X\nX--\nX--\nX++\n++X\n--X\nX--\n++X\n--X\n--X\nX--\nX--\nX++\nX++\nX--\nX++\nX--\nX--\nX--\n--X\nX--\nX--\nX--\nX++\n++X\nX--\n++X\nX++\n--X\n--X\n--X\n--X\n++X\nX--\n--X\n--X\n++X\nX--\nX--\nX++\n++X\nX++\n++X\n--X\n--X\nX--\n++X\nX--\nX--\n++X\n++X\n++X\n++X\nX++\n++X\n--X\nX++\n--X\n--X\n++X\n--X\nX++\n++X\nX++\n--X\nX--\nX--\n--X\n++X\nX++",
"output": "-10"
},
{
"input": "56\n--X\nX--\n--X\n--X\nX--\nX--\n--X\nX++\n++X\n--X\nX++\nX--\n--X\n++X\n--X\nX--\nX--\n++X\nX--\nX--\n--X\n++X\n--X\n++X\n--X\nX++\n++X\nX++\n--X\n++X\nX++\nX++\n--X\nX++\nX--\n--X\nX--\n--X\nX++\n++X\n--X\n++X\nX++\nX--\n--X\n--X\n++X\nX--\nX--\n--X\nX--\n--X\nX++\n--X\n++X\n--X",
"output": "-14"
},
{
"input": "59\nX--\n--X\nX++\n++X\nX--\n--X\n--X\n++X\n++X\n++X\n++X\nX++\n++X\n++X\nX++\n--X\nX--\nX++\n++X\n--X\nX++\n--X\n++X\nX++\n--X\n--X\nX++\nX++\n--X\nX++\nX++\nX++\nX--\nX--\n--X\nX++\nX--\nX--\n++X\nX--\nX++\n--X\nX++\nX--\nX--\nX--\nX--\n++X\n--X\nX++\nX++\nX--\nX++\n++X\nX--\nX++\nX--\nX--\n++X",
"output": "3"
},
{
"input": "87\n--X\n++X\n--X\nX++\n--X\nX--\n--X\n++X\nX--\n++X\n--X\n--X\nX++\n--X\nX--\nX++\n++X\n--X\n++X\n++X\n--X\n++X\n--X\nX--\n++X\n++X\nX--\nX++\nX++\n--X\n--X\n++X\nX--\n--X\n++X\n--X\nX++\n--X\n--X\nX--\n++X\n++X\n--X\nX--\nX--\nX--\nX--\nX--\nX++\n--X\n++X\n--X\nX++\n++X\nX++\n++X\n--X\nX++\n++X\nX--\n--X\nX++\n++X\nX++\nX++\n--X\n--X\n++X\n--X\nX++\nX++\n++X\nX++\nX++\nX++\nX++\n--X\n--X\n--X\n--X\n--X\n--X\n--X\nX--\n--X\n++X\n++X",
"output": "-5"
},
{
"input": "101\nX++\nX++\nX++\n++X\n--X\nX--\nX++\nX--\nX--\n--X\n--X\n++X\nX++\n++X\n++X\nX--\n--X\n++X\nX++\nX--\n++X\n--X\n--X\n--X\n++X\n--X\n++X\nX++\nX++\n++X\n--X\nX++\nX--\nX++\n++X\n++X\nX--\nX--\nX--\nX++\nX++\nX--\nX--\nX++\n++X\n++X\n++X\n--X\n--X\n++X\nX--\nX--\n--X\n++X\nX--\n++X\nX++\n++X\nX--\nX--\n--X\n++X\n--X\n++X\n++X\n--X\nX++\n++X\nX--\n++X\nX--\n++X\nX++\nX--\n++X\nX++\n--X\nX++\nX++\n++X\n--X\n++X\n--X\nX++\n--X\nX--\n--X\n++X\n++X\n++X\n--X\nX--\nX--\nX--\nX--\n--X\n--X\n--X\n++X\n--X\n--X",
"output": "1"
},
{
"input": "63\n--X\nX--\n++X\n--X\n++X\nX++\n--X\n--X\nX++\n--X\n--X\nX++\nX--\nX--\n--X\n++X\nX--\nX--\nX++\n++X\nX++\nX++\n--X\n--X\n++X\nX--\nX--\nX--\n++X\nX++\nX--\n--X\nX--\n++X\n++X\nX++\n++X\nX++\nX++\n--X\nX--\n++X\nX--\n--X\nX--\nX--\nX--\n++X\n++X\n++X\n++X\nX++\nX++\n++X\n--X\n--X\n++X\n++X\n++X\nX--\n++X\n++X\nX--",
"output": "1"
},
{
"input": "45\n--X\n++X\nX--\n++X\n++X\nX++\n--X\n--X\n--X\n--X\n--X\n--X\n--X\nX++\n++X\nX--\n++X\n++X\nX--\nX++\nX--\n--X\nX--\n++X\n++X\n--X\n--X\nX--\nX--\n--X\n++X\nX--\n--X\n++X\n++X\n--X\n--X\nX--\n++X\n++X\nX++\nX++\n++X\n++X\nX++",
"output": "-3"
},
{
"input": "21\n++X\nX++\n--X\nX--\nX++\n++X\n--X\nX--\nX++\nX--\nX--\nX--\nX++\n++X\nX++\n++X\n--X\nX--\n--X\nX++\n++X",
"output": "1"
},
{
"input": "100\n--X\n++X\nX++\n++X\nX--\n++X\nX--\nX++\n--X\nX++\nX--\nX--\nX--\n++X\nX--\nX++\nX++\n++X\nX++\nX++\nX++\nX++\n++X\nX++\n++X\nX--\n--X\n++X\nX--\n--X\n++X\n++X\nX--\nX++\nX++\nX++\n++X\n--X\n++X\nX++\nX--\n++X\n++X\n--X\n++X\nX--\nX--\nX--\nX++\nX--\nX--\nX++\nX++\n--X\nX++\nX++\n--X\nX--\n--X\n++X\n--X\n++X\n++X\nX--\n--X\n++X\n++X\n--X\n--X\n++X\nX++\nX--\nX++\nX--\nX++\nX++\n--X\nX--\nX--\n++X\nX--\n--X\n--X\nX++\n--X\n--X\nX--\nX--\n++X\n++X\nX--\n++X\nX++\n--X\n++X\n++X\nX++\n--X\n--X\nX++",
"output": "8"
},
{
"input": "17\nX++\nX++\n++X\n--X\n--X\n++X\n++X\n--X\nX--\nX++\nX--\n--X\n--X\nX--\n++X\nX--\nX++",
"output": "-1"
},
{
"input": "77\n++X\nX++\n--X\nX--\n--X\n--X\nX--\nX++\nX--\nX++\nX--\n++X\n--X\n--X\n--X\n--X\n++X\nX--\nX++\nX--\n--X\nX--\n--X\nX--\n++X\n--X\n++X\n++X\nX++\nX++\nX--\n--X\nX--\nX--\nX++\n--X\n--X\n++X\nX--\nX--\n++X\nX++\nX--\n++X\n--X\nX++\nX--\n++X\n++X\n++X\nX--\nX--\nX--\n--X\n++X\n++X\n++X\nX++\n--X\n--X\n++X\n--X\nX--\nX++\n++X\nX++\n++X\nX--\nX++\nX++\n--X\nX++\nX++\nX++\n--X\nX++\nX--",
"output": "-5"
},
{
"input": "21\nX--\n++X\n--X\nX--\n++X\nX--\n++X\nX--\n--X\n++X\nX++\n++X\nX++\n++X\nX--\n--X\nX++\nX++\nX--\n++X\nX--",
"output": "1"
},
{
"input": "1\nX--",
"output": "-1"
}
] | 1,698,246,037
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 15
| 0
|
n=int(input(""))
count=0
l=[]
for i in range(n):
z=input("")
l.append(z)
for i in range(len(l)):
if l[i] in ["x++","++x","+x+"]:
count+=1
else:
count=count-1
print(count)
|
Title: Bit++
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The classic programming language of Bitland is Bit++. This language is so peculiar and complicated.
The language is that peculiar as it has exactly one variable, called *x*. Also, there are two operations:
- Operation ++ increases the value of variable *x* by 1. - Operation -- decreases the value of variable *x* by 1.
A statement in language Bit++ is a sequence, consisting of exactly one operation and one variable *x*. The statement is written without spaces, that is, it can only contain characters "+", "-", "X". Executing a statement means applying the operation it contains.
A programme in Bit++ is a sequence of statements, each of them needs to be executed. Executing a programme means executing all the statements it contains.
You're given a programme in language Bit++. The initial value of *x* is 0. Execute the programme and find its final value (the value of the variable when this programme is executed).
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=150) — the number of statements in the programme.
Next *n* lines contain a statement each. Each statement contains exactly one operation (++ or --) and exactly one variable *x* (denoted as letter «X»). Thus, there are no empty statements. The operation and the variable can be written in any order.
Output Specification:
Print a single integer — the final value of *x*.
Demo Input:
['1\n++X\n', '2\nX++\n--X\n']
Demo Output:
['1\n', '0\n']
Note:
none
|
```python
n=int(input(""))
count=0
l=[]
for i in range(n):
z=input("")
l.append(z)
for i in range(len(l)):
if l[i] in ["x++","++x","+x+"]:
count+=1
else:
count=count-1
print(count)
```
| 0
|
|
500
|
A
|
New Year Transportation
|
PROGRAMMING
| 1,000
|
[
"dfs and similar",
"graphs",
"implementation"
] | null | null |
New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=×<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells.
So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≤<=*i*<=≤<=*n*<=-<=1 the condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≤<=*i*<=≤<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* one can't leave the Line World using portals.
Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system.
|
The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=3<=×<=104) and *t* (2<=≤<=*t*<=≤<=*n*) — the number of cells, and the index of the cell which I want to go to.
The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≤<=*a**i*<=≤<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World.
|
If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO".
|
[
"8 4\n1 2 1 2 1 2 1\n",
"8 5\n1 2 1 2 1 1 1\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4.
In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
| 500
|
[
{
"input": "8 4\n1 2 1 2 1 2 1",
"output": "YES"
},
{
"input": "8 5\n1 2 1 2 1 1 1",
"output": "NO"
},
{
"input": "20 19\n13 16 7 6 12 1 5 7 8 6 5 7 5 5 3 3 2 2 1",
"output": "YES"
},
{
"input": "50 49\n11 7 1 41 26 36 19 16 38 14 36 35 37 27 20 27 3 6 21 2 27 11 18 17 19 16 22 8 8 9 1 7 5 12 5 6 13 6 11 2 6 3 1 5 1 1 2 2 1",
"output": "YES"
},
{
"input": "120 104\n41 15 95 85 34 11 25 42 65 39 77 80 74 17 66 73 21 14 36 63 63 79 45 24 65 7 63 80 51 21 2 19 78 28 71 2 15 23 17 68 62 18 54 39 43 70 3 46 34 23 41 65 32 10 13 18 10 3 16 48 54 18 57 28 3 24 44 50 15 2 20 22 45 44 3 29 2 27 11 2 12 25 25 31 1 2 32 4 11 30 13 16 26 21 1 13 21 8 15 5 18 13 5 15 3 8 13 6 5 1 9 7 1 2 4 1 1 2 1",
"output": "NO"
},
{
"input": "10 3\n8 3 5 4 2 3 2 2 1",
"output": "NO"
},
{
"input": "10 9\n8 3 5 4 2 3 2 2 1",
"output": "YES"
},
{
"input": "3 2\n1 1",
"output": "YES"
},
{
"input": "3 2\n2 1",
"output": "NO"
},
{
"input": "4 2\n2 1 1",
"output": "NO"
},
{
"input": "4 4\n2 2 1",
"output": "YES"
},
{
"input": "8 8\n1 2 1 2 1 2 1",
"output": "YES"
},
{
"input": "3 3\n1 1",
"output": "YES"
},
{
"input": "8 8\n1 2 1 2 1 1 1",
"output": "YES"
},
{
"input": "3 3\n2 1",
"output": "YES"
},
{
"input": "4 4\n1 1 1",
"output": "YES"
},
{
"input": "8 8\n1 1 1 1 1 1 1",
"output": "YES"
},
{
"input": "5 5\n1 1 1 1",
"output": "YES"
}
] | 1,671,212,042
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 31
| 0
|
n,t=map(int,input().split())
mass=list(map(int,input().split()))
i=1
while i<=t:
i=mass[i-1]+l
if i==t:
print("YES");
break
else:
print("NO")
|
Title: New Year Transportation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=×<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells.
So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≤<=*i*<=≤<=*n*<=-<=1 the condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≤<=*i*<=≤<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* one can't leave the Line World using portals.
Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system.
Input Specification:
The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=3<=×<=104) and *t* (2<=≤<=*t*<=≤<=*n*) — the number of cells, and the index of the cell which I want to go to.
The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≤<=*a**i*<=≤<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World.
Output Specification:
If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO".
Demo Input:
['8 4\n1 2 1 2 1 2 1\n', '8 5\n1 2 1 2 1 1 1\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4.
In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
|
```python
n,t=map(int,input().split())
mass=list(map(int,input().split()))
i=1
while i<=t:
i=mass[i-1]+l
if i==t:
print("YES");
break
else:
print("NO")
```
| -1
|
|
729
|
A
|
Interview with Oleg
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] | null | null |
Polycarp has interviewed Oleg and has written the interview down without punctuation marks and spaces to save time. Thus, the interview is now a string *s* consisting of *n* lowercase English letters.
There is a filler word ogo in Oleg's speech. All words that can be obtained from ogo by adding go several times to the end of it are also considered to be fillers. For example, the words ogo, ogogo, ogogogo are fillers, but the words go, og, ogog, ogogog and oggo are not fillers.
The fillers have maximal size, for example, for ogogoo speech we can't consider ogo a filler and goo as a normal phrase. We should consider ogogo as a filler here.
To print the interview, Polycarp has to replace each of the fillers with three asterisks. Note that a filler word is replaced with exactly three asterisks regardless of its length.
Polycarp has dealt with this problem in no time. Can you do the same? The clock is ticking!
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the length of the interview.
The second line contains the string *s* of length *n*, consisting of lowercase English letters.
|
Print the interview text after the replacement of each of the fillers with "***". It is allowed for the substring "***" to have several consecutive occurences.
|
[
"7\naogogob\n",
"13\nogogmgogogogo\n",
"9\nogoogoogo\n"
] |
[
"a***b\n",
"***gmg***\n",
"*********\n"
] |
The first sample contains one filler word ogogo, so the interview for printing is "a***b".
The second sample contains two fillers ogo and ogogogo. Thus, the interview is transformed to "***gmg***".
| 500
|
[
{
"input": "7\naogogob",
"output": "a***b"
},
{
"input": "13\nogogmgogogogo",
"output": "***gmg***"
},
{
"input": "9\nogoogoogo",
"output": "*********"
},
{
"input": "32\nabcdefogoghijklmnogoopqrstuvwxyz",
"output": "abcdef***ghijklmn***opqrstuvwxyz"
},
{
"input": "100\nggogogoooggogooggoggogggggogoogoggooooggooggoooggogoooggoggoogggoogoggogggoooggoggoggogggogoogggoooo",
"output": "gg***oogg***oggoggoggggg******ggooooggooggooogg***ooggoggoogggo***ggogggoooggoggoggoggg***ogggoooo"
},
{
"input": "10\nogooggoggo",
"output": "***oggoggo"
},
{
"input": "20\nooggooogooogooogooog",
"output": "ooggoo***o***o***oog"
},
{
"input": "30\ngoggogoooggooggggoggoggoogoggo",
"output": "gogg***ooggooggggoggoggo***ggo"
},
{
"input": "40\nogggogooggoogoogggogooogogggoogggooggooo",
"output": "oggg***oggo***oggg***o***gggoogggooggooo"
},
{
"input": "50\noggggogoogggggggoogogggoooggooogoggogooogogggogooo",
"output": "ogggg***ogggggggo***gggoooggoo***gg***o***ggg***oo"
},
{
"input": "60\nggoooogoggogooogogooggoogggggogogogggggogggogooogogogggogooo",
"output": "ggooo***gg***o***oggooggggg***gggggoggg***o***ggg***oo"
},
{
"input": "70\ngogoooggggoggoggggggoggggoogooogogggggooogggogoogoogoggogggoggogoooooo",
"output": "g***ooggggoggoggggggoggggo***o***gggggoooggg*********ggogggogg***ooooo"
},
{
"input": "80\nooogoggoooggogogoggooooogoogogooogoggggogggggogoogggooogooooooggoggoggoggogoooog",
"output": "oo***ggooogg***ggoooo******o***ggggoggggg***ogggoo***oooooggoggoggogg***ooog"
},
{
"input": "90\nooogoggggooogoggggoooogggggooggoggoggooooooogggoggogggooggggoooooogoooogooggoooogggggooooo",
"output": "oo***ggggoo***ggggoooogggggooggoggoggooooooogggoggogggooggggooooo***oo***oggoooogggggooooo"
},
{
"input": "100\ngooogoggooggggoggoggooooggogoogggoogogggoogogoggogogogoggogggggogggggoogggooogogoggoooggogoooooogogg",
"output": "goo***ggooggggoggoggoooogg***ogggo***gggo***gg***ggogggggogggggoogggoo***ggooogg***oooo***gg"
},
{
"input": "100\ngoogoogggogoooooggoogooogoogoogogoooooogooogooggggoogoggogooogogogoogogooooggoggogoooogooooooggogogo",
"output": "go***oggg***ooooggo***o*********oooo***o***oggggo***gg***o******oooggogg***oo***ooooogg***"
},
{
"input": "100\ngoogoggggogggoooggoogoogogooggoggooggggggogogggogogggoogogggoogoggoggogooogogoooogooggggogggogggoooo",
"output": "go***ggggogggoooggo******oggoggoogggggg***ggg***gggo***gggo***ggogg***o***oo***oggggogggogggoooo"
},
{
"input": "100\nogogogogogoggogogogogogogoggogogogoogoggoggooggoggogoogoooogogoogggogogogogogoggogogogogogogogogogoe",
"output": "***gg***gg******ggoggooggogg******oo***oggg***gg***e"
},
{
"input": "5\nogoga",
"output": "***ga"
},
{
"input": "1\no",
"output": "o"
},
{
"input": "100\nogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogog",
"output": "***g"
},
{
"input": "99\nogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogogo",
"output": "***"
},
{
"input": "5\nggggg",
"output": "ggggg"
},
{
"input": "6\ngoogoo",
"output": "go***o"
},
{
"input": "7\nooogooo",
"output": "oo***oo"
},
{
"input": "8\ngggggggg",
"output": "gggggggg"
},
{
"input": "9\nogggogggg",
"output": "ogggogggg"
},
{
"input": "10\nogogoggogo",
"output": "***gg***"
},
{
"input": "11\noooggooggog",
"output": "oooggooggog"
},
{
"input": "12\nogggooooggog",
"output": "ogggooooggog"
},
{
"input": "13\nogoggogogooog",
"output": "***gg***oog"
},
{
"input": "15\nggooogoooggoggg",
"output": "ggoo***ooggoggg"
},
{
"input": "14\noogooooggooggo",
"output": "o***oooggooggo"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "1\ng",
"output": "g"
},
{
"input": "1\nz",
"output": "z"
},
{
"input": "46\nsdfkogogogogergergogogergerogogogogoergoegogog",
"output": "sdfk***gergerg***gerger***ergoeg***g"
},
{
"input": "86\ngdfggogogodfogogdofgoodfogodgodgfogoogdodhbofgobgbgfogoogdfogogogogogoogggsgfosogodgon",
"output": "gdfgg***df***gdofgoodf***dgodgf***ogdodhbofgobgbgf***ogdf***ogggsgfos***dgon"
},
{
"input": "83\nergegergoogogogerogoerorogroeorgefxcfgzdgawofqpwzxcvbnmsdfkfpweoriqgtogooggsdgogoog",
"output": "ergegergo***ger***erorogroeorgefxcfgzdgawofqpwzxcvbnmsdfkfpweoriqgt***oggsdg***og"
},
{
"input": "2\nog",
"output": "og"
},
{
"input": "4\nogog",
"output": "***g"
},
{
"input": "4\nogoo",
"output": "***o"
},
{
"input": "29\naaaogogogogogogogogogogogobbb",
"output": "aaa***bbb"
},
{
"input": "11\nogogogogogo",
"output": "***"
},
{
"input": "9\nogogogogo",
"output": "***"
},
{
"input": "3\nogo",
"output": "***"
},
{
"input": "15\nogogogogogogogo",
"output": "***"
},
{
"input": "25\nogogogogogogogogogogogogo",
"output": "***"
}
] | 1,598,906,424
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 109
| 307,200
|
n = int(input())
s = input()
l = list(s)
i = 0
while i < n:
j = i
if s[i] == "o":
flag = 0
while s[i+1:i+3] == "go":
flag +=1
i = i+2
if flag >= 1:
for x in range(j,j+3):
l[x] = "*"
for x in range(j+3,i+1):
l[x] = "+"
i+=1
ans = ""
for i in l:
if i != "+":
ans+=i
print(ans)
|
Title: Interview with Oleg
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp has interviewed Oleg and has written the interview down without punctuation marks and spaces to save time. Thus, the interview is now a string *s* consisting of *n* lowercase English letters.
There is a filler word ogo in Oleg's speech. All words that can be obtained from ogo by adding go several times to the end of it are also considered to be fillers. For example, the words ogo, ogogo, ogogogo are fillers, but the words go, og, ogog, ogogog and oggo are not fillers.
The fillers have maximal size, for example, for ogogoo speech we can't consider ogo a filler and goo as a normal phrase. We should consider ogogo as a filler here.
To print the interview, Polycarp has to replace each of the fillers with three asterisks. Note that a filler word is replaced with exactly three asterisks regardless of its length.
Polycarp has dealt with this problem in no time. Can you do the same? The clock is ticking!
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the length of the interview.
The second line contains the string *s* of length *n*, consisting of lowercase English letters.
Output Specification:
Print the interview text after the replacement of each of the fillers with "***". It is allowed for the substring "***" to have several consecutive occurences.
Demo Input:
['7\naogogob\n', '13\nogogmgogogogo\n', '9\nogoogoogo\n']
Demo Output:
['a***b\n', '***gmg***\n', '*********\n']
Note:
The first sample contains one filler word ogogo, so the interview for printing is "a***b".
The second sample contains two fillers ogo and ogogogo. Thus, the interview is transformed to "***gmg***".
|
```python
n = int(input())
s = input()
l = list(s)
i = 0
while i < n:
j = i
if s[i] == "o":
flag = 0
while s[i+1:i+3] == "go":
flag +=1
i = i+2
if flag >= 1:
for x in range(j,j+3):
l[x] = "*"
for x in range(j+3,i+1):
l[x] = "+"
i+=1
ans = ""
for i in l:
if i != "+":
ans+=i
print(ans)
```
| 3
|
|
61
|
A
|
Ultra-Fast Mathematician
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Ultra-Fast Mathematician
|
2
|
256
|
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
|
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
|
Write one line — the corresponding answer. Do not omit the leading 0s.
|
[
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] |
[
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] |
none
| 500
|
[
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,666,073,286
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 102
| 46
| 0
|
def solve(numOne, numTwo):
newNum = []
for idx in range(len(numOne)):
if numOne[idx] != numTwo[idx]:
newNum.append("1")
else:
newNum.append("0")
return "".join(newNum)
numOne = input()
numTwo = input()
print(solve(numOne, numTwo))
|
Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none
|
```python
def solve(numOne, numTwo):
newNum = []
for idx in range(len(numOne)):
if numOne[idx] != numTwo[idx]:
newNum.append("1")
else:
newNum.append("0")
return "".join(newNum)
numOne = input()
numTwo = input()
print(solve(numOne, numTwo))
```
| 3.9885
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Famous Brazil city Rio de Janeiro holds a tennis tournament and Ostap Bender doesn't want to miss this event. There will be *n* players participating, and the tournament will follow knockout rules from the very first game. That means, that if someone loses a game he leaves the tournament immediately.
Organizers are still arranging tournament grid (i.e. the order games will happen and who is going to play with whom) but they have already fixed one rule: two players can play against each other only if the number of games one of them has already played differs by no more than one from the number of games the other one has already played. Of course, both players had to win all their games in order to continue participating in the tournament.
Tournament hasn't started yet so the audience is a bit bored. Ostap decided to find out what is the maximum number of games the winner of the tournament can take part in (assuming the rule above is used). However, it is unlikely he can deal with this problem without your help.
|
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=1018) — the number of players to participate in the tournament.
|
Print the maximum number of games in which the winner of the tournament can take part.
|
[
"2\n",
"3\n",
"4\n",
"10\n"
] |
[
"1\n",
"2\n",
"2\n",
"4\n"
] |
In all samples we consider that player number 1 is the winner.
In the first sample, there would be only one game so the answer is 1.
In the second sample, player 1 can consequently beat players 2 and 3.
In the third sample, player 1 can't play with each other player as after he plays with players 2 and 3 he can't play against player 4, as he has 0 games played, while player 1 already played 2. Thus, the answer is 2 and to achieve we make pairs (1, 2) and (3, 4) and then clash the winners.
| 0
|
[
{
"input": "2",
"output": "1"
},
{
"input": "3",
"output": "2"
},
{
"input": "4",
"output": "2"
},
{
"input": "10",
"output": "4"
},
{
"input": "1000",
"output": "14"
},
{
"input": "2500",
"output": "15"
},
{
"input": "690000",
"output": "27"
},
{
"input": "3000000000",
"output": "45"
},
{
"input": "123456789123456789",
"output": "81"
},
{
"input": "5",
"output": "3"
},
{
"input": "143",
"output": "9"
},
{
"input": "144",
"output": "10"
},
{
"input": "145",
"output": "10"
},
{
"input": "232",
"output": "10"
},
{
"input": "233",
"output": "11"
},
{
"input": "234",
"output": "11"
},
{
"input": "679891637638612257",
"output": "84"
},
{
"input": "679891637638612258",
"output": "85"
},
{
"input": "679891637638612259",
"output": "85"
},
{
"input": "1000000000000000000",
"output": "85"
},
{
"input": "10235439547",
"output": "47"
},
{
"input": "1240723548",
"output": "43"
},
{
"input": "92353046212453",
"output": "66"
},
{
"input": "192403205846532",
"output": "68"
},
{
"input": "13925230525389",
"output": "62"
},
{
"input": "12048230592523",
"output": "62"
},
{
"input": "19204385325853",
"output": "63"
},
{
"input": "902353283921",
"output": "56"
},
{
"input": "793056859214355",
"output": "70"
},
{
"input": "982045466234565",
"output": "71"
},
{
"input": "126743950353465",
"output": "67"
},
{
"input": "12405430465",
"output": "47"
},
{
"input": "10238439257768",
"output": "61"
},
{
"input": "1728493055346",
"output": "58"
},
{
"input": "927553829046",
"output": "56"
},
{
"input": "62735129403",
"output": "51"
},
{
"input": "71624823950223",
"output": "65"
},
{
"input": "8902353464851212",
"output": "75"
},
{
"input": "61824012598535",
"output": "65"
},
{
"input": "1294902504603347",
"output": "71"
},
{
"input": "6",
"output": "3"
},
{
"input": "7",
"output": "3"
},
{
"input": "8",
"output": "4"
},
{
"input": "9",
"output": "4"
},
{
"input": "11",
"output": "4"
},
{
"input": "12",
"output": "4"
},
{
"input": "13",
"output": "5"
},
{
"input": "14",
"output": "5"
},
{
"input": "15",
"output": "5"
},
{
"input": "16",
"output": "5"
},
{
"input": "17",
"output": "5"
},
{
"input": "18",
"output": "5"
},
{
"input": "19",
"output": "5"
},
{
"input": "20",
"output": "5"
},
{
"input": "21",
"output": "6"
},
{
"input": "22",
"output": "6"
},
{
"input": "23",
"output": "6"
},
{
"input": "355687428096000",
"output": "69"
},
{
"input": "576460752303423488",
"output": "84"
},
{
"input": "32212254719",
"output": "49"
},
{
"input": "26388279066623",
"output": "63"
},
{
"input": "618473717761",
"output": "56"
},
{
"input": "262406072477",
"output": "54"
}
] | 1,552,412,731
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 63
| 109
| 0
|
n = int(input())
dp = [1, 2]
while dp[-2] + dp[-1] <= n:
dp.append(dp[-2] + dp[-1])
print(len(dp) - 1)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Famous Brazil city Rio de Janeiro holds a tennis tournament and Ostap Bender doesn't want to miss this event. There will be *n* players participating, and the tournament will follow knockout rules from the very first game. That means, that if someone loses a game he leaves the tournament immediately.
Organizers are still arranging tournament grid (i.e. the order games will happen and who is going to play with whom) but they have already fixed one rule: two players can play against each other only if the number of games one of them has already played differs by no more than one from the number of games the other one has already played. Of course, both players had to win all their games in order to continue participating in the tournament.
Tournament hasn't started yet so the audience is a bit bored. Ostap decided to find out what is the maximum number of games the winner of the tournament can take part in (assuming the rule above is used). However, it is unlikely he can deal with this problem without your help.
Input Specification:
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=1018) — the number of players to participate in the tournament.
Output Specification:
Print the maximum number of games in which the winner of the tournament can take part.
Demo Input:
['2\n', '3\n', '4\n', '10\n']
Demo Output:
['1\n', '2\n', '2\n', '4\n']
Note:
In all samples we consider that player number 1 is the winner.
In the first sample, there would be only one game so the answer is 1.
In the second sample, player 1 can consequently beat players 2 and 3.
In the third sample, player 1 can't play with each other player as after he plays with players 2 and 3 he can't play against player 4, as he has 0 games played, while player 1 already played 2. Thus, the answer is 2 and to achieve we make pairs (1, 2) and (3, 4) and then clash the winners.
|
```python
n = int(input())
dp = [1, 2]
while dp[-2] + dp[-1] <= n:
dp.append(dp[-2] + dp[-1])
print(len(dp) - 1)
```
| 3
|
|
386
|
A
|
Second-Price Auction
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
In this problem we consider a special type of an auction, which is called the second-price auction. As in regular auction *n* bidders place a bid which is price a bidder ready to pay. The auction is closed, that is, each bidder secretly informs the organizer of the auction price he is willing to pay. After that, the auction winner is the participant who offered the highest price. However, he pay not the price he offers, but the highest price among the offers of other participants (hence the name: the second-price auction).
Write a program that reads prices offered by bidders and finds the winner and the price he will pay. Consider that all of the offered prices are different.
|
The first line of the input contains *n* (2<=≤<=*n*<=≤<=1000) — number of bidders. The second line contains *n* distinct integer numbers *p*1,<=*p*2,<=... *p**n*, separated by single spaces (1<=≤<=*p**i*<=≤<=10000), where *p**i* stands for the price offered by the *i*-th bidder.
|
The single output line should contain two integers: index of the winner and the price he will pay. Indices are 1-based.
|
[
"2\n5 7\n",
"3\n10 2 8\n",
"6\n3 8 2 9 4 14\n"
] |
[
"2 5\n",
"1 8\n",
"6 9\n"
] |
none
| 500
|
[
{
"input": "2\n5 7",
"output": "2 5"
},
{
"input": "3\n10 2 8",
"output": "1 8"
},
{
"input": "6\n3 8 2 9 4 14",
"output": "6 9"
},
{
"input": "4\n4707 7586 4221 5842",
"output": "2 5842"
},
{
"input": "5\n3304 4227 4869 6937 6002",
"output": "4 6002"
},
{
"input": "6\n5083 3289 7708 5362 9031 7458",
"output": "5 7708"
},
{
"input": "7\n9038 6222 3392 1706 3778 1807 2657",
"output": "1 6222"
},
{
"input": "8\n7062 2194 4481 3864 7470 1814 8091 733",
"output": "7 7470"
},
{
"input": "9\n2678 5659 9199 2628 7906 7496 4524 2663 3408",
"output": "3 7906"
},
{
"input": "2\n3458 1504",
"output": "1 1504"
},
{
"input": "50\n9237 3904 407 9052 6657 9229 9752 3888 7732 2512 4614 1055 2355 7108 6506 6849 2529 8862 159 8630 7906 7941 960 8470 333 8659 54 9475 3163 5625 6393 6814 2656 3388 169 7918 4881 8468 9983 6281 6340 280 5108 2996 101 7617 3313 8172 326 1991",
"output": "39 9752"
},
{
"input": "100\n2515 3324 7975 6171 4240 1217 4829 5203 8603 6900 3031 4699 4732 6070 4221 3228 6497 7359 9130 4346 4619 1109 3945 5442 3271 16 9711 2045 6410 2301 3406 8125 6003 1892 1260 9661 3940 6692 4708 7027 4930 6925 1979 5361 4263 3144 867 8639 6230 5562 9714 3676 4231 3347 4733 4920 4881 3431 1059 7313 8912 3038 9308 72 9583 7009 3034 7425 2398 6141 3245 2495 2933 6710 8289 9806 1226 8393 7349 6462 1618 9613 3546 6012 2964 9995 1578 210 2123 4874 1252 8625 348 8020 803 7244 9080 5088 706 2602",
"output": "86 9806"
},
{
"input": "2\n2 1",
"output": "1 1"
},
{
"input": "2\n1 2",
"output": "2 1"
},
{
"input": "3\n10 20 30",
"output": "3 20"
},
{
"input": "3\n10 30 20",
"output": "2 20"
},
{
"input": "3\n20 10 30",
"output": "3 20"
},
{
"input": "3\n20 30 10",
"output": "2 20"
},
{
"input": "3\n30 10 20",
"output": "1 20"
},
{
"input": "3\n30 20 10",
"output": "1 20"
},
{
"input": "2\n1 10000",
"output": "2 1"
},
{
"input": "2\n10000 999",
"output": "1 999"
},
{
"input": "3\n3 4 1",
"output": "2 3"
},
{
"input": "6\n1 2 24 6 5 7",
"output": "3 7"
}
] | 1,666,892,999
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 42
| 93
| 0
|
x = int(input())
z = input().split(" ")
fin = ""
for i in range(len(z)):
z[i] = int(z[i])
highest = z.index(max(z))
fin += str(highest+1)
fin += " "
z.sort()
sndhigh = z[-2]
fin += str(sndhigh)
print(fin)
|
Title: Second-Price Auction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In this problem we consider a special type of an auction, which is called the second-price auction. As in regular auction *n* bidders place a bid which is price a bidder ready to pay. The auction is closed, that is, each bidder secretly informs the organizer of the auction price he is willing to pay. After that, the auction winner is the participant who offered the highest price. However, he pay not the price he offers, but the highest price among the offers of other participants (hence the name: the second-price auction).
Write a program that reads prices offered by bidders and finds the winner and the price he will pay. Consider that all of the offered prices are different.
Input Specification:
The first line of the input contains *n* (2<=≤<=*n*<=≤<=1000) — number of bidders. The second line contains *n* distinct integer numbers *p*1,<=*p*2,<=... *p**n*, separated by single spaces (1<=≤<=*p**i*<=≤<=10000), where *p**i* stands for the price offered by the *i*-th bidder.
Output Specification:
The single output line should contain two integers: index of the winner and the price he will pay. Indices are 1-based.
Demo Input:
['2\n5 7\n', '3\n10 2 8\n', '6\n3 8 2 9 4 14\n']
Demo Output:
['2 5\n', '1 8\n', '6 9\n']
Note:
none
|
```python
x = int(input())
z = input().split(" ")
fin = ""
for i in range(len(z)):
z[i] = int(z[i])
highest = z.index(max(z))
fin += str(highest+1)
fin += " "
z.sort()
sndhigh = z[-2]
fin += str(sndhigh)
print(fin)
```
| 3
|
|
984
|
B
|
Minesweeper
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
One day Alex decided to remember childhood when computers were not too powerful and lots of people played only default games. Alex enjoyed playing Minesweeper that time. He imagined that he saved world from bombs planted by terrorists, but he rarely won.
Alex has grown up since then, so he easily wins the most difficult levels. This quickly bored him, and he thought: what if the computer gave him invalid fields in the childhood and Alex could not win because of it?
He needs your help to check it.
A Minesweeper field is a rectangle $n \times m$, where each cell is either empty, or contains a digit from $1$ to $8$, or a bomb. The field is valid if for each cell:
- if there is a digit $k$ in the cell, then exactly $k$ neighboring cells have bombs. - if the cell is empty, then all neighboring cells have no bombs.
Two cells are neighbors if they have a common side or a corner (i. e. a cell has at most $8$ neighboring cells).
|
The first line contains two integers $n$ and $m$ ($1 \le n, m \le 100$) — the sizes of the field.
The next $n$ lines contain the description of the field. Each line contains $m$ characters, each of them is "." (if this cell is empty), "*" (if there is bomb in this cell), or a digit from $1$ to $8$, inclusive.
|
Print "YES", if the field is valid and "NO" otherwise.
You can choose the case (lower or upper) for each letter arbitrarily.
|
[
"3 3\n111\n1*1\n111\n",
"2 4\n*.*.\n1211\n"
] |
[
"YES",
"NO"
] |
In the second example the answer is "NO" because, if the positions of the bombs are preserved, the first line of the field should be *2*1.
You can read more about Minesweeper in [Wikipedia's article](https://en.wikipedia.org/wiki/Minesweeper_(video_game)).
| 1,000
|
[
{
"input": "3 3\n111\n1*1\n111",
"output": "YES"
},
{
"input": "2 4\n*.*.\n1211",
"output": "NO"
},
{
"input": "1 10\n.....1*1..",
"output": "YES"
},
{
"input": "1 1\n4",
"output": "NO"
},
{
"input": "10 10\n..........\n...111111.\n..13*21*1.\n.12**2111.\n.1*542..11\n.13**1..1*\n..2*31..11\n..111..111\n.......1*1\n.......111",
"output": "YES"
},
{
"input": "10 17\n12*2*22123*31....\n2*333*3*4***3211.\n*22*213**4***3*1.\n11111.12224*6*21.\n221..111.14**4311\n**2233*212****2*1\n*55***4*13*544421\n2***54*322*21**31\n13*4*33*221114*4*\n.1122*22*1...2*31",
"output": "YES"
},
{
"input": "10 10\n**********\n**********\n**********\n**********\n**********\n******3***\n**********\n**********\n**********\n***3.5****",
"output": "NO"
},
{
"input": "21 10\n62637783*1\n23*51**531\n35*7*6.**.\n.*3***581*\n2.32*745**\n83*7*6*6*5\n*74.**6**3\n323*6**7*6\n3454*67.*1\n**63265*6*\n3725*4553*\n24****5**4\n23.34****4\n55257*1*4*\n4*3253*456\n**.3*45488\n*7318**4*5\n234.*4557*\n12..21*.*3\n286.225*4*\n834*11*.3*",
"output": "NO"
},
{
"input": "10 10\n**********\n*********6\n*********5\n**********\n**********\n**********\n**********\n**********\n**********\n**********",
"output": "NO"
},
{
"input": "100 1\n.\n.\n.\n.\n1\n*\n2\n*\n1\n.\n.\n.\n.\n.\n.\n1\n*\n1\n1\n*\n1\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n1\n*\n2\n*\n*\n*\n1\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n1\n*\n2\n*\n1\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.",
"output": "YES"
},
{
"input": "1 100\n*************5****5****************************************************4****************************",
"output": "NO"
},
{
"input": "1 100\n.....1*1........1*1................................1*1...1**11*1.......1*1....1.....1*1.....1*1...1*",
"output": "NO"
},
{
"input": "1 10\n881111882*",
"output": "NO"
},
{
"input": "5 5\n*2221\n24**2\n*3*5*\n3425*\n**12*",
"output": "NO"
},
{
"input": "5 5\n****2\n4***4\n3****\n3*563\n*22**",
"output": "NO"
},
{
"input": "5 5\n***2.\n5**31\n**6**\n***43\n**31*",
"output": "NO"
},
{
"input": "5 5\n*32**\n4*3*4\n**44*\n**45*\n*4***",
"output": "NO"
},
{
"input": "3 3\n***\n*2*\n***",
"output": "NO"
},
{
"input": "1 1\n*",
"output": "YES"
},
{
"input": "1 2\n*1",
"output": "YES"
},
{
"input": "1 2\n*2",
"output": "NO"
},
{
"input": "2 2\n32\n**",
"output": "NO"
},
{
"input": "3 3\n...\n232\n***",
"output": "YES"
},
{
"input": "3 2\n..\n11\n.*",
"output": "NO"
},
{
"input": "2 3\n1*2\n3*2",
"output": "NO"
},
{
"input": "1 3\n.*.",
"output": "NO"
},
{
"input": "3 1\n.\n*\n.",
"output": "NO"
},
{
"input": "3 1\n1\n*\n1",
"output": "YES"
},
{
"input": "3 1\n*\n1\n*",
"output": "NO"
},
{
"input": "1 3\n1**",
"output": "YES"
},
{
"input": "1 1\n8",
"output": "NO"
},
{
"input": "1 1\n.",
"output": "YES"
},
{
"input": "1 2\n2*",
"output": "NO"
},
{
"input": "2 1\n*\n2",
"output": "NO"
},
{
"input": "2 1\n*\n*",
"output": "YES"
},
{
"input": "2 1\n.\n1",
"output": "NO"
},
{
"input": "1 3\n..1",
"output": "NO"
},
{
"input": "3 3\n112\n1*1\n111",
"output": "NO"
},
{
"input": "3 3\n11.\n1*1\n111",
"output": "NO"
},
{
"input": "3 3\n151\n1*1\n111",
"output": "NO"
},
{
"input": "3 3\n1.1\n1*1\n111",
"output": "NO"
},
{
"input": "3 3\n611\n1*1\n111",
"output": "NO"
},
{
"input": "3 3\n.11\n1*1\n111",
"output": "NO"
},
{
"input": "3 3\n111\n2*1\n111",
"output": "NO"
},
{
"input": "3 3\n111\n**1\n111",
"output": "NO"
},
{
"input": "3 3\n111\n5*1\n111",
"output": "NO"
},
{
"input": "3 3\n111\n.*1\n111",
"output": "NO"
},
{
"input": "3 3\n111\n1*1\n411",
"output": "NO"
},
{
"input": "3 3\n111\n1*1\n.11",
"output": "NO"
},
{
"input": "3 3\n111\n1*1\n121",
"output": "NO"
},
{
"input": "3 3\n111\n1*1\n1.1",
"output": "NO"
},
{
"input": "3 3\n111\n1*1\n115",
"output": "NO"
},
{
"input": "3 3\n111\n1*1\n11.",
"output": "NO"
},
{
"input": "3 3\n111\n1*4\n111",
"output": "NO"
},
{
"input": "3 3\n111\n1*.\n111",
"output": "NO"
},
{
"input": "1 4\n*222",
"output": "NO"
},
{
"input": "1 1\n*",
"output": "YES"
},
{
"input": "2 2\n**\n**",
"output": "YES"
},
{
"input": "3 3\n***\n*.*\n***",
"output": "NO"
},
{
"input": "3 3\n***\n***\n***",
"output": "YES"
},
{
"input": "3 3\n***\n*4*\n***",
"output": "NO"
},
{
"input": "2 6\n....1.\n.....*",
"output": "NO"
},
{
"input": "5 5\n*****\n*****\n*****\n*****\n*****",
"output": "YES"
},
{
"input": "4 1\n.\n*\n.\n.",
"output": "NO"
},
{
"input": "2 2\n2*\n11",
"output": "NO"
},
{
"input": "3 3\n888\n888\n888",
"output": "NO"
},
{
"input": "1 4\n*22*",
"output": "NO"
}
] | 1,586,856,234
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 4
| 202
| 2,150,400
|
n,m = map(int,input().split())
arr = []
for i in range(n):
arr.append(list(input()))
ans = True
for i in range(n):
if not ans:
break
for j in range(m):
try:
b = 0
g = int(arr[i][j])
if i-1>=0 and j-1>=0 and arr[i-1][j-1]=='*':
b+=1
if i-1>=0 and arr[i-1][j]=='*':
b+=1
if i-1>=0 and j+1<m and arr[i-1][j+1]=='*':
b+=1
if j-1>=0 and arr[i][j-1]=='*':
b+=1
if j+1<m and arr[i][j+1]=='*':
b+=1
if i+1<n and j-1>=0 and arr[i+1][j-1]=='*':
b+=1
if i+1<n and arr[i+1][j]=='*':
b+=1
if i+1<n and j+1<m and arr[i+1][j+1]=='*':
b+=1
if b!=g:
ans = False
break
except:
b = 0
if arr[i][j]=='.':
if i-1>=0 and j-1>=0 and arr[i-1][j-1]=='*':
b+=1
if i-1>=0 and arr[i-1][j]=='*':
b+=1
if i-1>=0 and j+1<m and arr[i-1][j+1]=='*':
b+=1
if j-1>=0 and arr[i][j-1]=='*':
b+=1
if j+1<m and arr[i][j+1]=='*':
b+=1
if i+1<n and j-1>=0 and arr[i+1][j+1]=='*':
b+=1
if i+1<n and arr[i+1][j]=='*':
b+=1
if i+1<n and j+1<m and arr[i+1][j+1]=='*':
b+=1
if b>0:
ans = False
break
if ans:
print('YES')
else:
print('NO')
|
Title: Minesweeper
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Alex decided to remember childhood when computers were not too powerful and lots of people played only default games. Alex enjoyed playing Minesweeper that time. He imagined that he saved world from bombs planted by terrorists, but he rarely won.
Alex has grown up since then, so he easily wins the most difficult levels. This quickly bored him, and he thought: what if the computer gave him invalid fields in the childhood and Alex could not win because of it?
He needs your help to check it.
A Minesweeper field is a rectangle $n \times m$, where each cell is either empty, or contains a digit from $1$ to $8$, or a bomb. The field is valid if for each cell:
- if there is a digit $k$ in the cell, then exactly $k$ neighboring cells have bombs. - if the cell is empty, then all neighboring cells have no bombs.
Two cells are neighbors if they have a common side or a corner (i. e. a cell has at most $8$ neighboring cells).
Input Specification:
The first line contains two integers $n$ and $m$ ($1 \le n, m \le 100$) — the sizes of the field.
The next $n$ lines contain the description of the field. Each line contains $m$ characters, each of them is "." (if this cell is empty), "*" (if there is bomb in this cell), or a digit from $1$ to $8$, inclusive.
Output Specification:
Print "YES", if the field is valid and "NO" otherwise.
You can choose the case (lower or upper) for each letter arbitrarily.
Demo Input:
['3 3\n111\n1*1\n111\n', '2 4\n*.*.\n1211\n']
Demo Output:
['YES', 'NO']
Note:
In the second example the answer is "NO" because, if the positions of the bombs are preserved, the first line of the field should be *2*1.
You can read more about Minesweeper in [Wikipedia's article](https://en.wikipedia.org/wiki/Minesweeper_(video_game)).
|
```python
n,m = map(int,input().split())
arr = []
for i in range(n):
arr.append(list(input()))
ans = True
for i in range(n):
if not ans:
break
for j in range(m):
try:
b = 0
g = int(arr[i][j])
if i-1>=0 and j-1>=0 and arr[i-1][j-1]=='*':
b+=1
if i-1>=0 and arr[i-1][j]=='*':
b+=1
if i-1>=0 and j+1<m and arr[i-1][j+1]=='*':
b+=1
if j-1>=0 and arr[i][j-1]=='*':
b+=1
if j+1<m and arr[i][j+1]=='*':
b+=1
if i+1<n and j-1>=0 and arr[i+1][j-1]=='*':
b+=1
if i+1<n and arr[i+1][j]=='*':
b+=1
if i+1<n and j+1<m and arr[i+1][j+1]=='*':
b+=1
if b!=g:
ans = False
break
except:
b = 0
if arr[i][j]=='.':
if i-1>=0 and j-1>=0 and arr[i-1][j-1]=='*':
b+=1
if i-1>=0 and arr[i-1][j]=='*':
b+=1
if i-1>=0 and j+1<m and arr[i-1][j+1]=='*':
b+=1
if j-1>=0 and arr[i][j-1]=='*':
b+=1
if j+1<m and arr[i][j+1]=='*':
b+=1
if i+1<n and j-1>=0 and arr[i+1][j+1]=='*':
b+=1
if i+1<n and arr[i+1][j]=='*':
b+=1
if i+1<n and j+1<m and arr[i+1][j+1]=='*':
b+=1
if b>0:
ans = False
break
if ans:
print('YES')
else:
print('NO')
```
| -1
|
|
209
|
A
|
Multicolored Marbles
|
PROGRAMMING
| 1,600
|
[
"dp",
"math"
] | null | null |
Polycarpus plays with red and blue marbles. He put *n* marbles from the left to the right in a row. As it turned out, the marbles form a zebroid.
A non-empty sequence of red and blue marbles is a zebroid, if the colors of the marbles in this sequence alternate. For example, sequences (red; blue; red) and (blue) are zebroids and sequence (red; red) is not a zebroid.
Now Polycarpus wonders, how many ways there are to pick a zebroid subsequence from this sequence. Help him solve the problem, find the number of ways modulo 1000000007 (109<=+<=7).
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=106) — the number of marbles in Polycarpus's sequence.
|
Print a single number — the answer to the problem modulo 1000000007 (109<=+<=7).
|
[
"3\n",
"4\n"
] |
[
"6\n",
"11\n"
] |
Let's consider the first test sample. Let's assume that Polycarpus initially had sequence (red; blue; red), so there are six ways to pick a zebroid:
- pick the first marble; - pick the second marble; - pick the third marble; - pick the first and second marbles; - pick the second and third marbles; - pick the first, second and third marbles.
It can be proven that if Polycarpus picks (blue; red; blue) as the initial sequence, the number of ways won't change.
| 500
|
[
{
"input": "3",
"output": "6"
},
{
"input": "4",
"output": "11"
},
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "3"
},
{
"input": "5",
"output": "19"
},
{
"input": "6",
"output": "32"
},
{
"input": "7",
"output": "53"
},
{
"input": "8",
"output": "87"
},
{
"input": "9",
"output": "142"
},
{
"input": "10",
"output": "231"
},
{
"input": "11",
"output": "375"
},
{
"input": "12",
"output": "608"
},
{
"input": "13",
"output": "985"
},
{
"input": "14",
"output": "1595"
},
{
"input": "15",
"output": "2582"
},
{
"input": "16",
"output": "4179"
},
{
"input": "17",
"output": "6763"
},
{
"input": "18",
"output": "10944"
},
{
"input": "19",
"output": "17709"
},
{
"input": "20",
"output": "28655"
},
{
"input": "21",
"output": "46366"
},
{
"input": "22",
"output": "75023"
},
{
"input": "30",
"output": "3524576"
},
{
"input": "40",
"output": "433494435"
},
{
"input": "35",
"output": "39088167"
},
{
"input": "747",
"output": "864986803"
},
{
"input": "811",
"output": "121575679"
},
{
"input": "523",
"output": "810594171"
},
{
"input": "939",
"output": "834252191"
},
{
"input": "7218",
"output": "124017976"
},
{
"input": "6578",
"output": "105202924"
},
{
"input": "4994",
"output": "909729063"
},
{
"input": "3410",
"output": "995527079"
},
{
"input": "9122",
"output": "424682518"
},
{
"input": "11500",
"output": "123418864"
},
{
"input": "37212",
"output": "991850249"
},
{
"input": "95628",
"output": "265542306"
},
{
"input": "21341",
"output": "913329411"
},
{
"input": "63405",
"output": "206564501"
},
{
"input": "670293",
"output": "922731630"
},
{
"input": "12357",
"output": "808648710"
},
{
"input": "838069",
"output": "536545985"
},
{
"input": "696485",
"output": "467961960"
},
{
"input": "1000000",
"output": "986892583"
},
{
"input": "999999",
"output": "452491920"
},
{
"input": "999998",
"output": "534400661"
},
{
"input": "999997",
"output": "918091264"
},
{
"input": "999996",
"output": "616309402"
},
{
"input": "999000",
"output": "47031574"
},
{
"input": "100",
"output": "252403354"
}
] | 1,579,087,666
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 50
| 1,278
| 0
|
n=int(input())
a,b=0,0
for i in range(n):
if i%2==0:a+=b+1
else:b+=a+1
a,b=a%1000000007,b%1000000007
print((a+b)%1000000007)
|
Title: Multicolored Marbles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus plays with red and blue marbles. He put *n* marbles from the left to the right in a row. As it turned out, the marbles form a zebroid.
A non-empty sequence of red and blue marbles is a zebroid, if the colors of the marbles in this sequence alternate. For example, sequences (red; blue; red) and (blue) are zebroids and sequence (red; red) is not a zebroid.
Now Polycarpus wonders, how many ways there are to pick a zebroid subsequence from this sequence. Help him solve the problem, find the number of ways modulo 1000000007 (109<=+<=7).
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=106) — the number of marbles in Polycarpus's sequence.
Output Specification:
Print a single number — the answer to the problem modulo 1000000007 (109<=+<=7).
Demo Input:
['3\n', '4\n']
Demo Output:
['6\n', '11\n']
Note:
Let's consider the first test sample. Let's assume that Polycarpus initially had sequence (red; blue; red), so there are six ways to pick a zebroid:
- pick the first marble; - pick the second marble; - pick the third marble; - pick the first and second marbles; - pick the second and third marbles; - pick the first, second and third marbles.
It can be proven that if Polycarpus picks (blue; red; blue) as the initial sequence, the number of ways won't change.
|
```python
n=int(input())
a,b=0,0
for i in range(n):
if i%2==0:a+=b+1
else:b+=a+1
a,b=a%1000000007,b%1000000007
print((a+b)%1000000007)
```
| 3
|
|
1,011
|
B
|
Planning The Expedition
|
PROGRAMMING
| 1,200
|
[
"binary search",
"brute force",
"implementation"
] | null | null |
Natasha is planning an expedition to Mars for $n$ people. One of the important tasks is to provide food for each participant.
The warehouse has $m$ daily food packages. Each package has some food type $a_i$.
Each participant must eat exactly one food package each day. Due to extreme loads, each participant must eat the same food type throughout the expedition. Different participants may eat different (or the same) types of food.
Formally, for each participant $j$ Natasha should select his food type $b_j$ and each day $j$-th participant will eat one food package of type $b_j$. The values $b_j$ for different participants may be different.
What is the maximum possible number of days the expedition can last, following the requirements above?
|
The first line contains two integers $n$ and $m$ ($1 \le n \le 100$, $1 \le m \le 100$) — the number of the expedition participants and the number of the daily food packages available.
The second line contains sequence of integers $a_1, a_2, \dots, a_m$ ($1 \le a_i \le 100$), where $a_i$ is the type of $i$-th food package.
|
Print the single integer — the number of days the expedition can last. If it is not possible to plan the expedition for even one day, print 0.
|
[
"4 10\n1 5 2 1 1 1 2 5 7 2\n",
"100 1\n1\n",
"2 5\n5 4 3 2 1\n",
"3 9\n42 42 42 42 42 42 42 42 42\n"
] |
[
"2\n",
"0\n",
"1\n",
"3\n"
] |
In the first example, Natasha can assign type $1$ food to the first participant, the same type $1$ to the second, type $5$ to the third and type $2$ to the fourth. In this case, the expedition can last for $2$ days, since each participant can get two food packages of his food type (there will be used $4$ packages of type $1$, two packages of type $2$ and two packages of type $5$).
In the second example, there are $100$ participants and only $1$ food package. In this case, the expedition can't last even $1$ day.
| 1,000
|
[
{
"input": "4 10\n1 5 2 1 1 1 2 5 7 2",
"output": "2"
},
{
"input": "100 1\n1",
"output": "0"
},
{
"input": "2 5\n5 4 3 2 1",
"output": "1"
},
{
"input": "3 9\n42 42 42 42 42 42 42 42 42",
"output": "3"
},
{
"input": "1 1\n100",
"output": "1"
},
{
"input": "4 100\n84 99 66 69 86 94 89 96 98 93 93 82 87 93 91 100 69 99 93 81 99 84 75 100 86 88 98 100 84 96 44 70 94 91 85 78 86 79 45 88 91 78 98 94 81 87 93 72 96 88 96 97 96 62 86 72 94 84 80 98 88 90 93 73 73 98 78 50 91 96 97 82 85 90 87 41 97 82 97 77 100 100 92 83 98 81 70 81 74 78 84 79 98 98 55 99 97 99 79 98",
"output": "5"
},
{
"input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "6 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "15"
},
{
"input": "1 1\n59",
"output": "1"
},
{
"input": "1 50\n39 1 46 21 23 28 100 32 63 63 18 15 40 29 34 49 56 74 47 42 96 97 59 62 76 62 69 61 36 21 66 18 92 58 63 85 5 6 77 75 91 66 38 10 66 43 20 74 37 83",
"output": "3"
},
{
"input": "1 100\n83 72 21 55 49 5 61 60 87 21 89 88 3 75 49 81 36 25 50 61 96 19 36 55 48 8 97 69 50 24 23 39 26 25 41 90 69 20 19 62 38 52 60 6 66 31 9 45 36 12 69 94 22 60 91 65 35 58 13 85 33 87 83 11 95 20 20 85 13 21 57 69 17 94 78 37 59 45 60 7 64 51 60 89 91 22 6 58 95 96 51 53 89 22 28 16 27 56 1 54",
"output": "5"
},
{
"input": "50 1\n75",
"output": "0"
},
{
"input": "50 50\n85 20 12 73 52 78 70 95 88 43 31 88 81 41 80 99 16 11 97 11 21 44 2 34 47 38 87 2 32 47 97 93 52 14 35 37 97 48 58 19 52 55 97 72 17 25 16 85 90 58",
"output": "1"
},
{
"input": "50 100\n2 37 74 32 99 75 73 86 67 33 62 30 15 21 51 41 73 75 67 39 90 10 56 74 72 26 38 65 75 55 46 99 34 49 92 82 11 100 15 71 75 12 22 56 47 74 20 98 59 65 14 76 1 40 89 36 43 93 83 73 75 100 50 95 27 10 72 51 25 69 15 3 57 60 84 99 31 44 12 61 69 95 51 31 28 36 57 35 31 52 44 19 79 12 27 27 7 81 68 1",
"output": "1"
},
{
"input": "100 1\n26",
"output": "0"
},
{
"input": "100 50\n8 82 62 11 85 57 5 32 99 92 77 2 61 86 8 88 10 28 83 4 68 79 8 64 56 98 4 88 22 54 30 60 62 79 72 38 17 28 32 16 62 26 56 44 72 33 22 84 77 45",
"output": "0"
},
{
"input": "100 100\n13 88 64 65 78 10 61 97 16 32 76 9 60 1 40 35 90 61 60 85 26 16 38 36 33 95 24 55 82 88 13 9 47 34 94 2 90 74 11 81 46 70 94 11 55 32 19 36 97 16 17 35 38 82 89 16 74 94 97 79 9 94 88 12 28 2 4 25 72 95 49 31 88 82 6 77 70 98 90 57 57 33 38 61 26 75 2 66 22 44 13 35 16 4 33 16 12 66 32 86",
"output": "1"
},
{
"input": "34 64\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "53 98\n1 1 2 2 2 2 2 1 2 2 2 1 1 2 2 2 1 1 2 1 1 2 2 1 1 2 1 1 1 2 1 2 1 1 1 2 2 1 2 1 1 1 2 2 1 2 1 1 2 1 2 2 1 2 2 2 2 2 2 2 2 2 1 1 2 2 1 2 1 2 1 2 1 1 2 2 2 1 1 2 1 2 1 1 1 1 2 2 2 2 2 1 1 2 2 2 1 1",
"output": "1"
},
{
"input": "17 8\n2 5 3 4 3 2 2 2",
"output": "0"
},
{
"input": "24 77\n8 6 10 4 6 6 4 10 9 7 7 5 5 4 6 7 10 6 3 4 6 6 4 9 4 6 2 5 3 4 4 1 4 6 6 8 1 1 6 4 6 2 5 7 7 2 4 4 10 1 10 9 2 3 8 1 10 4 3 9 3 8 3 5 6 3 4 9 5 3 4 1 1 6 1 2 1",
"output": "2"
},
{
"input": "65 74\n7 19 2 38 28 44 34 49 14 13 30 22 11 4 4 12 8 1 40 8 34 31 44 38 21 35 13 7 19 32 37 5 36 26 7 2 15 11 47 45 48 2 49 10 10 42 42 31 50 24 29 34 31 38 39 48 43 47 32 46 10 1 33 21 12 50 13 44 38 11 41 41 10 7",
"output": "1"
},
{
"input": "37 71\n50 93 15 80 82 23 35 90 70 73 55 23 23 6 86 63 38 70 38 52 88 34 25 75 32 19 6 98 31 38 21 8 66 8 59 71 7 80 69 23 17 70 6 40 72 5 48 59 18 1 48 91 17 41 11 27 53 95 87 31 62 94 94 60 38 99 70 50 81 86 44",
"output": "1"
},
{
"input": "35 4\n100 100 100 100",
"output": "0"
},
{
"input": "68 12\n100 100 100 99 99 100 100 100 99 99 99 99",
"output": "0"
},
{
"input": "91 33\n97 100 96 96 97 100 97 97 96 96 99 99 98 97 97 99 99 98 100 96 96 99 100 96 97 100 97 97 99 98 96 98 97",
"output": "0"
},
{
"input": "59 72\n99 96 96 93 94 97 93 96 100 99 93 99 96 92 92 97 93 100 92 100 91 96 99 100 97 98 93 93 96 100 97 99 100 100 91 93 96 91 93 100 95 96 92 97 91 91 99 100 91 95 95 100 92 93 98 93 95 92 95 100 91 95 99 95 92 91 100 93 98 98 96 99",
"output": "1"
},
{
"input": "9 35\n95 54 78 94 56 63 68 73 61 85 73 62 61 94 67 91 66 54 89 69 92 60 91 87 63 62 85 70 62 68 97 88 96 55 62",
"output": "2"
},
{
"input": "99 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "1 50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "50"
}
] | 1,580,277,691
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 31
| 234
| 2,355,200
|
# maa chudaaye duniya
from copy import copy
n, m = map(int, input().split())
arr = [0]*(101)
a = list(map(int, input().split()))
for i in a:
arr[i] += 1
d = 100
f = False
while d >= 1:
cc = copy(arr)
k = 0
for i in range(1, 101) :
while cc[i] >= d:
k += 1
cc[i] -= d
if k>=n:
print(d)
f = True
break
d -= 1
if not f:
print(0)
|
Title: Planning The Expedition
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Natasha is planning an expedition to Mars for $n$ people. One of the important tasks is to provide food for each participant.
The warehouse has $m$ daily food packages. Each package has some food type $a_i$.
Each participant must eat exactly one food package each day. Due to extreme loads, each participant must eat the same food type throughout the expedition. Different participants may eat different (or the same) types of food.
Formally, for each participant $j$ Natasha should select his food type $b_j$ and each day $j$-th participant will eat one food package of type $b_j$. The values $b_j$ for different participants may be different.
What is the maximum possible number of days the expedition can last, following the requirements above?
Input Specification:
The first line contains two integers $n$ and $m$ ($1 \le n \le 100$, $1 \le m \le 100$) — the number of the expedition participants and the number of the daily food packages available.
The second line contains sequence of integers $a_1, a_2, \dots, a_m$ ($1 \le a_i \le 100$), where $a_i$ is the type of $i$-th food package.
Output Specification:
Print the single integer — the number of days the expedition can last. If it is not possible to plan the expedition for even one day, print 0.
Demo Input:
['4 10\n1 5 2 1 1 1 2 5 7 2\n', '100 1\n1\n', '2 5\n5 4 3 2 1\n', '3 9\n42 42 42 42 42 42 42 42 42\n']
Demo Output:
['2\n', '0\n', '1\n', '3\n']
Note:
In the first example, Natasha can assign type $1$ food to the first participant, the same type $1$ to the second, type $5$ to the third and type $2$ to the fourth. In this case, the expedition can last for $2$ days, since each participant can get two food packages of his food type (there will be used $4$ packages of type $1$, two packages of type $2$ and two packages of type $5$).
In the second example, there are $100$ participants and only $1$ food package. In this case, the expedition can't last even $1$ day.
|
```python
# maa chudaaye duniya
from copy import copy
n, m = map(int, input().split())
arr = [0]*(101)
a = list(map(int, input().split()))
for i in a:
arr[i] += 1
d = 100
f = False
while d >= 1:
cc = copy(arr)
k = 0
for i in range(1, 101) :
while cc[i] >= d:
k += 1
cc[i] -= d
if k>=n:
print(d)
f = True
break
d -= 1
if not f:
print(0)
```
| 3
|
|
768
|
A
|
Oath of the Night's Watch
|
PROGRAMMING
| 900
|
[
"constructive algorithms",
"sortings"
] | null | null |
"Night gathers, and now my watch begins. It shall not end until my death. I shall take no wife, hold no lands, father no children. I shall wear no crowns and win no glory. I shall live and die at my post. I am the sword in the darkness. I am the watcher on the walls. I am the shield that guards the realms of men. I pledge my life and honor to the Night's Watch, for this night and all the nights to come." — The Night's Watch oath.
With that begins the watch of Jon Snow. He is assigned the task to support the stewards.
This time he has *n* stewards with him whom he has to provide support. Each steward has his own strength. Jon Snow likes to support a steward only if there exists at least one steward who has strength strictly less than him and at least one steward who has strength strictly greater than him.
Can you find how many stewards will Jon support?
|
First line consists of a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of stewards with Jon Snow.
Second line consists of *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) representing the values assigned to the stewards.
|
Output a single integer representing the number of stewards which Jon will feed.
|
[
"2\n1 5\n",
"3\n1 2 5\n"
] |
[
"0",
"1"
] |
In the first sample, Jon Snow cannot support steward with strength 1 because there is no steward with strength less than 1 and he cannot support steward with strength 5 because there is no steward with strength greater than 5.
In the second sample, Jon Snow can support steward with strength 2 because there are stewards with strength less than 2 and greater than 2.
| 500
|
[
{
"input": "2\n1 5",
"output": "0"
},
{
"input": "3\n1 2 5",
"output": "1"
},
{
"input": "4\n1 2 3 4",
"output": "2"
},
{
"input": "8\n7 8 9 4 5 6 1 2",
"output": "6"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n100",
"output": "0"
},
{
"input": "205\n5 5 3 3 6 2 9 3 8 9 6 6 10 8 1 5 3 3 1 2 9 9 9 3 9 10 3 9 8 3 5 6 6 4 6 9 2 9 10 9 5 6 6 7 4 2 6 3 4 1 10 1 7 2 7 7 3 2 6 5 5 2 9 3 8 8 7 6 6 4 2 2 6 2 3 5 7 2 2 10 1 4 6 9 2 3 7 2 2 7 4 4 9 10 7 5 8 6 5 3 6 10 2 7 5 6 6 8 3 3 9 4 3 5 7 9 3 2 1 1 3 2 1 9 3 1 4 4 10 2 5 5 8 1 4 8 5 3 1 10 8 6 5 8 3 5 4 5 4 4 6 7 2 8 10 8 7 6 6 9 6 7 1 10 3 2 5 10 4 4 5 4 3 4 8 5 3 8 10 3 10 9 7 2 1 8 6 4 6 5 8 10 2 6 7 4 9 4 5 1 8 7 10 3 1",
"output": "174"
},
{
"input": "4\n1000000000 99999999 1000000000 1000000000",
"output": "0"
},
{
"input": "3\n2 2 2",
"output": "0"
},
{
"input": "5\n1 1 1 1 1",
"output": "0"
},
{
"input": "3\n1 1 1",
"output": "0"
},
{
"input": "6\n1 1 3 3 2 2",
"output": "2"
},
{
"input": "7\n1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "4\n1 1 2 5",
"output": "1"
},
{
"input": "3\n0 0 0",
"output": "0"
},
{
"input": "5\n0 0 0 0 0",
"output": "0"
},
{
"input": "5\n1 1 1 1 5",
"output": "0"
},
{
"input": "5\n1 1 2 3 3",
"output": "1"
},
{
"input": "3\n1 1 3",
"output": "0"
},
{
"input": "3\n2 2 3",
"output": "0"
},
{
"input": "1\n6",
"output": "0"
},
{
"input": "5\n1 5 3 5 1",
"output": "1"
},
{
"input": "7\n1 2 2 2 2 2 3",
"output": "5"
},
{
"input": "4\n2 2 2 2",
"output": "0"
},
{
"input": "9\n2 2 2 3 4 5 6 6 6",
"output": "3"
},
{
"input": "10\n1 1 1 2 3 3 3 3 3 3",
"output": "1"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "0"
},
{
"input": "3\n0 0 1",
"output": "0"
},
{
"input": "9\n1 1 1 2 2 2 3 3 3",
"output": "3"
},
{
"input": "3\n1 2 2",
"output": "0"
},
{
"input": "6\n2 2 2 2 2 2",
"output": "0"
},
{
"input": "5\n2 2 2 2 2",
"output": "0"
},
{
"input": "5\n5 5 5 5 5",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "6\n1 2 5 5 5 5",
"output": "1"
},
{
"input": "5\n1 2 3 3 3",
"output": "1"
},
{
"input": "3\n1 1 2",
"output": "0"
},
{
"input": "6\n1 1 1 1 1 2",
"output": "0"
},
{
"input": "5\n1 1 2 4 4",
"output": "1"
},
{
"input": "3\n999999 5999999 9999999",
"output": "1"
},
{
"input": "4\n1 1 5 5",
"output": "0"
},
{
"input": "9\n1 1 1 2 2 2 4 4 4",
"output": "3"
},
{
"input": "5\n1 3 4 5 1",
"output": "2"
},
{
"input": "5\n3 3 3 3 3",
"output": "0"
},
{
"input": "5\n1 1 2 2 2",
"output": "0"
},
{
"input": "5\n2 1 1 1 3",
"output": "1"
},
{
"input": "5\n0 0 0 1 2",
"output": "1"
},
{
"input": "4\n2 2 2 3",
"output": "0"
},
{
"input": "7\n1 1 1 1 5 5 5",
"output": "0"
},
{
"input": "5\n1 2 3 4 4",
"output": "2"
},
{
"input": "2\n5 4",
"output": "0"
},
{
"input": "4\n5 5 5 5",
"output": "0"
},
{
"input": "5\n1 1 1 5 5",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "1\n3",
"output": "0"
},
{
"input": "3\n2 1 2",
"output": "0"
},
{
"input": "4\n1 2 2 2",
"output": "0"
},
{
"input": "8\n1000000000 1000000000 1000000000 999999999 999999999 999999999 999999998 999999998",
"output": "3"
},
{
"input": "5\n1 1 3 4 4",
"output": "1"
},
{
"input": "6\n1 1 2 2 3 3",
"output": "2"
},
{
"input": "4\n1 1 1 1",
"output": "0"
},
{
"input": "9\n1 2 3 4 1 5 6 7 8",
"output": "6"
},
{
"input": "8\n5 4 4 6 6 4 4 3",
"output": "5"
},
{
"input": "8\n4 3 3 3 3 3 3 3",
"output": "0"
},
{
"input": "7\n4 3 3 3 3 3 3",
"output": "0"
},
{
"input": "6\n4 3 3 3 3 3",
"output": "0"
},
{
"input": "5\n4 3 3 3 3",
"output": "0"
}
] | 1,667,706,596
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 88
| 93
| 11,878,400
|
n=int(input())
a=[int(i) for i in input().split()]
m=min(a)
n=max(a)
cnt=0
for z in a:
if m<z<n:
cnt+=1
print(cnt)
|
Title: Oath of the Night's Watch
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"Night gathers, and now my watch begins. It shall not end until my death. I shall take no wife, hold no lands, father no children. I shall wear no crowns and win no glory. I shall live and die at my post. I am the sword in the darkness. I am the watcher on the walls. I am the shield that guards the realms of men. I pledge my life and honor to the Night's Watch, for this night and all the nights to come." — The Night's Watch oath.
With that begins the watch of Jon Snow. He is assigned the task to support the stewards.
This time he has *n* stewards with him whom he has to provide support. Each steward has his own strength. Jon Snow likes to support a steward only if there exists at least one steward who has strength strictly less than him and at least one steward who has strength strictly greater than him.
Can you find how many stewards will Jon support?
Input Specification:
First line consists of a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of stewards with Jon Snow.
Second line consists of *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) representing the values assigned to the stewards.
Output Specification:
Output a single integer representing the number of stewards which Jon will feed.
Demo Input:
['2\n1 5\n', '3\n1 2 5\n']
Demo Output:
['0', '1']
Note:
In the first sample, Jon Snow cannot support steward with strength 1 because there is no steward with strength less than 1 and he cannot support steward with strength 5 because there is no steward with strength greater than 5.
In the second sample, Jon Snow can support steward with strength 2 because there are stewards with strength less than 2 and greater than 2.
|
```python
n=int(input())
a=[int(i) for i in input().split()]
m=min(a)
n=max(a)
cnt=0
for z in a:
if m<z<n:
cnt+=1
print(cnt)
```
| 3
|
|
263
|
A
|
Beautiful Matrix
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
|
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
|
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
|
[
"0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n",
"0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n"
] |
[
"3\n",
"1\n"
] |
none
| 500
|
[
{
"input": "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "0"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1",
"output": "4"
},
{
"input": "0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0",
"output": "3"
}
] | 1,697,750,631
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 62
| 0
|
n = 5
matrix = []
for i in range(n):
matrix.append(list(map(int, input().split())))
recordi = 0
recordj = 0
for i in range(n):
for j in range(n):
if matrix[i][j] == 1:
recordi = i
recordj = j
break
sum = abs(recordi - 2) + abs(recordj - 2)
print(sum)
|
Title: Beautiful Matrix
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
Input Specification:
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
Output Specification:
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
Demo Input:
['0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n', '0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n']
Demo Output:
['3\n', '1\n']
Note:
none
|
```python
n = 5
matrix = []
for i in range(n):
matrix.append(list(map(int, input().split())))
recordi = 0
recordj = 0
for i in range(n):
for j in range(n):
if matrix[i][j] == 1:
recordi = i
recordj = j
break
sum = abs(recordi - 2) + abs(recordj - 2)
print(sum)
```
| 3
|
|
984
|
A
|
Game
|
PROGRAMMING
| 800
|
[
"sortings"
] | null | null |
Two players play a game.
Initially there are $n$ integers $a_1, a_2, \ldots, a_n$ written on the board. Each turn a player selects one number and erases it from the board. This continues until there is only one number left on the board, i. e. $n - 1$ turns are made. The first player makes the first move, then players alternate turns.
The first player wants to minimize the last number that would be left on the board, while the second player wants to maximize it.
You want to know what number will be left on the board after $n - 1$ turns if both players make optimal moves.
|
The first line contains one integer $n$ ($1 \le n \le 1000$) — the number of numbers on the board.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \le a_i \le 10^6$).
|
Print one number that will be left on the board.
|
[
"3\n2 1 3\n",
"3\n2 2 2\n"
] |
[
"2",
"2"
] |
In the first sample, the first player erases $3$ and the second erases $1$. $2$ is left on the board.
In the second sample, $2$ is left on the board regardless of the actions of the players.
| 500
|
[
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "3\n2 2 2",
"output": "2"
},
{
"input": "9\n44 53 51 80 5 27 74 79 94",
"output": "53"
},
{
"input": "10\n38 82 23 37 96 4 81 60 67 86",
"output": "60"
},
{
"input": "10\n58 26 77 15 53 81 68 48 22 65",
"output": "53"
},
{
"input": "1\n124",
"output": "124"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n1 1 1000",
"output": "1"
},
{
"input": "2\n322 322",
"output": "322"
},
{
"input": "3\n9 92 12",
"output": "12"
},
{
"input": "3\n1 2 2",
"output": "2"
}
] | 1,560,181,566
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 124
| 0
|
n=int(input())
num=input().split()
num=[int(num[i]) for i in range(n)]
while len(num)!=1:
num.remove(max(num))
if len(num)>1:
num.remove(min(num))
num[0]=str(num[0])
num="".join(num)
print(num)
|
Title: Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two players play a game.
Initially there are $n$ integers $a_1, a_2, \ldots, a_n$ written on the board. Each turn a player selects one number and erases it from the board. This continues until there is only one number left on the board, i. e. $n - 1$ turns are made. The first player makes the first move, then players alternate turns.
The first player wants to minimize the last number that would be left on the board, while the second player wants to maximize it.
You want to know what number will be left on the board after $n - 1$ turns if both players make optimal moves.
Input Specification:
The first line contains one integer $n$ ($1 \le n \le 1000$) — the number of numbers on the board.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \le a_i \le 10^6$).
Output Specification:
Print one number that will be left on the board.
Demo Input:
['3\n2 1 3\n', '3\n2 2 2\n']
Demo Output:
['2', '2']
Note:
In the first sample, the first player erases $3$ and the second erases $1$. $2$ is left on the board.
In the second sample, $2$ is left on the board regardless of the actions of the players.
|
```python
n=int(input())
num=input().split()
num=[int(num[i]) for i in range(n)]
while len(num)!=1:
num.remove(max(num))
if len(num)>1:
num.remove(min(num))
num[0]=str(num[0])
num="".join(num)
print(num)
```
| 3
|
|
363
|
A
|
Soroban
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
You know that Japan is the country with almost the largest 'electronic devices per person' ratio. So you might be quite surprised to find out that the primary school in Japan teaches to count using a Soroban — an abacus developed in Japan. This phenomenon has its reasons, of course, but we are not going to speak about them. Let's have a look at the Soroban's construction.
Soroban consists of some number of rods, each rod contains five beads. We will assume that the rods are horizontal lines. One bead on each rod (the leftmost one) is divided from the others by a bar (the reckoning bar). This single bead is called go-dama and four others are ichi-damas. Each rod is responsible for representing a single digit from 0 to 9. We can obtain the value of a digit by following simple algorithm:
- Set the value of a digit equal to 0. - If the go-dama is shifted to the right, add 5. - Add the number of ichi-damas shifted to the left.
Thus, the upper rod on the picture shows digit 0, the middle one shows digit 2 and the lower one shows 7. We will consider the top rod to represent the last decimal digit of a number, so the picture shows number 720.
Write the program that prints the way Soroban shows the given number *n*.
|
The first line contains a single integer *n* (0<=≤<=*n*<=<<=109).
|
Print the description of the decimal digits of number *n* from the last one to the first one (as mentioned on the picture in the statement), one per line. Print the beads as large English letters 'O', rod pieces as character '-' and the reckoning bar as '|'. Print as many rods, as many digits are in the decimal representation of number *n* without leading zeroes. We can assume that number 0 has no leading zeroes.
|
[
"2\n",
"13\n",
"720\n"
] |
[
"O-|OO-OO\n",
"O-|OOO-O\nO-|O-OOO\n",
"O-|-OOOO\nO-|OO-OO\n-O|OO-OO\n"
] |
none
| 500
|
[
{
"input": "2",
"output": "O-|OO-OO"
},
{
"input": "13",
"output": "O-|OOO-O\nO-|O-OOO"
},
{
"input": "720",
"output": "O-|-OOOO\nO-|OO-OO\n-O|OO-OO"
},
{
"input": "0",
"output": "O-|-OOOO"
},
{
"input": "1",
"output": "O-|O-OOO"
},
{
"input": "3",
"output": "O-|OOO-O"
},
{
"input": "4",
"output": "O-|OOOO-"
},
{
"input": "5",
"output": "-O|-OOOO"
},
{
"input": "6",
"output": "-O|O-OOO"
},
{
"input": "637",
"output": "-O|OO-OO\nO-|OOO-O\n-O|O-OOO"
},
{
"input": "7",
"output": "-O|OO-OO"
},
{
"input": "8",
"output": "-O|OOO-O"
},
{
"input": "9",
"output": "-O|OOOO-"
},
{
"input": "10",
"output": "O-|-OOOO\nO-|O-OOO"
},
{
"input": "11",
"output": "O-|O-OOO\nO-|O-OOO"
},
{
"input": "100",
"output": "O-|-OOOO\nO-|-OOOO\nO-|O-OOO"
},
{
"input": "99",
"output": "-O|OOOO-\n-O|OOOO-"
},
{
"input": "245",
"output": "-O|-OOOO\nO-|OOOO-\nO-|OO-OO"
},
{
"input": "118",
"output": "-O|OOO-O\nO-|O-OOO\nO-|O-OOO"
},
{
"input": "429",
"output": "-O|OOOO-\nO-|OO-OO\nO-|OOOO-"
},
{
"input": "555",
"output": "-O|-OOOO\n-O|-OOOO\n-O|-OOOO"
},
{
"input": "660",
"output": "O-|-OOOO\n-O|O-OOO\n-O|O-OOO"
},
{
"input": "331",
"output": "O-|O-OOO\nO-|OOO-O\nO-|OOO-O"
},
{
"input": "987",
"output": "-O|OO-OO\n-O|OOO-O\n-O|OOOO-"
},
{
"input": "123456789",
"output": "-O|OOOO-\n-O|OOO-O\n-O|OO-OO\n-O|O-OOO\n-O|-OOOO\nO-|OOOO-\nO-|OOO-O\nO-|OO-OO\nO-|O-OOO"
},
{
"input": "234567890",
"output": "O-|-OOOO\n-O|OOOO-\n-O|OOO-O\n-O|OO-OO\n-O|O-OOO\n-O|-OOOO\nO-|OOOO-\nO-|OOO-O\nO-|OO-OO"
},
{
"input": "100000000",
"output": "O-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|O-OOO"
},
{
"input": "111111111",
"output": "O-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO"
},
{
"input": "90909090",
"output": "O-|-OOOO\n-O|OOOO-\nO-|-OOOO\n-O|OOOO-\nO-|-OOOO\n-O|OOOO-\nO-|-OOOO\n-O|OOOO-"
},
{
"input": "987654321",
"output": "O-|O-OOO\nO-|OO-OO\nO-|OOO-O\nO-|OOOO-\n-O|-OOOO\n-O|O-OOO\n-O|OO-OO\n-O|OOO-O\n-O|OOOO-"
},
{
"input": "45165125",
"output": "-O|-OOOO\nO-|OO-OO\nO-|O-OOO\n-O|-OOOO\n-O|O-OOO\nO-|O-OOO\n-O|-OOOO\nO-|OOOO-"
},
{
"input": "445511006",
"output": "-O|O-OOO\nO-|-OOOO\nO-|-OOOO\nO-|O-OOO\nO-|O-OOO\n-O|-OOOO\n-O|-OOOO\nO-|OOOO-\nO-|OOOO-"
},
{
"input": "999999999",
"output": "-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-"
},
{
"input": "984218523",
"output": "O-|OOO-O\nO-|OO-OO\n-O|-OOOO\n-O|OOO-O\nO-|O-OOO\nO-|OO-OO\nO-|OOOO-\n-O|OOO-O\n-O|OOOO-"
},
{
"input": "19",
"output": "-O|OOOO-\nO-|O-OOO"
},
{
"input": "10000000",
"output": "O-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|O-OOO"
}
] | 1,677,357,087
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 46
| 0
|
zero = ['O-|-OOOO','O-|O-OOO','O-|OO-OO','O-|OOO-O','O-|OOOO-','-O|-OOOO','-O|O-OOO','-O|OO-OO','-O|OOO-O','-O|OOOO-']
n = input()
for i in range(len(n),0,-1):
print(zero[int(n[i-1])])
|
Title: Soroban
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You know that Japan is the country with almost the largest 'electronic devices per person' ratio. So you might be quite surprised to find out that the primary school in Japan teaches to count using a Soroban — an abacus developed in Japan. This phenomenon has its reasons, of course, but we are not going to speak about them. Let's have a look at the Soroban's construction.
Soroban consists of some number of rods, each rod contains five beads. We will assume that the rods are horizontal lines. One bead on each rod (the leftmost one) is divided from the others by a bar (the reckoning bar). This single bead is called go-dama and four others are ichi-damas. Each rod is responsible for representing a single digit from 0 to 9. We can obtain the value of a digit by following simple algorithm:
- Set the value of a digit equal to 0. - If the go-dama is shifted to the right, add 5. - Add the number of ichi-damas shifted to the left.
Thus, the upper rod on the picture shows digit 0, the middle one shows digit 2 and the lower one shows 7. We will consider the top rod to represent the last decimal digit of a number, so the picture shows number 720.
Write the program that prints the way Soroban shows the given number *n*.
Input Specification:
The first line contains a single integer *n* (0<=≤<=*n*<=<<=109).
Output Specification:
Print the description of the decimal digits of number *n* from the last one to the first one (as mentioned on the picture in the statement), one per line. Print the beads as large English letters 'O', rod pieces as character '-' and the reckoning bar as '|'. Print as many rods, as many digits are in the decimal representation of number *n* without leading zeroes. We can assume that number 0 has no leading zeroes.
Demo Input:
['2\n', '13\n', '720\n']
Demo Output:
['O-|OO-OO\n', 'O-|OOO-O\nO-|O-OOO\n', 'O-|-OOOO\nO-|OO-OO\n-O|OO-OO\n']
Note:
none
|
```python
zero = ['O-|-OOOO','O-|O-OOO','O-|OO-OO','O-|OOO-O','O-|OOOO-','-O|-OOOO','-O|O-OOO','-O|OO-OO','-O|OOO-O','-O|OOOO-']
n = input()
for i in range(len(n),0,-1):
print(zero[int(n[i-1])])
```
| 3
|
|
600
|
C
|
Make Palindrome
|
PROGRAMMING
| 1,800
|
[
"constructive algorithms",
"greedy",
"strings"
] | null | null |
A string is called palindrome if it reads the same from left to right and from right to left. For example "kazak", "oo", "r" and "mikhailrubinchikkihcniburliahkim" are palindroms, but strings "abb" and "ij" are not.
You are given string *s* consisting of lowercase Latin letters. At once you can choose any position in the string and change letter in that position to any other lowercase letter. So after each changing the length of the string doesn't change. At first you can change some letters in *s*. Then you can permute the order of letters as you want. Permutation doesn't count as changes.
You should obtain palindrome with the minimal number of changes. If there are several ways to do that you should get the lexicographically (alphabetically) smallest palindrome. So firstly you should minimize the number of changes and then minimize the palindrome lexicographically.
|
The only line contains string *s* (1<=≤<=|*s*|<=≤<=2·105) consisting of only lowercase Latin letters.
|
Print the lexicographically smallest palindrome that can be obtained with the minimal number of changes.
|
[
"aabc\n",
"aabcd\n"
] |
[
"abba\n",
"abcba\n"
] |
none
| 0
|
[
{
"input": "aabc",
"output": "abba"
},
{
"input": "aabcd",
"output": "abcba"
},
{
"input": "u",
"output": "u"
},
{
"input": "ttttt",
"output": "ttttt"
},
{
"input": "xxxvvvxxvv",
"output": "vvvxxxxvvv"
},
{
"input": "wrwrwfrrfrffrrwwwffffwrfrrwfrrfrwwfwfrwfwfwffwrrwfrrrwwwfrrrwfrrfwrwwrwrrrffffwrrrwrwfffwrffrwwwrwww",
"output": "fffffffffffffffrrrrrrrrrrrrrrrrrrwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwrrrrrrrrrrrrrrrrrrfffffffffffffff"
},
{
"input": "aabbcccdd",
"output": "abcdcdcba"
},
{
"input": "baaab",
"output": "ababa"
},
{
"input": "aaabbbhhlhlugkjgckj",
"output": "aabbghjklclkjhgbbaa"
},
{
"input": "aabcc",
"output": "acbca"
},
{
"input": "bbbcccddd",
"output": "bbcdcdcbb"
},
{
"input": "zzzozzozozozoza",
"output": "aoozzzzozzzzooa"
},
{
"input": "aaabb",
"output": "ababa"
},
{
"input": "zza",
"output": "zaz"
},
{
"input": "azzzbbb",
"output": "abzbzba"
},
{
"input": "bbaaccddc",
"output": "abcdcdcba"
},
{
"input": "aaabbbccc",
"output": "aabcbcbaa"
},
{
"input": "aaaaabbccdd",
"output": "aabcdadcbaa"
},
{
"input": "aaabbbcccdd",
"output": "aabcdbdcbaa"
},
{
"input": "aaaabbcccccdd",
"output": "aabccdcdccbaa"
},
{
"input": "aaacccb",
"output": "aacbcaa"
},
{
"input": "abcd",
"output": "abba"
},
{
"input": "abb",
"output": "bab"
},
{
"input": "abababccc",
"output": "aabcbcbaa"
},
{
"input": "aaadd",
"output": "adada"
},
{
"input": "qqqqaaaccdd",
"output": "acdqqaqqdca"
},
{
"input": "affawwzzw",
"output": "afwzwzwfa"
},
{
"input": "hack",
"output": "acca"
},
{
"input": "bbaaa",
"output": "ababa"
},
{
"input": "ababa",
"output": "ababa"
},
{
"input": "aaazzzz",
"output": "azzazza"
},
{
"input": "aabbbcc",
"output": "abcbcba"
},
{
"input": "successfullhack",
"output": "accelsufuslecca"
},
{
"input": "aaabbccdd",
"output": "abcdadcba"
},
{
"input": "zaz",
"output": "zaz"
},
{
"input": "aaabbbcccdddeee",
"output": "aabbcdecedcbbaa"
},
{
"input": "zaaz",
"output": "azza"
},
{
"input": "acc",
"output": "cac"
},
{
"input": "abbbzzz",
"output": "abzbzba"
},
{
"input": "zzzzazazazazazznnznznnznnznznzaajzjajjjjanaznnzanzppnzpaznnpanz",
"output": "aaaaaaajjjnnnnnnnnppzzzzzzzzzzznzzzzzzzzzzzppnnnnnnnnjjjaaaaaaa"
},
{
"input": "aaaaabbbcccdddd",
"output": "aaabcddbddcbaaa"
},
{
"input": "aaaaabbccdddd",
"output": "aabcddaddcbaa"
},
{
"input": "abababa",
"output": "aabbbaa"
},
{
"input": "azz",
"output": "zaz"
},
{
"input": "abbbccc",
"output": "abcbcba"
},
{
"input": "aaacccddd",
"output": "aacdcdcaa"
},
{
"input": "asbbsha",
"output": "abshsba"
},
{
"input": "bababab",
"output": "abbabba"
},
{
"input": "aaabbccddbbccddaaaaaaaaaaaaaaaa",
"output": "aaaaaaaaabbccddaddccbbaaaaaaaaa"
},
{
"input": "aaabbccddbbccddaaaaaaaaaaaaaa",
"output": "aaaaaaaabbccddaddccbbaaaaaaaa"
},
{
"input": "aaabbccddbbccddaaaaaaaaaaaa",
"output": "aaaaaaabbccddaddccbbaaaaaaa"
},
{
"input": "ooooo",
"output": "ooooo"
},
{
"input": "aaabbccddbbccddaaaaaaaaaa",
"output": "aaaaaabbccddaddccbbaaaaaa"
},
{
"input": "aaabbccddbbccddaaaaaaaa",
"output": "aaaaabbccddaddccbbaaaaa"
},
{
"input": "aaabbccddbbccddaa",
"output": "aabbccddaddccbbaa"
}
] | 1,614,226,984
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 14
| 171
| 9,728,000
|
from collections import deque
# palindrome all letter sums must be even and 0 or 1 odd sum allowed
s = input()
cnt = [0]*26
for letter in s:
cnt[ord(letter) - ord('a')] += 1
# find number of odd counts
odd = []
for letter in range(26):
if cnt[letter] % 2:
odd.append(letter)
# swap odds (all if even or leave one)
for i in range(len(odd)//2):
l_up = odd[i]
l_down = odd[-(i+1)]
cnt[l_up] += 1
cnt[l_down] -= 1
m = []
# palindrome
# odd in middle
for i in range(26):
if cnt[i] % 2:
for j in range(cnt[i]):
m.append(chr(i + ord('a')))
cnt[i] = 0
# remaining even
p = []
for i in range(26):
while cnt[i] > 0:
p.append(chr(i + ord('a')))
cnt[i] -= 2
#print(p)
print(''.join(p) + ''.join(m) + ''.join(reversed(p)))
|
Title: Make Palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A string is called palindrome if it reads the same from left to right and from right to left. For example "kazak", "oo", "r" and "mikhailrubinchikkihcniburliahkim" are palindroms, but strings "abb" and "ij" are not.
You are given string *s* consisting of lowercase Latin letters. At once you can choose any position in the string and change letter in that position to any other lowercase letter. So after each changing the length of the string doesn't change. At first you can change some letters in *s*. Then you can permute the order of letters as you want. Permutation doesn't count as changes.
You should obtain palindrome with the minimal number of changes. If there are several ways to do that you should get the lexicographically (alphabetically) smallest palindrome. So firstly you should minimize the number of changes and then minimize the palindrome lexicographically.
Input Specification:
The only line contains string *s* (1<=≤<=|*s*|<=≤<=2·105) consisting of only lowercase Latin letters.
Output Specification:
Print the lexicographically smallest palindrome that can be obtained with the minimal number of changes.
Demo Input:
['aabc\n', 'aabcd\n']
Demo Output:
['abba\n', 'abcba\n']
Note:
none
|
```python
from collections import deque
# palindrome all letter sums must be even and 0 or 1 odd sum allowed
s = input()
cnt = [0]*26
for letter in s:
cnt[ord(letter) - ord('a')] += 1
# find number of odd counts
odd = []
for letter in range(26):
if cnt[letter] % 2:
odd.append(letter)
# swap odds (all if even or leave one)
for i in range(len(odd)//2):
l_up = odd[i]
l_down = odd[-(i+1)]
cnt[l_up] += 1
cnt[l_down] -= 1
m = []
# palindrome
# odd in middle
for i in range(26):
if cnt[i] % 2:
for j in range(cnt[i]):
m.append(chr(i + ord('a')))
cnt[i] = 0
# remaining even
p = []
for i in range(26):
while cnt[i] > 0:
p.append(chr(i + ord('a')))
cnt[i] -= 2
#print(p)
print(''.join(p) + ''.join(m) + ''.join(reversed(p)))
```
| 0
|
|
361
|
A
|
Levko and Table
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
Levko loves tables that consist of *n* rows and *n* columns very much. He especially loves beautiful tables. A table is beautiful to Levko if the sum of elements in each row and column of the table equals *k*.
Unfortunately, he doesn't know any such table. Your task is to help him to find at least one of them.
|
The single line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000).
|
Print any beautiful table. Levko doesn't like too big numbers, so all elements of the table mustn't exceed 1000 in their absolute value.
If there are multiple suitable tables, you are allowed to print any of them.
|
[
"2 4\n",
"4 7\n"
] |
[
"1 3\n3 1\n",
"2 1 0 4\n4 0 2 1\n1 3 3 0\n0 3 2 2\n"
] |
In the first sample the sum in the first row is 1 + 3 = 4, in the second row — 3 + 1 = 4, in the first column — 1 + 3 = 4 and in the second column — 3 + 1 = 4. There are other beautiful tables for this sample.
In the second sample the sum of elements in each row and each column equals 7. Besides, there are other tables that meet the statement requirements.
| 500
|
[
{
"input": "2 4",
"output": "4 0 \n0 4 "
},
{
"input": "4 7",
"output": "7 0 0 0 \n0 7 0 0 \n0 0 7 0 \n0 0 0 7 "
},
{
"input": "1 8",
"output": "8 "
},
{
"input": "9 3",
"output": "3 0 0 0 0 0 0 0 0 \n0 3 0 0 0 0 0 0 0 \n0 0 3 0 0 0 0 0 0 \n0 0 0 3 0 0 0 0 0 \n0 0 0 0 3 0 0 0 0 \n0 0 0 0 0 3 0 0 0 \n0 0 0 0 0 0 3 0 0 \n0 0 0 0 0 0 0 3 0 \n0 0 0 0 0 0 0 0 3 "
},
{
"input": "31 581",
"output": "581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "100 1000",
"output": "1000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 1000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ..."
},
{
"input": "100 999",
"output": "999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "99 998",
"output": "998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "100 997",
"output": "997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "81 111",
"output": "111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 111 0 0..."
},
{
"input": "1 407",
"output": "407 "
},
{
"input": "54 341",
"output": "341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "92 460",
"output": "460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "34 47",
"output": "47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 ..."
},
{
"input": "11 547",
"output": "547 0 0 0 0 0 0 0 0 0 0 \n0 547 0 0 0 0 0 0 0 0 0 \n0 0 547 0 0 0 0 0 0 0 0 \n0 0 0 547 0 0 0 0 0 0 0 \n0 0 0 0 547 0 0 0 0 0 0 \n0 0 0 0 0 547 0 0 0 0 0 \n0 0 0 0 0 0 547 0 0 0 0 \n0 0 0 0 0 0 0 547 0 0 0 \n0 0 0 0 0 0 0 0 547 0 0 \n0 0 0 0 0 0 0 0 0 547 0 \n0 0 0 0 0 0 0 0 0 0 547 "
},
{
"input": "100 1",
"output": "1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "99 1",
"output": "1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "99 2",
"output": "2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "2 7",
"output": "7 0 \n0 7 "
},
{
"input": "100 100",
"output": "100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "4 3",
"output": "3 0 0 0 \n0 3 0 0 \n0 0 3 0 \n0 0 0 3 "
},
{
"input": "3 2",
"output": "2 0 0 \n0 2 0 \n0 0 2 "
}
] | 1,561,230,639
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 22
| 109
| 0
|
"""from numpy import *
a,b=map(int,input().split())
arr=zeros([a,a],dtype=int)
for i in range(a):
for j in range(a):
if i==j:
arr[i][j]=b
for x in arr:
print(*x)
"""
n,k=map(int,input().split())
for i in range(n):
print(i*'0 ',end='')
print(k,end='')
print((n-1-i)*' 0')
|
Title: Levko and Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Levko loves tables that consist of *n* rows and *n* columns very much. He especially loves beautiful tables. A table is beautiful to Levko if the sum of elements in each row and column of the table equals *k*.
Unfortunately, he doesn't know any such table. Your task is to help him to find at least one of them.
Input Specification:
The single line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000).
Output Specification:
Print any beautiful table. Levko doesn't like too big numbers, so all elements of the table mustn't exceed 1000 in their absolute value.
If there are multiple suitable tables, you are allowed to print any of them.
Demo Input:
['2 4\n', '4 7\n']
Demo Output:
['1 3\n3 1\n', '2 1 0 4\n4 0 2 1\n1 3 3 0\n0 3 2 2\n']
Note:
In the first sample the sum in the first row is 1 + 3 = 4, in the second row — 3 + 1 = 4, in the first column — 1 + 3 = 4 and in the second column — 3 + 1 = 4. There are other beautiful tables for this sample.
In the second sample the sum of elements in each row and each column equals 7. Besides, there are other tables that meet the statement requirements.
|
```python
"""from numpy import *
a,b=map(int,input().split())
arr=zeros([a,a],dtype=int)
for i in range(a):
for j in range(a):
if i==j:
arr[i][j]=b
for x in arr:
print(*x)
"""
n,k=map(int,input().split())
for i in range(n):
print(i*'0 ',end='')
print(k,end='')
print((n-1-i)*' 0')
```
| 3
|
|
47
|
B
|
Coins
|
PROGRAMMING
| 1,200
|
[
"implementation"
] |
B. Coins
|
2
|
256
|
One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal.
|
The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(> or < sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A<B.
|
It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights.
|
[
"A>B\nC<B\nA>C\n",
"A<B\nB>C\nC>A\n"
] |
[
"CBA",
"ACB"
] |
none
| 1,000
|
[
{
"input": "A>B\nC<B\nA>C",
"output": "CBA"
},
{
"input": "A<B\nB>C\nC>A",
"output": "ACB"
},
{
"input": "A<C\nB<A\nB>C",
"output": "Impossible"
},
{
"input": "A<B\nA<C\nB>C",
"output": "ACB"
},
{
"input": "B>A\nC<B\nC>A",
"output": "ACB"
},
{
"input": "A>B\nB>C\nC<A",
"output": "CBA"
},
{
"input": "A>C\nA>B\nB<C",
"output": "BCA"
},
{
"input": "C<B\nB>A\nA<C",
"output": "ACB"
},
{
"input": "C<B\nA>B\nC<A",
"output": "CBA"
},
{
"input": "C>B\nB>A\nA<C",
"output": "ABC"
},
{
"input": "C<B\nB<A\nC>A",
"output": "Impossible"
},
{
"input": "B<C\nC<A\nA>B",
"output": "BCA"
},
{
"input": "A>B\nC<B\nC<A",
"output": "CBA"
},
{
"input": "B>A\nC>B\nA>C",
"output": "Impossible"
},
{
"input": "B<A\nC>B\nC>A",
"output": "BAC"
},
{
"input": "A<B\nC>B\nA<C",
"output": "ABC"
},
{
"input": "A<B\nC<A\nB<C",
"output": "Impossible"
},
{
"input": "A>C\nC<B\nB>A",
"output": "CAB"
},
{
"input": "C>A\nA<B\nB>C",
"output": "ACB"
},
{
"input": "C>A\nC<B\nB>A",
"output": "ACB"
},
{
"input": "B>C\nB>A\nA<C",
"output": "ACB"
},
{
"input": "C<B\nC<A\nB<A",
"output": "CBA"
},
{
"input": "A<C\nA<B\nB>C",
"output": "ACB"
},
{
"input": "B>A\nA>C\nB>C",
"output": "CAB"
},
{
"input": "B<A\nA<C\nC<B",
"output": "Impossible"
},
{
"input": "A<C\nB>C\nA>B",
"output": "Impossible"
},
{
"input": "B>A\nC<A\nC>B",
"output": "Impossible"
},
{
"input": "A>C\nC>B\nB<A",
"output": "BCA"
},
{
"input": "B<C\nB<A\nA>C",
"output": "BCA"
},
{
"input": "A>B\nC>B\nA<C",
"output": "BAC"
},
{
"input": "C<B\nC<A\nB<A",
"output": "CBA"
},
{
"input": "A<C\nA>B\nB>C",
"output": "Impossible"
},
{
"input": "B>A\nB>C\nA<C",
"output": "ACB"
},
{
"input": "B>C\nC<A\nB<A",
"output": "CBA"
},
{
"input": "C>A\nB>A\nB>C",
"output": "ACB"
},
{
"input": "B<A\nB>C\nA<C",
"output": "Impossible"
},
{
"input": "B<C\nA<B\nC>A",
"output": "ABC"
},
{
"input": "C<B\nB>A\nA>C",
"output": "CAB"
},
{
"input": "A>B\nC>A\nB<C",
"output": "BAC"
},
{
"input": "A>B\nB>C\nC<A",
"output": "CBA"
},
{
"input": "B>C\nC>A\nA>B",
"output": "Impossible"
},
{
"input": "B<A\nB>C\nC<A",
"output": "CBA"
},
{
"input": "C>B\nB>A\nC>A",
"output": "ABC"
},
{
"input": "A>C\nA>B\nB>C",
"output": "CBA"
},
{
"input": "B<C\nA>B\nA<C",
"output": "BAC"
},
{
"input": "C>A\nC<B\nB>A",
"output": "ACB"
},
{
"input": "C>B\nA<B\nC<A",
"output": "Impossible"
},
{
"input": "A<C\nC<B\nA>B",
"output": "Impossible"
},
{
"input": "B>C\nA<B\nA<C",
"output": "ACB"
},
{
"input": "C>A\nA<B\nC>B",
"output": "ABC"
}
] | 1,664,038,163
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 2
| 92
| 0
|
orders = {'A':0, 'B': 0, 'C':0}
for i in range(3):
order = input()
if (order[1] == '<'):
orders[order[2]] += 1
else:
orders[order[0]] += 1
sortedOrders = sorted(orders, key= orders.get)
result = ''.join(sortedOrders)
print(result)
|
Title: Coins
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal.
Input Specification:
The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(> or < sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A<B.
Output Specification:
It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights.
Demo Input:
['A>B\nC<B\nA>C\n', 'A<B\nB>C\nC>A\n']
Demo Output:
['CBA', 'ACB']
Note:
none
|
```python
orders = {'A':0, 'B': 0, 'C':0}
for i in range(3):
order = input()
if (order[1] == '<'):
orders[order[2]] += 1
else:
orders[order[0]] += 1
sortedOrders = sorted(orders, key= orders.get)
result = ''.join(sortedOrders)
print(result)
```
| 0
|
768
|
B
|
Code For 1
|
PROGRAMMING
| 1,600
|
[
"constructive algorithms",
"dfs and similar",
"divide and conquer"
] | null | null |
Jon fought bravely to rescue the wildlings who were attacked by the white-walkers at Hardhome. On his arrival, Sam tells him that he wants to go to Oldtown to train at the Citadel to become a maester, so he can return and take the deceased Aemon's place as maester of Castle Black. Jon agrees to Sam's proposal and Sam sets off his journey to the Citadel. However becoming a trainee at the Citadel is not a cakewalk and hence the maesters at the Citadel gave Sam a problem to test his eligibility.
Initially Sam has a list with a single element *n*. Then he has to perform certain operations on this list. In each operation Sam must remove any element *x*, such that *x*<=><=1, from the list and insert at the same position , , sequentially. He must continue with these operations until all the elements in the list are either 0 or 1.
Now the masters want the total number of 1s in the range *l* to *r* (1-indexed). Sam wants to become a maester but unfortunately he cannot solve this problem. Can you help Sam to pass the eligibility test?
|
The first line contains three integers *n*, *l*, *r* (0<=≤<=*n*<=<<=250, 0<=≤<=*r*<=-<=*l*<=≤<=105, *r*<=≥<=1, *l*<=≥<=1) – initial element and the range *l* to *r*.
It is guaranteed that *r* is not greater than the length of the final list.
|
Output the total number of 1s in the range *l* to *r* in the final sequence.
|
[
"7 2 5\n",
"10 3 10\n"
] |
[
"4\n",
"5\n"
] |
Consider first example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/288fbb682a6fa1934a47b763d6851f9d32a06150.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 2-nd to 5-th in list is [1, 1, 1, 1]. The number of ones is 4.
For the second example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/52e9bc51ef858cacc27fc274c7ba9419d5c1ded9.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 3-rd to 10-th in list is [1, 1, 1, 0, 1, 0, 1, 0]. The number of ones is 5.
| 1,000
|
[
{
"input": "7 2 5",
"output": "4"
},
{
"input": "10 3 10",
"output": "5"
},
{
"input": "56 18 40",
"output": "20"
},
{
"input": "203 40 124",
"output": "67"
},
{
"input": "903316762502 354723010040 354723105411",
"output": "78355"
},
{
"input": "33534354842198 32529564319236 32529564342569",
"output": "22239"
},
{
"input": "62518534961045 50734311240112 50734311287877",
"output": "42439"
},
{
"input": "95173251245550 106288351347530 106288351372022",
"output": "16565"
},
{
"input": "542 321 956",
"output": "336"
},
{
"input": "3621 237 2637",
"output": "2124"
},
{
"input": "9056 336 896",
"output": "311"
},
{
"input": "36007 368 24490",
"output": "13253"
},
{
"input": "244269 149154 244246",
"output": "88609"
},
{
"input": "880234 669493 757150",
"output": "73585"
},
{
"input": "3740160 1031384 1104236",
"output": "64965"
},
{
"input": "11586121 15337246 15397874",
"output": "41868"
},
{
"input": "38658997 35923164 35985664",
"output": "36004"
},
{
"input": "192308932 207804787 207866400",
"output": "44142"
},
{
"input": "950099012 175922161 176000556",
"output": "69369"
},
{
"input": "2787326787 3799676481 3799680514",
"output": "2618"
},
{
"input": "14417262581 8527979363 8528075536",
"output": "80707"
},
{
"input": "39889373539 7747197212 7747278363",
"output": "47105"
},
{
"input": "251772781087 70597428577 70597479816",
"output": "46933"
},
{
"input": "0 1 1",
"output": "0"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "3 2 3",
"output": "2"
},
{
"input": "14 7 12",
"output": "5"
},
{
"input": "1125899906842623 1 100001",
"output": "100001"
},
{
"input": "1125899906842623 1125899906742623 1125899906842623",
"output": "100001"
},
{
"input": "1000 1 1023",
"output": "1000"
},
{
"input": "281474976710656 17179869184 17179869186",
"output": "1"
},
{
"input": "2 2 2",
"output": "0"
},
{
"input": "3 2 2",
"output": "1"
}
] | 1,697,986,077
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 0
|
n, l, r = map(int, input().split())
def f(x):
if x <= 1:
return [x]
else:
left = int(x / 2)
mid = x % 2
right = int(x / 2)
left = f(left)
mid = f(mid)
right = f(right)
return left + mid + right
print(f(n).count(1))
|
Title: Code For 1
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Jon fought bravely to rescue the wildlings who were attacked by the white-walkers at Hardhome. On his arrival, Sam tells him that he wants to go to Oldtown to train at the Citadel to become a maester, so he can return and take the deceased Aemon's place as maester of Castle Black. Jon agrees to Sam's proposal and Sam sets off his journey to the Citadel. However becoming a trainee at the Citadel is not a cakewalk and hence the maesters at the Citadel gave Sam a problem to test his eligibility.
Initially Sam has a list with a single element *n*. Then he has to perform certain operations on this list. In each operation Sam must remove any element *x*, such that *x*<=><=1, from the list and insert at the same position , , sequentially. He must continue with these operations until all the elements in the list are either 0 or 1.
Now the masters want the total number of 1s in the range *l* to *r* (1-indexed). Sam wants to become a maester but unfortunately he cannot solve this problem. Can you help Sam to pass the eligibility test?
Input Specification:
The first line contains three integers *n*, *l*, *r* (0<=≤<=*n*<=<<=250, 0<=≤<=*r*<=-<=*l*<=≤<=105, *r*<=≥<=1, *l*<=≥<=1) – initial element and the range *l* to *r*.
It is guaranteed that *r* is not greater than the length of the final list.
Output Specification:
Output the total number of 1s in the range *l* to *r* in the final sequence.
Demo Input:
['7 2 5\n', '10 3 10\n']
Demo Output:
['4\n', '5\n']
Note:
Consider first example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/288fbb682a6fa1934a47b763d6851f9d32a06150.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 2-nd to 5-th in list is [1, 1, 1, 1]. The number of ones is 4.
For the second example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/52e9bc51ef858cacc27fc274c7ba9419d5c1ded9.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 3-rd to 10-th in list is [1, 1, 1, 0, 1, 0, 1, 0]. The number of ones is 5.
|
```python
n, l, r = map(int, input().split())
def f(x):
if x <= 1:
return [x]
else:
left = int(x / 2)
mid = x % 2
right = int(x / 2)
left = f(left)
mid = f(mid)
right = f(right)
return left + mid + right
print(f(n).count(1))
```
| 0
|
|
427
|
A
|
Police Recruits
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups.
Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime.
If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated.
Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated.
|
The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers.
If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time.
|
Print a single integer, the number of crimes which will go untreated.
|
[
"3\n-1 -1 1\n",
"8\n1 -1 1 -1 -1 1 1 1\n",
"11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n"
] |
[
"2\n",
"1\n",
"8\n"
] |
Lets consider the second example:
1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired.
The answer is one, as one crime (on step 5) will go untreated.
| 500
|
[
{
"input": "3\n-1 -1 1",
"output": "2"
},
{
"input": "8\n1 -1 1 -1 -1 1 1 1",
"output": "1"
},
{
"input": "11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1",
"output": "8"
},
{
"input": "7\n-1 -1 1 1 -1 -1 1",
"output": "2"
},
{
"input": "21\n-1 -1 -1 -1 -1 3 2 -1 6 -1 -1 2 1 -1 2 2 1 6 5 -1 5",
"output": "5"
},
{
"input": "98\n-1 -1 1 -1 -1 -1 -1 1 -1 -1 1 -1 -1 1 -1 1 1 1 -1 1 1 1 1 1 -1 1 -1 -1 -1 -1 1 -1 -1 1 1 -1 1 1 1 -1 -1 -1 -1 -1 -1 1 -1 -1 -1 1 -1 1 -1 1 -1 1 1 1 1 1 1 1 -1 -1 1 1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 1 -1 1 1 1 -1 1 1 -1 -1 -1 1 1 1 -1 -1 -1 1 -1 1 1",
"output": "13"
},
{
"input": "3\n-1 5 4",
"output": "1"
},
{
"input": "146\n4 -1 -1 -1 -1 -1 -1 -1 -1 -1 4 -1 3 -1 3 -1 -1 1 4 -1 2 -1 -1 3 -1 -1 -1 4 1 -1 -1 -1 4 -1 -1 -1 -1 -1 -1 3 2 -1 3 2 4 5 2 4 1 5 -1 -1 2 -1 -1 1 -1 5 3 -1 1 2 2 3 5 3 -1 -1 3 -1 -1 3 5 5 -1 -1 5 -1 4 4 1 -1 -1 -1 2 1 -1 -1 -1 2 5 3 -1 -1 -1 3 -1 5 4 -1 1 -1 -1 3 -1 -1 3 1 1 2 -1 -1 -1 1 3 1 -1 2 -1 -1 5 5 -1 -1 3 4 5 1 -1 2 -1 -1 -1 3 -1 5 3 2 -1 2 -1 -1 5 -1 3 -1",
"output": "5"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n-1",
"output": "1"
},
{
"input": "2\n1 -1",
"output": "0"
},
{
"input": "2\n-1 1",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n-1 -1",
"output": "2"
},
{
"input": "4\n10 -1 -1 -1",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "4\n-1 -1 1 1",
"output": "2"
}
] | 1,676,102,655
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 2
| 46
| 0
|
a=int(input())
d=list(map(int,input().split()))
s=0
j=0
for i in range(len(d)):
s=s+d[i]
if s<0:
j=j+1
else:
j=2
print(j-1)
|
Title: Police Recruits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups.
Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime.
If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated.
Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated.
Input Specification:
The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers.
If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time.
Output Specification:
Print a single integer, the number of crimes which will go untreated.
Demo Input:
['3\n-1 -1 1\n', '8\n1 -1 1 -1 -1 1 1 1\n', '11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n']
Demo Output:
['2\n', '1\n', '8\n']
Note:
Lets consider the second example:
1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired.
The answer is one, as one crime (on step 5) will go untreated.
|
```python
a=int(input())
d=list(map(int,input().split()))
s=0
j=0
for i in range(len(d)):
s=s+d[i]
if s<0:
j=j+1
else:
j=2
print(j-1)
```
| 0
|
|
432
|
A
|
Choosing Teams
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
|
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
|
Print a single number — the answer to the problem.
|
[
"5 2\n0 4 5 1 0\n",
"6 4\n0 1 2 3 4 5\n",
"6 5\n0 0 0 0 0 0\n"
] |
[
"1\n",
"0\n",
"2\n"
] |
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
| 500
|
[
{
"input": "5 2\n0 4 5 1 0",
"output": "1"
},
{
"input": "6 4\n0 1 2 3 4 5",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "3 4\n0 1 0",
"output": "1"
},
{
"input": "3 4\n0 2 0",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "12 2\n0 1 2 3 4 0 1 2 3 4 0 1",
"output": "3"
},
{
"input": "15 2\n0 1 2 3 4 0 1 2 3 4 0 1 2 3 4",
"output": "4"
},
{
"input": "13 1\n5 0 5 0 1 5 0 4 1 1 1 4 1",
"output": "3"
},
{
"input": "20 1\n5 0 4 2 2 3 2 1 2 4 1 3 5 5 5 4 4 1 3 0",
"output": "5"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "6 3\n4 4 4 4 4 4",
"output": "0"
},
{
"input": "1 4\n1",
"output": "0"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "2 3\n0 0",
"output": "0"
}
] | 1,698,901,446
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 2
| 61
| 0
|
n, k = map(int, input().split())
participation_counts = list(map(int, input().split()))
already_participated = sum(1 for count in participation_counts if count >= k)
can_participate_more = sum(1 for count in participation_counts if count < k and count + (5 - k) >= k)
teams_with_already_participated = already_participated // 3
teams_with_can_participate_more = min(can_participate_more, n - already_participated) // 3
max_teams = teams_with_already_participated + teams_with_can_participate_more
print(max_teams)
|
Title: Choosing Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
Input Specification:
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['5 2\n0 4 5 1 0\n', '6 4\n0 1 2 3 4 5\n', '6 5\n0 0 0 0 0 0\n']
Demo Output:
['1\n', '0\n', '2\n']
Note:
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
|
```python
n, k = map(int, input().split())
participation_counts = list(map(int, input().split()))
already_participated = sum(1 for count in participation_counts if count >= k)
can_participate_more = sum(1 for count in participation_counts if count < k and count + (5 - k) >= k)
teams_with_already_participated = already_participated // 3
teams_with_can_participate_more = min(can_participate_more, n - already_participated) // 3
max_teams = teams_with_already_participated + teams_with_can_participate_more
print(max_teams)
```
| 0
|
|
520
|
A
|
Pangram
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices.
You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of characters in the string.
The second line contains the string. The string consists only of uppercase and lowercase Latin letters.
|
Output "YES", if the string is a pangram and "NO" otherwise.
|
[
"12\ntoosmallword\n",
"35\nTheQuickBrownFoxJumpsOverTheLazyDog\n"
] |
[
"NO\n",
"YES\n"
] |
none
| 500
|
[
{
"input": "12\ntoosmallword",
"output": "NO"
},
{
"input": "35\nTheQuickBrownFoxJumpsOverTheLazyDog",
"output": "YES"
},
{
"input": "1\na",
"output": "NO"
},
{
"input": "26\nqwertyuiopasdfghjklzxcvbnm",
"output": "YES"
},
{
"input": "26\nABCDEFGHIJKLMNOPQRSTUVWXYZ",
"output": "YES"
},
{
"input": "48\nthereisasyetinsufficientdataforameaningfulanswer",
"output": "NO"
},
{
"input": "30\nToBeOrNotToBeThatIsTheQuestion",
"output": "NO"
},
{
"input": "30\njackdawslovemybigsphinxofquarz",
"output": "NO"
},
{
"input": "31\nTHEFIVEBOXINGWIZARDSJUMPQUICKLY",
"output": "YES"
},
{
"input": "26\naaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "NO"
},
{
"input": "26\nMGJYIZDKsbhpVeNFlquRTcWoAx",
"output": "YES"
},
{
"input": "26\nfWMOhAPsbIVtyUEZrGNQXDklCJ",
"output": "YES"
},
{
"input": "26\nngPMVFSThiRCwLEuyOAbKxQzDJ",
"output": "YES"
},
{
"input": "25\nnxYTzLFwzNolAumjgcAboyxAj",
"output": "NO"
},
{
"input": "26\npRWdodGdxUESvcScPGbUoooZsC",
"output": "NO"
},
{
"input": "66\nBovdMlDzTaqKllZILFVfxbLGsRnzmtVVTmqiIDTYrossLEPlmsPrkUYtWEsGHVOnFj",
"output": "NO"
},
{
"input": "100\nmKtsiDRJypUieHIkvJaMFkwaKxcCIbBszZQLIyPpCDCjhNpAnYFngLjRpnKWpKWtGnwoSteeZXuFHWQxxxOpFlNeYTwKocsXuCoa",
"output": "YES"
},
{
"input": "26\nEoqxUbsLjPytUHMiFnvcGWZdRK",
"output": "NO"
},
{
"input": "26\nvCUFRKElZOnjmXGylWQaHDiPst",
"output": "NO"
},
{
"input": "26\nWtrPuaHdXLKJMsnvQfgOiJZBEY",
"output": "NO"
},
{
"input": "26\npGiFluRteQwkaVoPszJyNBChxM",
"output": "NO"
},
{
"input": "26\ncTUpqjPmANrdbzSFhlWIoKxgVY",
"output": "NO"
},
{
"input": "26\nLndjgvAEuICHKxPwqYztosrmBN",
"output": "NO"
},
{
"input": "26\nMdaXJrCipnOZLykfqHWEStevbU",
"output": "NO"
},
{
"input": "26\nEjDWsVxfKTqGXRnUMOLYcIzPba",
"output": "NO"
},
{
"input": "26\nxKwzRMpunYaqsdfaBgJcVElTHo",
"output": "NO"
},
{
"input": "26\nnRYUQsTwCPLZkgshfEXvBdoiMa",
"output": "NO"
},
{
"input": "26\nHNCQPfJutyAlDGsvRxZWMEbIdO",
"output": "NO"
},
{
"input": "26\nDaHJIpvKznQcmUyWsTGObXRFDe",
"output": "NO"
},
{
"input": "26\nkqvAnFAiRhzlJbtyuWedXSPcOG",
"output": "NO"
},
{
"input": "26\nhlrvgdwsIOyjcmUZXtAKEqoBpF",
"output": "NO"
},
{
"input": "26\njLfXXiMhBTcAwQVReGnpKzdsYu",
"output": "NO"
},
{
"input": "26\nlNMcVuwItjxRBGAekjhyDsQOzf",
"output": "NO"
},
{
"input": "26\nRkSwbNoYldUGtAZvpFMcxhIJFE",
"output": "NO"
},
{
"input": "26\nDqspXZJTuONYieKgaHLMBwfVSC",
"output": "NO"
},
{
"input": "26\necOyUkqNljFHRVXtIpWabGMLDz",
"output": "NO"
},
{
"input": "26\nEKAvqZhBnPmVCDRlgWJfOusxYI",
"output": "NO"
},
{
"input": "26\naLbgqeYchKdMrsZxIPFvTOWNjA",
"output": "NO"
},
{
"input": "26\nxfpBLsndiqtacOCHGmeWUjRkYz",
"output": "NO"
},
{
"input": "26\nXsbRKtqleZPNIVCdfUhyagAomJ",
"output": "NO"
},
{
"input": "26\nAmVtbrwquEthZcjKPLiyDgSoNF",
"output": "NO"
},
{
"input": "26\nOhvXDcwqAUmSEPRZGnjFLiKtNB",
"output": "NO"
},
{
"input": "26\nEKWJqCFLRmstxVBdYuinpbhaOg",
"output": "NO"
},
{
"input": "26\nmnbvcxxlkjhgfdsapoiuytrewq",
"output": "NO"
},
{
"input": "26\naAbcdefghijklmnopqrstuvwxy",
"output": "NO"
},
{
"input": "30\nABCDEFGHTYRIOPLabcdefghtyriopl",
"output": "NO"
},
{
"input": "25\nabcdefghijklmnopqrstuvwxy",
"output": "NO"
},
{
"input": "26\nabcdefhijklmnopqrstVxyzABC",
"output": "NO"
},
{
"input": "25\nqwertyuiopasdfghjklxcvbnm",
"output": "NO"
},
{
"input": "34\nTheQuickBrownFoxJumpsOverTheLayDog",
"output": "NO"
},
{
"input": "26\nabcdefghigklmnopqrstuvwxyz",
"output": "NO"
},
{
"input": "26\nabcdefghijklmnopqrstuvwxyA",
"output": "NO"
},
{
"input": "50\nqazwsxedcrfvtgbyhnujmikolQWERTYUIOASDFGHJKLZXCVBNM",
"output": "NO"
},
{
"input": "35\nTheQuickBrownFoxJumpsOverTheLasyDog",
"output": "NO"
},
{
"input": "25\nbcdefghijklmnopqrstuvwxyz",
"output": "NO"
},
{
"input": "38\nAbCdEfGhIjKlMnOpQrStVwXyZzzzzzzaaaaaaa",
"output": "NO"
},
{
"input": "26\nabcdefghiklmnopqrstvxyzABC",
"output": "NO"
},
{
"input": "26\nabcdefghijklmnopqrstuvwxzZ",
"output": "NO"
},
{
"input": "50\nabcdefghijklmnopqrstuvwxyABCDEFGHIJKLMNOPQRSTUVWXY",
"output": "NO"
}
] | 1,698,949,561
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 59
| 62
| 0
|
def main():
# Reading multiple test cases
n = int(input())
word = input().strip().lower() # string values
if len(set(word)) == 26:
print("YES")
else:
print("NO")
if __name__ == "__main__":
main()
|
Title: Pangram
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices.
You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of characters in the string.
The second line contains the string. The string consists only of uppercase and lowercase Latin letters.
Output Specification:
Output "YES", if the string is a pangram and "NO" otherwise.
Demo Input:
['12\ntoosmallword\n', '35\nTheQuickBrownFoxJumpsOverTheLazyDog\n']
Demo Output:
['NO\n', 'YES\n']
Note:
none
|
```python
def main():
# Reading multiple test cases
n = int(input())
word = input().strip().lower() # string values
if len(set(word)) == 26:
print("YES")
else:
print("NO")
if __name__ == "__main__":
main()
```
| 3
|
|
259
|
B
|
Little Elephant and Magic Square
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation"
] | null | null |
Little Elephant loves magic squares very much.
A magic square is a 3<=×<=3 table, each cell contains some positive integer. At that the sums of integers in all rows, columns and diagonals of the table are equal. The figure below shows the magic square, the sum of integers in all its rows, columns and diagonals equals 15.
The Little Elephant remembered one magic square. He started writing this square on a piece of paper, but as he wrote, he forgot all three elements of the main diagonal of the magic square. Fortunately, the Little Elephant clearly remembered that all elements of the magic square did not exceed 105.
Help the Little Elephant, restore the original magic square, given the Elephant's notes.
|
The first three lines of the input contain the Little Elephant's notes. The first line contains elements of the first row of the magic square. The second line contains the elements of the second row, the third line is for the third row. The main diagonal elements that have been forgotten by the Elephant are represented by zeroes.
It is guaranteed that the notes contain exactly three zeroes and they are all located on the main diagonal. It is guaranteed that all positive numbers in the table do not exceed 105.
|
Print three lines, in each line print three integers — the Little Elephant's magic square. If there are multiple magic squares, you are allowed to print any of them. Note that all numbers you print must be positive and not exceed 105.
It is guaranteed that there exists at least one magic square that meets the conditions.
|
[
"0 1 1\n1 0 1\n1 1 0\n",
"0 3 6\n5 0 5\n4 7 0\n"
] |
[
"1 1 1\n1 1 1\n1 1 1\n",
"6 3 6\n5 5 5\n4 7 4\n"
] |
none
| 1,000
|
[
{
"input": "0 1 1\n1 0 1\n1 1 0",
"output": "1 1 1\n1 1 1\n1 1 1"
},
{
"input": "0 3 6\n5 0 5\n4 7 0",
"output": "6 3 6\n5 5 5\n4 7 4"
},
{
"input": "0 4 4\n4 0 4\n4 4 0",
"output": "4 4 4\n4 4 4\n4 4 4"
},
{
"input": "0 54 48\n36 0 78\n66 60 0",
"output": "69 54 48\n36 57 78\n66 60 45"
},
{
"input": "0 17 14\n15 0 15\n16 13 0",
"output": "14 17 14\n15 15 15\n16 13 16"
},
{
"input": "0 97 56\n69 0 71\n84 43 0",
"output": "57 97 56\n69 70 71\n84 43 83"
},
{
"input": "0 1099 1002\n1027 0 1049\n1074 977 0",
"output": "1013 1099 1002\n1027 1038 1049\n1074 977 1063"
},
{
"input": "0 98721 99776\n99575 0 99123\n98922 99977 0",
"output": "99550 98721 99776\n99575 99349 99123\n98922 99977 99148"
},
{
"input": "0 6361 2304\n1433 0 8103\n7232 3175 0",
"output": "5639 6361 2304\n1433 4768 8103\n7232 3175 3897"
},
{
"input": "0 99626 99582\n99766 0 99258\n99442 99398 0",
"output": "99328 99626 99582\n99766 99512 99258\n99442 99398 99696"
},
{
"input": "0 99978 99920\n99950 0 99918\n99948 99890 0",
"output": "99904 99978 99920\n99950 99934 99918\n99948 99890 99964"
},
{
"input": "0 840 666\n612 0 948\n894 720 0",
"output": "834 840 666\n612 780 948\n894 720 726"
},
{
"input": "0 28 10\n12 0 24\n26 8 0",
"output": "16 28 10\n12 18 24\n26 8 20"
},
{
"input": "0 120 83\n98 0 90\n105 68 0",
"output": "79 120 83\n98 94 90\n105 68 109"
},
{
"input": "0 86900 85807\n85836 0 86842\n86871 85778 0",
"output": "86310 86900 85807\n85836 86339 86842\n86871 85778 86368"
},
{
"input": "0 74 78\n78 0 74\n74 78 0",
"output": "76 74 78\n78 76 74\n74 78 76"
},
{
"input": "0 505 681\n605 0 657\n581 757 0",
"output": "707 505 681\n605 631 657\n581 757 555"
},
{
"input": "0 662 918\n822 0 854\n758 1014 0",
"output": "934 662 918\n822 838 854\n758 1014 742"
},
{
"input": "0 93 95\n93 0 97\n95 97 0",
"output": "97 93 95\n93 95 97\n95 97 93"
},
{
"input": "0 709 712\n719 0 695\n702 705 0",
"output": "700 709 712\n719 707 695\n702 705 714"
},
{
"input": "0 7 6\n9 0 1\n4 3 0",
"output": "2 7 6\n9 5 1\n4 3 8"
},
{
"input": "0 9 2\n3 0 7\n8 1 0",
"output": "4 9 2\n3 5 7\n8 1 6"
},
{
"input": "0 1 43\n13 0 61\n31 73 0",
"output": "67 1 43\n13 37 61\n31 73 7"
},
{
"input": "0 100000 100000\n100000 0 100000\n100000 100000 0",
"output": "100000 100000 100000\n100000 100000 100000\n100000 100000 100000"
}
] | 1,624,362,917
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 0
|
def solve(f , s , t):
f_tot , s_tot , t_tot = sum(f) , sum(s) , sum(t)
get = (f_tot + s_tot + t_tot) // 2
f[0] , s[1] , t[2] = get - f_tot , get - s_tot , get - t_tot
print(f)
print(s)
print(t)
return
f = list(map(int,input().split()))
s = list(map(int,input().split()))
t = list(map(int,input().split()))
print(solve(f , s , t))
|
Title: Little Elephant and Magic Square
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Elephant loves magic squares very much.
A magic square is a 3<=×<=3 table, each cell contains some positive integer. At that the sums of integers in all rows, columns and diagonals of the table are equal. The figure below shows the magic square, the sum of integers in all its rows, columns and diagonals equals 15.
The Little Elephant remembered one magic square. He started writing this square on a piece of paper, but as he wrote, he forgot all three elements of the main diagonal of the magic square. Fortunately, the Little Elephant clearly remembered that all elements of the magic square did not exceed 105.
Help the Little Elephant, restore the original magic square, given the Elephant's notes.
Input Specification:
The first three lines of the input contain the Little Elephant's notes. The first line contains elements of the first row of the magic square. The second line contains the elements of the second row, the third line is for the third row. The main diagonal elements that have been forgotten by the Elephant are represented by zeroes.
It is guaranteed that the notes contain exactly three zeroes and they are all located on the main diagonal. It is guaranteed that all positive numbers in the table do not exceed 105.
Output Specification:
Print three lines, in each line print three integers — the Little Elephant's magic square. If there are multiple magic squares, you are allowed to print any of them. Note that all numbers you print must be positive and not exceed 105.
It is guaranteed that there exists at least one magic square that meets the conditions.
Demo Input:
['0 1 1\n1 0 1\n1 1 0\n', '0 3 6\n5 0 5\n4 7 0\n']
Demo Output:
['1 1 1\n1 1 1\n1 1 1\n', '6 3 6\n5 5 5\n4 7 4\n']
Note:
none
|
```python
def solve(f , s , t):
f_tot , s_tot , t_tot = sum(f) , sum(s) , sum(t)
get = (f_tot + s_tot + t_tot) // 2
f[0] , s[1] , t[2] = get - f_tot , get - s_tot , get - t_tot
print(f)
print(s)
print(t)
return
f = list(map(int,input().split()))
s = list(map(int,input().split()))
t = list(map(int,input().split()))
print(solve(f , s , t))
```
| 0
|
|
445
|
A
|
DZY Loves Chessboard
|
PROGRAMMING
| 1,200
|
[
"dfs and similar",
"implementation"
] | null | null |
DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard.
|
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad.
|
Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists.
|
[
"1 1\n.\n",
"2 2\n..\n..\n",
"3 3\n.-.\n---\n--."
] |
[
"B\n",
"BW\nWB\n",
"B-B\n---\n--B"
] |
In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are.
| 500
|
[
{
"input": "1 1\n.",
"output": "B"
},
{
"input": "2 2\n..\n..",
"output": "BW\nWB"
},
{
"input": "3 3\n.-.\n---\n--.",
"output": "B-B\n---\n--B"
},
{
"input": "3 1\n-\n.\n.",
"output": "-\nW\nB"
},
{
"input": "11 11\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------",
"output": "-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------"
},
{
"input": "1 1\n-",
"output": "-"
},
{
"input": "4 2\n..\n..\n..\n..",
"output": "BW\nWB\nBW\nWB"
},
{
"input": "5 1\n.\n.\n.\n.\n.",
"output": "B\nW\nB\nW\nB"
}
] | 1,615,035,231
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 37
| 109
| 1,740,800
|
n,m=map(int,input().split())
l=[]
for _ in range(n):
l.append(list(input()))
for i in range(n):
for j in range(m):
if l[i][j]=='.':
if (i+j)%2==0:
l[i][j]='B'
else:
l[i][j]='W'
for _ in l:
print(''.join(_))
|
Title: DZY Loves Chessboard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad.
Output Specification:
Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists.
Demo Input:
['1 1\n.\n', '2 2\n..\n..\n', '3 3\n.-.\n---\n--.']
Demo Output:
['B\n', 'BW\nWB\n', 'B-B\n---\n--B']
Note:
In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are.
|
```python
n,m=map(int,input().split())
l=[]
for _ in range(n):
l.append(list(input()))
for i in range(n):
for j in range(m):
if l[i][j]=='.':
if (i+j)%2==0:
l[i][j]='B'
else:
l[i][j]='W'
for _ in l:
print(''.join(_))
```
| 3
|
|
559
|
B
|
Equivalent Strings
|
PROGRAMMING
| 1,700
|
[
"divide and conquer",
"hashing",
"sortings",
"strings"
] | null | null |
Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases:
1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1
As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent.
Gerald has already completed this home task. Now it's your turn!
|
The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length.
|
Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise.
|
[
"aaba\nabaa\n",
"aabb\nabab\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a".
In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa".
| 1,000
|
[
{
"input": "aaba\nabaa",
"output": "YES"
},
{
"input": "aabb\nabab",
"output": "NO"
},
{
"input": "a\na",
"output": "YES"
},
{
"input": "a\nb",
"output": "NO"
},
{
"input": "ab\nab",
"output": "YES"
},
{
"input": "ab\nba",
"output": "YES"
},
{
"input": "ab\nbb",
"output": "NO"
},
{
"input": "zzaa\naazz",
"output": "YES"
},
{
"input": "azza\nzaaz",
"output": "YES"
},
{
"input": "abc\nabc",
"output": "YES"
},
{
"input": "abc\nacb",
"output": "NO"
},
{
"input": "azzz\nzzaz",
"output": "YES"
},
{
"input": "abcd\ndcab",
"output": "YES"
},
{
"input": "abcd\ncdab",
"output": "YES"
},
{
"input": "abcd\ndcba",
"output": "YES"
},
{
"input": "abcd\nacbd",
"output": "NO"
},
{
"input": "oloaxgddgujq\noloaxgujqddg",
"output": "YES"
},
{
"input": "uwzwdxfmosmqatyv\ndxfmzwwusomqvyta",
"output": "YES"
},
{
"input": "hagnzomowtledfdotnll\nledfdotnllomowthagnz",
"output": "YES"
},
{
"input": "snyaydaeobufdg\nsnyaydaeobufdg",
"output": "YES"
},
{
"input": "baaaaa\nabaaaa",
"output": "NO"
},
{
"input": "hhiisug\nmzdjwju",
"output": "NO"
},
{
"input": "bbbabbabaaab\naaaabbabbbbb",
"output": "NO"
},
{
"input": "bbaaab\naababb",
"output": "NO"
},
{
"input": "aabbaaaa\naaaaabab",
"output": "NO"
},
{
"input": "aab\naba",
"output": "NO"
},
{
"input": "abcddd\nbacddd",
"output": "NO"
},
{
"input": "qgiufelsfhanx\naaaaaaaaaaaaa",
"output": "NO"
},
{
"input": "aabaababaaba\naababaaababa",
"output": "NO"
},
{
"input": "nocdqzdriyyil\naaaaaaaaaaaaa",
"output": "NO"
},
{
"input": "zdmctxl\nkojqhgw",
"output": "NO"
},
{
"input": "yhwepqwyhwepqwyhwepqweahnqtueahnqtueahnqtuyhwepqwyhwepqwyhwepqwyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtueahnqtueahnqtueahnqtueahnqtu\neahnqtueahnqtueahnqtuyhwepqweahnqtuyhwepqwyhwepqweahnqtuyhwepqweahnqtuyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtuyhwepqwyhwepqwyhwepqw",
"output": "NO"
},
{
"input": "abc\nbac",
"output": "NO"
},
{
"input": "ottceez\npcstdvz",
"output": "NO"
}
] | 1,541,963,556
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 62
| 0
|
def smallest(x):
if len(x) % 2:
return x
s1 = smallest(x[:len(x)/2])
s2 = smallest(x[len(x)/2])
if s1 < s2:
return s1 + s2
else:
return s2 + s1
def are_equiv(x, y):
if smallest(x) == smallest(y):
return "YES"
else:
return "NO"
print(are_equiv(input(), input()))
|
Title: Equivalent Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases:
1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1
As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent.
Gerald has already completed this home task. Now it's your turn!
Input Specification:
The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length.
Output Specification:
Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise.
Demo Input:
['aaba\nabaa\n', 'aabb\nabab\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a".
In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa".
|
```python
def smallest(x):
if len(x) % 2:
return x
s1 = smallest(x[:len(x)/2])
s2 = smallest(x[len(x)/2])
if s1 < s2:
return s1 + s2
else:
return s2 + s1
def are_equiv(x, y):
if smallest(x) == smallest(y):
return "YES"
else:
return "NO"
print(are_equiv(input(), input()))
```
| -1
|
|
899
|
B
|
Months and Years
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
Everybody in Russia uses Gregorian calendar. In this calendar there are 31 days in January, 28 or 29 days in February (depending on whether the year is leap or not), 31 days in March, 30 days in April, 31 days in May, 30 in June, 31 in July, 31 in August, 30 in September, 31 in October, 30 in November, 31 in December.
A year is leap in one of two cases: either its number is divisible by 4, but not divisible by 100, or is divisible by 400. For example, the following years are leap: 2000, 2004, but years 1900 and 2018 are not leap.
In this problem you are given *n* (1<=≤<=*n*<=≤<=24) integers *a*1,<=*a*2,<=...,<=*a**n*, and you have to check if these integers could be durations in days of *n* consecutive months, according to Gregorian calendar. Note that these months could belong to several consecutive years. In other words, check if there is a month in some year, such that its duration is *a*1 days, duration of the next month is *a*2 days, and so on.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=24) — the number of integers.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (28<=≤<=*a**i*<=≤<=31) — the numbers you are to check.
|
If there are several consecutive months that fit the sequence, print "YES" (without quotes). Otherwise, print "NO" (without quotes).
You can print each letter in arbitrary case (small or large).
|
[
"4\n31 31 30 31\n",
"2\n30 30\n",
"5\n29 31 30 31 30\n",
"3\n31 28 30\n",
"3\n31 31 28\n"
] |
[
"Yes\n\n",
"No\n\n",
"Yes\n\n",
"No\n\n",
"Yes\n\n"
] |
In the first example the integers can denote months July, August, September and October.
In the second example the answer is no, because there are no two consecutive months each having 30 days.
In the third example the months are: February (leap year) — March — April – May — June.
In the fourth example the number of days in the second month is 28, so this is February. March follows February and has 31 days, but not 30, so the answer is NO.
In the fifth example the months are: December — January — February (non-leap year).
| 1,000
|
[
{
"input": "4\n31 31 30 31",
"output": "Yes"
},
{
"input": "2\n30 30",
"output": "No"
},
{
"input": "5\n29 31 30 31 30",
"output": "Yes"
},
{
"input": "3\n31 28 30",
"output": "No"
},
{
"input": "3\n31 31 28",
"output": "Yes"
},
{
"input": "24\n29 28 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "4\n31 29 31 30",
"output": "Yes"
},
{
"input": "24\n31 28 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "8\n31 29 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "1\n29",
"output": "Yes"
},
{
"input": "8\n31 29 31 30 31 31 31 31",
"output": "No"
},
{
"input": "1\n31",
"output": "Yes"
},
{
"input": "11\n30 31 30 31 31 30 31 30 31 31 28",
"output": "Yes"
},
{
"input": "21\n30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31",
"output": "Yes"
},
{
"input": "4\n31 28 28 30",
"output": "No"
},
{
"input": "2\n30 31",
"output": "Yes"
},
{
"input": "7\n28 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "4\n28 31 30 31",
"output": "Yes"
},
{
"input": "17\n28 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "9\n31 31 29 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "4\n31 28 31 30",
"output": "Yes"
},
{
"input": "21\n30 31 30 31 31 28 31 30 31 30 31 29 30 31 30 31 31 28 31 30 31",
"output": "No"
},
{
"input": "2\n31 31",
"output": "Yes"
},
{
"input": "17\n31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "4\n30 31 30 31",
"output": "Yes"
},
{
"input": "12\n31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "12\n31 29 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "11\n30 31 30 31 31 30 31 30 31 29 28",
"output": "No"
},
{
"input": "22\n31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "14\n31 30 31 31 28 31 30 31 30 31 31 30 31 30",
"output": "Yes"
},
{
"input": "12\n31 30 31 31 28 31 30 31 30 31 31 30",
"output": "Yes"
},
{
"input": "4\n31 29 29 30",
"output": "No"
},
{
"input": "7\n28 28 30 31 30 31 31",
"output": "No"
},
{
"input": "9\n29 31 29 31 30 31 30 31 31",
"output": "No"
},
{
"input": "17\n31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "2\n31 29",
"output": "Yes"
},
{
"input": "12\n31 28 31 30 31 30 31 31 30 31 28 31",
"output": "No"
},
{
"input": "2\n29 31",
"output": "Yes"
},
{
"input": "12\n31 29 31 30 31 30 31 30 30 31 30 31",
"output": "No"
},
{
"input": "12\n31 28 31 30 31 29 31 31 30 31 30 31",
"output": "No"
},
{
"input": "22\n31 30 31 30 31 31 30 31 30 31 31 28 31 30 28 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "14\n31 30 31 31 28 31 30 31 30 31 31 30 29 30",
"output": "No"
},
{
"input": "19\n31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31",
"output": "Yes"
},
{
"input": "20\n31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "1\n28",
"output": "Yes"
},
{
"input": "1\n29",
"output": "Yes"
},
{
"input": "17\n31 30 31 30 31 31 29 31 30 31 31 31 31 30 31 30 31",
"output": "No"
},
{
"input": "1\n30",
"output": "Yes"
},
{
"input": "1\n31",
"output": "Yes"
},
{
"input": "24\n31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "24\n28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "12\n31 30 31 31 28 28 30 31 30 31 31 30",
"output": "No"
},
{
"input": "24\n29 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "24\n28 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "24\n31 29 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "13\n28 31 30 31 30 31 31 30 31 30 31 31 28",
"output": "Yes"
},
{
"input": "15\n31 31 28 31 30 31 30 31 31 30 31 30 31 31 29",
"output": "Yes"
},
{
"input": "23\n31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31 29 31",
"output": "Yes"
},
{
"input": "24\n31 30 31 30 31 31 30 31 30 31 31 30 31 30 31 30 31 31 30 31 30 31 31 30",
"output": "No"
},
{
"input": "23\n29 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "15\n31 31 29 31 30 31 30 31 31 30 31 30 31 31 28",
"output": "Yes"
},
{
"input": "12\n31 30 31 30 31 30 31 31 30 31 30 31",
"output": "No"
}
] | 1,513,902,379
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 62
| 77
| 5,632,000
|
n=int(input())
line=input().split(' ')
line=[int(i) for i in line]
b1=[31,28,31,30,31,30,31,31,30,31,30,31]
b2=[31,29,31,30,31,30,31,31,30,31,30,31]
b=b1*3+b2+b1*3
s=0
for i in range(0,84):
if line==b[i:i+n]:
s=1
if s==1:
print('Yes',end='')
print('\n')
else:
print('No',end='')
print('\n')
|
Title: Months and Years
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Everybody in Russia uses Gregorian calendar. In this calendar there are 31 days in January, 28 or 29 days in February (depending on whether the year is leap or not), 31 days in March, 30 days in April, 31 days in May, 30 in June, 31 in July, 31 in August, 30 in September, 31 in October, 30 in November, 31 in December.
A year is leap in one of two cases: either its number is divisible by 4, but not divisible by 100, or is divisible by 400. For example, the following years are leap: 2000, 2004, but years 1900 and 2018 are not leap.
In this problem you are given *n* (1<=≤<=*n*<=≤<=24) integers *a*1,<=*a*2,<=...,<=*a**n*, and you have to check if these integers could be durations in days of *n* consecutive months, according to Gregorian calendar. Note that these months could belong to several consecutive years. In other words, check if there is a month in some year, such that its duration is *a*1 days, duration of the next month is *a*2 days, and so on.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=24) — the number of integers.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (28<=≤<=*a**i*<=≤<=31) — the numbers you are to check.
Output Specification:
If there are several consecutive months that fit the sequence, print "YES" (without quotes). Otherwise, print "NO" (without quotes).
You can print each letter in arbitrary case (small or large).
Demo Input:
['4\n31 31 30 31\n', '2\n30 30\n', '5\n29 31 30 31 30\n', '3\n31 28 30\n', '3\n31 31 28\n']
Demo Output:
['Yes\n\n', 'No\n\n', 'Yes\n\n', 'No\n\n', 'Yes\n\n']
Note:
In the first example the integers can denote months July, August, September and October.
In the second example the answer is no, because there are no two consecutive months each having 30 days.
In the third example the months are: February (leap year) — March — April – May — June.
In the fourth example the number of days in the second month is 28, so this is February. March follows February and has 31 days, but not 30, so the answer is NO.
In the fifth example the months are: December — January — February (non-leap year).
|
```python
n=int(input())
line=input().split(' ')
line=[int(i) for i in line]
b1=[31,28,31,30,31,30,31,31,30,31,30,31]
b2=[31,29,31,30,31,30,31,31,30,31,30,31]
b=b1*3+b2+b1*3
s=0
for i in range(0,84):
if line==b[i:i+n]:
s=1
if s==1:
print('Yes',end='')
print('\n')
else:
print('No',end='')
print('\n')
```
| 3
|
|
554
|
A
|
Kyoya and Photobooks
|
PROGRAMMING
| 900
|
[
"brute force",
"math",
"strings"
] | null | null |
Kyoya Ootori is selling photobooks of the Ouran High School Host Club. He has 26 photos, labeled "a" to "z", and he has compiled them into a photo booklet with some photos in some order (possibly with some photos being duplicated). A photo booklet can be described as a string of lowercase letters, consisting of the photos in the booklet in order. He now wants to sell some "special edition" photobooks, each with one extra photo inserted anywhere in the book. He wants to make as many distinct photobooks as possible, so he can make more money. He asks Haruhi, how many distinct photobooks can he make by inserting one extra photo into the photobook he already has?
Please help Haruhi solve this problem.
|
The first line of input will be a single string *s* (1<=≤<=|*s*|<=≤<=20). String *s* consists only of lowercase English letters.
|
Output a single integer equal to the number of distinct photobooks Kyoya Ootori can make.
|
[
"a\n",
"hi\n"
] |
[
"51\n",
"76\n"
] |
In the first case, we can make 'ab','ac',...,'az','ba','ca',...,'za', and 'aa', producing a total of 51 distinct photo booklets.
| 250
|
[
{
"input": "a",
"output": "51"
},
{
"input": "hi",
"output": "76"
},
{
"input": "y",
"output": "51"
},
{
"input": "kgan",
"output": "126"
},
{
"input": "zoabkyuvus",
"output": "276"
},
{
"input": "spyemhyznjieyhhbk",
"output": "451"
},
{
"input": "xulsyfkuizjauadjjopu",
"output": "526"
},
{
"input": "e",
"output": "51"
},
{
"input": "zv",
"output": "76"
},
{
"input": "jgv",
"output": "101"
},
{
"input": "zsfo",
"output": "126"
},
{
"input": "jselr",
"output": "151"
},
{
"input": "dwemig",
"output": "176"
},
{
"input": "mddoxsf",
"output": "201"
},
{
"input": "jgirkrmi",
"output": "226"
},
{
"input": "spkxurcum",
"output": "251"
},
{
"input": "fykkiubdkt",
"output": "276"
},
{
"input": "fznbcxsxygs",
"output": "301"
},
{
"input": "qcrvrdqcbtou",
"output": "326"
},
{
"input": "qktrbjzrqgmlr",
"output": "351"
},
{
"input": "foamodbvptlxxg",
"output": "376"
},
{
"input": "ydzpjhsidipricw",
"output": "401"
},
{
"input": "lpfpndmjfvqejdgf",
"output": "426"
},
{
"input": "ofkvparuvjtggnmab",
"output": "451"
},
{
"input": "xxncfutrtxcwdzwbgs",
"output": "476"
},
{
"input": "zovhffccflkgqncsdte",
"output": "501"
},
{
"input": "cskgsxywlvfeicoueglr",
"output": "526"
},
{
"input": "gggggggggggggggggggg",
"output": "526"
},
{
"input": "qdqdddqddqqddqddqdqd",
"output": "526"
},
{
"input": "takttttaakaaktakttkt",
"output": "526"
},
{
"input": "coccoooogogcgocccmcg",
"output": "526"
},
{
"input": "kskkskkkssksssk",
"output": "401"
},
{
"input": "lllllllllllllll",
"output": "401"
}
] | 1,620,304,024
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 46
| 6,963,200
|
import itertools
import math
def repetations(l1):
s1=set(l1)
prod=1
for i in s1:
prod*=math.factorial(l1.count(i))
return prod
st=input()
l1=list(st)
base=97
ans=0
numer=len(st)+1
for i in range(base,123):
l1.append(chr(i))
co=len(list(itertools.permutations(l1,2)))
res=repetations(l1)
# print(res,numer)
ans+=(numer/res)
l1.pop()
print(int(ans))
|
Title: Kyoya and Photobooks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kyoya Ootori is selling photobooks of the Ouran High School Host Club. He has 26 photos, labeled "a" to "z", and he has compiled them into a photo booklet with some photos in some order (possibly with some photos being duplicated). A photo booklet can be described as a string of lowercase letters, consisting of the photos in the booklet in order. He now wants to sell some "special edition" photobooks, each with one extra photo inserted anywhere in the book. He wants to make as many distinct photobooks as possible, so he can make more money. He asks Haruhi, how many distinct photobooks can he make by inserting one extra photo into the photobook he already has?
Please help Haruhi solve this problem.
Input Specification:
The first line of input will be a single string *s* (1<=≤<=|*s*|<=≤<=20). String *s* consists only of lowercase English letters.
Output Specification:
Output a single integer equal to the number of distinct photobooks Kyoya Ootori can make.
Demo Input:
['a\n', 'hi\n']
Demo Output:
['51\n', '76\n']
Note:
In the first case, we can make 'ab','ac',...,'az','ba','ca',...,'za', and 'aa', producing a total of 51 distinct photo booklets.
|
```python
import itertools
import math
def repetations(l1):
s1=set(l1)
prod=1
for i in s1:
prod*=math.factorial(l1.count(i))
return prod
st=input()
l1=list(st)
base=97
ans=0
numer=len(st)+1
for i in range(base,123):
l1.append(chr(i))
co=len(list(itertools.permutations(l1,2)))
res=repetations(l1)
# print(res,numer)
ans+=(numer/res)
l1.pop()
print(int(ans))
```
| 0
|
|
294
|
A
|
Shaass and Oskols
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Shaass has decided to hunt some birds. There are *n* horizontal electricity wires aligned parallel to each other. Wires are numbered 1 to *n* from top to bottom. On each wire there are some oskols sitting next to each other. Oskol is the name of a delicious kind of birds in Shaass's territory. Supposed there are *a**i* oskols sitting on the *i*-th wire.
Sometimes Shaass shots one of the birds and the bird dies (suppose that this bird sat at the *i*-th wire). Consequently all the birds on the *i*-th wire to the left of the dead bird get scared and jump up on the wire number *i*<=-<=1, if there exists no upper wire they fly away. Also all the birds to the right of the dead bird jump down on wire number *i*<=+<=1, if there exists no such wire they fly away.
Shaass has shot *m* birds. You're given the initial number of birds on each wire, tell him how many birds are sitting on each wire after the shots.
|
The first line of the input contains an integer *n*, (1<=≤<=*n*<=≤<=100). The next line contains a list of space-separated integers *a*1,<=*a*2,<=...,<=*a**n*, (0<=≤<=*a**i*<=≤<=100).
The third line contains an integer *m*, (0<=≤<=*m*<=≤<=100). Each of the next *m* lines contains two integers *x**i* and *y**i*. The integers mean that for the *i*-th time Shaass shoot the *y**i*-th (from left) bird on the *x**i*-th wire, (1<=≤<=*x**i*<=≤<=*n*,<=1<=≤<=*y**i*). It's guaranteed there will be at least *y**i* birds on the *x**i*-th wire at that moment.
|
On the *i*-th line of the output print the number of birds on the *i*-th wire.
|
[
"5\n10 10 10 10 10\n5\n2 5\n3 13\n2 12\n1 13\n4 6\n",
"3\n2 4 1\n1\n2 2\n"
] |
[
"0\n12\n5\n0\n16\n",
"3\n0\n3\n"
] |
none
| 500
|
[
{
"input": "5\n10 10 10 10 10\n5\n2 5\n3 13\n2 12\n1 13\n4 6",
"output": "0\n12\n5\n0\n16"
},
{
"input": "3\n2 4 1\n1\n2 2",
"output": "3\n0\n3"
},
{
"input": "5\n58 51 45 27 48\n5\n4 9\n5 15\n4 5\n5 8\n1 43",
"output": "0\n66\n57\n7\n0"
},
{
"input": "10\n48 53 10 28 91 56 81 2 67 52\n2\n2 40\n6 51",
"output": "87\n0\n23\n28\n141\n0\n86\n2\n67\n52"
},
{
"input": "2\n72 45\n6\n1 69\n2 41\n1 19\n2 7\n1 5\n2 1",
"output": "0\n0"
},
{
"input": "10\n95 54 36 39 98 30 19 24 14 12\n3\n9 5\n8 15\n7 5",
"output": "95\n54\n36\n39\n98\n34\n0\n28\n13\n21"
},
{
"input": "100\n95 15 25 18 64 62 23 59 70 84 50 26 87 35 75 86 0 22 77 60 66 41 21 9 75 50 25 3 69 14 39 68 64 46 59 99 2 0 21 76 90 12 61 42 6 91 36 39 47 41 93 81 66 57 70 36 68 89 52 1 19 93 67 22 76 20 8 81 98 18 100 73 61 93 75 80 53 72 40 20 2 86 33 59 27 16 11 26 55 44 47 55 94 58 2 55 82 22 9 95\n0",
"output": "95\n15\n25\n18\n64\n62\n23\n59\n70\n84\n50\n26\n87\n35\n75\n86\n0\n22\n77\n60\n66\n41\n21\n9\n75\n50\n25\n3\n69\n14\n39\n68\n64\n46\n59\n99\n2\n0\n21\n76\n90\n12\n61\n42\n6\n91\n36\n39\n47\n41\n93\n81\n66\n57\n70\n36\n68\n89\n52\n1\n19\n93\n67\n22\n76\n20\n8\n81\n98\n18\n100\n73\n61\n93\n75\n80\n53\n72\n40\n20\n2\n86\n33\n59\n27\n16\n11\n26\n55\n44\n47\n55\n94\n58\n2\n55\n82\n22\n9\n95"
},
{
"input": "1\n100\n1\n1 100",
"output": "0"
},
{
"input": "1\n100\n1\n1 1",
"output": "0"
},
{
"input": "1\n50\n1\n1 25",
"output": "0"
},
{
"input": "2\n50 0\n1\n1 1",
"output": "0\n49"
},
{
"input": "1\n10\n0",
"output": "10"
}
] | 1,591,747,154
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 2
| 186
| 307,200
|
n = int(input())
l = list(map(int, input().split()))
m = int(input())
for i in range(m):
a, b = map(int, input().split())
if(a!=1):
l[a-2] += l[a-1]-(l[a-1]-b+1)
l[a] += l[a-1]-b
l[a-1] = 0
elif(a==1):
l[a] += l[a-1]-b
l[a-1]=0
for i in l:
print(i)
|
Title: Shaass and Oskols
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Shaass has decided to hunt some birds. There are *n* horizontal electricity wires aligned parallel to each other. Wires are numbered 1 to *n* from top to bottom. On each wire there are some oskols sitting next to each other. Oskol is the name of a delicious kind of birds in Shaass's territory. Supposed there are *a**i* oskols sitting on the *i*-th wire.
Sometimes Shaass shots one of the birds and the bird dies (suppose that this bird sat at the *i*-th wire). Consequently all the birds on the *i*-th wire to the left of the dead bird get scared and jump up on the wire number *i*<=-<=1, if there exists no upper wire they fly away. Also all the birds to the right of the dead bird jump down on wire number *i*<=+<=1, if there exists no such wire they fly away.
Shaass has shot *m* birds. You're given the initial number of birds on each wire, tell him how many birds are sitting on each wire after the shots.
Input Specification:
The first line of the input contains an integer *n*, (1<=≤<=*n*<=≤<=100). The next line contains a list of space-separated integers *a*1,<=*a*2,<=...,<=*a**n*, (0<=≤<=*a**i*<=≤<=100).
The third line contains an integer *m*, (0<=≤<=*m*<=≤<=100). Each of the next *m* lines contains two integers *x**i* and *y**i*. The integers mean that for the *i*-th time Shaass shoot the *y**i*-th (from left) bird on the *x**i*-th wire, (1<=≤<=*x**i*<=≤<=*n*,<=1<=≤<=*y**i*). It's guaranteed there will be at least *y**i* birds on the *x**i*-th wire at that moment.
Output Specification:
On the *i*-th line of the output print the number of birds on the *i*-th wire.
Demo Input:
['5\n10 10 10 10 10\n5\n2 5\n3 13\n2 12\n1 13\n4 6\n', '3\n2 4 1\n1\n2 2\n']
Demo Output:
['0\n12\n5\n0\n16\n', '3\n0\n3\n']
Note:
none
|
```python
n = int(input())
l = list(map(int, input().split()))
m = int(input())
for i in range(m):
a, b = map(int, input().split())
if(a!=1):
l[a-2] += l[a-1]-(l[a-1]-b+1)
l[a] += l[a-1]-b
l[a-1] = 0
elif(a==1):
l[a] += l[a-1]-b
l[a-1]=0
for i in l:
print(i)
```
| -1
|
|
215
|
A
|
Bicycle Chain
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation"
] | null | null |
Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation.
We know that the *i*-th star on the pedal axle has *a**i* (0<=<<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=<<=*b*1<=<<=*b*2<=<<=...<=<<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value .
Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears.
In the problem, fraction denotes division in real numbers, that is, no rounding is performed.
|
The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing.
The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing.
It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces.
|
Print the number of "integer" gears with the maximum ratio among all "integer" gears.
|
[
"2\n4 5\n3\n12 13 15\n",
"4\n1 2 3 4\n5\n10 11 12 13 14\n"
] |
[
"2\n",
"1\n"
] |
In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15.
| 500
|
[
{
"input": "2\n4 5\n3\n12 13 15",
"output": "2"
},
{
"input": "4\n1 2 3 4\n5\n10 11 12 13 14",
"output": "1"
},
{
"input": "1\n1\n1\n1",
"output": "1"
},
{
"input": "2\n1 2\n1\n1",
"output": "1"
},
{
"input": "1\n1\n2\n1 2",
"output": "1"
},
{
"input": "4\n3 7 11 13\n4\n51 119 187 221",
"output": "4"
},
{
"input": "4\n2 3 4 5\n3\n1 2 3",
"output": "2"
},
{
"input": "10\n6 12 13 20 48 53 74 92 96 97\n10\n1 21 32 36 47 54 69 75 95 97",
"output": "1"
},
{
"input": "10\n5 9 10 14 15 17 19 22 24 26\n10\n2 11 17 19 21 22 24 25 27 28",
"output": "1"
},
{
"input": "10\n24 53 56 126 354 432 442 740 795 856\n10\n273 438 494 619 689 711 894 947 954 958",
"output": "1"
},
{
"input": "10\n3 4 6 7 8 10 14 16 19 20\n10\n3 4 5 7 8 10 15 16 18 20",
"output": "1"
},
{
"input": "10\n1 6 8 14 15 17 25 27 34 39\n10\n1 8 16 17 19 22 32 39 44 50",
"output": "1"
},
{
"input": "10\n5 21 22 23 25 32 35 36 38 39\n10\n3 7 8 9 18 21 23 24 36 38",
"output": "4"
},
{
"input": "50\n5 8 13 16 19 20 21 22 24 27 28 29 30 32 33 34 35 43 45 48 50 51 54 55 58 59 60 61 62 65 70 71 72 76 78 79 80 81 83 84 85 87 89 91 92 94 97 98 99 100\n50\n2 3 5 6 7 10 15 16 17 20 23 28 29 30 31 34 36 37 40 42 45 46 48 54 55 56 58 59 61 62 69 70 71 72 75 76 78 82 84 85 86 87 88 89 90 91 92 97 99 100",
"output": "1"
},
{
"input": "50\n3 5 6 8 9 11 13 19 21 23 24 32 34 35 42 50 51 52 56 58 59 69 70 72 73 75 76 77 78 80 83 88 90 95 96 100 101 102 108 109 113 119 124 135 138 141 142 143 145 150\n50\n5 8 10 11 18 19 23 30 35 43 51 53 55 58 63 68 69 71 77 78 79 82 83 86 88 89 91 92 93 94 96 102 103 105 109 110 113 114 116 123 124 126 127 132 133 135 136 137 142 149",
"output": "1"
},
{
"input": "50\n6 16 24 25 27 33 36 40 51 60 62 65 71 72 75 77 85 87 91 93 98 102 103 106 117 118 120 121 122 123 125 131 134 136 143 148 155 157 160 161 164 166 170 178 184 187 188 192 194 197\n50\n5 9 17 23 27 34 40 44 47 59 62 70 81 82 87 88 89 90 98 101 102 110 113 114 115 116 119 122 124 128 130 137 138 140 144 150 152 155 159 164 166 169 171 175 185 186 187 189 190 193",
"output": "1"
},
{
"input": "50\n14 22 23 31 32 35 48 63 76 79 88 97 101 102 103 104 106 113 114 115 116 126 136 138 145 152 155 156 162 170 172 173 179 180 182 203 208 210 212 222 226 229 231 232 235 237 245 246 247 248\n50\n2 5 6 16 28 44 45 46 54 55 56 63 72 80 87 93 94 96 97 100 101 103 132 135 140 160 164 165 167 168 173 180 182 185 186 192 194 198 199 202 203 211 213 216 217 227 232 233 236 245",
"output": "1"
},
{
"input": "50\n14 19 33 35 38 41 51 54 69 70 71 73 76 80 84 94 102 104 105 106 107 113 121 128 131 168 180 181 187 191 195 201 205 207 210 216 220 238 249 251 263 271 272 275 281 283 285 286 291 294\n50\n2 3 5 20 21 35 38 40 43 48 49 52 55 64 73 77 82 97 109 113 119 121 125 132 137 139 145 146 149 180 182 197 203 229 234 241 244 251 264 271 274 281 284 285 287 291 292 293 294 298",
"output": "1"
},
{
"input": "50\n2 4 5 16 18 19 22 23 25 26 34 44 48 54 67 79 80 84 92 110 116 133 138 154 163 171 174 202 205 218 228 229 234 245 247 249 250 263 270 272 274 275 277 283 289 310 312 334 339 342\n50\n1 5 17 18 25 37 46 47 48 59 67 75 80 83 84 107 115 122 137 141 159 162 175 180 184 204 221 224 240 243 247 248 249 258 259 260 264 266 269 271 274 293 294 306 329 330 334 335 342 350",
"output": "1"
},
{
"input": "50\n6 9 11 21 28 39 42 56 60 63 81 88 91 95 105 110 117 125 149 165 174 176 185 189 193 196 205 231 233 268 278 279 281 286 289 292 298 303 305 306 334 342 350 353 361 371 372 375 376 378\n50\n6 17 20 43 45 52 58 59 82 83 88 102 111 118 121 131 145 173 190 191 200 216 224 225 232 235 243 256 260 271 290 291 321 322 323 329 331 333 334 341 343 348 351 354 356 360 366 379 387 388",
"output": "1"
},
{
"input": "10\n17 239 443 467 661 1069 1823 2333 3767 4201\n20\n51 83 97 457 593 717 997 1329 1401 1459 1471 1983 2371 2539 3207 3251 3329 5469 6637 6999",
"output": "8"
},
{
"input": "20\n179 359 401 467 521 601 919 941 1103 1279 1709 1913 1949 2003 2099 2143 2179 2213 2399 4673\n20\n151 181 191 251 421 967 1109 1181 1249 1447 1471 1553 1619 2327 2551 2791 3049 3727 6071 7813",
"output": "3"
},
{
"input": "20\n79 113 151 709 809 983 1291 1399 1409 1429 2377 2659 2671 2897 3217 3511 3557 3797 3823 4363\n10\n19 101 659 797 1027 1963 2129 2971 3299 9217",
"output": "3"
},
{
"input": "30\n19 47 109 179 307 331 389 401 461 509 547 569 617 853 883 1249 1361 1381 1511 1723 1741 1783 2459 2531 2621 3533 3821 4091 5557 6217\n20\n401 443 563 941 967 997 1535 1567 1655 1747 1787 1945 1999 2251 2305 2543 2735 4415 6245 7555",
"output": "8"
},
{
"input": "30\n3 43 97 179 257 313 353 359 367 389 397 457 547 599 601 647 1013 1021 1063 1433 1481 1531 1669 3181 3373 3559 3769 4157 4549 5197\n50\n13 15 17 19 29 79 113 193 197 199 215 223 271 293 359 485 487 569 601 683 895 919 941 967 1283 1285 1289 1549 1565 1765 1795 1835 1907 1931 1945 1985 1993 2285 2731 2735 2995 3257 4049 4139 5105 5315 7165 7405 7655 8345",
"output": "20"
},
{
"input": "50\n11 17 23 53 59 109 137 149 173 251 353 379 419 421 439 503 593 607 661 773 821 877 941 997 1061 1117 1153 1229 1289 1297 1321 1609 1747 2311 2389 2543 2693 3041 3083 3137 3181 3209 3331 3373 3617 3767 4201 4409 4931 6379\n50\n55 59 67 73 85 89 101 115 211 263 295 353 545 599 607 685 739 745 997 1031 1255 1493 1523 1667 1709 1895 1949 2161 2195 2965 3019 3035 3305 3361 3373 3673 3739 3865 3881 4231 4253 4385 4985 5305 5585 5765 6145 6445 8045 8735",
"output": "23"
},
{
"input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782",
"output": "3"
},
{
"input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428",
"output": "4"
},
{
"input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959",
"output": "5"
},
{
"input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664",
"output": "24"
},
{
"input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782",
"output": "3"
},
{
"input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428",
"output": "4"
},
{
"input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959",
"output": "5"
},
{
"input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664",
"output": "24"
},
{
"input": "47\n66 262 357 457 513 530 538 540 592 691 707 979 1015 1242 1246 1667 1823 1886 1963 2133 2649 2679 2916 2949 3413 3523 3699 3958 4393 4922 5233 5306 5799 6036 6302 6629 7208 7282 7315 7822 7833 7927 8068 8150 8870 8962 9987\n39\n167 199 360 528 1515 1643 1986 1988 2154 2397 2856 3552 3656 3784 3980 4096 4104 4240 4320 4736 4951 5266 5656 5849 5850 6169 6517 6875 7244 7339 7689 7832 8120 8716 9503 9509 9933 9936 9968",
"output": "12"
},
{
"input": "1\n94\n50\n423 446 485 1214 1468 1507 1853 1930 1999 2258 2271 2285 2425 2543 2715 2743 2992 3196 4074 4108 4448 4475 4652 5057 5250 5312 5356 5375 5731 5986 6298 6501 6521 7146 7255 7276 7332 7481 7998 8141 8413 8665 8908 9221 9336 9491 9504 9677 9693 9706",
"output": "1"
},
{
"input": "50\n51 67 75 186 194 355 512 561 720 876 1077 1221 1503 1820 2153 2385 2568 2608 2937 2969 3271 3311 3481 4081 4093 4171 4255 4256 4829 5020 5192 5636 5817 6156 6712 6717 7153 7436 7608 7612 7866 7988 8264 8293 8867 9311 9879 9882 9889 9908\n1\n5394",
"output": "1"
},
{
"input": "50\n26 367 495 585 675 789 855 1185 1312 1606 2037 2241 2587 2612 2628 2807 2873 2924 3774 4067 4376 4668 4902 5001 5082 5100 5104 5209 5345 5515 5661 5777 5902 5907 6155 6323 6675 6791 7503 8159 8207 8254 8740 8848 8855 8933 9069 9164 9171 9586\n5\n1557 6246 7545 8074 8284",
"output": "1"
},
{
"input": "5\n25 58 91 110 2658\n50\n21 372 909 1172 1517 1554 1797 1802 1843 1977 2006 2025 2137 2225 2317 2507 2645 2754 2919 3024 3202 3212 3267 3852 4374 4487 4553 4668 4883 4911 4916 5016 5021 5068 5104 5162 5683 5856 6374 6871 7333 7531 8099 8135 8173 8215 8462 8776 9433 9790",
"output": "4"
},
{
"input": "45\n37 48 56 59 69 70 79 83 85 86 99 114 131 134 135 145 156 250 1739 1947 2116 2315 2449 3104 3666 4008 4406 4723 4829 5345 5836 6262 6296 6870 7065 7110 7130 7510 7595 8092 8442 8574 9032 9091 9355\n50\n343 846 893 1110 1651 1837 2162 2331 2596 3012 3024 3131 3294 3394 3528 3717 3997 4125 4347 4410 4581 4977 5030 5070 5119 5229 5355 5413 5418 5474 5763 5940 6151 6161 6164 6237 6506 6519 6783 7182 7413 7534 8069 8253 8442 8505 9135 9308 9828 9902",
"output": "17"
},
{
"input": "50\n17 20 22 28 36 38 46 47 48 50 52 57 58 62 63 69 70 74 75 78 79 81 82 86 87 90 93 95 103 202 292 442 1756 1769 2208 2311 2799 2957 3483 4280 4324 4932 5109 5204 6225 6354 6561 7136 8754 9670\n40\n68 214 957 1649 1940 2078 2134 2716 3492 3686 4462 4559 4656 4756 4850 5044 5490 5529 5592 5626 6014 6111 6693 6790 7178 7275 7566 7663 7702 7857 7954 8342 8511 8730 8957 9021 9215 9377 9445 9991",
"output": "28"
},
{
"input": "39\n10 13 21 25 36 38 47 48 58 64 68 69 73 79 86 972 2012 2215 2267 2503 3717 3945 4197 4800 5266 6169 6612 6824 7023 7322 7582 7766 8381 8626 8879 9079 9088 9838 9968\n50\n432 877 970 1152 1202 1223 1261 1435 1454 1578 1843 1907 2003 2037 2183 2195 2215 2425 3065 3492 3615 3637 3686 3946 4189 4415 4559 4656 4665 4707 4886 4887 5626 5703 5955 6208 6521 6581 6596 6693 6985 7013 7081 7343 7663 8332 8342 8637 9207 9862",
"output": "15"
},
{
"input": "50\n7 144 269 339 395 505 625 688 709 950 1102 1152 1350 1381 1641 1830 1977 1999 2093 2180 2718 3308 3574 4168 4232 4259 4393 4689 4982 5154 5476 5581 5635 5721 6159 6302 6741 7010 7152 7315 7417 7482 8116 8239 8640 9347 9395 9614 9661 9822\n20\n84 162 292 1728 1866 2088 3228 3470 4068 5318 5470 6060 6380 6929 7500 8256 8399 8467 8508 9691",
"output": "8"
},
{
"input": "50\n159 880 1070 1139 1358 1608 1691 1841 2073 2171 2213 2597 2692 2759 2879 2931 3173 3217 3441 4201 4878 5106 5129 5253 5395 5647 5968 6019 6130 6276 6286 6330 6409 6728 7488 7713 7765 7828 7899 8064 8264 8457 8483 8685 8900 8946 8965 9133 9187 9638\n45\n57 159 1070 1139 1391 1608 1691 1841 2171 2213 2692 2759 2931 3173 3217 3441 4201 4878 5106 5129 5253 5647 5968 6130 6276 6286 6409 7488 7694 7713 7765 7828 7899 8003 8064 8081 8244 8264 8685 8900 8946 8965 9133 9638 9673",
"output": "38"
},
{
"input": "3\n3 4 5\n3\n6 20 25",
"output": "2"
},
{
"input": "4\n2 3 5 8\n4\n2 6 8 10",
"output": "1"
},
{
"input": "4\n3 5 7 11\n4\n3 5 7 22",
"output": "1"
},
{
"input": "2\n2 3\n3\n20 30 50",
"output": "1"
},
{
"input": "3\n1 2 3\n4\n2 4 6 49",
"output": "1"
},
{
"input": "2\n4 5\n3\n12 15 20",
"output": "1"
},
{
"input": "3\n2 5 7\n3\n4 5 7",
"output": "1"
},
{
"input": "3\n3 5 8\n3\n6 8 10",
"output": "2"
},
{
"input": "2\n2 3\n4\n4 6 9 33",
"output": "1"
},
{
"input": "2\n2 3\n4\n4 6 21 40",
"output": "1"
},
{
"input": "3\n4 9 10\n3\n8 9 10",
"output": "1"
},
{
"input": "5\n1 5 6 9 51\n5\n5 12 18 27 10000",
"output": "1"
},
{
"input": "13\n1 2 3 4 5 6 7 8 9 10 11 12 13\n1\n14",
"output": "1"
}
] | 1,590,691,447
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 57
| 280
| 1,331,200
|
#A. Bicycle Chain
n = int(input())
a = list(map(int,input().split()))
m = int(input())
b = list(map(int,input().split()))
t = 0
max_ = 0
for i in a:
for j in b:
if j%i==0:
if j//i > max_:
t = 1
max_ = j//i
elif j//i == max_:
t += 1
print(t)
|
Title: Bicycle Chain
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation.
We know that the *i*-th star on the pedal axle has *a**i* (0<=<<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=<<=*b*1<=<<=*b*2<=<<=...<=<<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value .
Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears.
In the problem, fraction denotes division in real numbers, that is, no rounding is performed.
Input Specification:
The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing.
The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing.
It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces.
Output Specification:
Print the number of "integer" gears with the maximum ratio among all "integer" gears.
Demo Input:
['2\n4 5\n3\n12 13 15\n', '4\n1 2 3 4\n5\n10 11 12 13 14\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15.
|
```python
#A. Bicycle Chain
n = int(input())
a = list(map(int,input().split()))
m = int(input())
b = list(map(int,input().split()))
t = 0
max_ = 0
for i in a:
for j in b:
if j%i==0:
if j//i > max_:
t = 1
max_ = j//i
elif j//i == max_:
t += 1
print(t)
```
| 3
|
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.