contestId
int64
0
1.01k
index
stringclasses
57 values
name
stringlengths
2
58
type
stringclasses
2 values
rating
int64
0
3.5k
tags
listlengths
0
11
title
stringclasses
522 values
time-limit
stringclasses
8 values
memory-limit
stringclasses
8 values
problem-description
stringlengths
0
7.15k
input-specification
stringlengths
0
2.05k
output-specification
stringlengths
0
1.5k
demo-input
listlengths
0
7
demo-output
listlengths
0
7
note
stringlengths
0
5.24k
points
float64
0
425k
test_cases
listlengths
0
402
creationTimeSeconds
int64
1.37B
1.7B
relativeTimeSeconds
int64
8
2.15B
programmingLanguage
stringclasses
3 values
verdict
stringclasses
14 values
testset
stringclasses
12 values
passedTestCount
int64
0
1k
timeConsumedMillis
int64
0
15k
memoryConsumedBytes
int64
0
805M
code
stringlengths
3
65.5k
prompt
stringlengths
262
8.2k
response
stringlengths
17
65.5k
score
float64
-1
3.99
455
A
Boredom
PROGRAMMING
1,500
[ "dp" ]
null
null
Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it. Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player. Alex is a perfectionist, so he decided to get as many points as possible. Help him.
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence. The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105).
Print a single integer — the maximum number of points that Alex can earn.
[ "2\n1 2\n", "3\n1 2 3\n", "9\n1 2 1 3 2 2 2 2 3\n" ]
[ "2\n", "4\n", "10\n" ]
Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points.
500
[ { "input": "2\n1 2", "output": "2" }, { "input": "3\n1 2 3", "output": "4" }, { "input": "9\n1 2 1 3 2 2 2 2 3", "output": "10" }, { "input": "5\n3 3 4 5 4", "output": "11" }, { "input": "5\n5 3 5 3 4", "output": "16" }, { "input": "5\n4 2 3 2 5", "output": "9" }, { "input": "10\n10 5 8 9 5 6 8 7 2 8", "output": "46" }, { "input": "10\n1 1 1 1 1 1 2 3 4 4", "output": "14" }, { "input": "100\n6 6 8 9 7 9 6 9 5 7 7 4 5 3 9 1 10 3 4 5 8 9 6 5 6 4 10 9 1 4 1 7 1 4 9 10 8 2 9 9 10 5 8 9 5 6 8 7 2 8 7 6 2 6 10 8 6 2 5 5 3 2 8 8 5 3 6 2 1 4 7 2 7 3 7 4 10 10 7 5 4 7 5 10 7 1 1 10 7 7 7 2 3 4 2 8 4 7 4 4", "output": "296" }, { "input": "100\n6 1 5 7 10 10 2 7 3 7 2 10 7 6 3 5 5 5 3 7 2 4 2 7 7 4 2 8 2 10 4 7 9 1 1 7 9 7 1 10 10 9 5 6 10 1 7 5 8 1 1 5 3 10 2 4 3 5 2 7 4 9 5 10 1 3 7 6 6 9 3 6 6 10 1 10 6 1 10 3 4 1 7 9 2 7 8 9 3 3 2 4 6 6 1 2 9 4 1 2", "output": "313" }, { "input": "100\n7 6 3 8 8 3 10 5 3 8 6 4 6 9 6 7 3 9 10 7 5 5 9 10 7 2 3 8 9 5 4 7 9 3 6 4 9 10 7 6 8 7 6 6 10 3 7 4 5 7 7 5 1 5 4 8 7 3 3 4 7 8 5 9 2 2 3 1 6 4 6 6 6 1 7 10 7 4 5 3 9 2 4 1 5 10 9 3 9 6 8 5 2 1 10 4 8 5 10 9", "output": "298" }, { "input": "100\n2 10 9 1 2 6 7 2 2 8 9 9 9 5 6 2 5 1 1 10 7 4 5 5 8 1 9 4 10 1 9 3 1 8 4 10 8 8 2 4 6 5 1 4 2 2 1 2 8 5 3 9 4 10 10 7 8 6 1 8 2 6 7 1 6 7 3 10 10 3 7 7 6 9 6 8 8 10 4 6 4 3 3 3 2 3 10 6 8 5 5 10 3 7 3 1 1 1 5 5", "output": "312" }, { "input": "100\n4 9 7 10 4 7 2 6 1 9 1 8 7 5 5 7 6 7 9 8 10 5 3 5 7 10 3 2 1 3 8 9 4 10 4 7 6 4 9 6 7 1 9 4 3 5 8 9 2 7 10 5 7 5 3 8 10 3 8 9 3 4 3 10 6 5 1 8 3 2 5 8 4 7 5 3 3 2 6 9 9 8 2 7 6 3 2 2 8 8 4 5 6 9 2 3 2 2 5 2", "output": "287" }, { "input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8", "output": "380" }, { "input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8", "output": "380" }, { "input": "100\n10 5 8 4 4 4 1 4 5 8 3 10 2 4 1 10 8 1 1 6 8 4 2 9 1 3 1 7 7 9 3 5 5 8 6 9 9 4 8 1 3 3 2 6 1 5 4 5 3 5 5 6 7 5 7 9 3 5 4 9 2 6 8 1 1 7 7 3 8 9 8 7 3 2 4 1 6 1 3 9 4 2 2 8 5 10 1 8 8 5 1 5 6 9 4 5 6 5 10 2", "output": "265" }, { "input": "100\n7 5 1 8 5 6 6 2 6 2 7 7 3 6 2 4 4 2 10 2 2 2 10 6 6 1 5 10 9 1 5 9 8 9 4 1 10 5 7 5 7 6 4 8 8 1 7 8 3 8 2 1 8 4 10 3 5 6 6 10 9 6 5 1 10 7 6 9 9 2 10 10 9 1 2 1 7 7 4 10 1 10 5 5 3 8 9 8 1 4 10 2 4 5 4 4 1 6 2 9", "output": "328" }, { "input": "100\n5 6 10 7 1 7 10 1 9 1 5 1 4 1 3 3 7 9 1 6 1 6 5 7 1 6 3 1 3 6 3 8 2 4 1 5 2 10 7 3 10 4 10 1 5 4 2 9 7 9 5 7 10 4 1 4 8 9 3 1 3 7 7 4 3 7 7 10 6 9 5 5 6 5 3 9 8 8 5 5 4 10 9 4 10 4 1 8 3 5 4 10 9 3 10 4 10 7 10 9", "output": "324" }, { "input": "10\n7 4 5 3 9 1 10 3 4 5", "output": "34" }, { "input": "10\n8 9 6 5 6 4 10 9 1 4", "output": "39" }, { "input": "10\n1 7 1 4 9 10 8 2 9 9", "output": "40" }, { "input": "1\n100000", "output": "100000" } ]
1,669,128,693
2,147,483,647
Python 3
OK
TESTS
47
171
7,270,400
n=int(input()) l=[0]*100005 for i in [int(j) for j in input().split()]: l[i]+=1 dp=[0]*100005 for i in range(1,100001): dp[i]=max( dp[i-1], dp[i-2] + i*l[i] ) print(max(dp))
Title: Boredom Time Limit: None seconds Memory Limit: None megabytes Problem Description: Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it. Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player. Alex is a perfectionist, so he decided to get as many points as possible. Help him. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence. The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105). Output Specification: Print a single integer — the maximum number of points that Alex can earn. Demo Input: ['2\n1 2\n', '3\n1 2 3\n', '9\n1 2 1 3 2 2 2 2 3\n'] Demo Output: ['2\n', '4\n', '10\n'] Note: Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points.
```python n=int(input()) l=[0]*100005 for i in [int(j) for j in input().split()]: l[i]+=1 dp=[0]*100005 for i in range(1,100001): dp[i]=max( dp[i-1], dp[i-2] + i*l[i] ) print(max(dp)) ```
3
627
B
Factory Repairs
PROGRAMMING
1,700
[ "data structures" ]
null
null
A factory produces thimbles in bulk. Typically, it can produce up to *a* thimbles a day. However, some of the machinery is defective, so it can currently only produce *b* thimbles each day. The factory intends to choose a *k*-day period to do maintenance and construction; it cannot produce any thimbles during this time, but will be restored to its full production of *a* thimbles per day after the *k* days are complete. Initially, no orders are pending. The factory receives updates of the form *d**i*, *a**i*, indicating that *a**i* new orders have been placed for the *d**i*-th day. Each order requires a single thimble to be produced on precisely the specified day. The factory may opt to fill as many or as few of the orders in a single batch as it likes. As orders come in, the factory owner would like to know the maximum number of orders he will be able to fill if he starts repairs on a given day *p**i*. Help the owner answer his questions.
The first line contains five integers *n*, *k*, *a*, *b*, and *q* (1<=≤<=*k*<=≤<=*n*<=≤<=200<=000, 1<=≤<=*b*<=&lt;<=*a*<=≤<=10 000, 1<=≤<=*q*<=≤<=200<=000) — the number of days, the length of the repair time, the production rates of the factory, and the number of updates, respectively. The next *q* lines contain the descriptions of the queries. Each query is of one of the following two forms: - 1 *d**i* *a**i* (1<=≤<=*d**i*<=≤<=*n*, 1<=≤<=*a**i*<=≤<=10 000), representing an update of *a**i* orders on day *d**i*, or - 2 *p**i* (1<=≤<=*p**i*<=≤<=*n*<=-<=*k*<=+<=1), representing a question: at the moment, how many orders could be filled if the factory decided to commence repairs on day *p**i*? It's guaranteed that the input will contain at least one query of the second type.
For each query of the second type, print a line containing a single integer — the maximum number of orders that the factory can fill over all *n* days.
[ "5 2 2 1 8\n1 1 2\n1 5 3\n1 2 1\n2 2\n1 4 2\n1 3 2\n2 1\n2 3\n", "5 4 10 1 6\n1 1 5\n1 5 5\n1 3 2\n1 5 2\n2 1\n2 2\n" ]
[ "3\n6\n4\n", "7\n1\n" ]
Consider the first sample. We produce up to 1 thimble a day currently and will produce up to 2 thimbles a day after repairs. Repairs take 2 days. For the first question, we are able to fill 1 order on day 1, no orders on days 2 and 3 since we are repairing, no orders on day 4 since no thimbles have been ordered for that day, and 2 orders for day 5 since we are limited to our production capacity, for a total of 3 orders filled. For the third question, we are able to fill 1 order on day 1, 1 order on day 2, and 2 orders on day 5, for a total of 4 orders.
1,000
[ { "input": "5 2 2 1 8\n1 1 2\n1 5 3\n1 2 1\n2 2\n1 4 2\n1 3 2\n2 1\n2 3", "output": "3\n6\n4" }, { "input": "5 4 10 1 6\n1 1 5\n1 5 5\n1 3 2\n1 5 2\n2 1\n2 2", "output": "7\n1" }, { "input": "1 1 2 1 1\n2 1", "output": "0" } ]
1,584,038,294
2,147,483,647
Python 3
COMPILATION_ERROR
TESTS
0
0
0
//B - Factory Repairs: //Assunto: #include<bits/stdc++.h> #define fi first #define se second #define pb push_back #define all(x) x.begin(), x.end() #define rall(x) x.rbegin(), x.rend() #define loop(i, a, b) for(int i = a; i < b; i++) #define loopBack(i, a, b) for(int i = a; i >= b; i--) #define INF INT_MAX #define LINF LLONG_MAX #define DINF DBL_MAX #define MAX 10050 #define MOD 1000000007 using namespace std; typedef long long int ll; typedef pair<int, int> ii; ll n, k, a, b, q, type, x, y, ans; ll sum(ll k, vector<ll> &bit) { int s = 0; while(k > 0) { s += bit[k]; k -= k & -k; } return s; } void add(ll val, ll k, vector<ll> &bit, ll aux) { while(k <= n) { bit[k] += min(aux, val); k += k & -k; } } int main() { ios::sync_with_stdio(0); cin.tie(0); cout.tie(0); //freopen("in.txt", "r", stdin); cin >> n >> k >> a >> b >> q; vector<ll> bit1(n+1, 0), bit2(n+1, 0); while(q--) { cin >> type; if(type == 1) { cin >> x >> y; add(y, x, bit1, b); add(y, x, bit2, a); } else { cin >> x; ans = sum(x-1, bit1); ans += sum(n, bit2) - sum((x + k) - 1, bit2); cout << ans << "\n"; } } }
Title: Factory Repairs Time Limit: None seconds Memory Limit: None megabytes Problem Description: A factory produces thimbles in bulk. Typically, it can produce up to *a* thimbles a day. However, some of the machinery is defective, so it can currently only produce *b* thimbles each day. The factory intends to choose a *k*-day period to do maintenance and construction; it cannot produce any thimbles during this time, but will be restored to its full production of *a* thimbles per day after the *k* days are complete. Initially, no orders are pending. The factory receives updates of the form *d**i*, *a**i*, indicating that *a**i* new orders have been placed for the *d**i*-th day. Each order requires a single thimble to be produced on precisely the specified day. The factory may opt to fill as many or as few of the orders in a single batch as it likes. As orders come in, the factory owner would like to know the maximum number of orders he will be able to fill if he starts repairs on a given day *p**i*. Help the owner answer his questions. Input Specification: The first line contains five integers *n*, *k*, *a*, *b*, and *q* (1<=≤<=*k*<=≤<=*n*<=≤<=200<=000, 1<=≤<=*b*<=&lt;<=*a*<=≤<=10 000, 1<=≤<=*q*<=≤<=200<=000) — the number of days, the length of the repair time, the production rates of the factory, and the number of updates, respectively. The next *q* lines contain the descriptions of the queries. Each query is of one of the following two forms: - 1 *d**i* *a**i* (1<=≤<=*d**i*<=≤<=*n*, 1<=≤<=*a**i*<=≤<=10 000), representing an update of *a**i* orders on day *d**i*, or - 2 *p**i* (1<=≤<=*p**i*<=≤<=*n*<=-<=*k*<=+<=1), representing a question: at the moment, how many orders could be filled if the factory decided to commence repairs on day *p**i*? It's guaranteed that the input will contain at least one query of the second type. Output Specification: For each query of the second type, print a line containing a single integer — the maximum number of orders that the factory can fill over all *n* days. Demo Input: ['5 2 2 1 8\n1 1 2\n1 5 3\n1 2 1\n2 2\n1 4 2\n1 3 2\n2 1\n2 3\n', '5 4 10 1 6\n1 1 5\n1 5 5\n1 3 2\n1 5 2\n2 1\n2 2\n'] Demo Output: ['3\n6\n4\n', '7\n1\n'] Note: Consider the first sample. We produce up to 1 thimble a day currently and will produce up to 2 thimbles a day after repairs. Repairs take 2 days. For the first question, we are able to fill 1 order on day 1, no orders on days 2 and 3 since we are repairing, no orders on day 4 since no thimbles have been ordered for that day, and 2 orders for day 5 since we are limited to our production capacity, for a total of 3 orders filled. For the third question, we are able to fill 1 order on day 1, 1 order on day 2, and 2 orders on day 5, for a total of 4 orders.
```python //B - Factory Repairs: //Assunto: #include<bits/stdc++.h> #define fi first #define se second #define pb push_back #define all(x) x.begin(), x.end() #define rall(x) x.rbegin(), x.rend() #define loop(i, a, b) for(int i = a; i < b; i++) #define loopBack(i, a, b) for(int i = a; i >= b; i--) #define INF INT_MAX #define LINF LLONG_MAX #define DINF DBL_MAX #define MAX 10050 #define MOD 1000000007 using namespace std; typedef long long int ll; typedef pair<int, int> ii; ll n, k, a, b, q, type, x, y, ans; ll sum(ll k, vector<ll> &bit) { int s = 0; while(k > 0) { s += bit[k]; k -= k & -k; } return s; } void add(ll val, ll k, vector<ll> &bit, ll aux) { while(k <= n) { bit[k] += min(aux, val); k += k & -k; } } int main() { ios::sync_with_stdio(0); cin.tie(0); cout.tie(0); //freopen("in.txt", "r", stdin); cin >> n >> k >> a >> b >> q; vector<ll> bit1(n+1, 0), bit2(n+1, 0); while(q--) { cin >> type; if(type == 1) { cin >> x >> y; add(y, x, bit1, b); add(y, x, bit2, a); } else { cin >> x; ans = sum(x-1, bit1); ans += sum(n, bit2) - sum((x + k) - 1, bit2); cout << ans << "\n"; } } } ```
-1
721
A
One-dimensional Japanese Crossword
PROGRAMMING
800
[ "implementation" ]
null
null
Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)). Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword. Help Adaltik find the numbers encrypting the row he drew.
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew).
The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row. The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right.
[ "3\nBBW\n", "5\nBWBWB\n", "4\nWWWW\n", "4\nBBBB\n", "13\nWBBBBWWBWBBBW\n" ]
[ "1\n2 ", "3\n1 1 1 ", "0\n", "1\n4 ", "3\n4 1 3 " ]
The last sample case correspond to the picture in the statement.
500
[ { "input": "3\nBBW", "output": "1\n2 " }, { "input": "5\nBWBWB", "output": "3\n1 1 1 " }, { "input": "4\nWWWW", "output": "0" }, { "input": "4\nBBBB", "output": "1\n4 " }, { "input": "13\nWBBBBWWBWBBBW", "output": "3\n4 1 3 " }, { "input": "1\nB", "output": "1\n1 " }, { "input": "2\nBB", "output": "1\n2 " }, { "input": "100\nWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWB", "output": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "1\nW", "output": "0" }, { "input": "2\nWW", "output": "0" }, { "input": "2\nWB", "output": "1\n1 " }, { "input": "2\nBW", "output": "1\n1 " }, { "input": "3\nBBB", "output": "1\n3 " }, { "input": "3\nBWB", "output": "2\n1 1 " }, { "input": "3\nWBB", "output": "1\n2 " }, { "input": "3\nWWB", "output": "1\n1 " }, { "input": "3\nWBW", "output": "1\n1 " }, { "input": "3\nBWW", "output": "1\n1 " }, { "input": "3\nWWW", "output": "0" }, { "input": "100\nBBBWWWWWWBBWWBBWWWBBWBBBBBBBBBBBWBBBWBBWWWBBWWBBBWBWWBBBWWBBBWBBBBBWWWBWWBBWWWWWWBWBBWWBWWWBWBWWWWWB", "output": "21\n3 2 2 2 11 3 2 2 3 1 3 3 5 1 2 1 2 1 1 1 1 " }, { "input": "5\nBBBWB", "output": "2\n3 1 " }, { "input": "5\nBWWWB", "output": "2\n1 1 " }, { "input": "5\nWWWWB", "output": "1\n1 " }, { "input": "5\nBWWWW", "output": "1\n1 " }, { "input": "5\nBBBWW", "output": "1\n3 " }, { "input": "5\nWWBBB", "output": "1\n3 " }, { "input": "10\nBBBBBWWBBB", "output": "2\n5 3 " }, { "input": "10\nBBBBWBBWBB", "output": "3\n4 2 2 " }, { "input": "20\nBBBBBWWBWBBWBWWBWBBB", "output": "6\n5 1 2 1 1 3 " }, { "input": "20\nBBBWWWWBBWWWBWBWWBBB", "output": "5\n3 2 1 1 3 " }, { "input": "20\nBBBBBBBBWBBBWBWBWBBB", "output": "5\n8 3 1 1 3 " }, { "input": "20\nBBBWBWBWWWBBWWWWBWBB", "output": "6\n3 1 1 2 1 2 " }, { "input": "40\nBBBBBBWWWWBWBWWWBWWWWWWWWWWWBBBBBBBBBBBB", "output": "5\n6 1 1 1 12 " }, { "input": "40\nBBBBBWBWWWBBWWWBWBWWBBBBWWWWBWBWBBBBBBBB", "output": "9\n5 1 2 1 1 4 1 1 8 " }, { "input": "50\nBBBBBBBBBBBWWWWBWBWWWWBBBBBBBBWWWWWWWBWWWWBWBBBBBB", "output": "7\n11 1 1 8 1 1 6 " }, { "input": "50\nWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW", "output": "0" }, { "input": "50\nBBBBBWWWWWBWWWBWWWWWBWWWBWWWWWWBBWBBWWWWBWWWWWWWBW", "output": "9\n5 1 1 1 1 2 2 1 1 " }, { "input": "50\nWWWWBWWBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWBWWWWWWWBBBBB", "output": "6\n1 1 1 1 1 5 " }, { "input": "50\nBBBBBWBWBWWBWBWWWWWWBWBWBWWWWWWWWWWWWWBWBWWWWBWWWB", "output": "12\n5 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "1\n50 " }, { "input": "100\nBBBBBBBBBBBWBWWWWBWWBBWBBWWWWWWWWWWBWBWWBWWWWWWWWWWWBBBWWBBWWWWWBWBWWWWBWWWWWWWWWWWBWWWWWBBBBBBBBBBB", "output": "15\n11 1 1 2 2 1 1 1 3 2 1 1 1 1 11 " }, { "input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "1\n100 " }, { "input": "100\nBBBBBBBBBBBBBBBBBBBBWBWBWWWWWBWWWWWWWWWWWWWWBBWWWBWWWWBWWBWWWWWWBWWWWWWWWWWWWWBWBBBBBBBBBBBBBBBBBBBB", "output": "11\n20 1 1 1 2 1 1 1 1 1 20 " }, { "input": "100\nBBBBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWWWWWBWBWWWWWWBBWWWWWWWWWWWWBWWWWBWWWWWWWWWWWWBWWWWWWWBWWWWWWWBBBBBB", "output": "11\n4 1 1 1 1 2 1 1 1 1 6 " }, { "input": "5\nBWBWB", "output": "3\n1 1 1 " }, { "input": "10\nWWBWWWBWBB", "output": "3\n1 1 2 " }, { "input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "1\n50 " }, { "input": "50\nBBBBBBBBBBBBBBBBBWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "2\n17 31 " }, { "input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "2\n24 42 " }, { "input": "90\nWWBWWBWBBWBBWWBWBWBBBWBWBBBWBWBWBWBWBWBWBWBBBBBWBBWWWWBWBBWBWWBBBWBWBWWBWBWBWBWWWWWWBWBBBB", "output": "30\n1 1 2 2 1 1 3 1 3 1 1 1 1 1 1 1 5 2 1 2 1 3 1 1 1 1 1 1 1 4 " }, { "input": "100\nBWWWBWBWBBBBBWBWWBWBWWWBWBWBWWBBWWBBBWBBBWWBWBWWBBBBWBWBBBWBWBBWWWWWWBWWBBBBWBWBWWBWBWWWBWBWWBWBWWWB", "output": "31\n1 1 1 5 1 1 1 1 1 1 2 3 3 1 1 4 1 3 1 2 1 4 1 1 1 1 1 1 1 1 1 " }, { "input": "90\nWBWBBBBBBWWWBBWWBWWWBBWWBWWWBWBBWBWBBWWWWBWBWBBWBBWBWWWBBWBBWWWWBWBBWWWBBBWBBWBWBBBBWWBWWB", "output": "25\n1 6 2 1 2 1 1 2 1 2 1 1 2 2 1 2 2 1 2 3 2 1 4 1 1 " }, { "input": "80\nBBWWBBBWBBWWWWBBWBWBBWWWWWBWBBWWBWBWBWBWBWWBWWBWWWBWBBWBBWBBWBBBWWBBBBBBBWBBBWBB", "output": "23\n2 3 2 2 1 2 1 2 1 1 1 1 1 1 1 1 2 2 2 3 7 3 2 " }, { "input": "65\nWWWWBWWWBBBBBWWWWWWBBBWWBBBBWWWWWWWWBBBWWWWBWBWWBBWWWWBWWWBBWBBBB", "output": "11\n1 5 3 4 3 1 1 2 1 2 4 " } ]
1,664,794,493
2,147,483,647
Python 3
OK
TESTS
54
46
0
n = int(input()) s = input() count = 0 k = 0 ans = [] for i in s: if i=="B": count+=1 else: if count!=0: k+=1 ans.append(count) count=0 if count!=0: ans.append(count) k+=1 print(k) print(*ans)
Title: One-dimensional Japanese Crossword Time Limit: None seconds Memory Limit: None megabytes Problem Description: Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)). Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword. Help Adaltik find the numbers encrypting the row he drew. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew). Output Specification: The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row. The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right. Demo Input: ['3\nBBW\n', '5\nBWBWB\n', '4\nWWWW\n', '4\nBBBB\n', '13\nWBBBBWWBWBBBW\n'] Demo Output: ['1\n2 ', '3\n1 1 1 ', '0\n', '1\n4 ', '3\n4 1 3 '] Note: The last sample case correspond to the picture in the statement.
```python n = int(input()) s = input() count = 0 k = 0 ans = [] for i in s: if i=="B": count+=1 else: if count!=0: k+=1 ans.append(count) count=0 if count!=0: ans.append(count) k+=1 print(k) print(*ans) ```
3
219
A
k-String
PROGRAMMING
1,000
[ "implementation", "strings" ]
null
null
A string is called a *k*-string if it can be represented as *k* concatenated copies of some string. For example, the string "aabaabaabaab" is at the same time a 1-string, a 2-string and a 4-string, but it is not a 3-string, a 5-string, or a 6-string and so on. Obviously any string is a 1-string. You are given a string *s*, consisting of lowercase English letters and a positive integer *k*. Your task is to reorder the letters in the string *s* in such a way that the resulting string is a *k*-string.
The first input line contains integer *k* (1<=≤<=*k*<=≤<=1000). The second line contains *s*, all characters in *s* are lowercase English letters. The string length *s* satisfies the inequality 1<=≤<=|*s*|<=≤<=1000, where |*s*| is the length of string *s*.
Rearrange the letters in string *s* in such a way that the result is a *k*-string. Print the result on a single output line. If there are multiple solutions, print any of them. If the solution doesn't exist, print "-1" (without quotes).
[ "2\naazz\n", "3\nabcabcabz\n" ]
[ "azaz\n", "-1\n" ]
none
500
[ { "input": "2\naazz", "output": "azaz" }, { "input": "3\nabcabcabz", "output": "-1" }, { "input": "1\na", "output": "a" }, { "input": "2\nabba", "output": "abab" }, { "input": "2\naaab", "output": "-1" }, { "input": "7\nabacaba", "output": "-1" }, { "input": "5\naaaaa", "output": "aaaaa" }, { "input": "3\naabaaaaabb", "output": "-1" }, { "input": "2\naaab", "output": "-1" }, { "input": "2\nbabac", "output": "-1" }, { "input": "3\nbbbccc", "output": "bcbcbc" }, { "input": "2\naa", "output": "aa" }, { "input": "250\ncececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececece", "output": "cececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececece" }, { "input": "15\nabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaa", "output": "aaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbc" }, { "input": "1\naaa", "output": "aaa" }, { "input": "1\naabaab", "output": "aaaabb" }, { "input": "2\naabbbbccccccdddddddd", "output": "abbcccddddabbcccdddd" }, { "input": "3\naaaaaaaaacccdddddd", "output": "aaacddaaacddaaacdd" }, { "input": "3\naaaaaaaaacccbbbbbb", "output": "aaabbcaaabbcaaabbc" }, { "input": "2\naazzzz", "output": "azzazz" }, { "input": "2\naaaa", "output": "aaaa" }, { "input": "2\naaaazz", "output": "aazaaz" }, { "input": "2\naaaabb", "output": "aabaab" }, { "input": "2\naabbbb", "output": "abbabb" }, { "input": "2\naaaazzzz", "output": "aazzaazz" }, { "input": "2\naaazz", "output": "-1" }, { "input": "2\nbbbbaa", "output": "abbabb" }, { "input": "2\naaaaaabbbb", "output": "aaabbaaabb" }, { "input": "2\naaaaaazz", "output": "aaazaaaz" }, { "input": "2\naaaabbbb", "output": "aabbaabb" }, { "input": "2\naabaab", "output": "aabaab" }, { "input": "1\naaaaa", "output": "aaaaa" }, { "input": "2\nbbaaaa", "output": "aabaab" }, { "input": "2\nacaccc", "output": "accacc" } ]
1,679,653,685
2,147,483,647
Python 3
OK
TESTS
42
92
0
k = int(input()) st = input() dic = {} for i in st: if(i in dic): dic[i] = dic[i] +1 else : dic[i] = 1 # print(dic) e= 0 for i in dic: if dic[i]%k !=0: e=e+1 if e: print(-1) else : ans = '' for i in dic: ans = ans+ i*(dic[i]//k) temp = ans for i in range(k-1): ans = ans + temp print(ans)
Title: k-String Time Limit: None seconds Memory Limit: None megabytes Problem Description: A string is called a *k*-string if it can be represented as *k* concatenated copies of some string. For example, the string "aabaabaabaab" is at the same time a 1-string, a 2-string and a 4-string, but it is not a 3-string, a 5-string, or a 6-string and so on. Obviously any string is a 1-string. You are given a string *s*, consisting of lowercase English letters and a positive integer *k*. Your task is to reorder the letters in the string *s* in such a way that the resulting string is a *k*-string. Input Specification: The first input line contains integer *k* (1<=≤<=*k*<=≤<=1000). The second line contains *s*, all characters in *s* are lowercase English letters. The string length *s* satisfies the inequality 1<=≤<=|*s*|<=≤<=1000, where |*s*| is the length of string *s*. Output Specification: Rearrange the letters in string *s* in such a way that the result is a *k*-string. Print the result on a single output line. If there are multiple solutions, print any of them. If the solution doesn't exist, print "-1" (without quotes). Demo Input: ['2\naazz\n', '3\nabcabcabz\n'] Demo Output: ['azaz\n', '-1\n'] Note: none
```python k = int(input()) st = input() dic = {} for i in st: if(i in dic): dic[i] = dic[i] +1 else : dic[i] = 1 # print(dic) e= 0 for i in dic: if dic[i]%k !=0: e=e+1 if e: print(-1) else : ans = '' for i in dic: ans = ans+ i*(dic[i]//k) temp = ans for i in range(k-1): ans = ans + temp print(ans) ```
3
450
A
Jzzhu and Children
PROGRAMMING
1,000
[ "implementation" ]
null
null
There are *n* children in Jzzhu's school. Jzzhu is going to give some candies to them. Let's number all the children from 1 to *n*. The *i*-th child wants to get at least *a**i* candies. Jzzhu asks children to line up. Initially, the *i*-th child stands at the *i*-th place of the line. Then Jzzhu start distribution of the candies. He follows the algorithm: 1. Give *m* candies to the first child of the line. 1. If this child still haven't got enough candies, then the child goes to the end of the line, else the child go home. 1. Repeat the first two steps while the line is not empty. Consider all the children in the order they go home. Jzzhu wants to know, which child will be the last in this order?
The first line contains two integers *n*,<=*m* (1<=≤<=*n*<=≤<=100; 1<=≤<=*m*<=≤<=100). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100).
Output a single integer, representing the number of the last child.
[ "5 2\n1 3 1 4 2\n", "6 4\n1 1 2 2 3 3\n" ]
[ "4\n", "6\n" ]
Let's consider the first sample. Firstly child 1 gets 2 candies and go home. Then child 2 gets 2 candies and go to the end of the line. Currently the line looks like [3, 4, 5, 2] (indices of the children in order of the line). Then child 3 gets 2 candies and go home, and then child 4 gets 2 candies and goes to the end of the line. Currently the line looks like [5, 2, 4]. Then child 5 gets 2 candies and goes home. Then child 2 gets two candies and goes home, and finally child 4 gets 2 candies and goes home. Child 4 is the last one who goes home.
500
[ { "input": "5 2\n1 3 1 4 2", "output": "4" }, { "input": "6 4\n1 1 2 2 3 3", "output": "6" }, { "input": "7 3\n6 1 5 4 2 3 1", "output": "4" }, { "input": "10 5\n2 7 3 6 2 5 1 3 4 5", "output": "4" }, { "input": "100 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "100" }, { "input": "9 3\n9 5 2 3 7 1 8 4 6", "output": "7" }, { "input": "20 10\n58 4 32 10 73 7 30 39 47 6 59 21 24 66 79 79 46 13 29 58", "output": "16" }, { "input": "50 5\n89 56 3 2 40 37 56 52 83 59 43 83 43 59 29 74 22 58 53 41 53 67 78 30 57 32 58 29 95 46 45 85 60 49 41 82 8 71 52 40 45 26 6 71 84 91 4 93 40 54", "output": "48" }, { "input": "50 1\n4 3 9 7 6 8 3 7 10 9 8 8 10 2 9 3 2 4 4 10 4 6 8 10 9 9 4 2 8 9 4 4 9 5 1 5 2 4 4 9 10 2 5 10 7 2 8 6 8 1", "output": "44" }, { "input": "50 5\n3 9 10 8 3 3 4 6 8 2 9 9 3 1 2 10 6 8 7 2 7 4 2 7 5 10 2 2 2 5 10 5 6 6 8 7 10 4 3 2 10 8 6 6 8 6 4 4 1 3", "output": "46" }, { "input": "50 2\n56 69 72 15 95 92 51 1 74 87 100 29 46 54 18 81 84 72 84 83 20 63 71 27 45 74 50 89 48 8 21 15 47 3 39 73 80 84 6 99 17 25 56 3 74 64 71 39 89 78", "output": "40" }, { "input": "50 3\n31 39 64 16 86 3 1 9 25 54 98 42 20 3 49 41 73 37 55 62 33 77 64 22 33 82 26 13 10 13 7 40 48 18 46 79 94 72 19 12 11 61 16 37 10 49 14 94 48 69", "output": "11" }, { "input": "50 100\n67 67 61 68 42 29 70 77 12 61 71 27 4 73 87 52 59 38 93 90 31 27 87 47 26 57 76 6 28 72 81 68 50 84 69 79 39 93 52 6 88 12 46 13 90 68 71 38 90 95", "output": "50" }, { "input": "100 3\n4 14 20 11 19 11 14 20 5 7 6 12 11 17 5 11 7 6 2 10 13 5 12 8 5 17 20 18 7 19 11 7 7 20 20 8 10 17 17 19 20 5 15 16 19 7 11 16 4 17 2 10 1 20 20 16 19 9 9 11 5 7 12 9 9 6 20 18 13 19 8 4 8 1 2 4 10 11 15 14 1 7 17 12 13 19 12 2 3 14 15 15 5 17 14 12 17 14 16 9", "output": "86" }, { "input": "100 5\n16 8 14 16 12 11 17 19 19 2 8 9 5 6 19 9 11 18 6 9 14 16 14 18 17 17 17 5 15 20 19 7 7 10 10 5 14 20 5 19 11 16 16 19 17 9 7 12 14 10 2 11 14 5 20 8 10 11 19 2 14 14 19 17 5 10 8 8 4 2 1 10 20 12 14 11 7 6 6 15 1 5 9 15 3 17 16 17 5 14 11 9 16 15 1 11 10 6 15 7", "output": "93" }, { "input": "100 1\n58 94 18 50 17 14 96 62 83 80 75 5 9 22 25 41 3 96 74 45 66 37 2 37 13 85 68 54 77 11 85 19 25 21 52 59 90 61 72 89 82 22 10 16 3 68 61 29 55 76 28 85 65 76 27 3 14 10 56 37 86 18 35 38 56 68 23 88 33 38 52 87 55 83 94 34 100 41 83 56 91 77 32 74 97 13 67 31 57 81 53 39 5 88 46 1 79 4 49 42", "output": "77" }, { "input": "100 2\n1 51 76 62 34 93 90 43 57 59 52 78 3 48 11 60 57 48 5 54 28 81 87 23 44 77 67 61 14 73 29 53 21 89 67 41 47 9 63 37 1 71 40 85 4 14 77 40 78 75 89 74 4 70 32 65 81 95 49 90 72 41 76 55 69 83 73 84 85 93 46 6 74 90 62 37 97 7 7 37 83 30 37 88 34 16 11 59 85 19 57 63 85 20 63 97 97 65 61 48", "output": "97" }, { "input": "100 3\n30 83 14 55 61 66 34 98 90 62 89 74 45 93 33 31 75 35 82 100 63 69 48 18 99 2 36 71 14 30 70 76 96 85 97 90 49 36 6 76 37 94 70 3 63 73 75 48 39 29 13 2 46 26 9 56 1 18 54 53 85 34 2 12 1 93 75 67 77 77 14 26 33 25 55 9 57 70 75 6 87 66 18 3 41 69 73 24 49 2 20 72 39 58 91 54 74 56 66 78", "output": "20" }, { "input": "100 4\n69 92 76 3 32 50 15 38 21 22 14 3 67 41 95 12 10 62 83 52 78 1 18 58 94 35 62 71 58 75 13 73 60 34 50 97 50 70 19 96 53 10 100 26 20 39 62 59 88 26 24 83 70 68 66 8 6 38 16 93 2 91 81 89 78 74 21 8 31 56 28 53 77 5 81 5 94 42 77 75 92 15 59 36 61 18 55 45 69 68 81 51 12 42 85 74 98 31 17 41", "output": "97" }, { "input": "100 5\n2 72 10 60 6 50 72 34 97 77 35 43 80 64 40 53 46 6 90 22 29 70 26 68 52 19 72 88 83 18 55 32 99 81 11 21 39 42 41 63 60 97 30 23 55 78 89 35 24 50 99 52 27 76 24 8 20 27 51 37 17 82 69 18 46 19 26 77 52 83 76 65 43 66 84 84 13 30 66 88 84 23 37 1 17 26 11 50 73 56 54 37 40 29 35 8 1 39 50 82", "output": "51" }, { "input": "100 7\n6 73 7 54 92 33 66 65 80 47 2 53 28 59 61 16 54 89 37 48 77 40 49 59 27 52 17 22 78 80 81 80 8 93 50 7 87 57 29 16 89 55 20 7 51 54 30 98 44 96 27 70 1 1 32 61 22 92 84 98 31 89 91 90 28 56 49 25 86 49 55 16 19 1 18 8 88 47 16 18 73 86 2 96 16 91 74 49 38 98 94 25 34 85 29 27 99 31 31 58", "output": "97" }, { "input": "100 9\n36 4 45 16 19 6 10 87 44 82 71 49 70 35 83 19 40 76 45 94 44 96 10 54 82 77 86 63 11 37 21 3 15 89 80 88 89 16 72 23 25 9 51 25 10 45 96 5 6 18 51 31 42 57 41 51 42 15 89 61 45 82 16 48 61 67 19 40 9 33 90 36 78 36 79 79 16 10 83 87 9 22 84 12 23 76 36 14 2 81 56 33 56 23 57 84 76 55 35 88", "output": "47" }, { "input": "100 10\n75 81 39 64 90 58 92 28 75 9 96 78 92 83 77 68 76 71 14 46 58 60 80 25 78 11 13 63 22 82 65 68 47 6 33 63 90 50 85 43 73 94 80 48 67 11 83 17 22 15 94 80 66 99 66 4 46 35 52 1 62 39 96 57 37 47 97 49 64 12 36 63 90 16 4 75 85 82 85 56 13 4 92 45 44 93 17 35 22 46 18 44 29 7 52 4 100 98 87 51", "output": "98" }, { "input": "100 20\n21 19 61 70 54 97 98 14 61 72 25 94 24 56 55 25 12 80 76 11 35 17 80 26 11 94 52 47 84 61 10 2 74 25 10 21 2 79 55 50 30 75 10 64 44 5 60 96 52 16 74 41 20 77 20 44 8 86 74 36 49 61 99 13 54 64 19 99 50 43 12 73 48 48 83 55 72 73 63 81 30 27 95 9 97 82 24 3 89 90 33 14 47 88 22 78 12 75 58 67", "output": "94" }, { "input": "100 30\n56 79 59 23 11 23 67 82 81 80 99 79 8 58 93 36 98 81 46 39 34 67 3 50 4 68 70 71 2 21 52 30 75 23 33 21 16 100 56 43 8 27 40 8 56 24 17 40 94 10 67 49 61 36 95 87 17 41 7 94 33 19 17 50 26 11 94 54 38 46 77 9 53 35 98 42 50 20 43 6 78 6 38 24 100 45 43 16 1 50 16 46 14 91 95 88 10 1 50 19", "output": "95" }, { "input": "100 40\n86 11 97 17 38 95 11 5 13 83 67 75 50 2 46 39 84 68 22 85 70 23 64 46 59 93 39 80 35 78 93 21 83 19 64 1 49 59 99 83 44 81 70 58 15 82 83 47 55 65 91 10 2 92 4 77 37 32 12 57 78 11 42 8 59 21 96 69 61 30 44 29 12 70 91 14 10 83 11 75 14 10 19 39 8 98 5 81 66 66 79 55 36 29 22 45 19 24 55 49", "output": "88" }, { "input": "100 50\n22 39 95 69 94 53 80 73 33 90 40 60 2 4 84 50 70 38 92 12 36 74 87 70 51 36 57 5 54 6 35 81 52 17 55 100 95 81 32 76 21 1 100 1 95 1 40 91 98 59 84 19 11 51 79 19 47 86 45 15 62 2 59 77 31 68 71 92 17 33 10 33 85 57 5 2 88 97 91 99 63 20 63 54 79 93 24 62 46 27 30 87 3 64 95 88 16 50 79 1", "output": "99" }, { "input": "100 70\n61 48 89 17 97 6 93 13 64 50 66 88 24 52 46 99 6 65 93 64 82 37 57 41 47 1 84 5 97 83 79 46 16 35 40 7 64 15 44 96 37 17 30 92 51 67 26 3 14 56 27 68 66 93 36 39 51 6 40 55 79 26 71 54 8 48 18 2 71 12 55 60 29 37 31 97 26 37 25 68 67 70 3 87 100 41 5 82 65 92 24 66 76 48 89 8 40 93 31 95", "output": "100" }, { "input": "100 90\n87 32 30 15 10 52 93 63 84 1 82 41 27 51 75 32 42 94 39 53 70 13 4 22 99 35 44 38 5 23 18 100 61 80 9 12 42 93 9 77 3 7 60 95 66 78 95 42 69 8 1 88 93 66 96 20 76 63 15 36 92 52 2 72 36 57 48 63 29 20 74 88 49 47 81 61 94 74 70 93 47 3 19 52 59 41 5 40 22 3 76 97 91 37 95 88 91 99 76 15", "output": "98" }, { "input": "100 100\n79 75 7 28 6 96 38 35 57 95 41 74 24 96 32 78 81 13 63 84 24 95 3 23 66 1 60 6 96 49 41 5 14 18 31 97 66 19 49 89 49 70 51 28 20 99 18 1 28 77 24 46 69 21 40 32 31 66 28 6 66 97 9 16 70 90 91 30 34 82 93 41 65 11 39 52 1 88 63 43 80 50 60 49 28 56 18 76 24 57 74 1 28 99 36 35 79 54 18 16", "output": "100" }, { "input": "1 3\n5", "output": "1" }, { "input": "1 1\n100", "output": "1" }, { "input": "2 3\n4 2", "output": "1" }, { "input": "2 5\n99 97", "output": "2" }, { "input": "3 4\n7 5 2", "output": "2" }, { "input": "3 50\n47 86 51", "output": "3" }, { "input": "5 100\n82 100 85 1 37", "output": "5" }, { "input": "5 20\n40 39 21 5 20", "output": "3" }, { "input": "1 27\n81", "output": "1" }, { "input": "20 13\n7 8 29 83 74 28 93 85 7 8 3 9 8 70 49 50 39 41 57 1", "output": "7" }, { "input": "2 1\n100 2", "output": "1" }, { "input": "2 2\n6 4", "output": "1" }, { "input": "5 2\n6 4 4 1 1", "output": "1" }, { "input": "1 4\n3", "output": "1" }, { "input": "3 2\n1 5 3", "output": "2" }, { "input": "3 1\n3 2 2", "output": "1" }, { "input": "3 1\n2 3 2", "output": "2" }, { "input": "5 1\n5 1 1 1 1", "output": "1" }, { "input": "2 3\n7 4", "output": "1" } ]
1,664,282,944
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
4
31
0
n,m = map(int,input().split()) numbers = [int(num) for num in input().split(" ", n-1)] i = 1 j = n for num in numbers: if m<num: j = i%n k = (num-m) numbers.append(k) i = i+1 print(j)
Title: Jzzhu and Children Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* children in Jzzhu's school. Jzzhu is going to give some candies to them. Let's number all the children from 1 to *n*. The *i*-th child wants to get at least *a**i* candies. Jzzhu asks children to line up. Initially, the *i*-th child stands at the *i*-th place of the line. Then Jzzhu start distribution of the candies. He follows the algorithm: 1. Give *m* candies to the first child of the line. 1. If this child still haven't got enough candies, then the child goes to the end of the line, else the child go home. 1. Repeat the first two steps while the line is not empty. Consider all the children in the order they go home. Jzzhu wants to know, which child will be the last in this order? Input Specification: The first line contains two integers *n*,<=*m* (1<=≤<=*n*<=≤<=100; 1<=≤<=*m*<=≤<=100). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100). Output Specification: Output a single integer, representing the number of the last child. Demo Input: ['5 2\n1 3 1 4 2\n', '6 4\n1 1 2 2 3 3\n'] Demo Output: ['4\n', '6\n'] Note: Let's consider the first sample. Firstly child 1 gets 2 candies and go home. Then child 2 gets 2 candies and go to the end of the line. Currently the line looks like [3, 4, 5, 2] (indices of the children in order of the line). Then child 3 gets 2 candies and go home, and then child 4 gets 2 candies and goes to the end of the line. Currently the line looks like [5, 2, 4]. Then child 5 gets 2 candies and goes home. Then child 2 gets two candies and goes home, and finally child 4 gets 2 candies and goes home. Child 4 is the last one who goes home.
```python n,m = map(int,input().split()) numbers = [int(num) for num in input().split(" ", n-1)] i = 1 j = n for num in numbers: if m<num: j = i%n k = (num-m) numbers.append(k) i = i+1 print(j) ```
0
985
D
Sand Fortress
PROGRAMMING
2,100
[ "binary search", "constructive algorithms", "math" ]
null
null
You are going to the beach with the idea to build the greatest sand castle ever in your head! The beach is not as three-dimensional as you could have imagined, it can be decribed as a line of spots to pile up sand pillars. Spots are numbered 1 through infinity from left to right. Obviously, there is not enough sand on the beach, so you brought *n* packs of sand with you. Let height *h**i* of the sand pillar on some spot *i* be the number of sand packs you spent on it. You can't split a sand pack to multiple pillars, all the sand from it should go to a single one. There is a fence of height equal to the height of pillar with *H* sand packs to the left of the first spot and you should prevent sand from going over it. Finally you ended up with the following conditions to building the castle: - *h*1<=≤<=*H*: no sand from the leftmost spot should go over the fence; - For any |*h**i*<=-<=*h**i*<=+<=1|<=≤<=1: large difference in heights of two neighboring pillars can lead sand to fall down from the higher one to the lower, you really don't want this to happen; - : you want to spend all the sand you brought with you. As you have infinite spots to build, it is always possible to come up with some valid castle structure. Though you want the castle to be as compact as possible. Your task is to calculate the minimum number of spots you can occupy so that all the aforementioned conditions hold.
The only line contains two integer numbers *n* and *H* (1<=≤<=*n*,<=*H*<=≤<=1018) — the number of sand packs you have and the height of the fence, respectively.
Print the minimum number of spots you can occupy so the all the castle building conditions hold.
[ "5 2\n", "6 8\n" ]
[ "3\n", "3\n" ]
Here are the heights of some valid castles: - *n* = 5, *H* = 2, [2, 2, 1, 0, ...], [2, 1, 1, 1, 0, ...], [1, 0, 1, 2, 1, 0, ...] - *n* = 6, *H* = 8, [3, 2, 1, 0, ...], [2, 2, 1, 1, 0, ...], [0, 1, 0, 1, 2, 1, 1, 0...] (this one has 5 spots occupied) The first list for both cases is the optimal answer, 3 spots are occupied in them. And here are some invalid ones: - *n* = 5, *H* = 2, [3, 2, 0, ...], [2, 3, 0, ...], [1, 0, 2, 2, ...] - *n* = 6, *H* = 8, [2, 2, 2, 0, ...], [6, 0, ...], [1, 4, 1, 0...], [2, 2, 1, 0, ...]
0
[ { "input": "5 2", "output": "3" }, { "input": "6 8", "output": "3" }, { "input": "20 4", "output": "7" }, { "input": "1000000000000000000 1000000000000000000", "output": "1414213562" }, { "input": "1 1", "output": "1" }, { "input": "1 1000000000000000000", "output": "1" }, { "input": "1000000000000000000 1", "output": "1999999999" }, { "input": "1036191544337895 45523434", "output": "45523434" }, { "input": "1036191544337896 45523434", "output": "45523435" }, { "input": "1036191544337895 45523433", "output": "45523435" }, { "input": "1036191544337895 1", "output": "64379858" }, { "input": "1036191544337895 1000000000000000000", "output": "45523434" }, { "input": "30 3", "output": "9" }, { "input": "30 4", "output": "8" }, { "input": "6 100", "output": "3" }, { "input": "7 100", "output": "4" }, { "input": "1000000000000000000 99999999999", "output": "1414213562" }, { "input": "999999997351043581 1000000000000000000", "output": "1414213561" }, { "input": "911343366122896086 1416605974", "output": "1350069158" }, { "input": "828974163639871882 2010864527", "output": "1287613423" }, { "input": "696616491401388220 958775125", "output": "1191798158" }, { "input": "999999999000000000 1", "output": "1999999998" }, { "input": "961245465290770608 1687994843", "output": "1386539192" }, { "input": "692106376966414549 974053139", "output": "1186035874" }, { "input": "12 1", "output": "6" }, { "input": "806680349368385877 1068656310", "output": "1278847474" } ]
1,527,318,936
2,147,483,647
PyPy 3
TIME_LIMIT_EXCEEDED
TESTS
3
2,000
307,200
n, H = tuple(map(int, input().split(' '))) answer = 0 def stackUp(mid): sum = 0 for i in range(mid): sum += (i + 1) return sum spots = 0 low = 0 high = H while low < high-1: mid = (low + high)//2 sandBags = stackUp(mid) if sandBags >= n: high = mid elif sandBags < n: low = mid sandBags = stackUp(high) remain = n-sandBags if remain == 0: answer = high else: answer = high while remain > 0: if remain > H: remain -= answer answer += 1 elif remain <= H and remain > answer: remain -= (answer + 1) answer += 1 elif remain <= answer: answer += 1 remain = 0 print(answer)
Title: Sand Fortress Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are going to the beach with the idea to build the greatest sand castle ever in your head! The beach is not as three-dimensional as you could have imagined, it can be decribed as a line of spots to pile up sand pillars. Spots are numbered 1 through infinity from left to right. Obviously, there is not enough sand on the beach, so you brought *n* packs of sand with you. Let height *h**i* of the sand pillar on some spot *i* be the number of sand packs you spent on it. You can't split a sand pack to multiple pillars, all the sand from it should go to a single one. There is a fence of height equal to the height of pillar with *H* sand packs to the left of the first spot and you should prevent sand from going over it. Finally you ended up with the following conditions to building the castle: - *h*1<=≤<=*H*: no sand from the leftmost spot should go over the fence; - For any |*h**i*<=-<=*h**i*<=+<=1|<=≤<=1: large difference in heights of two neighboring pillars can lead sand to fall down from the higher one to the lower, you really don't want this to happen; - : you want to spend all the sand you brought with you. As you have infinite spots to build, it is always possible to come up with some valid castle structure. Though you want the castle to be as compact as possible. Your task is to calculate the minimum number of spots you can occupy so that all the aforementioned conditions hold. Input Specification: The only line contains two integer numbers *n* and *H* (1<=≤<=*n*,<=*H*<=≤<=1018) — the number of sand packs you have and the height of the fence, respectively. Output Specification: Print the minimum number of spots you can occupy so the all the castle building conditions hold. Demo Input: ['5 2\n', '6 8\n'] Demo Output: ['3\n', '3\n'] Note: Here are the heights of some valid castles: - *n* = 5, *H* = 2, [2, 2, 1, 0, ...], [2, 1, 1, 1, 0, ...], [1, 0, 1, 2, 1, 0, ...] - *n* = 6, *H* = 8, [3, 2, 1, 0, ...], [2, 2, 1, 1, 0, ...], [0, 1, 0, 1, 2, 1, 1, 0...] (this one has 5 spots occupied) The first list for both cases is the optimal answer, 3 spots are occupied in them. And here are some invalid ones: - *n* = 5, *H* = 2, [3, 2, 0, ...], [2, 3, 0, ...], [1, 0, 2, 2, ...] - *n* = 6, *H* = 8, [2, 2, 2, 0, ...], [6, 0, ...], [1, 4, 1, 0...], [2, 2, 1, 0, ...]
```python n, H = tuple(map(int, input().split(' '))) answer = 0 def stackUp(mid): sum = 0 for i in range(mid): sum += (i + 1) return sum spots = 0 low = 0 high = H while low < high-1: mid = (low + high)//2 sandBags = stackUp(mid) if sandBags >= n: high = mid elif sandBags < n: low = mid sandBags = stackUp(high) remain = n-sandBags if remain == 0: answer = high else: answer = high while remain > 0: if remain > H: remain -= answer answer += 1 elif remain <= H and remain > answer: remain -= (answer + 1) answer += 1 elif remain <= answer: answer += 1 remain = 0 print(answer) ```
0
165
A
Supercentral Point
PROGRAMMING
1,000
[ "implementation" ]
null
null
One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*): - point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=&gt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=&lt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=&lt;<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=&gt;<=*y* We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points. Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set.
The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different.
Print the only number — the number of supercentral points of the given set.
[ "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n", "5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n" ]
[ "2\n", "1\n" ]
In the first sample the supercentral points are only points (1, 1) and (1, 2). In the second sample there is one supercental point — point (0, 0).
500
[ { "input": "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3", "output": "2" }, { "input": "5\n0 0\n0 1\n1 0\n0 -1\n-1 0", "output": "1" }, { "input": "9\n-565 -752\n-184 723\n-184 -752\n-184 1\n950 723\n-565 723\n950 -752\n950 1\n-565 1", "output": "1" }, { "input": "25\n-651 897\n916 897\n-651 -808\n-748 301\n-734 414\n-651 -973\n-734 897\n916 -550\n-758 414\n916 180\n-758 -808\n-758 -973\n125 -550\n125 -973\n125 301\n916 414\n-748 -808\n-651 301\n-734 301\n-307 897\n-651 -550\n-651 414\n125 -808\n-748 -550\n916 -808", "output": "7" }, { "input": "1\n487 550", "output": "0" }, { "input": "10\n990 -396\n990 736\n990 646\n990 -102\n990 -570\n990 155\n990 528\n990 489\n990 268\n990 676", "output": "0" }, { "input": "30\n507 836\n525 836\n-779 196\n507 -814\n525 -814\n525 42\n525 196\n525 -136\n-779 311\n507 -360\n525 300\n507 578\n507 311\n-779 836\n507 300\n525 -360\n525 311\n-779 -360\n-779 578\n-779 300\n507 42\n525 578\n-779 379\n507 196\n525 379\n507 379\n-779 -814\n-779 42\n-779 -136\n507 -136", "output": "8" }, { "input": "25\n890 -756\n890 -188\n-37 -756\n-37 853\n523 998\n-261 853\n-351 853\n-351 -188\n523 -756\n-261 -188\n-37 998\n523 -212\n-351 998\n-37 -188\n-351 -756\n-37 -212\n890 998\n890 -212\n523 853\n-351 -212\n-261 -212\n-261 998\n-261 -756\n890 853\n523 -188", "output": "9" }, { "input": "21\n-813 -11\n486 254\n685 254\n-708 254\n-55 -11\n-671 -191\n486 -11\n-671 -11\n685 -11\n685 -191\n486 -191\n-55 254\n-708 -11\n-813 254\n-708 -191\n41 -11\n-671 254\n-813 -191\n41 254\n-55 -191\n41 -191", "output": "5" }, { "input": "4\n1 0\n2 0\n1 1\n1 -1", "output": "0" } ]
1,658,232,761
2,147,483,647
Python 3
OK
TESTS
26
124
0
n = int(input()) s = [] for i in range(n): x, y = map(int, input().split()) s.append([x, y]) kol = 0 for elem in s: u = 0 d = 0 r = 0 l = 0 for ilem in s: if elem != ilem: if ilem[0] == elem[0] and ilem[1] > elem[1]: u += 1 elif ilem[0] == elem[0] and ilem[1] < elem[1]: d += 1 elif ilem[0] > elem[0] and ilem[1] == elem[1]: r += 1 elif ilem[0] < elem[0] and ilem[1] == elem[1]: l += 1 if u * d * r * l > 0: kol += 1 print(kol)
Title: Supercentral Point Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*): - point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=&gt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=&lt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=&lt;<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=&gt;<=*y* We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points. Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set. Input Specification: The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different. Output Specification: Print the only number — the number of supercentral points of the given set. Demo Input: ['8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n', '5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n'] Demo Output: ['2\n', '1\n'] Note: In the first sample the supercentral points are only points (1, 1) and (1, 2). In the second sample there is one supercental point — point (0, 0).
```python n = int(input()) s = [] for i in range(n): x, y = map(int, input().split()) s.append([x, y]) kol = 0 for elem in s: u = 0 d = 0 r = 0 l = 0 for ilem in s: if elem != ilem: if ilem[0] == elem[0] and ilem[1] > elem[1]: u += 1 elif ilem[0] == elem[0] and ilem[1] < elem[1]: d += 1 elif ilem[0] > elem[0] and ilem[1] == elem[1]: r += 1 elif ilem[0] < elem[0] and ilem[1] == elem[1]: l += 1 if u * d * r * l > 0: kol += 1 print(kol) ```
3
957
A
Tritonic Iridescence
PROGRAMMING
1,300
[ "implementation" ]
null
null
Overlooking the captivating blend of myriads of vernal hues, Arkady the painter lays out a long, long canvas. Arkady has a sufficiently large amount of paint of three colours: cyan, magenta, and yellow. On the one-dimensional canvas split into *n* consecutive segments, each segment needs to be painted in one of the colours. Arkady has already painted some (possibly none or all) segments and passes the paintbrush to you. You are to determine whether there are at least two ways of colouring all the unpainted segments so that no two adjacent segments are of the same colour. Two ways are considered different if and only if a segment is painted in different colours in them.
The first line contains a single positive integer *n* (1<=≤<=*n*<=≤<=100) — the length of the canvas. The second line contains a string *s* of *n* characters, the *i*-th of which is either 'C' (denoting a segment painted in cyan), 'M' (denoting one painted in magenta), 'Y' (one painted in yellow), or '?' (an unpainted one).
If there are at least two different ways of painting, output "Yes"; otherwise output "No" (both without quotes). You can print each character in any case (upper or lower).
[ "5\nCY??Y\n", "5\nC?C?Y\n", "5\n?CYC?\n", "5\nC??MM\n", "3\nMMY\n" ]
[ "Yes\n", "Yes\n", "Yes\n", "No\n", "No\n" ]
For the first example, there are exactly two different ways of colouring: CYCMY and CYMCY. For the second example, there are also exactly two different ways of colouring: CMCMY and CYCMY. For the third example, there are four ways of colouring: MCYCM, MCYCY, YCYCM, and YCYCY. For the fourth example, no matter how the unpainted segments are coloured, the existing magenta segments will prevent the painting from satisfying the requirements. The similar is true for the fifth example.
500
[ { "input": "5\nCY??Y", "output": "Yes" }, { "input": "5\nC?C?Y", "output": "Yes" }, { "input": "5\n?CYC?", "output": "Yes" }, { "input": "5\nC??MM", "output": "No" }, { "input": "3\nMMY", "output": "No" }, { "input": "15\n??YYYYYY??YYYY?", "output": "No" }, { "input": "100\nYCY?CMCMCYMYMYC?YMYMYMY?CMC?MCMYCMYMYCM?CMCM?CMYMYCYCMCMCMCMCMYM?CYCYCMCM?CY?MYCYCMYM?CYCYCYMY?CYCYC", "output": "No" }, { "input": "1\nC", "output": "No" }, { "input": "1\n?", "output": "Yes" }, { "input": "2\nMY", "output": "No" }, { "input": "2\n?M", "output": "Yes" }, { "input": "2\nY?", "output": "Yes" }, { "input": "2\n??", "output": "Yes" }, { "input": "3\n??C", "output": "Yes" }, { "input": "3\nM??", "output": "Yes" }, { "input": "3\nYCM", "output": "No" }, { "input": "3\n?C?", "output": "Yes" }, { "input": "3\nMC?", "output": "Yes" }, { "input": "4\nCYCM", "output": "No" }, { "input": "4\nM?CM", "output": "No" }, { "input": "4\n??YM", "output": "Yes" }, { "input": "4\nC???", "output": "Yes" }, { "input": "10\nMCYM?MYM?C", "output": "Yes" }, { "input": "50\nCMCMCYM?MY?C?MC??YM?CY?YM??M?MCMCYCYMCYCMCM?MCM?MC", "output": "Yes" }, { "input": "97\nMCM?YCMYM?YMY?MY?MYCY?CMCMCYC?YMY?MYCMC?M?YCMC?YM?C?MCMCMYMCMY?MCM?YC?YMYMY?MYCYCM?YC?YCY?MYMYMYC", "output": "No" }, { "input": "100\nC?M?M?M?YM??YMYC?MCYMYM??Y??YC?CYC???YM?YM??MYMY?CYCYMYC?YC?C?CYCMY??CMC?YMCMYCYCYMYM?CYM?M?MCMCMY?Y", "output": "Yes" }, { "input": "100\n?YYYYYYYYYYYYYYYYYYYYYYYYYYYYY??YYY?YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY?", "output": "No" }, { "input": "100\n????????????????????????????????????????????????????????????????????????????????????????????????????", "output": "Yes" }, { "input": "100\nY?CYMYMYMYCYMY?CMCYMYMC?MYCY?CMCYCYMCM?YCMCYMYCYCY?MYMYCYCYCM?CYMYMY?CY?MYCYCY?M?YMYCY?CMCMCY?CY?M?C", "output": "No" }, { "input": "4\nM??C", "output": "Yes" }, { "input": "6\nY?C??C", "output": "Yes" }, { "input": "5\nC???Y", "output": "Yes" }, { "input": "5\nC??MY", "output": "Yes" }, { "input": "5\nCY??M", "output": "Yes" }, { "input": "4\nC??Y", "output": "Yes" }, { "input": "52\n??????????????????????????????????????????????????YY", "output": "No" }, { "input": "3\nYY?", "output": "No" }, { "input": "5\nCC??Y", "output": "No" }, { "input": "8\nCMC??MCM", "output": "Yes" }, { "input": "7\nM?YCM??", "output": "Yes" }, { "input": "6\n?CC???", "output": "No" }, { "input": "100\n??????????????????????????????????????????????????????????????????????????????????????????????????MM", "output": "No" }, { "input": "4\nC??M", "output": "Yes" }, { "input": "4\n?C?M", "output": "Yes" }, { "input": "6\nMC??MC", "output": "Yes" } ]
1,522,157,883
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
62
7,065,600
n = int(input()) s = input() flag=0 for i in range(n): if i==0 and s[0] == '?': print('Yes') flag=1 break elif i==n-1 and s[n-1] == '?': print('Yes') flag=1 break else: if s[i-1]=='?' or s[i+1]=='?': print('Yes') flag=1 break elif s[i-1] == s[i+1]: print('Yes') flag=1 break if flag==0: print('No')
Title: Tritonic Iridescence Time Limit: None seconds Memory Limit: None megabytes Problem Description: Overlooking the captivating blend of myriads of vernal hues, Arkady the painter lays out a long, long canvas. Arkady has a sufficiently large amount of paint of three colours: cyan, magenta, and yellow. On the one-dimensional canvas split into *n* consecutive segments, each segment needs to be painted in one of the colours. Arkady has already painted some (possibly none or all) segments and passes the paintbrush to you. You are to determine whether there are at least two ways of colouring all the unpainted segments so that no two adjacent segments are of the same colour. Two ways are considered different if and only if a segment is painted in different colours in them. Input Specification: The first line contains a single positive integer *n* (1<=≤<=*n*<=≤<=100) — the length of the canvas. The second line contains a string *s* of *n* characters, the *i*-th of which is either 'C' (denoting a segment painted in cyan), 'M' (denoting one painted in magenta), 'Y' (one painted in yellow), or '?' (an unpainted one). Output Specification: If there are at least two different ways of painting, output "Yes"; otherwise output "No" (both without quotes). You can print each character in any case (upper or lower). Demo Input: ['5\nCY??Y\n', '5\nC?C?Y\n', '5\n?CYC?\n', '5\nC??MM\n', '3\nMMY\n'] Demo Output: ['Yes\n', 'Yes\n', 'Yes\n', 'No\n', 'No\n'] Note: For the first example, there are exactly two different ways of colouring: CYCMY and CYMCY. For the second example, there are also exactly two different ways of colouring: CMCMY and CYCMY. For the third example, there are four ways of colouring: MCYCM, MCYCY, YCYCM, and YCYCY. For the fourth example, no matter how the unpainted segments are coloured, the existing magenta segments will prevent the painting from satisfying the requirements. The similar is true for the fifth example.
```python n = int(input()) s = input() flag=0 for i in range(n): if i==0 and s[0] == '?': print('Yes') flag=1 break elif i==n-1 and s[n-1] == '?': print('Yes') flag=1 break else: if s[i-1]=='?' or s[i+1]=='?': print('Yes') flag=1 break elif s[i-1] == s[i+1]: print('Yes') flag=1 break if flag==0: print('No') ```
0
706
B
Interesting drink
PROGRAMMING
1,100
[ "binary search", "dp", "implementation" ]
null
null
Vasiliy likes to rest after a hard work, so you may often meet him in some bar nearby. As all programmers do, he loves the famous drink "Beecola", which can be bought in *n* different shops in the city. It's known that the price of one bottle in the shop *i* is equal to *x**i* coins. Vasiliy plans to buy his favorite drink for *q* consecutive days. He knows, that on the *i*-th day he will be able to spent *m**i* coins. Now, for each of the days he want to know in how many different shops he can buy a bottle of "Beecola".
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of shops in the city that sell Vasiliy's favourite drink. The second line contains *n* integers *x**i* (1<=≤<=*x**i*<=≤<=100<=000) — prices of the bottles of the drink in the *i*-th shop. The third line contains a single integer *q* (1<=≤<=*q*<=≤<=100<=000) — the number of days Vasiliy plans to buy the drink. Then follow *q* lines each containing one integer *m**i* (1<=≤<=*m**i*<=≤<=109) — the number of coins Vasiliy can spent on the *i*-th day.
Print *q* integers. The *i*-th of them should be equal to the number of shops where Vasiliy will be able to buy a bottle of the drink on the *i*-th day.
[ "5\n3 10 8 6 11\n4\n1\n10\n3\n11\n" ]
[ "0\n4\n1\n5\n" ]
On the first day, Vasiliy won't be able to buy a drink in any of the shops. On the second day, Vasiliy can buy a drink in the shops 1, 2, 3 and 4. On the third day, Vasiliy can buy a drink only in the shop number 1. Finally, on the last day Vasiliy can buy a drink in any shop.
1,000
[ { "input": "5\n3 10 8 6 11\n4\n1\n10\n3\n11", "output": "0\n4\n1\n5" }, { "input": "5\n868 987 714 168 123\n10\n424\n192\n795\n873\n117\n914\n735\n158\n631\n471", "output": "2\n2\n3\n4\n0\n4\n3\n1\n2\n2" }, { "input": "3\n435 482 309\n7\n245\n241\n909\n745\n980\n29\n521", "output": "0\n0\n3\n3\n3\n0\n3" }, { "input": "1\n653\n9\n903\n980\n80\n770\n965\n874\n381\n657\n969", "output": "1\n1\n0\n1\n1\n1\n0\n1\n1" }, { "input": "12\n35345 58181 32223 84621 35905 73863 99537 30666 67771 39229 36847 29038\n23\n55052824\n82504840\n35160556\n78141700\n73401989\n86305919\n39430705\n31939373\n23501765\n4406029\n61436920\n14295390\n34275309\n28028753\n85724689\n70158847\n2396455\n66994588\n84024224\n30175981\n65622319\n76517111\n76605341", "output": "12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12" }, { "input": "4\n698 193 1584 76192\n4\n553640\n310518\n274280\n429192", "output": "4\n4\n4\n4" }, { "input": "1\n1\n1\n1000000000", "output": "1" }, { "input": "1\n1\n1\n100005", "output": "1" }, { "input": "3\n1 2 3\n1\n100005", "output": "3" }, { "input": "2\n1 2\n3\n100004\n100005\n100006", "output": "2\n2\n2" }, { "input": "3\n1 1 1\n1\n1", "output": "3" }, { "input": "1\n1\n1\n1", "output": "1" }, { "input": "3\n1 2 3\n1\n100000", "output": "3" }, { "input": "5\n1 1 1 1 10\n2\n1\n10", "output": "4\n5" }, { "input": "5\n3 10 8 6 11\n1\n10000000", "output": "5" } ]
1,695,809,542
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
31
6,860,800
# https://codeforces.com/problemset/problem/706/B from typing import List def search(sorted_xs: int, left:int, right:int, m: int) -> int: '''Returns the greatest index in ascending array. `-1` if does not exists.''' while left < right: mid: int = left + ((right - left ) // 2) if sorted_xs[mid] == m: return mid if sorted_xs[mid] < m: left = mid + 1 elif sorted_xs[mid] > m: right = mid - 1 return - 1 def solve(q:int, sorted_xs: List[int], ms:List[int]) -> None: for m in ms: print(search(sorted_xs,0, q, m) + 1); def main() -> None: n: int = int(input()) xs: List[int] = list(map(int, input().split(" "))) xs.sort() q:int = int(input()) ms:List[int] = [] for _ in range(q): m = int(input()) ms.append(m) solve(q, xs, ms) if __name__ == "__main__": main()
Title: Interesting drink Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasiliy likes to rest after a hard work, so you may often meet him in some bar nearby. As all programmers do, he loves the famous drink "Beecola", which can be bought in *n* different shops in the city. It's known that the price of one bottle in the shop *i* is equal to *x**i* coins. Vasiliy plans to buy his favorite drink for *q* consecutive days. He knows, that on the *i*-th day he will be able to spent *m**i* coins. Now, for each of the days he want to know in how many different shops he can buy a bottle of "Beecola". Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of shops in the city that sell Vasiliy's favourite drink. The second line contains *n* integers *x**i* (1<=≤<=*x**i*<=≤<=100<=000) — prices of the bottles of the drink in the *i*-th shop. The third line contains a single integer *q* (1<=≤<=*q*<=≤<=100<=000) — the number of days Vasiliy plans to buy the drink. Then follow *q* lines each containing one integer *m**i* (1<=≤<=*m**i*<=≤<=109) — the number of coins Vasiliy can spent on the *i*-th day. Output Specification: Print *q* integers. The *i*-th of them should be equal to the number of shops where Vasiliy will be able to buy a bottle of the drink on the *i*-th day. Demo Input: ['5\n3 10 8 6 11\n4\n1\n10\n3\n11\n'] Demo Output: ['0\n4\n1\n5\n'] Note: On the first day, Vasiliy won't be able to buy a drink in any of the shops. On the second day, Vasiliy can buy a drink in the shops 1, 2, 3 and 4. On the third day, Vasiliy can buy a drink only in the shop number 1. Finally, on the last day Vasiliy can buy a drink in any shop.
```python # https://codeforces.com/problemset/problem/706/B from typing import List def search(sorted_xs: int, left:int, right:int, m: int) -> int: '''Returns the greatest index in ascending array. `-1` if does not exists.''' while left < right: mid: int = left + ((right - left ) // 2) if sorted_xs[mid] == m: return mid if sorted_xs[mid] < m: left = mid + 1 elif sorted_xs[mid] > m: right = mid - 1 return - 1 def solve(q:int, sorted_xs: List[int], ms:List[int]) -> None: for m in ms: print(search(sorted_xs,0, q, m) + 1); def main() -> None: n: int = int(input()) xs: List[int] = list(map(int, input().split(" "))) xs.sort() q:int = int(input()) ms:List[int] = [] for _ in range(q): m = int(input()) ms.append(m) solve(q, xs, ms) if __name__ == "__main__": main() ```
0
711
A
Bus to Udayland
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
ZS the Coder and Chris the Baboon are travelling to Udayland! To get there, they have to get on the special IOI bus. The IOI bus has *n* rows of seats. There are 4 seats in each row, and the seats are separated into pairs by a walkway. When ZS and Chris came, some places in the bus was already occupied. ZS and Chris are good friends. They insist to get a pair of neighbouring empty seats. Two seats are considered neighbouring if they are in the same row and in the same pair. Given the configuration of the bus, can you help ZS and Chris determine where they should sit?
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of rows of seats in the bus. Then, *n* lines follow. Each line contains exactly 5 characters, the first two of them denote the first pair of seats in the row, the third character denotes the walkway (it always equals '|') and the last two of them denote the second pair of seats in the row. Each character, except the walkway, equals to 'O' or to 'X'. 'O' denotes an empty seat, 'X' denotes an occupied seat. See the sample cases for more details.
If it is possible for Chris and ZS to sit at neighbouring empty seats, print "YES" (without quotes) in the first line. In the next *n* lines print the bus configuration, where the characters in the pair of seats for Chris and ZS is changed with characters '+'. Thus the configuration should differ from the input one by exactly two charaters (they should be equal to 'O' in the input and to '+' in the output). If there is no pair of seats for Chris and ZS, print "NO" (without quotes) in a single line. If there are multiple solutions, you may print any of them.
[ "6\nOO|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n", "4\nXO|OX\nXO|XX\nOX|OX\nXX|OX\n", "5\nXX|XX\nXX|XX\nXO|OX\nXO|OO\nOX|XO\n" ]
[ "YES\n++|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n", "NO\n", "YES\nXX|XX\nXX|XX\nXO|OX\nXO|++\nOX|XO\n" ]
Note that the following is an incorrect configuration for the first sample case because the seats must be in the same pair. O+|+X XO|XX OX|OO XX|OX OO|OO OO|XX
500
[ { "input": "6\nOO|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX", "output": "YES\n++|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX" }, { "input": "4\nXO|OX\nXO|XX\nOX|OX\nXX|OX", "output": "NO" }, { "input": "5\nXX|XX\nXX|XX\nXO|OX\nXO|OO\nOX|XO", "output": "YES\nXX|XX\nXX|XX\nXO|OX\nXO|++\nOX|XO" }, { "input": "1\nXO|OX", "output": "NO" }, { "input": "1\nOO|OO", "output": "YES\n++|OO" }, { "input": "4\nXO|XX\nXX|XO\nOX|XX\nXO|XO", "output": "NO" }, { "input": "9\nOX|XO\nOX|XO\nXO|OX\nOX|OX\nXO|OX\nXX|OO\nOX|OX\nOX|XO\nOX|OX", "output": "YES\nOX|XO\nOX|XO\nXO|OX\nOX|OX\nXO|OX\nXX|++\nOX|OX\nOX|XO\nOX|OX" }, { "input": "61\nOX|XX\nOX|XX\nOX|XX\nXO|XO\nXX|XO\nXX|XX\nXX|XX\nOX|XX\nXO|XO\nOX|XO\nXO|OX\nXX|XX\nXX|XX\nOX|OX\nXX|OX\nOX|XO\nOX|XO\nXO|OX\nXO|XX\nOX|XX\nOX|XX\nXO|OX\nXO|XX\nXO|XX\nOX|XX\nXX|XX\nXX|XO\nXO|XX\nXX|XX\nXO|OX\nXX|XO\nXO|XX\nXO|XO\nXO|OX\nXX|OX\nXO|OX\nOX|XX\nXX|OX\nXX|XX\nOX|XO\nOX|XX\nXO|OX\nOX|XX\nOX|XX\nXO|XO\nXO|XX\nOX|XX\nXO|XO\nOX|XX\nXX|XX\nOX|XO\nXO|XO\nXO|XO\nOX|OX\nXX|OX\nXX|OX\nOX|XO\nOX|XX\nOX|OX\nXO|XX\nOX|XX", "output": "NO" }, { "input": "1\nOO|XX", "output": "YES\n++|XX" }, { "input": "10\nOO|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|XX", "output": "YES\n++|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|XX" }, { "input": "10\nXX|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|OO", "output": "YES\nXX|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|++" }, { "input": "5\nXX|XX\nXX|XX\nXO|OX\nOO|OX\nOX|XO", "output": "YES\nXX|XX\nXX|XX\nXO|OX\n++|OX\nOX|XO" }, { "input": "6\nOO|XX\nXO|XX\nOX|OO\nXX|OX\nOO|XX\nOX|XX", "output": "YES\n++|XX\nXO|XX\nOX|OO\nXX|OX\nOO|XX\nOX|XX" } ]
1,617,200,514
2,147,483,647
Python 3
OK
TESTS
71
78
0
ans=[] flag=False for _ in range(int(input())): a=input().split('|') if(not flag): if(a[0]=='OO' or a[1]=='OO'): if(a[0]=='OO'): a[0]='++' else: a[1]="++" flag=True ans.append(a) if(flag): print("YES") for i in ans: print(i[0]+"|"+i[1]) else: print("NO")
Title: Bus to Udayland Time Limit: None seconds Memory Limit: None megabytes Problem Description: ZS the Coder and Chris the Baboon are travelling to Udayland! To get there, they have to get on the special IOI bus. The IOI bus has *n* rows of seats. There are 4 seats in each row, and the seats are separated into pairs by a walkway. When ZS and Chris came, some places in the bus was already occupied. ZS and Chris are good friends. They insist to get a pair of neighbouring empty seats. Two seats are considered neighbouring if they are in the same row and in the same pair. Given the configuration of the bus, can you help ZS and Chris determine where they should sit? Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of rows of seats in the bus. Then, *n* lines follow. Each line contains exactly 5 characters, the first two of them denote the first pair of seats in the row, the third character denotes the walkway (it always equals '|') and the last two of them denote the second pair of seats in the row. Each character, except the walkway, equals to 'O' or to 'X'. 'O' denotes an empty seat, 'X' denotes an occupied seat. See the sample cases for more details. Output Specification: If it is possible for Chris and ZS to sit at neighbouring empty seats, print "YES" (without quotes) in the first line. In the next *n* lines print the bus configuration, where the characters in the pair of seats for Chris and ZS is changed with characters '+'. Thus the configuration should differ from the input one by exactly two charaters (they should be equal to 'O' in the input and to '+' in the output). If there is no pair of seats for Chris and ZS, print "NO" (without quotes) in a single line. If there are multiple solutions, you may print any of them. Demo Input: ['6\nOO|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n', '4\nXO|OX\nXO|XX\nOX|OX\nXX|OX\n', '5\nXX|XX\nXX|XX\nXO|OX\nXO|OO\nOX|XO\n'] Demo Output: ['YES\n++|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n', 'NO\n', 'YES\nXX|XX\nXX|XX\nXO|OX\nXO|++\nOX|XO\n'] Note: Note that the following is an incorrect configuration for the first sample case because the seats must be in the same pair. O+|+X XO|XX OX|OO XX|OX OO|OO OO|XX
```python ans=[] flag=False for _ in range(int(input())): a=input().split('|') if(not flag): if(a[0]=='OO' or a[1]=='OO'): if(a[0]=='OO'): a[0]='++' else: a[1]="++" flag=True ans.append(a) if(flag): print("YES") for i in ans: print(i[0]+"|"+i[1]) else: print("NO") ```
3
245
E
Mishap in Club
PROGRAMMING
1,400
[ "greedy", "implementation" ]
null
null
Polycarpus just has been out of luck lately! As soon as he found a job in the "Binary Cat" cafe, the club got burgled. All ice-cream was stolen. On the burglary night Polycarpus kept a careful record of all club visitors. Each time a visitor entered the club, Polycarpus put down character "+" in his notes. Similarly, each time a visitor left the club, Polycarpus put character "-" in his notes. We know that all cases of going in and out happened consecutively, that is, no two events happened at the same time. Polycarpus doesn't remember whether there was somebody in the club at the moment when his shift begun and at the moment when it ended. Right now the police wonders what minimum number of distinct people Polycarpus could have seen. Assume that he sees anybody coming in or out of the club. Each person could have come in or out an arbitrary number of times.
The only line of the input contains a sequence of characters "+" and "-", the characters are written one after another without any separators. The characters are written in the order, in which the corresponding events occurred. The given sequence has length from 1 to 300 characters, inclusive.
Print the sought minimum number of people
[ "+-+-+\n", "---" ]
[ "1\n", "3" ]
none
0
[ { "input": "+-+-+", "output": "1" }, { "input": "---", "output": "3" }, { "input": "-", "output": "1" }, { "input": "--", "output": "2" }, { "input": "---", "output": "3" }, { "input": "----", "output": "4" }, { "input": "---+", "output": "3" }, { "input": "--+-", "output": "2" }, { "input": "--++", "output": "2" }, { "input": "-+--", "output": "2" }, { "input": "-++", "output": "2" }, { "input": "-++-", "output": "2" }, { "input": "+", "output": "1" }, { "input": "+-", "output": "1" }, { "input": "+--", "output": "2" }, { "input": "+--+", "output": "2" }, { "input": "++--", "output": "2" }, { "input": "-+++--+-++--+-+--+-+", "output": "3" }, { "input": "++-++--+++++-+++++---+++-++-++-", "output": "12" }, { "input": "----+-+--++---++---++-+-----+--", "output": "11" }, { "input": "-+++---+++++++++++++-++-++++++-++-+-+++-", "output": "22" }, { "input": "++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++", "output": "300" }, { "input": "------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------", "output": "300" }, { "input": "++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++-+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++", "output": "298" }, { "input": "++++++++++++++++++++-+++++++++++++++++++++++++++++++++++++++++++++++++++++++-+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++", "output": "296" }, { "input": "+++++++++++++++++++++++++++++++++++++++++-++++++++-++++++++++++-+++++++++++++++++++++++++++++++++++++++++++++++++++++-+++++++++++++++++++++++++-++++++++++++++++++++++++-++++-+++++++++++++-++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++-+++-+++++++++++++++++", "output": "280" }, { "input": "++++-+---+++--++++-++-++++++++-++-++++-++++++-+-+-+++--+-++++++-+++-++-+++-++++-++++-+-+----+++++---++++-+---+++--+++++-+++-+-++++++----+--+++++++++-+--+++-+-+-++++++--+-+-+-+-++--+-+-----++++++-+++-++--+++++++++---+-++++++-++-++++-+--+-++-++++-+-+--++-+--+++-+-++++++++++++-+++-+----++++++++--+-+-++", "output": "100" }, { "input": "+----++-----+----+++--++---+++--+-++++-++---++++++--++++--++-++--++--++----++++---+--+++----++--++--++--+--++++++++--++--+++----+++----++----++-+--+---+--+-++--+--+--+-+--+---++-+-++--+++++-++------+++-++--+--+--+++++++--++-+--+-+--++++-++--+---+-+-++-+-++----+-++++++-+++--+----++-+--++-----+++-++-+", "output": "15" }, { "input": "-+++----+-++--+-+----+--+++++----+---+-++-+---+++--+---++-+-----+----+------+--+----++-++-----+++--+---+-+-----++++------+--+-----++---+---+---+-++------++++--+-+-------------+---+--+-+--------++---+-++---+-----+++--+---+-++-+---+-+---+++--++-----++------+----+---+---+--+-+-++-+---++--------+----++", "output": "103" }, { "input": "----------+-----------------------------------------------------------+-+-------------+--------------------------------------------------------------------------------+--+-----+-+-------------------------------------------+-----------------------------------------------------------------+-----------", "output": "280" } ]
1,367,837,349
2,147,483,647
Python 3
OK
TESTS
30
93
102,400
m,p,c=0,0,0 s=(input()) for i in s: if i=='-': c-=1 else: c+=1 m=min(m,c) p=max(p,c) print (p-m)
Title: Mishap in Club Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarpus just has been out of luck lately! As soon as he found a job in the "Binary Cat" cafe, the club got burgled. All ice-cream was stolen. On the burglary night Polycarpus kept a careful record of all club visitors. Each time a visitor entered the club, Polycarpus put down character "+" in his notes. Similarly, each time a visitor left the club, Polycarpus put character "-" in his notes. We know that all cases of going in and out happened consecutively, that is, no two events happened at the same time. Polycarpus doesn't remember whether there was somebody in the club at the moment when his shift begun and at the moment when it ended. Right now the police wonders what minimum number of distinct people Polycarpus could have seen. Assume that he sees anybody coming in or out of the club. Each person could have come in or out an arbitrary number of times. Input Specification: The only line of the input contains a sequence of characters "+" and "-", the characters are written one after another without any separators. The characters are written in the order, in which the corresponding events occurred. The given sequence has length from 1 to 300 characters, inclusive. Output Specification: Print the sought minimum number of people Demo Input: ['+-+-+\n', '---'] Demo Output: ['1\n', '3'] Note: none
```python m,p,c=0,0,0 s=(input()) for i in s: if i=='-': c-=1 else: c+=1 m=min(m,c) p=max(p,c) print (p-m) ```
3
296
A
Yaroslav and Permutations
PROGRAMMING
1,100
[ "greedy", "math" ]
null
null
Yaroslav has an array that consists of *n* integers. In one second Yaroslav can swap two neighboring array elements. Now Yaroslav is wondering if he can obtain an array where any two neighboring elements would be distinct in a finite time. Help Yaroslav.
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000) — the array elements.
In the single line print "YES" (without the quotes) if Yaroslav can obtain the array he needs, and "NO" (without the quotes) otherwise.
[ "1\n1\n", "3\n1 1 2\n", "4\n7 7 7 7\n" ]
[ "YES\n", "YES\n", "NO\n" ]
In the first sample the initial array fits well. In the second sample Yaroslav can get array: 1, 2, 1. He can swap the last and the second last elements to obtain it. In the third sample Yarosav can't get the array he needs.
500
[ { "input": "1\n1", "output": "YES" }, { "input": "3\n1 1 2", "output": "YES" }, { "input": "4\n7 7 7 7", "output": "NO" }, { "input": "4\n479 170 465 146", "output": "YES" }, { "input": "5\n996 437 605 996 293", "output": "YES" }, { "input": "6\n727 539 896 668 36 896", "output": "YES" }, { "input": "7\n674 712 674 674 674 674 674", "output": "NO" }, { "input": "8\n742 742 742 742 742 289 742 742", "output": "NO" }, { "input": "9\n730 351 806 806 806 630 85 757 967", "output": "YES" }, { "input": "10\n324 539 83 440 834 640 440 440 440 440", "output": "YES" }, { "input": "7\n925 830 925 98 987 162 356", "output": "YES" }, { "input": "68\n575 32 53 351 151 942 725 967 431 108 192 8 338 458 288 754 384 946 910 210 759 222 589 423 947 507 31 414 169 901 592 763 656 411 360 625 538 549 484 596 42 603 351 292 837 375 21 597 22 349 200 669 485 282 735 54 1000 419 939 901 789 128 468 729 894 649 484 808", "output": "YES" }, { "input": "22\n618 814 515 310 617 936 452 601 250 520 557 799 304 225 9 845 610 990 703 196 486 94", "output": "YES" }, { "input": "44\n459 581 449 449 449 449 449 449 449 623 449 449 449 449 449 449 449 449 889 449 203 273 329 449 449 449 449 449 449 845 882 323 22 449 449 893 449 449 449 449 449 870 449 402", "output": "NO" }, { "input": "90\n424 3 586 183 286 89 427 618 758 833 933 170 155 722 190 977 330 369 693 426 556 435 550 442 513 146 61 719 754 140 424 280 997 688 530 550 438 867 950 194 196 298 417 287 106 489 283 456 735 115 702 317 672 787 264 314 356 186 54 913 809 833 946 314 757 322 559 647 983 482 145 197 223 130 162 536 451 174 467 45 660 293 440 254 25 155 511 746 650 187", "output": "YES" }, { "input": "14\n959 203 478 315 788 788 373 834 488 519 774 764 193 103", "output": "YES" }, { "input": "81\n544 528 528 528 528 4 506 528 32 528 528 528 528 528 528 528 528 975 528 528 528 528 528 528 528 528 528 528 528 528 528 20 528 528 528 528 528 528 528 528 852 528 528 120 528 528 61 11 528 528 528 228 528 165 883 528 488 475 628 528 528 528 528 528 528 597 528 528 528 528 528 528 528 528 528 528 528 412 528 521 925", "output": "NO" }, { "input": "89\n354 356 352 355 355 355 352 354 354 352 355 356 355 352 354 356 354 355 355 354 353 352 352 355 355 356 352 352 353 356 352 353 354 352 355 352 353 353 353 354 353 354 354 353 356 353 353 354 354 354 354 353 352 353 355 356 356 352 356 354 353 352 355 354 356 356 356 354 354 356 354 355 354 355 353 352 354 355 352 355 355 354 356 353 353 352 356 352 353", "output": "YES" }, { "input": "71\n284 284 285 285 285 284 285 284 284 285 284 285 284 284 285 284 285 285 285 285 284 284 285 285 284 284 284 285 284 285 284 285 285 284 284 284 285 284 284 285 285 285 284 284 285 284 285 285 284 285 285 284 285 284 284 284 285 285 284 285 284 285 285 285 285 284 284 285 285 284 285", "output": "NO" }, { "input": "28\n602 216 214 825 814 760 814 28 76 814 814 288 814 814 222 707 11 490 814 543 914 705 814 751 976 814 814 99", "output": "YES" }, { "input": "48\n546 547 914 263 986 945 914 914 509 871 324 914 153 571 914 914 914 528 970 566 544 914 914 914 410 914 914 589 609 222 914 889 691 844 621 68 914 36 914 39 630 749 914 258 945 914 727 26", "output": "YES" }, { "input": "56\n516 76 516 197 516 427 174 516 706 813 94 37 516 815 516 516 937 483 16 516 842 516 638 691 516 635 516 516 453 263 516 516 635 257 125 214 29 81 516 51 362 516 677 516 903 516 949 654 221 924 516 879 516 516 972 516", "output": "YES" }, { "input": "46\n314 723 314 314 314 235 314 314 314 314 270 314 59 972 314 216 816 40 314 314 314 314 314 314 314 381 314 314 314 314 314 314 314 789 314 957 114 942 314 314 29 314 314 72 314 314", "output": "NO" }, { "input": "72\n169 169 169 599 694 81 250 529 865 406 817 169 667 169 965 169 169 663 65 169 903 169 942 763 169 807 169 603 169 169 13 169 169 810 169 291 169 169 169 169 169 169 169 713 169 440 169 169 169 169 169 480 169 169 867 169 169 169 169 169 169 169 169 393 169 169 459 169 99 169 601 800", "output": "NO" }, { "input": "100\n317 316 317 316 317 316 317 316 317 316 316 317 317 316 317 316 316 316 317 316 317 317 316 317 316 316 316 316 316 316 317 316 317 317 317 317 317 317 316 316 316 317 316 317 316 317 316 317 317 316 317 316 317 317 316 317 316 317 316 317 316 316 316 317 317 317 317 317 316 317 317 316 316 316 316 317 317 316 317 316 316 316 316 316 316 317 316 316 317 317 317 317 317 317 317 317 317 316 316 317", "output": "NO" }, { "input": "100\n510 510 510 162 969 32 510 511 510 510 911 183 496 875 903 461 510 510 123 578 510 510 510 510 510 755 510 673 510 510 763 510 510 909 510 435 487 959 807 510 368 788 557 448 284 332 510 949 510 510 777 112 857 926 487 510 510 510 678 510 510 197 829 427 698 704 409 509 510 238 314 851 510 651 510 455 682 510 714 635 973 510 443 878 510 510 510 591 510 24 596 510 43 183 510 510 671 652 214 784", "output": "YES" }, { "input": "100\n476 477 474 476 476 475 473 476 474 475 473 477 476 476 474 476 474 475 476 477 473 473 473 474 474 476 473 473 476 476 475 476 473 474 473 473 477 475 475 475 476 475 477 477 477 476 475 475 475 473 476 477 475 476 477 473 474 477 473 475 476 476 474 477 476 474 473 477 473 475 477 473 476 474 477 473 475 477 473 476 476 475 476 475 474 473 477 473 475 473 477 473 473 474 475 473 477 476 477 474", "output": "YES" }, { "input": "100\n498 498 498 498 498 499 498 499 499 499 498 498 498 498 499 498 499 499 498 499 498 498 498 499 499 499 498 498 499 499 498 498 498 499 498 499 498 498 498 499 498 499 498 498 498 498 499 498 498 499 498 498 499 498 499 499 498 499 499 499 498 498 498 498 499 498 499 498 499 499 499 499 498 498 499 499 498 499 499 498 498 499 499 498 498 499 499 499 498 498 499 498 498 498 499 499 499 498 498 499", "output": "NO" }, { "input": "100\n858 53 816 816 816 816 816 816 816 181 816 816 816 816 579 879 816 948 171 816 816 150 866 816 816 816 897 816 816 816 816 816 816 706 816 539 816 816 816 816 816 816 423 487 816 615 254 816 816 816 816 83 816 816 816 816 816 816 816 816 816 816 816 136 775 999 816 816 816 644 816 816 816 816 927 816 802 816 856 816 816 816 816 816 816 816 816 816 816 700 816 816 816 816 982 477 816 891 806 816", "output": "NO" }, { "input": "100\n167 169 169 167 169 169 167 167 167 167 168 166 170 170 169 170 170 170 169 168 166 167 170 169 167 169 168 169 166 170 166 167 170 166 166 167 169 166 166 169 166 167 168 168 170 167 168 166 168 170 167 168 167 169 169 166 168 167 170 168 167 169 168 169 166 168 168 169 169 166 170 168 167 169 170 168 167 169 168 167 168 168 166 169 170 170 166 166 167 170 167 168 167 167 169 169 166 166 169 167", "output": "YES" }, { "input": "100\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000", "output": "NO" }, { "input": "99\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000", "output": "NO" }, { "input": "100\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "YES" }, { "input": "99\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "YES" }, { "input": "2\n1 1", "output": "NO" }, { "input": "1\n1000", "output": "YES" }, { "input": "12\n2 2 4 4 4 4 6 6 6 6 6 6", "output": "YES" } ]
1,588,259,129
2,147,483,647
Python 3
OK
TESTS
37
216
0
n = int(input()) numbers = (map(int, input().split())) two_count = 0 ans_dict = dict() for i in numbers: ans_dict[i] = ans_dict.get(i, 0) + 1 for k, v in ans_dict.items(): if v > (n +1)/2: print("NO") break else: print("YES")
Title: Yaroslav and Permutations Time Limit: None seconds Memory Limit: None megabytes Problem Description: Yaroslav has an array that consists of *n* integers. In one second Yaroslav can swap two neighboring array elements. Now Yaroslav is wondering if he can obtain an array where any two neighboring elements would be distinct in a finite time. Help Yaroslav. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000) — the array elements. Output Specification: In the single line print "YES" (without the quotes) if Yaroslav can obtain the array he needs, and "NO" (without the quotes) otherwise. Demo Input: ['1\n1\n', '3\n1 1 2\n', '4\n7 7 7 7\n'] Demo Output: ['YES\n', 'YES\n', 'NO\n'] Note: In the first sample the initial array fits well. In the second sample Yaroslav can get array: 1, 2, 1. He can swap the last and the second last elements to obtain it. In the third sample Yarosav can't get the array he needs.
```python n = int(input()) numbers = (map(int, input().split())) two_count = 0 ans_dict = dict() for i in numbers: ans_dict[i] = ans_dict.get(i, 0) + 1 for k, v in ans_dict.items(): if v > (n +1)/2: print("NO") break else: print("YES") ```
3
248
A
Cupboards
PROGRAMMING
800
[ "implementation" ]
null
null
One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house. Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find. And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open. Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position. Your task is to write a program that will determine the required number of seconds *t*.
The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero. The numbers in the lines are separated by single spaces.
In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs.
[ "5\n0 1\n1 0\n0 1\n1 1\n0 1\n" ]
[ "3\n" ]
none
500
[ { "input": "5\n0 1\n1 0\n0 1\n1 1\n0 1", "output": "3" }, { "input": "2\n0 0\n0 0", "output": "0" }, { "input": "3\n0 1\n1 1\n1 1", "output": "1" }, { "input": "8\n0 1\n1 0\n0 1\n1 1\n0 1\n1 0\n0 1\n1 0", "output": "7" }, { "input": "8\n1 0\n1 0\n1 0\n0 1\n0 1\n1 1\n1 1\n0 1", "output": "6" }, { "input": "15\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "5\n1 0\n1 0\n1 0\n0 1\n0 1", "output": "4" } ]
1,621,668,597
2,147,483,647
PyPy 3
OK
TESTS
57
404
3,788,800
l=[] r=[] for i in range(int(input())): f=[int(i) for i in input().split()] l.append(f[0]) r.append(f[1]) cl_1=l.count(1) cl_0=l.count(0) cr_1=r.count(1) cr_0=r.count(0) if cl_1<cl_0: c=cl_1 else: c=cl_0 if cr_1<cr_0: c+=cr_1 else: c+=cr_0 print(c)
Title: Cupboards Time Limit: None seconds Memory Limit: None megabytes Problem Description: One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house. Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find. And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open. Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position. Your task is to write a program that will determine the required number of seconds *t*. Input Specification: The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero. The numbers in the lines are separated by single spaces. Output Specification: In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs. Demo Input: ['5\n0 1\n1 0\n0 1\n1 1\n0 1\n'] Demo Output: ['3\n'] Note: none
```python l=[] r=[] for i in range(int(input())): f=[int(i) for i in input().split()] l.append(f[0]) r.append(f[1]) cl_1=l.count(1) cl_0=l.count(0) cr_1=r.count(1) cr_0=r.count(0) if cl_1<cl_0: c=cl_1 else: c=cl_0 if cr_1<cr_0: c+=cr_1 else: c+=cr_0 print(c) ```
3
698
A
Vacations
PROGRAMMING
1,400
[ "dp" ]
null
null
Vasya has *n* days of vacations! So he decided to improve his IT skills and do sport. Vasya knows the following information about each of this *n* days: whether that gym opened and whether a contest was carried out in the Internet on that day. For the *i*-th day there are four options: 1. on this day the gym is closed and the contest is not carried out; 1. on this day the gym is closed and the contest is carried out; 1. on this day the gym is open and the contest is not carried out; 1. on this day the gym is open and the contest is carried out. On each of days Vasya can either have a rest or write the contest (if it is carried out on this day), or do sport (if the gym is open on this day). Find the minimum number of days on which Vasya will have a rest (it means, he will not do sport and write the contest at the same time). The only limitation that Vasya has — he does not want to do the same activity on two consecutive days: it means, he will not do sport on two consecutive days, and write the contest on two consecutive days.
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of days of Vasya's vacations. The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=3) separated by space, where: - *a**i* equals 0, if on the *i*-th day of vacations the gym is closed and the contest is not carried out; - *a**i* equals 1, if on the *i*-th day of vacations the gym is closed, but the contest is carried out; - *a**i* equals 2, if on the *i*-th day of vacations the gym is open and the contest is not carried out; - *a**i* equals 3, if on the *i*-th day of vacations the gym is open and the contest is carried out.
Print the minimum possible number of days on which Vasya will have a rest. Remember that Vasya refuses: - to do sport on any two consecutive days, - to write the contest on any two consecutive days.
[ "4\n1 3 2 0\n", "7\n1 3 3 2 1 2 3\n", "2\n2 2\n" ]
[ "2\n", "0\n", "1\n" ]
In the first test Vasya can write the contest on the day number 1 and do sport on the day number 3. Thus, he will have a rest for only 2 days. In the second test Vasya should write contests on days number 1, 3, 5 and 7, in other days do sport. Thus, he will not have a rest for a single day. In the third test Vasya can do sport either on a day number 1 or number 2. He can not do sport in two days, because it will be contrary to the his limitation. Thus, he will have a rest for only one day.
500
[ { "input": "4\n1 3 2 0", "output": "2" }, { "input": "7\n1 3 3 2 1 2 3", "output": "0" }, { "input": "2\n2 2", "output": "1" }, { "input": "1\n0", "output": "1" }, { "input": "10\n0 0 1 1 0 0 0 0 1 0", "output": "8" }, { "input": "100\n3 2 3 3 3 2 3 1 3 2 2 3 2 3 3 3 3 3 3 1 2 2 3 1 3 3 2 2 2 3 1 0 3 3 3 2 3 3 1 1 3 1 3 3 3 1 3 1 3 0 1 3 2 3 2 1 1 3 2 3 3 3 2 3 1 3 3 3 3 2 2 2 1 3 1 3 3 3 3 1 3 2 3 3 0 3 3 3 3 3 1 0 2 1 3 3 0 2 3 3", "output": "16" }, { "input": "10\n2 3 0 1 3 1 2 2 1 0", "output": "3" }, { "input": "45\n3 3 2 3 2 3 3 3 0 3 3 3 3 3 3 3 1 3 2 3 2 3 2 2 2 3 2 3 3 3 3 3 1 2 3 3 2 2 2 3 3 3 3 1 3", "output": "6" }, { "input": "1\n1", "output": "0" }, { "input": "1\n2", "output": "0" }, { "input": "1\n3", "output": "0" }, { "input": "2\n1 1", "output": "1" }, { "input": "2\n1 3", "output": "0" }, { "input": "2\n0 1", "output": "1" }, { "input": "2\n0 0", "output": "2" }, { "input": "2\n3 3", "output": "0" }, { "input": "3\n3 3 3", "output": "0" }, { "input": "2\n3 2", "output": "0" }, { "input": "2\n0 2", "output": "1" }, { "input": "10\n2 2 3 3 3 3 2 1 3 2", "output": "2" }, { "input": "15\n0 1 0 0 0 2 0 1 0 0 0 2 0 0 0", "output": "11" }, { "input": "15\n1 3 2 2 2 3 3 3 3 2 3 2 2 1 1", "output": "4" }, { "input": "15\n3 1 3 2 3 2 2 2 3 3 3 3 2 3 2", "output": "3" }, { "input": "20\n0 2 0 1 0 0 0 1 2 0 1 1 1 0 1 1 0 1 1 0", "output": "12" }, { "input": "20\n2 3 2 3 3 3 3 2 0 3 1 1 2 3 0 3 2 3 0 3", "output": "5" }, { "input": "20\n3 3 3 3 2 3 3 2 1 3 3 2 2 2 3 2 2 2 2 2", "output": "4" }, { "input": "25\n0 0 1 0 0 1 0 0 1 0 0 1 0 2 0 0 2 0 0 1 0 2 0 1 1", "output": "16" }, { "input": "25\n1 3 3 2 2 3 3 3 3 3 1 2 2 3 2 0 2 1 0 1 3 2 2 3 3", "output": "5" }, { "input": "25\n2 3 1 3 3 2 1 3 3 3 1 3 3 1 3 2 3 3 1 3 3 3 2 3 3", "output": "3" }, { "input": "30\n0 0 1 0 1 0 1 1 0 0 0 0 0 0 1 0 0 1 1 0 0 2 0 0 1 1 2 0 0 0", "output": "22" }, { "input": "30\n1 1 3 2 2 0 3 2 3 3 1 2 0 1 1 2 3 3 2 3 1 3 2 3 0 2 0 3 3 2", "output": "9" }, { "input": "30\n1 2 3 2 2 3 3 3 3 3 3 3 3 3 3 1 2 2 3 2 3 3 3 2 1 3 3 3 1 3", "output": "2" }, { "input": "35\n0 1 1 0 0 2 0 0 1 0 0 0 1 0 1 0 1 0 0 0 1 2 1 0 2 2 1 0 1 0 1 1 1 0 0", "output": "21" }, { "input": "35\n2 2 0 3 2 2 0 3 3 1 1 3 3 1 2 2 0 2 2 2 2 3 1 0 2 1 3 2 2 3 2 3 3 1 2", "output": "11" }, { "input": "35\n1 2 2 3 3 3 3 3 2 2 3 3 2 3 3 2 3 2 3 3 2 2 2 3 3 2 3 3 3 1 3 3 2 2 2", "output": "7" }, { "input": "40\n2 0 1 1 0 0 0 0 2 0 1 1 1 0 0 1 0 0 0 0 0 2 0 0 0 2 1 1 1 3 0 0 0 0 0 0 0 1 1 0", "output": "28" }, { "input": "40\n2 2 3 2 0 2 3 2 1 2 3 0 2 3 2 1 1 3 1 1 0 2 3 1 3 3 1 1 3 3 2 2 1 3 3 3 2 3 3 1", "output": "10" }, { "input": "40\n1 3 2 3 3 2 3 3 2 2 3 1 2 1 2 2 3 1 2 2 1 2 2 2 1 2 2 3 2 3 2 3 2 3 3 3 1 3 2 3", "output": "8" }, { "input": "45\n2 1 0 0 0 2 1 0 1 0 0 2 2 1 1 0 0 2 0 0 0 0 0 0 1 0 0 2 0 0 1 1 0 0 1 0 0 1 1 2 0 0 2 0 2", "output": "29" }, { "input": "45\n3 3 2 3 3 3 2 2 3 2 3 1 3 2 3 2 2 1 1 3 2 3 2 1 3 1 2 3 2 2 0 3 3 2 3 2 3 2 3 2 0 3 1 1 3", "output": "8" }, { "input": "50\n3 0 0 0 2 0 0 0 0 0 0 0 2 1 0 2 0 1 0 1 3 0 2 1 1 0 0 1 1 0 0 1 2 1 1 2 1 1 0 0 0 0 0 0 0 1 2 2 0 0", "output": "32" }, { "input": "50\n3 3 3 3 1 0 3 3 0 2 3 1 1 1 3 2 3 3 3 3 3 1 0 1 2 2 3 3 2 3 0 0 0 2 1 0 1 2 2 2 2 0 2 2 2 1 2 3 3 2", "output": "16" }, { "input": "50\n3 2 3 1 2 1 2 3 3 2 3 3 2 1 3 3 3 3 3 3 2 3 2 3 2 2 3 3 3 2 3 3 3 3 2 3 1 2 3 3 2 3 3 1 2 2 1 1 3 3", "output": "7" }, { "input": "55\n0 0 1 1 0 1 0 0 1 0 1 0 0 0 2 0 0 1 0 0 0 1 0 0 0 0 3 1 0 0 0 1 0 0 0 0 2 0 0 0 2 0 2 1 0 0 0 0 0 0 0 0 2 0 0", "output": "40" }, { "input": "55\n3 0 3 3 3 2 0 2 3 0 3 2 3 3 0 3 3 1 3 3 1 2 3 2 0 3 3 2 1 2 3 2 3 0 3 2 2 1 2 3 2 2 1 3 2 2 3 1 3 2 2 3 3 2 2", "output": "13" }, { "input": "55\n3 3 1 3 2 3 2 3 2 2 3 3 3 3 3 1 1 3 3 2 3 2 3 2 0 1 3 3 3 3 2 3 2 3 1 1 2 2 2 3 3 3 3 3 2 2 2 3 2 3 3 3 3 1 3", "output": "7" }, { "input": "60\n0 1 0 0 0 0 0 0 0 2 1 1 3 0 0 0 0 0 1 0 1 1 0 0 0 3 0 1 0 1 0 2 0 0 0 0 0 1 0 0 0 0 1 1 0 1 0 0 0 0 0 1 0 0 1 0 1 0 0 0", "output": "44" }, { "input": "60\n3 2 1 3 2 2 3 3 3 1 1 3 2 2 3 3 1 3 2 2 3 3 2 2 2 2 0 2 2 3 2 3 0 3 3 3 2 3 3 0 1 3 2 1 3 1 1 2 1 3 1 1 2 2 1 3 3 3 2 2", "output": "15" }, { "input": "60\n3 2 2 3 2 3 2 3 3 2 3 2 3 3 2 3 3 3 3 3 3 2 3 3 1 2 3 3 3 2 1 3 3 1 3 1 3 0 3 3 3 2 3 2 3 2 3 3 1 1 2 3 3 3 3 2 1 3 2 3", "output": "8" }, { "input": "65\n1 0 2 1 1 0 1 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 0 1 2 0 2 1 0 2 1 0 1 0 1 1 0 1 1 1 2 1 0 1 0 0 0 0 1 2 2 1 0 0 1 2 1 2 0 2 0 0 0 1 1", "output": "35" }, { "input": "65\n2 2 2 3 0 2 1 2 3 3 1 3 1 2 1 3 2 3 2 2 2 1 2 0 3 1 3 1 1 3 1 3 3 3 3 3 1 3 0 3 1 3 1 2 2 3 2 0 3 1 3 2 1 2 2 2 3 3 2 3 3 3 2 2 3", "output": "13" }, { "input": "65\n3 2 3 3 3 2 3 2 3 3 3 3 3 3 3 3 3 2 3 2 3 2 2 3 3 3 3 3 2 2 2 3 3 2 3 3 2 3 3 3 3 2 3 3 3 2 2 3 3 3 3 3 3 2 2 3 3 2 3 3 1 3 3 3 3", "output": "6" }, { "input": "70\n1 0 0 0 1 0 1 0 0 0 1 1 0 1 0 0 1 1 1 0 1 1 0 0 1 1 1 3 1 1 0 1 2 0 2 1 0 0 0 1 1 1 1 1 0 0 1 0 0 0 1 1 1 3 0 0 1 0 0 0 1 0 0 0 0 0 1 0 1 1", "output": "43" }, { "input": "70\n2 3 3 3 1 3 3 1 2 1 1 2 2 3 0 2 3 3 1 3 3 2 2 3 3 3 2 2 2 2 1 3 3 0 2 1 1 3 2 3 3 2 2 3 1 3 1 2 3 2 3 3 2 2 2 3 1 1 2 1 3 3 2 2 3 3 3 1 1 1", "output": "16" }, { "input": "70\n3 3 2 2 1 2 1 2 2 2 2 2 3 3 2 3 3 3 3 2 2 2 2 3 3 3 1 3 3 3 2 3 3 3 3 2 3 3 1 3 1 3 2 3 3 2 3 3 3 2 3 2 3 3 1 2 3 3 2 2 2 3 2 3 3 3 3 3 3 1", "output": "10" }, { "input": "75\n1 0 0 1 1 0 0 1 0 1 2 0 0 2 1 1 0 0 0 0 0 0 2 1 1 0 0 0 0 1 0 1 0 1 1 1 0 1 0 0 1 0 0 0 0 0 0 1 1 0 0 1 2 1 0 0 0 0 0 0 0 1 0 0 0 1 0 0 0 1 1 1 0 1 0", "output": "51" }, { "input": "75\n1 3 3 3 1 1 3 2 3 3 1 3 3 3 2 1 3 2 2 3 1 1 1 1 1 1 2 3 3 3 3 3 3 2 3 3 3 3 3 2 3 3 2 2 2 1 2 3 3 2 2 3 0 1 1 3 3 0 0 1 1 3 2 3 3 3 3 1 2 2 3 3 3 3 1", "output": "16" }, { "input": "75\n3 3 3 3 2 2 3 2 2 3 2 2 1 2 3 3 2 2 3 3 1 2 2 2 1 3 3 3 1 2 2 3 3 3 2 3 2 2 2 3 3 1 3 2 2 3 3 3 0 3 2 1 3 3 2 3 3 3 3 1 2 3 3 3 2 2 3 3 3 3 2 2 3 3 1", "output": "11" }, { "input": "80\n0 0 0 0 2 0 1 1 1 1 1 0 0 0 0 2 0 0 1 0 0 0 0 1 1 0 2 2 1 1 0 1 0 1 0 1 1 1 0 1 2 1 1 0 0 0 1 1 0 1 1 0 1 0 0 1 0 0 1 0 0 0 0 0 0 0 2 2 0 1 1 0 0 0 0 0 0 0 0 1", "output": "56" }, { "input": "80\n2 2 3 3 2 1 0 1 0 3 2 2 3 2 1 3 1 3 3 2 3 3 3 2 3 3 3 2 1 3 3 1 3 3 3 3 3 3 2 2 2 1 3 2 1 3 2 1 1 0 1 1 2 1 3 0 1 2 3 2 2 3 2 3 1 3 3 2 1 1 0 3 3 3 3 1 2 1 2 0", "output": "17" }, { "input": "80\n2 3 3 2 2 2 3 3 2 3 3 3 3 3 2 3 2 3 2 3 3 3 3 3 3 3 3 3 2 3 1 3 2 3 3 0 3 1 2 3 3 1 2 3 2 3 3 2 3 3 3 3 3 2 2 3 0 3 3 3 3 3 2 2 3 2 3 3 3 3 3 2 3 2 3 3 3 3 2 3", "output": "9" }, { "input": "85\n0 1 1 0 0 0 0 0 0 1 0 0 0 1 0 0 0 0 2 0 1 0 0 2 0 1 1 0 0 0 0 2 2 0 0 0 1 0 0 0 1 2 0 1 0 0 0 2 1 1 2 0 3 1 0 2 2 1 0 0 1 1 0 0 0 0 1 0 2 1 1 2 1 0 0 1 2 1 2 0 0 1 0 1 0", "output": "54" }, { "input": "85\n2 3 1 3 2 3 1 3 3 2 1 2 1 2 2 3 2 2 3 2 0 3 3 2 1 2 2 2 3 3 2 3 3 3 2 1 1 3 1 3 2 2 2 3 3 2 3 2 3 1 1 3 2 3 1 3 3 2 3 3 2 2 3 0 1 1 2 2 2 2 1 2 3 1 3 3 1 3 2 2 3 2 3 3 3", "output": "19" }, { "input": "85\n1 2 1 2 3 2 3 3 3 3 3 3 3 2 1 3 2 3 3 3 3 2 3 3 3 1 3 3 3 3 2 3 3 3 3 3 3 2 2 1 3 3 3 3 2 2 3 1 1 2 3 3 3 2 3 3 3 3 3 2 3 3 3 2 2 3 3 1 1 1 3 3 3 3 1 3 3 3 1 3 3 1 3 2 3", "output": "9" }, { "input": "90\n2 0 1 0 0 0 0 0 0 1 1 2 0 0 0 0 0 0 0 2 2 0 2 0 0 2 1 0 2 0 1 0 1 0 0 1 2 2 0 0 1 0 0 1 0 1 0 2 0 1 1 1 0 1 1 0 1 0 2 0 1 0 1 0 0 0 1 0 0 1 2 0 0 0 1 0 0 2 2 0 0 0 0 0 1 3 1 1 0 1", "output": "57" }, { "input": "90\n2 3 3 3 2 3 2 1 3 0 3 2 3 3 2 1 3 3 2 3 2 3 3 2 1 3 1 3 3 1 2 2 3 3 2 1 2 3 2 3 0 3 3 2 2 3 1 0 3 3 1 3 3 3 3 2 1 2 2 1 3 2 1 3 3 1 2 0 2 2 3 2 2 3 3 3 1 3 2 1 2 3 3 2 3 2 3 3 2 1", "output": "17" }, { "input": "90\n2 3 2 3 2 2 3 3 2 3 2 1 2 3 3 3 2 3 2 3 3 2 3 3 3 1 3 3 1 3 2 3 2 2 1 3 3 3 3 3 3 3 3 3 3 2 3 2 3 2 1 3 3 3 3 2 2 3 3 3 3 3 3 3 3 3 3 3 3 2 2 3 3 3 3 1 3 2 3 3 3 2 2 3 2 3 2 1 3 2", "output": "9" }, { "input": "95\n0 0 3 0 2 0 1 0 0 2 0 0 0 0 0 0 0 1 0 0 0 2 0 0 0 0 0 1 0 0 2 1 0 0 1 0 0 0 1 0 0 0 0 1 0 1 0 0 1 0 1 2 0 1 2 2 0 0 1 0 2 0 0 0 1 0 2 1 2 1 0 1 0 0 0 1 0 0 1 1 2 1 1 1 1 2 0 0 0 0 0 1 1 0 1", "output": "61" }, { "input": "95\n2 3 3 2 1 1 3 3 3 2 3 3 3 2 3 2 3 3 3 2 3 2 2 3 3 2 1 2 3 3 3 1 3 0 3 3 1 3 3 1 0 1 3 3 3 0 2 1 3 3 3 3 0 1 3 2 3 3 2 1 3 1 2 1 1 2 3 0 3 3 2 1 3 2 1 3 3 3 2 2 3 2 3 3 3 2 1 3 3 3 2 3 3 1 2", "output": "15" }, { "input": "95\n2 3 3 2 3 2 2 1 3 1 2 1 2 3 1 2 3 3 1 3 3 3 1 2 3 2 2 2 2 3 3 3 2 2 3 3 3 3 3 1 2 2 3 3 3 3 2 3 2 2 2 3 3 2 3 3 3 3 3 3 3 0 3 2 0 3 3 1 3 3 3 2 3 2 3 2 3 3 3 3 2 2 1 1 3 3 3 3 3 1 3 3 3 3 2", "output": "14" }, { "input": "100\n1 0 2 0 0 0 0 2 0 0 0 1 0 1 0 0 1 0 1 2 0 1 1 0 0 1 0 1 1 0 0 0 2 0 1 0 0 2 0 0 0 0 0 1 1 1 0 0 1 0 2 0 0 0 0 1 0 1 0 1 0 1 0 1 2 2 0 0 2 0 1 0 1 0 1 0 0 0 1 0 0 2 1 1 1 0 0 1 0 0 0 2 0 0 2 1 1 0 0 2", "output": "63" }, { "input": "100\n3 2 1 3 2 3 2 3 2 2 3 1 3 3 3 3 3 2 2 3 2 2 3 2 3 3 3 2 3 1 2 1 3 3 3 3 1 3 3 3 3 3 2 3 2 1 3 3 1 2 2 3 1 3 3 1 2 2 1 3 1 3 2 2 3 3 1 3 2 3 1 2 1 2 3 3 2 2 1 2 3 3 3 3 3 1 3 3 3 3 2 1 3 0 3 3 3 2 3 3", "output": "15" }, { "input": "100\n1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2", "output": "0" }, { "input": "100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3", "output": "0" }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "50" }, { "input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2", "output": "50" }, { "input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "49" }, { "input": "100\n2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1", "output": "0" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "100" }, { "input": "2\n0 3", "output": "1" }, { "input": "2\n1 0", "output": "1" }, { "input": "2\n1 2", "output": "0" }, { "input": "2\n2 0", "output": "1" }, { "input": "2\n2 1", "output": "0" }, { "input": "2\n2 3", "output": "0" }, { "input": "2\n3 0", "output": "1" }, { "input": "2\n3 1", "output": "0" }, { "input": "100\n3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0", "output": "50" } ]
1,588,830,482
2,147,483,647
Python 3
OK
TESTS
88
109
6,656,000
n=int(input()) a = [int(x) for x in input().split()] c = 0 last = 0 for i in range(n): if a[i]==0 or a[i]==last: c+=1 last = 0 elif a[i]==3 : if(last!=0): last = 3 - last else: last=a[i] print(c)
Title: Vacations Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya has *n* days of vacations! So he decided to improve his IT skills and do sport. Vasya knows the following information about each of this *n* days: whether that gym opened and whether a contest was carried out in the Internet on that day. For the *i*-th day there are four options: 1. on this day the gym is closed and the contest is not carried out; 1. on this day the gym is closed and the contest is carried out; 1. on this day the gym is open and the contest is not carried out; 1. on this day the gym is open and the contest is carried out. On each of days Vasya can either have a rest or write the contest (if it is carried out on this day), or do sport (if the gym is open on this day). Find the minimum number of days on which Vasya will have a rest (it means, he will not do sport and write the contest at the same time). The only limitation that Vasya has — he does not want to do the same activity on two consecutive days: it means, he will not do sport on two consecutive days, and write the contest on two consecutive days. Input Specification: The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of days of Vasya's vacations. The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=3) separated by space, where: - *a**i* equals 0, if on the *i*-th day of vacations the gym is closed and the contest is not carried out; - *a**i* equals 1, if on the *i*-th day of vacations the gym is closed, but the contest is carried out; - *a**i* equals 2, if on the *i*-th day of vacations the gym is open and the contest is not carried out; - *a**i* equals 3, if on the *i*-th day of vacations the gym is open and the contest is carried out. Output Specification: Print the minimum possible number of days on which Vasya will have a rest. Remember that Vasya refuses: - to do sport on any two consecutive days, - to write the contest on any two consecutive days. Demo Input: ['4\n1 3 2 0\n', '7\n1 3 3 2 1 2 3\n', '2\n2 2\n'] Demo Output: ['2\n', '0\n', '1\n'] Note: In the first test Vasya can write the contest on the day number 1 and do sport on the day number 3. Thus, he will have a rest for only 2 days. In the second test Vasya should write contests on days number 1, 3, 5 and 7, in other days do sport. Thus, he will not have a rest for a single day. In the third test Vasya can do sport either on a day number 1 or number 2. He can not do sport in two days, because it will be contrary to the his limitation. Thus, he will have a rest for only one day.
```python n=int(input()) a = [int(x) for x in input().split()] c = 0 last = 0 for i in range(n): if a[i]==0 or a[i]==last: c+=1 last = 0 elif a[i]==3 : if(last!=0): last = 3 - last else: last=a[i] print(c) ```
3
519
C
A and B and Team Training
PROGRAMMING
1,300
[ "greedy", "implementation", "math", "number theory" ]
null
null
A and B are preparing themselves for programming contests. An important part of preparing for a competition is sharing programming knowledge from the experienced members to those who are just beginning to deal with the contests. Therefore, during the next team training A decided to make teams so that newbies are solving problems together with experienced participants. A believes that the optimal team of three people should consist of one experienced participant and two newbies. Thus, each experienced participant can share the experience with a large number of people. However, B believes that the optimal team should have two experienced members plus one newbie. Thus, each newbie can gain more knowledge and experience. As a result, A and B have decided that all the teams during the training session should belong to one of the two types described above. Furthermore, they agree that the total number of teams should be as much as possible. There are *n* experienced members and *m* newbies on the training session. Can you calculate what maximum number of teams can be formed?
The first line contains two integers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=5·105) — the number of experienced participants and newbies that are present at the training session.
Print the maximum number of teams that can be formed.
[ "2 6\n", "4 5\n" ]
[ "2\n", "3\n" ]
Let's represent the experienced players as XP and newbies as NB. In the first test the teams look as follows: (XP, NB, NB), (XP, NB, NB). In the second test sample the teams look as follows: (XP, NB, NB), (XP, NB, NB), (XP, XP, NB).
1,500
[ { "input": "2 6", "output": "2" }, { "input": "4 5", "output": "3" }, { "input": "1 1", "output": "0" }, { "input": "3 3", "output": "2" }, { "input": "500000 500000", "output": "333333" }, { "input": "70 100", "output": "56" }, { "input": "5 12525", "output": "5" }, { "input": "10 5", "output": "5" }, { "input": "5 10", "output": "5" }, { "input": "0 0", "output": "0" }, { "input": "0 1", "output": "0" }, { "input": "1 0", "output": "0" }, { "input": "0 21233", "output": "0" }, { "input": "12523 0", "output": "0" }, { "input": "1231 1253", "output": "828" }, { "input": "500000 0", "output": "0" }, { "input": "1 500000", "output": "1" }, { "input": "250000 500000", "output": "250000" }, { "input": "500000 250000", "output": "250000" }, { "input": "33333 77777", "output": "33333" }, { "input": "30900 174529", "output": "30900" }, { "input": "89979 57154", "output": "49044" }, { "input": "231646 398487", "output": "210044" }, { "input": "332019 281112", "output": "204377" }, { "input": "473686 122443", "output": "122443" }, { "input": "481245 86879", "output": "86879" }, { "input": "39935 123534", "output": "39935" }, { "input": "10000 20000", "output": "10000" }, { "input": "10000 20001", "output": "10000" }, { "input": "10000 20002", "output": "10000" }, { "input": "10000 20003", "output": "10000" }, { "input": "10000 20004", "output": "10000" }, { "input": "10001 20000", "output": "10000" }, { "input": "10001 20001", "output": "10000" }, { "input": "10001 20002", "output": "10001" }, { "input": "10001 20003", "output": "10001" }, { "input": "10001 20004", "output": "10001" }, { "input": "20000 10000", "output": "10000" }, { "input": "20001 10000", "output": "10000" }, { "input": "20002 10000", "output": "10000" }, { "input": "20003 10000", "output": "10000" }, { "input": "20004 10000", "output": "10000" }, { "input": "20000 10001", "output": "10000" }, { "input": "20001 10001", "output": "10000" }, { "input": "20002 10001", "output": "10001" }, { "input": "20003 10001", "output": "10001" }, { "input": "20004 10001", "output": "10001" }, { "input": "10 0", "output": "0" }, { "input": "0 6", "output": "0" }, { "input": "2 3", "output": "1" }, { "input": "1 2", "output": "1" }, { "input": "0 0", "output": "0" } ]
1,637,396,898
2,147,483,647
Python 3
OK
TESTS
52
61
0
a,b=map(int,input().split()) a,b=min(a,b),max(a,b) if b>=2*a: print(a) else: s=2*a-b if s%3==2: print(b-a+s//3*2+1) else: print(b-a+s//3*2)
Title: A and B and Team Training Time Limit: None seconds Memory Limit: None megabytes Problem Description: A and B are preparing themselves for programming contests. An important part of preparing for a competition is sharing programming knowledge from the experienced members to those who are just beginning to deal with the contests. Therefore, during the next team training A decided to make teams so that newbies are solving problems together with experienced participants. A believes that the optimal team of three people should consist of one experienced participant and two newbies. Thus, each experienced participant can share the experience with a large number of people. However, B believes that the optimal team should have two experienced members plus one newbie. Thus, each newbie can gain more knowledge and experience. As a result, A and B have decided that all the teams during the training session should belong to one of the two types described above. Furthermore, they agree that the total number of teams should be as much as possible. There are *n* experienced members and *m* newbies on the training session. Can you calculate what maximum number of teams can be formed? Input Specification: The first line contains two integers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=5·105) — the number of experienced participants and newbies that are present at the training session. Output Specification: Print the maximum number of teams that can be formed. Demo Input: ['2 6\n', '4 5\n'] Demo Output: ['2\n', '3\n'] Note: Let's represent the experienced players as XP and newbies as NB. In the first test the teams look as follows: (XP, NB, NB), (XP, NB, NB). In the second test sample the teams look as follows: (XP, NB, NB), (XP, NB, NB), (XP, XP, NB).
```python a,b=map(int,input().split()) a,b=min(a,b),max(a,b) if b>=2*a: print(a) else: s=2*a-b if s%3==2: print(b-a+s//3*2+1) else: print(b-a+s//3*2) ```
3
780
A
Andryusha and Socks
PROGRAMMING
800
[ "implementation" ]
null
null
Andryusha is an orderly boy and likes to keep things in their place. Today he faced a problem to put his socks in the wardrobe. He has *n* distinct pairs of socks which are initially in a bag. The pairs are numbered from 1 to *n*. Andryusha wants to put paired socks together and put them in the wardrobe. He takes the socks one by one from the bag, and for each sock he looks whether the pair of this sock has been already took out of the bag, or not. If not (that means the pair of this sock is still in the bag), he puts the current socks on the table in front of him. Otherwise, he puts both socks from the pair to the wardrobe. Andryusha remembers the order in which he took the socks from the bag. Can you tell him what is the maximum number of socks that were on the table at the same time?
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=105) — the number of sock pairs. The second line contains 2*n* integers *x*1,<=*x*2,<=...,<=*x*2*n* (1<=≤<=*x**i*<=≤<=*n*), which describe the order in which Andryusha took the socks from the bag. More precisely, *x**i* means that the *i*-th sock Andryusha took out was from pair *x**i*. It is guaranteed that Andryusha took exactly two socks of each pair.
Print single integer — the maximum number of socks that were on the table at the same time.
[ "1\n1 1\n", "3\n2 1 1 3 2 3\n" ]
[ "1\n", "2\n" ]
In the first example Andryusha took a sock from the first pair and put it on the table. Then he took the next sock which is from the first pair as well, so he immediately puts both socks to the wardrobe. Thus, at most one sock was on the table at the same time. In the second example Andryusha behaved as follows: - Initially the table was empty, he took out a sock from pair 2 and put it on the table. - Sock (2) was on the table. Andryusha took out a sock from pair 1 and put it on the table. - Socks (1, 2) were on the table. Andryusha took out a sock from pair 1, and put this pair into the wardrobe. - Sock (2) was on the table. Andryusha took out a sock from pair 3 and put it on the table. - Socks (2, 3) were on the table. Andryusha took out a sock from pair 2, and put this pair into the wardrobe. - Sock (3) was on the table. Andryusha took out a sock from pair 3 and put this pair into the wardrobe.
500
[ { "input": "1\n1 1", "output": "1" }, { "input": "3\n2 1 1 3 2 3", "output": "2" }, { "input": "5\n5 1 3 2 4 3 1 2 4 5", "output": "5" }, { "input": "10\n4 2 6 3 4 8 7 1 1 5 2 10 6 8 3 5 10 9 9 7", "output": "6" }, { "input": "50\n30 47 31 38 37 50 36 43 9 23 2 2 15 31 14 49 9 16 6 44 27 14 5 6 3 47 25 26 1 35 3 15 24 19 8 46 49 41 4 26 40 28 42 11 34 35 46 18 7 28 18 40 19 42 4 41 38 48 50 12 29 39 33 17 25 22 22 21 36 45 27 30 20 7 13 29 39 44 21 8 37 45 34 1 20 10 11 17 33 12 43 13 10 16 48 24 32 5 23 32", "output": "25" }, { "input": "50\n1 1 2 2 3 3 4 4 5 5 6 6 7 7 8 8 9 9 10 10 11 11 12 12 13 13 14 14 15 15 16 16 17 17 18 18 19 19 20 20 21 21 22 22 23 23 24 24 25 25 26 26 27 27 28 28 29 29 30 30 31 31 32 32 33 33 34 34 35 35 36 36 37 37 38 38 39 39 40 40 41 41 42 42 43 43 44 44 45 45 46 46 47 47 48 48 49 49 50 50", "output": "1" }, { "input": "50\n50 50 49 49 48 48 47 47 46 46 45 45 44 44 43 43 42 42 41 41 40 40 39 39 38 38 37 37 36 36 35 35 34 34 33 33 32 32 31 31 30 30 29 29 28 28 27 27 26 26 25 25 24 24 23 23 22 22 21 21 20 20 19 19 18 18 17 17 16 16 15 15 14 14 13 13 12 12 11 11 10 10 9 9 8 8 7 7 6 6 5 5 4 4 3 3 2 2 1 1", "output": "1" }, { "input": "50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50", "output": "50" }, { "input": "50\n50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "50" }, { "input": "10\n2 9 4 1 6 7 10 3 1 5 8 6 2 3 10 7 4 8 5 9", "output": "9" } ]
1,598,703,637
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
217
13,312,000
n = int(input()) socks = list(map(int, input().split())) table = [0] * n maximum = 0 temp = 0 for i in range(n): if table[socks[i] - 1] == 0: table[socks[i] - 1] = 1 temp += 1 else: temp -= 1 maximum = max(maximum, temp) print(maximum)
Title: Andryusha and Socks Time Limit: None seconds Memory Limit: None megabytes Problem Description: Andryusha is an orderly boy and likes to keep things in their place. Today he faced a problem to put his socks in the wardrobe. He has *n* distinct pairs of socks which are initially in a bag. The pairs are numbered from 1 to *n*. Andryusha wants to put paired socks together and put them in the wardrobe. He takes the socks one by one from the bag, and for each sock he looks whether the pair of this sock has been already took out of the bag, or not. If not (that means the pair of this sock is still in the bag), he puts the current socks on the table in front of him. Otherwise, he puts both socks from the pair to the wardrobe. Andryusha remembers the order in which he took the socks from the bag. Can you tell him what is the maximum number of socks that were on the table at the same time? Input Specification: The first line contains the single integer *n* (1<=≤<=*n*<=≤<=105) — the number of sock pairs. The second line contains 2*n* integers *x*1,<=*x*2,<=...,<=*x*2*n* (1<=≤<=*x**i*<=≤<=*n*), which describe the order in which Andryusha took the socks from the bag. More precisely, *x**i* means that the *i*-th sock Andryusha took out was from pair *x**i*. It is guaranteed that Andryusha took exactly two socks of each pair. Output Specification: Print single integer — the maximum number of socks that were on the table at the same time. Demo Input: ['1\n1 1\n', '3\n2 1 1 3 2 3\n'] Demo Output: ['1\n', '2\n'] Note: In the first example Andryusha took a sock from the first pair and put it on the table. Then he took the next sock which is from the first pair as well, so he immediately puts both socks to the wardrobe. Thus, at most one sock was on the table at the same time. In the second example Andryusha behaved as follows: - Initially the table was empty, he took out a sock from pair 2 and put it on the table. - Sock (2) was on the table. Andryusha took out a sock from pair 1 and put it on the table. - Socks (1, 2) were on the table. Andryusha took out a sock from pair 1, and put this pair into the wardrobe. - Sock (2) was on the table. Andryusha took out a sock from pair 3 and put it on the table. - Socks (2, 3) were on the table. Andryusha took out a sock from pair 2, and put this pair into the wardrobe. - Sock (3) was on the table. Andryusha took out a sock from pair 3 and put this pair into the wardrobe.
```python n = int(input()) socks = list(map(int, input().split())) table = [0] * n maximum = 0 temp = 0 for i in range(n): if table[socks[i] - 1] == 0: table[socks[i] - 1] = 1 temp += 1 else: temp -= 1 maximum = max(maximum, temp) print(maximum) ```
0
454
A
Little Pony and Crystal Mine
PROGRAMMING
800
[ "implementation" ]
null
null
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=&gt;<=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it. You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
Output a crystal of size *n*.
[ "3\n", "5\n", "7\n" ]
[ "*D*\nDDD\n*D*\n", "**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n", "***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n" ]
none
500
[ { "input": "3", "output": "*D*\nDDD\n*D*" }, { "input": "5", "output": "**D**\n*DDD*\nDDDDD\n*DDD*\n**D**" }, { "input": "7", "output": "***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***" }, { "input": "11", "output": "*****D*****\n****DDD****\n***DDDDD***\n**DDDDDDD**\n*DDDDDDDDD*\nDDDDDDDDDDD\n*DDDDDDDDD*\n**DDDDDDD**\n***DDDDD***\n****DDD****\n*****D*****" }, { "input": "15", "output": "*******D*******\n******DDD******\n*****DDDDD*****\n****DDDDDDD****\n***DDDDDDDDD***\n**DDDDDDDDDDD**\n*DDDDDDDDDDDDD*\nDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDD*\n**DDDDDDDDDDD**\n***DDDDDDDDD***\n****DDDDDDD****\n*****DDDDD*****\n******DDD******\n*******D*******" }, { "input": "21", "output": "**********D**********\n*********DDD*********\n********DDDDD********\n*******DDDDDDD*******\n******DDDDDDDDD******\n*****DDDDDDDDDDD*****\n****DDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDD**\n*DDDDDDDDDDDDDDDDDDD*\nDDDDDDDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDDDDDDDD*\n**DDDDDDDDDDDDDDDDD**\n***DDDDDDDDDDDDDDD***\n****DDDDDDDDDDDDD****\n*****DDDDDDDDDDD*****\n******DDDDDDDDD******\n*******DDDDDDD*******\n********DDDDD********\n*********DDD*********\n**********D**********" }, { "input": "33", "output": "****************D****************\n***************DDD***************\n**************DDDDD**************\n*************DDDDDDD*************\n************DDDDDDDDD************\n***********DDDDDDDDDDD***********\n**********DDDDDDDDDDDDD**********\n*********DDDDDDDDDDDDDDD*********\n********DDDDDDDDDDDDDDDDD********\n*******DDDDDDDDDDDDDDDDDDD*******\n******DDDDDDDDDDDDDDDDDDDDD******\n*****DDDDDDDDDDDDDDDDDDDDDDD*****\n****DDDDDDDDDDDDDDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDDDD..." }, { "input": "57", "output": "****************************D****************************\n***************************DDD***************************\n**************************DDDDD**************************\n*************************DDDDDDD*************************\n************************DDDDDDDDD************************\n***********************DDDDDDDDDDD***********************\n**********************DDDDDDDDDDDDD**********************\n*********************DDDDDDDDDDDDDDD*********************\n********************DDDDDDDDDDDDDDDDD**..." }, { "input": "69", "output": "**********************************D**********************************\n*********************************DDD*********************************\n********************************DDDDD********************************\n*******************************DDDDDDD*******************************\n******************************DDDDDDDDD******************************\n*****************************DDDDDDDDDDD*****************************\n****************************DDDDDDDDDDDDD****************************\n**************..." }, { "input": "81", "output": "****************************************D****************************************\n***************************************DDD***************************************\n**************************************DDDDD**************************************\n*************************************DDDDDDD*************************************\n************************************DDDDDDDDD************************************\n***********************************DDDDDDDDDDD***********************************\n*************..." }, { "input": "91", "output": "*********************************************D*********************************************\n********************************************DDD********************************************\n*******************************************DDDDD*******************************************\n******************************************DDDDDDD******************************************\n*****************************************DDDDDDDDD*****************************************\n****************************************DDDDDD..." }, { "input": "101", "output": "**************************************************D**************************************************\n*************************************************DDD*************************************************\n************************************************DDDDD************************************************\n***********************************************DDDDDDD***********************************************\n**********************************************DDDDDDDDD********************************************..." } ]
1,606,495,682
1,082
Python 3
OK
TESTS
12
109
307,200
import math a=int(input()) arr=[a//2] ans=[] for i in range(math.ceil(a//2)+1): trr=[] for j in range(a): if(j in arr): trr.append('D') else: trr.append("*") ans.append(trr) arr.append(arr[0]-1) arr.sort() arr.append(arr[len(arr)-1]+1) for i in ans: print(''.join(i)) ans=ans[::-1] ans.pop(0) for i in ans: print(''.join(i))
Title: Little Pony and Crystal Mine Time Limit: None seconds Memory Limit: None megabytes Problem Description: Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=&gt;<=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it. You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw. Input Specification: The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd). Output Specification: Output a crystal of size *n*. Demo Input: ['3\n', '5\n', '7\n'] Demo Output: ['*D*\nDDD\n*D*\n', '**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n', '***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n'] Note: none
```python import math a=int(input()) arr=[a//2] ans=[] for i in range(math.ceil(a//2)+1): trr=[] for j in range(a): if(j in arr): trr.append('D') else: trr.append("*") ans.append(trr) arr.append(arr[0]-1) arr.sort() arr.append(arr[len(arr)-1]+1) for i in ans: print(''.join(i)) ans=ans[::-1] ans.pop(0) for i in ans: print(''.join(i)) ```
3
679
A
Bear and Prime 100
PROGRAMMING
1,400
[ "constructive algorithms", "interactive", "math" ]
null
null
This is an interactive problem. In the output section below you will see the information about flushing the output. Bear Limak thinks of some hidden number — an integer from interval [2,<=100]. Your task is to say if the hidden number is prime or composite. Integer *x*<=&gt;<=1 is called prime if it has exactly two distinct divisors, 1 and *x*. If integer *x*<=&gt;<=1 is not prime, it's called composite. You can ask up to 20 queries about divisors of the hidden number. In each query you should print an integer from interval [2,<=100]. The system will answer "yes" if your integer is a divisor of the hidden number. Otherwise, the answer will be "no". For example, if the hidden number is 14 then the system will answer "yes" only if you print 2, 7 or 14. When you are done asking queries, print "prime" or "composite" and terminate your program. You will get the Wrong Answer verdict if you ask more than 20 queries, or if you print an integer not from the range [2,<=100]. Also, you will get the Wrong Answer verdict if the printed answer isn't correct. You will get the Idleness Limit Exceeded verdict if you don't print anything (but you should) or if you forget about flushing the output (more info below).
After each query you should read one string from the input. It will be "yes" if the printed integer is a divisor of the hidden number, and "no" otherwise.
Up to 20 times you can ask a query — print an integer from interval [2,<=100] in one line. You have to both print the end-of-line character and flush the output. After flushing you should read a response from the input. In any moment you can print the answer "prime" or "composite" (without the quotes). After that, flush the output and terminate your program. To flush you can use (just after printing an integer and end-of-line): - fflush(stdout) in C++; - System.out.flush() in Java; - stdout.flush() in Python; - flush(output) in Pascal; - See the documentation for other languages. Hacking. To hack someone, as the input you should print the hidden number — one integer from the interval [2,<=100]. Of course, his/her solution won't be able to read the hidden number from the input.
[ "yes\nno\nyes\n", "no\nyes\nno\nno\nno\n" ]
[ "2\n80\n5\ncomposite\n", "58\n59\n78\n78\n2\nprime\n" ]
The hidden number in the first query is 30. In a table below you can see a better form of the provided example of the communication process. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ea790051c34ea7d2761cd9b096412ca7c647a173.png" style="max-width: 100.0%;max-height: 100.0%;"/> The hidden number is divisible by both 2 and 5. Thus, it must be composite. Note that it isn't necessary to know the exact value of the hidden number. In this test, the hidden number is 30. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/35c6952617fa94ec3e0ea8e63aa1c3c49b3ba420.png" style="max-width: 100.0%;max-height: 100.0%;"/> 59 is a divisor of the hidden number. In the interval [2, 100] there is only one number with this divisor. The hidden number must be 59, which is prime. Note that the answer is known even after the second query and you could print it then and terminate. Though, it isn't forbidden to ask unnecessary queries (unless you exceed the limit of 20 queries).
750
[ { "input": "30", "output": "composite 4" }, { "input": "59", "output": "prime 15" }, { "input": "2", "output": "prime 16" }, { "input": "7", "output": "prime 16" }, { "input": "9", "output": "composite 3" }, { "input": "13", "output": "prime 15" }, { "input": "55", "output": "composite 6" }, { "input": "89", "output": "prime 15" }, { "input": "3", "output": "prime 16" }, { "input": "4", "output": "composite 2" }, { "input": "6", "output": "composite 4" }, { "input": "8", "output": "composite 2" }, { "input": "11", "output": "prime 15" }, { "input": "12", "output": "composite 2" }, { "input": "25", "output": "composite 4" }, { "input": "36", "output": "composite 2" }, { "input": "46", "output": "composite 10" }, { "input": "47", "output": "prime 15" }, { "input": "49", "output": "composite 5" }, { "input": "51", "output": "composite 8" }, { "input": "53", "output": "prime 15" }, { "input": "59", "output": "prime 15" }, { "input": "64", "output": "composite 2" }, { "input": "81", "output": "composite 3" }, { "input": "91", "output": "composite 7" }, { "input": "93", "output": "composite 12" }, { "input": "94", "output": "composite 16" }, { "input": "95", "output": "composite 9" }, { "input": "96", "output": "composite 2" }, { "input": "97", "output": "prime 15" }, { "input": "99", "output": "composite 3" }, { "input": "100", "output": "composite 2" }, { "input": "26", "output": "composite 7" }, { "input": "94", "output": "composite 16" }, { "input": "25", "output": "composite 4" }, { "input": "46", "output": "composite 10" }, { "input": "49", "output": "composite 5" }, { "input": "82", "output": "composite 14" }, { "input": "87", "output": "composite 11" }, { "input": "85", "output": "composite 8" }, { "input": "74", "output": "composite 13" }, { "input": "86", "output": "composite 15" }, { "input": "93", "output": "composite 12" }, { "input": "58", "output": "composite 11" }, { "input": "47", "output": "prime 15" }, { "input": "22", "output": "composite 6" }, { "input": "23", "output": "prime 15" }, { "input": "62", "output": "composite 12" }, { "input": "38", "output": "composite 9" }, { "input": "91", "output": "composite 7" }, { "input": "34", "output": "composite 8" }, { "input": "95", "output": "composite 9" }, { "input": "4", "output": "composite 2" }, { "input": "16", "output": "composite 2" }, { "input": "96", "output": "composite 2" }, { "input": "69", "output": "composite 10" }, { "input": "65", "output": "composite 7" }, { "input": "6", "output": "composite 4" }, { "input": "18", "output": "composite 4" } ]
1,678,189,771
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
2
46
0
def main(): for i in range(2, 11): print(i) query = input() if query == 'yes': print('composite') return print('prime') if __name__ == '__main__': main()
Title: Bear and Prime 100 Time Limit: None seconds Memory Limit: None megabytes Problem Description: This is an interactive problem. In the output section below you will see the information about flushing the output. Bear Limak thinks of some hidden number — an integer from interval [2,<=100]. Your task is to say if the hidden number is prime or composite. Integer *x*<=&gt;<=1 is called prime if it has exactly two distinct divisors, 1 and *x*. If integer *x*<=&gt;<=1 is not prime, it's called composite. You can ask up to 20 queries about divisors of the hidden number. In each query you should print an integer from interval [2,<=100]. The system will answer "yes" if your integer is a divisor of the hidden number. Otherwise, the answer will be "no". For example, if the hidden number is 14 then the system will answer "yes" only if you print 2, 7 or 14. When you are done asking queries, print "prime" or "composite" and terminate your program. You will get the Wrong Answer verdict if you ask more than 20 queries, or if you print an integer not from the range [2,<=100]. Also, you will get the Wrong Answer verdict if the printed answer isn't correct. You will get the Idleness Limit Exceeded verdict if you don't print anything (but you should) or if you forget about flushing the output (more info below). Input Specification: After each query you should read one string from the input. It will be "yes" if the printed integer is a divisor of the hidden number, and "no" otherwise. Output Specification: Up to 20 times you can ask a query — print an integer from interval [2,<=100] in one line. You have to both print the end-of-line character and flush the output. After flushing you should read a response from the input. In any moment you can print the answer "prime" or "composite" (without the quotes). After that, flush the output and terminate your program. To flush you can use (just after printing an integer and end-of-line): - fflush(stdout) in C++; - System.out.flush() in Java; - stdout.flush() in Python; - flush(output) in Pascal; - See the documentation for other languages. Hacking. To hack someone, as the input you should print the hidden number — one integer from the interval [2,<=100]. Of course, his/her solution won't be able to read the hidden number from the input. Demo Input: ['yes\nno\nyes\n', 'no\nyes\nno\nno\nno\n'] Demo Output: ['2\n80\n5\ncomposite\n', '58\n59\n78\n78\n2\nprime\n'] Note: The hidden number in the first query is 30. In a table below you can see a better form of the provided example of the communication process. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ea790051c34ea7d2761cd9b096412ca7c647a173.png" style="max-width: 100.0%;max-height: 100.0%;"/> The hidden number is divisible by both 2 and 5. Thus, it must be composite. Note that it isn't necessary to know the exact value of the hidden number. In this test, the hidden number is 30. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/35c6952617fa94ec3e0ea8e63aa1c3c49b3ba420.png" style="max-width: 100.0%;max-height: 100.0%;"/> 59 is a divisor of the hidden number. In the interval [2, 100] there is only one number with this divisor. The hidden number must be 59, which is prime. Note that the answer is known even after the second query and you could print it then and terminate. Though, it isn't forbidden to ask unnecessary queries (unless you exceed the limit of 20 queries).
```python def main(): for i in range(2, 11): print(i) query = input() if query == 'yes': print('composite') return print('prime') if __name__ == '__main__': main() ```
0
479
A
Expression
PROGRAMMING
1,000
[ "brute force", "math" ]
null
null
Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets: - 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9 Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2. It's easy to see that the maximum value that you can obtain is 9. Your task is: given *a*, *b* and *c* print the maximum value that you can get.
The input contains three integers *a*, *b* and *c*, each on a single line (1<=≤<=*a*,<=*b*,<=*c*<=≤<=10).
Print the maximum value of the expression that you can obtain.
[ "1\n2\n3\n", "2\n10\n3\n" ]
[ "9\n", "60\n" ]
none
500
[ { "input": "1\n2\n3", "output": "9" }, { "input": "2\n10\n3", "output": "60" }, { "input": "1\n1\n1", "output": "3" }, { "input": "1\n2\n1", "output": "4" }, { "input": "10\n10\n10", "output": "1000" }, { "input": "5\n1\n3", "output": "20" }, { "input": "3\n1\n5", "output": "20" }, { "input": "6\n7\n1", "output": "48" }, { "input": "1\n8\n3", "output": "27" }, { "input": "9\n7\n2", "output": "126" }, { "input": "1\n1\n10", "output": "20" }, { "input": "9\n1\n1", "output": "18" }, { "input": "10\n5\n6", "output": "300" }, { "input": "8\n9\n7", "output": "504" }, { "input": "4\n2\n10", "output": "80" }, { "input": "2\n8\n3", "output": "48" }, { "input": "3\n5\n7", "output": "105" }, { "input": "1\n10\n1", "output": "12" }, { "input": "2\n2\n2", "output": "8" }, { "input": "5\n6\n1", "output": "35" }, { "input": "10\n1\n1", "output": "20" }, { "input": "1\n6\n1", "output": "8" }, { "input": "1\n9\n1", "output": "11" }, { "input": "2\n1\n2", "output": "6" }, { "input": "2\n6\n1", "output": "14" }, { "input": "9\n2\n1", "output": "27" }, { "input": "1\n9\n2", "output": "20" }, { "input": "1\n3\n1", "output": "5" }, { "input": "2\n1\n1", "output": "4" } ]
1,694,013,974
2,147,483,647
PyPy 3-64
OK
TESTS
29
62
0
a, b, c = map(int, [input() for i in range(3)]) result = max(a+b+c, a+b*c, a*b*c, a*b+c, a*(b+c), (a+b)*c) print(result)
Title: Expression Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets: - 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9 Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2. It's easy to see that the maximum value that you can obtain is 9. Your task is: given *a*, *b* and *c* print the maximum value that you can get. Input Specification: The input contains three integers *a*, *b* and *c*, each on a single line (1<=≤<=*a*,<=*b*,<=*c*<=≤<=10). Output Specification: Print the maximum value of the expression that you can obtain. Demo Input: ['1\n2\n3\n', '2\n10\n3\n'] Demo Output: ['9\n', '60\n'] Note: none
```python a, b, c = map(int, [input() for i in range(3)]) result = max(a+b+c, a+b*c, a*b*c, a*b+c, a*(b+c), (a+b)*c) print(result) ```
3
404
C
Restore Graph
PROGRAMMING
1,800
[ "dfs and similar", "graphs", "sortings" ]
null
null
Valera had an undirected connected graph without self-loops and multiple edges consisting of *n* vertices. The graph had an interesting property: there were at most *k* edges adjacent to each of its vertices. For convenience, we will assume that the graph vertices were indexed by integers from 1 to *n*. One day Valera counted the shortest distances from one of the graph vertices to all other ones and wrote them out in array *d*. Thus, element *d*[*i*] of the array shows the shortest distance from the vertex Valera chose to vertex number *i*. Then something irreparable terrible happened. Valera lost the initial graph. However, he still has the array *d*. Help him restore the lost graph.
The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=&lt;<=*n*<=≤<=105). Number *n* shows the number of vertices in the original graph. Number *k* shows that at most *k* edges were adjacent to each vertex in the original graph. The second line contains space-separated integers *d*[1],<=*d*[2],<=...,<=*d*[*n*] (0<=≤<=*d*[*i*]<=&lt;<=*n*). Number *d*[*i*] shows the shortest distance from the vertex Valera chose to the vertex number *i*.
If Valera made a mistake in his notes and the required graph doesn't exist, print in the first line number -1. Otherwise, in the first line print integer *m* (0<=≤<=*m*<=≤<=106) — the number of edges in the found graph. In each of the next *m* lines print two space-separated integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*; *a**i*<=≠<=*b**i*), denoting the edge that connects vertices with numbers *a**i* and *b**i*. The graph shouldn't contain self-loops and multiple edges. If there are multiple possible answers, print any of them.
[ "3 2\n0 1 1\n", "4 2\n2 0 1 3\n", "3 1\n0 0 0\n" ]
[ "3\n1 2\n1 3\n3 2\n", "3\n1 3\n1 4\n2 3\n", "-1\n" ]
none
1,500
[ { "input": "3 2\n0 1 1", "output": "2\n1 2\n1 3" }, { "input": "4 2\n2 0 1 3", "output": "3\n1 3\n1 4\n2 3" }, { "input": "3 1\n0 0 0", "output": "-1" }, { "input": "5 3\n0 2 1 2 1", "output": "4\n1 3\n1 5\n2 5\n4 5" }, { "input": "7 3\n2 2 0 1 3 2 1", "output": "6\n1 7\n2 7\n3 4\n3 7\n4 6\n5 6" }, { "input": "9 4\n2 1 1 3 1 2 2 1 0", "output": "8\n1 8\n2 9\n3 9\n4 7\n5 9\n6 8\n7 8\n8 9" }, { "input": "3 1\n0 1 2", "output": "-1" }, { "input": "2 1\n1 0", "output": "1\n1 2" }, { "input": "2 1\n1 1", "output": "-1" }, { "input": "2 1\n0 0", "output": "-1" }, { "input": "4 2\n0 1 0 1", "output": "-1" }, { "input": "5 3\n3 1 4 2 1", "output": "-1" }, { "input": "5 4\n1 2 2 2 3", "output": "-1" }, { "input": "4 3\n1 1 1 2", "output": "-1" }, { "input": "4 3\n1 2 2 3", "output": "-1" }, { "input": "4 3\n1 2 3 3", "output": "-1" }, { "input": "7 6\n1 1 2 2 3 3 3", "output": "-1" }, { "input": "10 5\n0 1 1 1 1 1 1 2 2 2", "output": "-1" }, { "input": "5 4\n0 1 1 1 4", "output": "-1" } ]
1,599,056,182
2,147,483,647
PyPy 3
RUNTIME_ERROR
TESTS
2
187
2,457,600
#!/usr/bin/env python3 # created : 2020. 9. 1. 22:40 import os from sys import stdin, stdout from collections import deque def solve(tc): n, k = map(int, stdin.readline().split()) dseq = list(map(int, stdin.readline().split())) idx = list(range(n)) idx = sorted(idx, key=lambda x: dseq[x]) i = 0 while dseq[idx[i]] == 0: i += 1 if i == 0 or i > 1: print(-1) return ans = [] ok = True cnt = 0 queue = deque() queue.append([idx[0], 0]) par = queue.popleft() while i < n: if dseq[idx[i]] <= par[1]: ok = False break elif dseq[idx[i]] == par[1]+1: ans.append([par[0]+1, idx[i]+1]) queue.append([idx[i], par[1]+1]) cnt += 1 if cnt == k: if len(queue)==0: ok = False break par = queue.popleft() cnt = 0 else: if len(queue): par = queue.popleft() continue else: ok = False break i += 1 if not ok: print(-1) return print(len(ans)) for a, b in ans: print(a,b) tcs = 1 tc = 1 while tc <= tcs: solve(tc) tc += 1
Title: Restore Graph Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera had an undirected connected graph without self-loops and multiple edges consisting of *n* vertices. The graph had an interesting property: there were at most *k* edges adjacent to each of its vertices. For convenience, we will assume that the graph vertices were indexed by integers from 1 to *n*. One day Valera counted the shortest distances from one of the graph vertices to all other ones and wrote them out in array *d*. Thus, element *d*[*i*] of the array shows the shortest distance from the vertex Valera chose to vertex number *i*. Then something irreparable terrible happened. Valera lost the initial graph. However, he still has the array *d*. Help him restore the lost graph. Input Specification: The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=&lt;<=*n*<=≤<=105). Number *n* shows the number of vertices in the original graph. Number *k* shows that at most *k* edges were adjacent to each vertex in the original graph. The second line contains space-separated integers *d*[1],<=*d*[2],<=...,<=*d*[*n*] (0<=≤<=*d*[*i*]<=&lt;<=*n*). Number *d*[*i*] shows the shortest distance from the vertex Valera chose to the vertex number *i*. Output Specification: If Valera made a mistake in his notes and the required graph doesn't exist, print in the first line number -1. Otherwise, in the first line print integer *m* (0<=≤<=*m*<=≤<=106) — the number of edges in the found graph. In each of the next *m* lines print two space-separated integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*; *a**i*<=≠<=*b**i*), denoting the edge that connects vertices with numbers *a**i* and *b**i*. The graph shouldn't contain self-loops and multiple edges. If there are multiple possible answers, print any of them. Demo Input: ['3 2\n0 1 1\n', '4 2\n2 0 1 3\n', '3 1\n0 0 0\n'] Demo Output: ['3\n1 2\n1 3\n3 2\n', '3\n1 3\n1 4\n2 3\n', '-1\n'] Note: none
```python #!/usr/bin/env python3 # created : 2020. 9. 1. 22:40 import os from sys import stdin, stdout from collections import deque def solve(tc): n, k = map(int, stdin.readline().split()) dseq = list(map(int, stdin.readline().split())) idx = list(range(n)) idx = sorted(idx, key=lambda x: dseq[x]) i = 0 while dseq[idx[i]] == 0: i += 1 if i == 0 or i > 1: print(-1) return ans = [] ok = True cnt = 0 queue = deque() queue.append([idx[0], 0]) par = queue.popleft() while i < n: if dseq[idx[i]] <= par[1]: ok = False break elif dseq[idx[i]] == par[1]+1: ans.append([par[0]+1, idx[i]+1]) queue.append([idx[i], par[1]+1]) cnt += 1 if cnt == k: if len(queue)==0: ok = False break par = queue.popleft() cnt = 0 else: if len(queue): par = queue.popleft() continue else: ok = False break i += 1 if not ok: print(-1) return print(len(ans)) for a, b in ans: print(a,b) tcs = 1 tc = 1 while tc <= tcs: solve(tc) tc += 1 ```
-1
625
A
Guest From the Past
PROGRAMMING
1,700
[ "implementation", "math" ]
null
null
Kolya Gerasimov loves kefir very much. He lives in year 1984 and knows all the details of buying this delicious drink. One day, as you probably know, he found himself in year 2084, and buying kefir there is much more complicated. Kolya is hungry, so he went to the nearest milk shop. In 2084 you may buy kefir in a plastic liter bottle, that costs *a* rubles, or in glass liter bottle, that costs *b* rubles. Also, you may return empty glass bottle and get *c* (*c*<=&lt;<=*b*) rubles back, but you cannot return plastic bottles. Kolya has *n* rubles and he is really hungry, so he wants to drink as much kefir as possible. There were no plastic bottles in his 1984, so Kolya doesn't know how to act optimally and asks for your help.
First line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1018) — the number of rubles Kolya has at the beginning. Then follow three lines containing integers *a*, *b* and *c* (1<=≤<=*a*<=≤<=1018, 1<=≤<=*c*<=&lt;<=*b*<=≤<=1018) — the cost of one plastic liter bottle, the cost of one glass liter bottle and the money one can get back by returning an empty glass bottle, respectively.
Print the only integer — maximum number of liters of kefir, that Kolya can drink.
[ "10\n11\n9\n8\n", "10\n5\n6\n1\n" ]
[ "2\n", "2\n" ]
In the first sample, Kolya can buy one glass bottle, then return it and buy one more glass bottle. Thus he will drink 2 liters of kefir. In the second sample, Kolya can buy two plastic bottle and get two liters of kefir, or he can buy one liter glass bottle, then return it and buy one plastic bottle. In both cases he will drink two liters of kefir.
750
[ { "input": "10\n11\n9\n8", "output": "2" }, { "input": "10\n5\n6\n1", "output": "2" }, { "input": "2\n2\n2\n1", "output": "1" }, { "input": "10\n3\n3\n1", "output": "4" }, { "input": "10\n1\n2\n1", "output": "10" }, { "input": "10\n2\n3\n1", "output": "5" }, { "input": "9\n2\n4\n1", "output": "4" }, { "input": "9\n2\n2\n1", "output": "8" }, { "input": "9\n10\n10\n1", "output": "0" }, { "input": "10\n2\n2\n1", "output": "9" }, { "input": "1000000000000000000\n2\n10\n9", "output": "999999999999999995" }, { "input": "501000000000000000\n300000000000000000\n301000000000000000\n100000000000000000", "output": "2" }, { "input": "10\n1\n9\n8", "output": "10" }, { "input": "10\n8\n8\n7", "output": "3" }, { "input": "10\n5\n5\n1", "output": "2" }, { "input": "29\n3\n3\n1", "output": "14" }, { "input": "45\n9\n9\n8", "output": "37" }, { "input": "45\n9\n9\n1", "output": "5" }, { "input": "100\n10\n10\n9", "output": "91" }, { "input": "179\n10\n9\n1", "output": "22" }, { "input": "179\n2\n2\n1", "output": "178" }, { "input": "179\n179\n179\n1", "output": "1" }, { "input": "179\n59\n59\n58", "output": "121" }, { "input": "500\n250\n250\n1", "output": "2" }, { "input": "500\n1\n250\n1", "output": "500" }, { "input": "501\n500\n500\n499", "output": "2" }, { "input": "501\n450\n52\n1", "output": "9" }, { "input": "501\n300\n301\n100", "output": "2" }, { "input": "500\n179\n10\n1", "output": "55" }, { "input": "1000\n500\n10\n9", "output": "991" }, { "input": "1000\n2\n10\n9", "output": "995" }, { "input": "1001\n1000\n1000\n999", "output": "2" }, { "input": "10000\n10000\n10000\n1", "output": "1" }, { "input": "10000\n10\n5000\n4999", "output": "5500" }, { "input": "1000000000\n999999998\n999999999\n999999998", "output": "3" }, { "input": "1000000000\n50\n50\n49", "output": "999999951" }, { "input": "1000000000\n500\n5000\n4999", "output": "999995010" }, { "input": "1000000000\n51\n100\n98", "output": "499999952" }, { "input": "1000000000\n100\n51\n50", "output": "999999950" }, { "input": "1000000000\n2\n5\n4", "output": "999999998" }, { "input": "1000000000000000000\n999999998000000000\n999999999000000000\n999999998000000000", "output": "3" }, { "input": "1000000000\n2\n2\n1", "output": "999999999" }, { "input": "999999999\n2\n999999998\n1", "output": "499999999" }, { "input": "999999999999999999\n2\n2\n1", "output": "999999999999999998" }, { "input": "999999999999999999\n10\n10\n9", "output": "999999999999999990" }, { "input": "999999999999999999\n999999999999999998\n999999999999999998\n999999999999999997", "output": "2" }, { "input": "999999999999999999\n501\n501\n1", "output": "1999999999999999" }, { "input": "999999999999999999\n2\n50000000000000000\n49999999999999999", "output": "974999999999999999" }, { "input": "999999999999999999\n180\n180\n1", "output": "5586592178770949" }, { "input": "1000000000000000000\n42\n41\n1", "output": "24999999999999999" }, { "input": "1000000000000000000\n41\n40\n1", "output": "25641025641025641" }, { "input": "100000000000000000\n79\n100\n25", "output": "1333333333333333" }, { "input": "1\n100\n5\n4", "output": "0" }, { "input": "1000000000000000000\n1000000000000000000\n10000000\n9999999", "output": "999999999990000001" }, { "input": "999999999999999999\n999999999000000000\n900000000000000000\n899999999999999999", "output": "100000000000000000" }, { "input": "13\n10\n15\n11", "output": "1" }, { "input": "1\n1000\n5\n4", "output": "0" }, { "input": "10\n100\n10\n1", "output": "1" }, { "input": "3\n2\n100000\n99999", "output": "1" }, { "input": "4\n2\n4\n2", "output": "2" }, { "input": "5\n3\n6\n4", "output": "1" }, { "input": "1\n7\n65\n49", "output": "0" }, { "input": "10\n20\n100\n99", "output": "0" }, { "input": "10000000000\n10000000000\n9000000000\n8999999999", "output": "1000000001" }, { "input": "90\n30\n101\n100", "output": "3" }, { "input": "999999999999999\n5\n500000000000000\n499999999999999", "output": "599999999999999" }, { "input": "1000000000000000000\n1000000000000000000\n1000000000\n999999999", "output": "999999999000000001" }, { "input": "1\n1000000000000000000\n1000000000\n999999999", "output": "0" }, { "input": "100000000000000000\n100000000000000000\n1000000000\n999999999", "output": "99999999000000001" }, { "input": "100000000000000009\n100\n1000000000000000\n999999999999999", "output": "99010000000000009" }, { "input": "10\n20\n10\n9", "output": "1" }, { "input": "10\n4\n14\n13", "output": "2" }, { "input": "11\n3\n9\n7", "output": "4" }, { "input": "1000000000\n5\n7\n4", "output": "333333332" }, { "input": "12155\n1943\n28717\n24074", "output": "6" }, { "input": "1000000000000000000\n10\n20\n5", "output": "100000000000000000" }, { "input": "98\n33\n440\n314", "output": "2" }, { "input": "1070252292\n57449678\n237309920\n221182550", "output": "56" }, { "input": "100\n3\n102\n101", "output": "33" }, { "input": "100000000000000000\n100000000000000001\n1000000000000000\n999999999999999", "output": "99000000000000001" }, { "input": "66249876257975628\n302307316\n406102416\n182373516", "output": "296116756" }, { "input": "10\n5\n10\n1", "output": "2" }, { "input": "1000000000000000000\n10\n1000000000\n999999998", "output": "499999999600000000" } ]
1,594,014,117
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
52
155
20,172,800
import math as ma n=int(input()) a=int(input()) b=int(input()) c=int(input()) if a<=b-c: print(n//a) else: d=(n-b)//(b-c)+1 n=n-d*(b-c) d+=n//a print(d)
Title: Guest From the Past Time Limit: None seconds Memory Limit: None megabytes Problem Description: Kolya Gerasimov loves kefir very much. He lives in year 1984 and knows all the details of buying this delicious drink. One day, as you probably know, he found himself in year 2084, and buying kefir there is much more complicated. Kolya is hungry, so he went to the nearest milk shop. In 2084 you may buy kefir in a plastic liter bottle, that costs *a* rubles, or in glass liter bottle, that costs *b* rubles. Also, you may return empty glass bottle and get *c* (*c*<=&lt;<=*b*) rubles back, but you cannot return plastic bottles. Kolya has *n* rubles and he is really hungry, so he wants to drink as much kefir as possible. There were no plastic bottles in his 1984, so Kolya doesn't know how to act optimally and asks for your help. Input Specification: First line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1018) — the number of rubles Kolya has at the beginning. Then follow three lines containing integers *a*, *b* and *c* (1<=≤<=*a*<=≤<=1018, 1<=≤<=*c*<=&lt;<=*b*<=≤<=1018) — the cost of one plastic liter bottle, the cost of one glass liter bottle and the money one can get back by returning an empty glass bottle, respectively. Output Specification: Print the only integer — maximum number of liters of kefir, that Kolya can drink. Demo Input: ['10\n11\n9\n8\n', '10\n5\n6\n1\n'] Demo Output: ['2\n', '2\n'] Note: In the first sample, Kolya can buy one glass bottle, then return it and buy one more glass bottle. Thus he will drink 2 liters of kefir. In the second sample, Kolya can buy two plastic bottle and get two liters of kefir, or he can buy one liter glass bottle, then return it and buy one plastic bottle. In both cases he will drink two liters of kefir.
```python import math as ma n=int(input()) a=int(input()) b=int(input()) c=int(input()) if a<=b-c: print(n//a) else: d=(n-b)//(b-c)+1 n=n-d*(b-c) d+=n//a print(d) ```
0
381
A
Sereja and Dima
PROGRAMMING
800
[ "greedy", "implementation", "two pointers" ]
null
null
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins. Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move. Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
[ "4\n4 1 2 10\n", "7\n1 2 3 4 5 6 7\n" ]
[ "12 5\n", "16 12\n" ]
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
500
[ { "input": "4\n4 1 2 10", "output": "12 5" }, { "input": "7\n1 2 3 4 5 6 7", "output": "16 12" }, { "input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13", "output": "613 418" }, { "input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24", "output": "644 500" }, { "input": "1\n3", "output": "3 0" }, { "input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646", "output": "6848 6568" }, { "input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727", "output": "9562 9561" }, { "input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12", "output": "315 315" }, { "input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304", "output": "3238 2222" }, { "input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325", "output": "5246 4864" }, { "input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71", "output": "8147 7807" }, { "input": "1\n1", "output": "1 0" } ]
1,672,546,868
2,147,483,647
Python 3
OK
TESTS
34
46
0
n = int(input()) li = list(map(int, input().split())) s = 0 d = 0 i = 1 j = 0 k = n-1 while j <= k and i <= n: if li[j] > li[k]: if i%2==0: d += li[j] else: s += li[j] j += 1 else: if i%2==0: d += li[k] else: s += li[k] k -= 1 i += 1 print(s, d)
Title: Sereja and Dima Time Limit: None seconds Memory Limit: None megabytes Problem Description: Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins. Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move. Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000. Output Specification: On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game. Demo Input: ['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n'] Demo Output: ['12 5\n', '16 12\n'] Note: In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
```python n = int(input()) li = list(map(int, input().split())) s = 0 d = 0 i = 1 j = 0 k = n-1 while j <= k and i <= n: if li[j] > li[k]: if i%2==0: d += li[j] else: s += li[j] j += 1 else: if i%2==0: d += li[k] else: s += li[k] k -= 1 i += 1 print(s, d) ```
3
383
D
Antimatter
PROGRAMMING
2,300
[ "dp" ]
null
null
Iahub accidentally discovered a secret lab. He found there *n* devices ordered in a line, numbered from 1 to *n* from left to right. Each device *i* (1<=≤<=*i*<=≤<=*n*) can create either *a**i* units of matter or *a**i* units of antimatter. Iahub wants to choose some contiguous subarray of devices in the lab, specify the production mode for each of them (produce matter or antimatter) and finally take a photo of it. However he will be successful only if the amounts of matter and antimatter produced in the selected subarray will be the same (otherwise there would be overflowing matter or antimatter in the photo). You are requested to compute the number of different ways Iahub can successful take a photo. A photo is different than another if it represents another subarray, or if at least one device of the subarray is set to produce matter in one of the photos and antimatter in the other one.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=1000). The sum *a*1<=+<=*a*2<=+<=...<=+<=*a**n* will be less than or equal to 10000.
Output a single integer, the number of ways Iahub can take a photo, modulo 1000000007 (109<=+<=7).
[ "4\n1 1 1 1\n" ]
[ "12\n" ]
The possible photos are [1+, 2-], [1-, 2+], [2+, 3-], [2-, 3+], [3+, 4-], [3-, 4+], [1+, 2+, 3-, 4-], [1+, 2-, 3+, 4-], [1+, 2-, 3-, 4+], [1-, 2+, 3+, 4-], [1-, 2+, 3-, 4+] and [1-, 2-, 3+, 4+], where "*i*+" means that the *i*-th element produces matter, and "*i*-" means that the *i*-th element produces antimatter.
2,000
[ { "input": "4\n1 1 1 1", "output": "12" }, { "input": "10\n16 9 9 11 10 12 9 6 10 8", "output": "86" }, { "input": "50\n2 1 5 2 1 3 1 2 3 2 1 1 5 2 2 2 3 2 1 2 2 2 3 3 1 3 1 1 2 2 2 2 1 2 3 1 2 4 1 1 1 3 2 1 1 1 3 2 1 3", "output": "115119382" }, { "input": "100\n8 3 3 7 3 6 4 6 9 4 6 5 5 5 4 3 4 2 3 5 3 6 5 3 6 5 6 6 2 6 4 5 5 4 6 4 3 2 8 5 6 6 7 4 4 9 5 6 6 3 7 1 6 2 6 5 9 3 8 6 2 6 3 2 4 4 3 5 4 7 6 5 4 6 3 5 6 8 8 6 3 7 7 1 4 6 8 6 5 3 7 8 4 7 5 3 8 5 4 4", "output": "450259307" }, { "input": "250\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "533456111" }, { "input": "250\n6 1 4 3 3 7 4 5 3 2 4 4 2 5 4 2 1 7 6 2 4 5 3 3 4 5 3 4 5 4 6 4 6 5 3 3 1 5 4 5 3 4 2 4 2 5 1 4 3 3 3 2 6 6 4 7 2 6 5 3 3 6 5 2 1 3 3 5 2 2 3 7 3 5 6 4 7 3 5 3 4 5 5 4 11 5 1 5 3 3 3 1 4 6 4 4 5 5 5 5 2 5 5 3 2 2 5 6 10 5 4 2 5 4 2 5 5 3 4 2 5 4 3 2 4 4 2 5 4 1 5 3 9 6 4 6 3 5 4 5 3 6 7 4 5 5 3 6 2 6 3 3 4 5 6 3 3 3 5 2 4 4 4 5 4 2 5 4 6 5 3 3 6 3 1 5 6 5 4 6 2 3 4 4 5 2 1 7 4 5 5 5 2 2 7 6 1 5 3 2 7 5 8 2 2 2 3 5 2 4 4 2 2 6 4 6 3 2 8 3 4 7 3 2 7 3 5 5 3 2 2 4 5 3 4 3 5 3 5 4 3 1 2 4 7 4 2 3 3 5", "output": "377970747" }, { "input": "250\n2 2 2 2 3 2 4 2 3 2 5 1 2 3 4 4 5 3 5 1 2 5 2 3 5 3 2 3 3 3 5 1 5 5 5 4 1 3 2 5 1 2 3 5 3 3 5 2 1 1 3 3 5 1 4 2 3 3 2 2 3 5 5 4 1 4 1 5 1 3 3 4 1 5 2 5 5 3 2 4 4 4 4 3 5 1 3 4 3 4 2 1 4 3 5 1 2 3 4 2 5 5 3 2 5 3 5 4 2 3 2 3 1 1 2 4 2 5 2 3 3 2 4 5 4 2 2 5 5 5 5 4 3 4 5 2 2 3 3 4 5 1 5 5 2 5 1 5 5 4 4 1 4 2 1 2 1 2 2 3 1 4 5 4 2 4 5 1 1 3 2 1 4 1 5 2 3 1 2 3 2 3 3 2 4 2 5 5 2 3 4 2 2 4 2 4 1 5 5 3 1 3 4 5 2 5 5 1 3 1 3 3 2 5 3 5 2 4 3 5 5 3 3 2 3 2 5 3 4 3 5 3 3 4 5 3 1 2 2 5 4 4 5 1 4 1 2 5 2 3", "output": "257270797" }, { "input": "1\n1", "output": "0" }, { "input": "2\n1 1", "output": "2" }, { "input": "2\n1000 1000", "output": "2" }, { "input": "2\n1 2", "output": "0" }, { "input": "3\n1 2 4", "output": "0" }, { "input": "3\n1 2 2", "output": "2" }, { "input": "1\n1000", "output": "0" }, { "input": "3\n999 999 999", "output": "4" } ]
1,538,597,403
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
2
1,000
18,432,000
# http://codeforces.com/contest/383/problem/D from sys import stdin M = 10000 def read_input(): n = int(stdin.readline()) devices = [int(x) for x in stdin.readline().split()] return n, devices if __name__ == "__main__": n, devices = read_input() res = [{} for _ in range(n+1)] for nb, val in enumerate(devices, 1): for i in range(-M, M, 1): if i - val >= -M: res[nb][i-val] = res[nb].get(i-val,0) + res[nb-1].get(i, 0) if i + val <= M: res[nb][i+val] = res[nb].get(i+val,0)+ res[nb-1].get(i, 0) res[nb][val] += 1 res[nb][-val] += 1 print(sum([el.get(0, 0) for el in res]))
Title: Antimatter Time Limit: None seconds Memory Limit: None megabytes Problem Description: Iahub accidentally discovered a secret lab. He found there *n* devices ordered in a line, numbered from 1 to *n* from left to right. Each device *i* (1<=≤<=*i*<=≤<=*n*) can create either *a**i* units of matter or *a**i* units of antimatter. Iahub wants to choose some contiguous subarray of devices in the lab, specify the production mode for each of them (produce matter or antimatter) and finally take a photo of it. However he will be successful only if the amounts of matter and antimatter produced in the selected subarray will be the same (otherwise there would be overflowing matter or antimatter in the photo). You are requested to compute the number of different ways Iahub can successful take a photo. A photo is different than another if it represents another subarray, or if at least one device of the subarray is set to produce matter in one of the photos and antimatter in the other one. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=1000). The sum *a*1<=+<=*a*2<=+<=...<=+<=*a**n* will be less than or equal to 10000. Output Specification: Output a single integer, the number of ways Iahub can take a photo, modulo 1000000007 (109<=+<=7). Demo Input: ['4\n1 1 1 1\n'] Demo Output: ['12\n'] Note: The possible photos are [1+, 2-], [1-, 2+], [2+, 3-], [2-, 3+], [3+, 4-], [3-, 4+], [1+, 2+, 3-, 4-], [1+, 2-, 3+, 4-], [1+, 2-, 3-, 4+], [1-, 2+, 3+, 4-], [1-, 2+, 3-, 4+] and [1-, 2-, 3+, 4+], where "*i*+" means that the *i*-th element produces matter, and "*i*-" means that the *i*-th element produces antimatter.
```python # http://codeforces.com/contest/383/problem/D from sys import stdin M = 10000 def read_input(): n = int(stdin.readline()) devices = [int(x) for x in stdin.readline().split()] return n, devices if __name__ == "__main__": n, devices = read_input() res = [{} for _ in range(n+1)] for nb, val in enumerate(devices, 1): for i in range(-M, M, 1): if i - val >= -M: res[nb][i-val] = res[nb].get(i-val,0) + res[nb-1].get(i, 0) if i + val <= M: res[nb][i+val] = res[nb].get(i+val,0)+ res[nb-1].get(i, 0) res[nb][val] += 1 res[nb][-val] += 1 print(sum([el.get(0, 0) for el in res])) ```
0
519
B
A and B and Compilation Errors
PROGRAMMING
1,100
[ "data structures", "implementation", "sortings" ]
null
null
A and B are preparing themselves for programming contests. B loves to debug his code. But before he runs the solution and starts debugging, he has to first compile the code. Initially, the compiler displayed *n* compilation errors, each of them is represented as a positive integer. After some effort, B managed to fix some mistake and then another one mistake. However, despite the fact that B is sure that he corrected the two errors, he can not understand exactly what compilation errors disappeared — the compiler of the language which B uses shows errors in the new order every time! B is sure that unlike many other programming languages, compilation errors for his programming language do not depend on each other, that is, if you correct one error, the set of other error does not change. Can you help B find out exactly what two errors he corrected?
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=105) — the initial number of compilation errors. The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the errors the compiler displayed for the first time. The third line contains *n*<=-<=1 space-separated integers *b*1,<=*b*2,<=...,<=*b**n*<=-<=1 — the errors displayed at the second compilation. It is guaranteed that the sequence in the third line contains all numbers of the second string except for exactly one. The fourth line contains *n*<=-<=2 space-separated integers *с*1,<=*с*2,<=...,<=*с**n*<=-<=2 — the errors displayed at the third compilation. It is guaranteed that the sequence in the fourth line contains all numbers of the third line except for exactly one.
Print two numbers on a single line: the numbers of the compilation errors that disappeared after B made the first and the second correction, respectively.
[ "5\n1 5 8 123 7\n123 7 5 1\n5 1 7\n", "6\n1 4 3 3 5 7\n3 7 5 4 3\n4 3 7 5\n" ]
[ "8\n123\n", "1\n3\n" ]
In the first test sample B first corrects the error number 8, then the error number 123. In the second test sample B first corrects the error number 1, then the error number 3. Note that if there are multiple errors with the same number, B can correct only one of them in one step.
1,000
[ { "input": "5\n1 5 8 123 7\n123 7 5 1\n5 1 7", "output": "8\n123" }, { "input": "6\n1 4 3 3 5 7\n3 7 5 4 3\n4 3 7 5", "output": "1\n3" }, { "input": "3\n1 2 3\n3 2\n2", "output": "1\n3" }, { "input": "10\n460626451 802090732 277246428 661369649 388684428 784303821 376287098 656422756 9301599 25720377\n277246428 388684428 661369649 460626451 656422756 802090732 9301599 784303821 376287098\n376287098 802090732 388684428 9301599 656422756 784303821 460626451 277246428", "output": "25720377\n661369649" }, { "input": "3\n796067435 964699482 819602309\n964699482 796067435\n964699482", "output": "819602309\n796067435" }, { "input": "3\n374054998 726316780 902899520\n902899520 726316780\n726316780", "output": "374054998\n902899520" }, { "input": "3\n168638990 939116221 323703261\n168638990 323703261\n168638990", "output": "939116221\n323703261" }, { "input": "3\n77 77 77\n77 77\n77", "output": "77\n77" }, { "input": "3\n84 30 9\n9 84\n9", "output": "30\n84" }, { "input": "6\n5 4 3 3 5 5\n3 5 5 4 3\n3 5 4 3", "output": "5\n5" }, { "input": "4\n1 5 7 8\n1 5 7\n1 5", "output": "8\n7" } ]
1,680,556,916
2,147,483,647
Python 3
OK
TESTS
33
171
14,438,400
n = int(input()) e1 = [int(e) for e in input().split()] e2 = [int(e) for e in input().split()] e3 = [int(e) for e in input().split()] primeiro, segundo, terceiro = sum(e1), sum(e2), sum(e3) print(abs(segundo - primeiro)) print(abs(terceiro - segundo))
Title: A and B and Compilation Errors Time Limit: None seconds Memory Limit: None megabytes Problem Description: A and B are preparing themselves for programming contests. B loves to debug his code. But before he runs the solution and starts debugging, he has to first compile the code. Initially, the compiler displayed *n* compilation errors, each of them is represented as a positive integer. After some effort, B managed to fix some mistake and then another one mistake. However, despite the fact that B is sure that he corrected the two errors, he can not understand exactly what compilation errors disappeared — the compiler of the language which B uses shows errors in the new order every time! B is sure that unlike many other programming languages, compilation errors for his programming language do not depend on each other, that is, if you correct one error, the set of other error does not change. Can you help B find out exactly what two errors he corrected? Input Specification: The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=105) — the initial number of compilation errors. The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the errors the compiler displayed for the first time. The third line contains *n*<=-<=1 space-separated integers *b*1,<=*b*2,<=...,<=*b**n*<=-<=1 — the errors displayed at the second compilation. It is guaranteed that the sequence in the third line contains all numbers of the second string except for exactly one. The fourth line contains *n*<=-<=2 space-separated integers *с*1,<=*с*2,<=...,<=*с**n*<=-<=2 — the errors displayed at the third compilation. It is guaranteed that the sequence in the fourth line contains all numbers of the third line except for exactly one. Output Specification: Print two numbers on a single line: the numbers of the compilation errors that disappeared after B made the first and the second correction, respectively. Demo Input: ['5\n1 5 8 123 7\n123 7 5 1\n5 1 7\n', '6\n1 4 3 3 5 7\n3 7 5 4 3\n4 3 7 5\n'] Demo Output: ['8\n123\n', '1\n3\n'] Note: In the first test sample B first corrects the error number 8, then the error number 123. In the second test sample B first corrects the error number 1, then the error number 3. Note that if there are multiple errors with the same number, B can correct only one of them in one step.
```python n = int(input()) e1 = [int(e) for e in input().split()] e2 = [int(e) for e in input().split()] e3 = [int(e) for e in input().split()] primeiro, segundo, terceiro = sum(e1), sum(e2), sum(e3) print(abs(segundo - primeiro)) print(abs(terceiro - segundo)) ```
3
447
A
DZY Loves Hash
PROGRAMMING
800
[ "implementation" ]
null
null
DZY has a hash table with *p* buckets, numbered from 0 to *p*<=-<=1. He wants to insert *n* numbers, in the order they are given, into the hash table. For the *i*-th number *x**i*, DZY will put it into the bucket numbered *h*(*x**i*), where *h*(*x*) is the hash function. In this problem we will assume, that *h*(*x*)<==<=*x* *mod* *p*. Operation *a* *mod* *b* denotes taking a remainder after division *a* by *b*. However, each bucket can contain no more than one element. If DZY wants to insert an number into a bucket which is already filled, we say a "conflict" happens. Suppose the first conflict happens right after the *i*-th insertion, you should output *i*. If no conflict happens, just output -1.
The first line contains two integers, *p* and *n* (2<=≤<=*p*,<=*n*<=≤<=300). Then *n* lines follow. The *i*-th of them contains an integer *x**i* (0<=≤<=*x**i*<=≤<=109).
Output a single integer — the answer to the problem.
[ "10 5\n0\n21\n53\n41\n53\n", "5 5\n0\n1\n2\n3\n4\n" ]
[ "4\n", "-1\n" ]
none
500
[ { "input": "10 5\n0\n21\n53\n41\n53", "output": "4" }, { "input": "5 5\n0\n1\n2\n3\n4", "output": "-1" }, { "input": "10 6\n811966798\n734823552\n790326404\n929189974\n414343256\n560346537", "output": "4" }, { "input": "2 2\n788371161\n801743052", "output": "-1" }, { "input": "10 6\n812796223\n122860157\n199259103\n597650585\n447742024\n521549402", "output": "3" }, { "input": "300 2\n822454942\n119374431", "output": "-1" }, { "input": "300 2\n823284367\n507345500", "output": "-1" }, { "input": "2 5\n791579811\n35613889\n997079893\n878677665\n693717467", "output": "2" }, { "input": "20 5\n793926268\n28931770\n842870287\n974950617\n859404206", "output": "-1" }, { "input": "100 15\n805069249\n778178198\n633897389\n844316223\n146759898\n870527016\n82668754\n42060733\n943602929\n979451110\n746979598\n47406033\n607284062\n850870259\n229415316", "output": "5" }, { "input": "100 15\n806204335\n189490323\n718805086\n716787474\n262315718\n822030596\n894644222\n724054623\n141384399\n579354205\n192622443\n672556242\n97417563\n243354557\n208957882", "output": "8" }, { "input": "100 15\n807033760\n577461392\n275221433\n532633429\n295714486\n783298996\n255799943\n99107143\n729119412\n59302896\n37640015\n313610861\n630550567\n534283052\n681062462", "output": "8" }, { "input": "100 15\n808103310\n136224397\n360129131\n405104681\n263786657\n734802577\n67808179\n928584682\n926900882\n511722343\n483348395\n938695534\n120684068\n74152694\n808088675", "output": "9" }, { "input": "2 2\n2\n2", "output": "2" }, { "input": "300 2\n0\n300", "output": "2" }, { "input": "2 2\n0\n0", "output": "2" } ]
1,633,951,927
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
46
0
p,n = map(int, input().split()) x = [int(input()) for i in range(n)] for j in range(1,n): if x[j] in x[:j-1]: print(j) break else: pass else: print(-1)
Title: DZY Loves Hash Time Limit: None seconds Memory Limit: None megabytes Problem Description: DZY has a hash table with *p* buckets, numbered from 0 to *p*<=-<=1. He wants to insert *n* numbers, in the order they are given, into the hash table. For the *i*-th number *x**i*, DZY will put it into the bucket numbered *h*(*x**i*), where *h*(*x*) is the hash function. In this problem we will assume, that *h*(*x*)<==<=*x* *mod* *p*. Operation *a* *mod* *b* denotes taking a remainder after division *a* by *b*. However, each bucket can contain no more than one element. If DZY wants to insert an number into a bucket which is already filled, we say a "conflict" happens. Suppose the first conflict happens right after the *i*-th insertion, you should output *i*. If no conflict happens, just output -1. Input Specification: The first line contains two integers, *p* and *n* (2<=≤<=*p*,<=*n*<=≤<=300). Then *n* lines follow. The *i*-th of them contains an integer *x**i* (0<=≤<=*x**i*<=≤<=109). Output Specification: Output a single integer — the answer to the problem. Demo Input: ['10 5\n0\n21\n53\n41\n53\n', '5 5\n0\n1\n2\n3\n4\n'] Demo Output: ['4\n', '-1\n'] Note: none
```python p,n = map(int, input().split()) x = [int(input()) for i in range(n)] for j in range(1,n): if x[j] in x[:j-1]: print(j) break else: pass else: print(-1) ```
0
433
A
Kitahara Haruki's Gift
PROGRAMMING
1,100
[ "brute force", "implementation" ]
null
null
Kitahara Haruki has bought *n* apples for Touma Kazusa and Ogiso Setsuna. Now he wants to divide all the apples between the friends. Each apple weights 100 grams or 200 grams. Of course Kitahara Haruki doesn't want to offend any of his friend. Therefore the total weight of the apples given to Touma Kazusa must be equal to the total weight of the apples given to Ogiso Setsuna. But unfortunately Kitahara Haruki doesn't have a knife right now, so he cannot split any apple into some parts. Please, tell him: is it possible to divide all the apples in a fair way between his friends?
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of apples. The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (*w**i*<==<=100 or *w**i*<==<=200), where *w**i* is the weight of the *i*-th apple.
In a single line print "YES" (without the quotes) if it is possible to divide all the apples between his friends. Otherwise print "NO" (without the quotes).
[ "3\n100 200 100\n", "4\n100 100 100 200\n" ]
[ "YES\n", "NO\n" ]
In the first test sample Kitahara Haruki can give the first and the last apple to Ogiso Setsuna and the middle apple to Touma Kazusa.
500
[ { "input": "3\n100 200 100", "output": "YES" }, { "input": "4\n100 100 100 200", "output": "NO" }, { "input": "1\n100", "output": "NO" }, { "input": "1\n200", "output": "NO" }, { "input": "2\n100 100", "output": "YES" }, { "input": "2\n200 200", "output": "YES" }, { "input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "YES" }, { "input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "NO" }, { "input": "52\n200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 100 200 100 200 200 200 100 200 200", "output": "YES" }, { "input": "2\n100 200", "output": "NO" }, { "input": "2\n200 100", "output": "NO" }, { "input": "3\n100 100 100", "output": "NO" }, { "input": "3\n200 200 200", "output": "NO" }, { "input": "3\n200 100 200", "output": "NO" }, { "input": "4\n100 100 100 100", "output": "YES" }, { "input": "4\n200 200 200 200", "output": "YES" }, { "input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "YES" }, { "input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 100 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "NO" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "YES" }, { "input": "100\n100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "NO" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "YES" }, { "input": "100\n100 100 100 100 100 100 100 100 200 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "NO" }, { "input": "99\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "NO" }, { "input": "99\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "NO" }, { "input": "99\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "YES" }, { "input": "99\n200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200", "output": "NO" }, { "input": "99\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "NO" }, { "input": "99\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "YES" }, { "input": "99\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "NO" }, { "input": "100\n100 100 200 100 100 200 200 200 200 100 200 100 100 100 200 100 100 100 100 200 100 100 100 100 100 100 200 100 100 200 200 100 100 100 200 200 200 100 200 200 100 200 100 100 200 100 200 200 100 200 200 100 100 200 200 100 200 200 100 100 200 100 200 100 200 200 200 200 200 100 200 200 200 200 200 200 100 100 200 200 200 100 100 100 200 100 100 200 100 100 100 200 200 100 100 200 200 200 200 100", "output": "YES" }, { "input": "100\n100 100 200 200 100 200 100 100 100 100 100 100 200 100 200 200 200 100 100 200 200 200 200 200 100 200 100 200 100 100 100 200 100 100 200 100 200 100 100 100 200 200 100 100 100 200 200 200 200 200 100 200 200 100 100 100 100 200 100 100 200 100 100 100 100 200 200 200 100 200 100 200 200 200 100 100 200 200 200 200 100 200 100 200 200 100 200 100 200 200 200 200 200 200 100 100 100 200 200 100", "output": "NO" }, { "input": "100\n100 200 100 100 200 200 200 200 100 200 200 200 200 200 200 200 200 200 100 100 100 200 200 200 200 200 100 200 200 200 200 100 200 200 100 100 200 100 100 100 200 100 100 100 200 100 200 100 200 200 200 100 100 200 100 200 100 200 100 100 100 200 100 200 100 100 100 100 200 200 200 200 100 200 200 100 200 100 100 100 200 100 100 100 100 100 200 100 100 100 200 200 200 100 200 100 100 100 200 200", "output": "YES" }, { "input": "99\n100 200 200 200 100 200 100 200 200 100 100 100 100 200 100 100 200 100 200 100 100 200 100 100 200 200 100 100 100 100 200 200 200 200 200 100 100 200 200 100 100 100 100 200 200 100 100 100 100 100 200 200 200 100 100 100 200 200 200 100 200 100 100 100 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 100 200 100 200 200 200 200 100 200 100 100 100 100 100 100 100 100 100", "output": "YES" }, { "input": "99\n100 200 100 100 100 100 200 200 100 200 100 100 200 100 100 100 100 100 100 200 100 100 100 100 100 100 100 200 100 200 100 100 100 100 100 100 100 200 200 200 200 200 200 200 100 200 100 200 100 200 100 200 100 100 200 200 200 100 200 200 200 200 100 200 100 200 200 200 200 100 200 100 200 200 100 200 200 200 200 200 100 100 200 100 100 100 100 200 200 200 100 100 200 200 200 200 200 200 200", "output": "NO" }, { "input": "99\n200 100 100 100 200 200 200 100 100 100 100 100 100 100 100 100 200 200 100 200 200 100 200 100 100 200 200 200 100 200 100 200 200 100 200 100 200 200 200 100 100 200 200 200 200 100 100 100 100 200 200 200 200 100 200 200 200 100 100 100 200 200 200 100 200 100 200 100 100 100 200 100 200 200 100 200 200 200 100 100 100 200 200 200 100 200 200 200 100 100 100 200 100 200 100 100 100 200 200", "output": "YES" }, { "input": "56\n100 200 200 200 200 200 100 200 100 100 200 100 100 100 100 100 200 200 200 100 200 100 100 200 200 200 100 200 100 200 200 100 100 100 100 100 200 100 200 100 200 200 200 100 100 200 200 200 200 200 200 200 200 200 200 100", "output": "YES" }, { "input": "72\n200 100 200 200 200 100 100 200 200 100 100 100 100 200 100 200 100 100 100 100 200 100 200 100 100 200 100 100 200 100 200 100 100 200 100 200 100 100 200 200 200 200 200 100 100 200 200 200 200 100 100 100 200 200 100 100 100 100 100 200 100 100 200 100 100 200 200 100 100 200 100 200", "output": "YES" }, { "input": "32\n200 200 200 100 100 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200", "output": "YES" }, { "input": "48\n200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 100 200 200 200 200 200 200", "output": "NO" }, { "input": "60\n100 100 200 200 100 200 100 200 100 100 100 100 100 100 200 100 100 100 200 100 200 100 100 100 100 100 200 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100", "output": "YES" }, { "input": "24\n200 200 100 100 200 100 200 200 100 200 200 200 200 200 100 200 200 200 200 200 200 200 200 100", "output": "YES" }, { "input": "40\n100 100 200 200 200 200 100 100 100 200 100 100 200 200 100 100 100 100 100 200 100 200 200 100 200 200 200 100 100 100 100 100 200 200 100 200 100 100 200 100", "output": "NO" }, { "input": "5\n200 200 200 200 200", "output": "NO" }, { "input": "9\n100 100 100 200 100 100 200 100 200", "output": "YES" }, { "input": "1\n200", "output": "NO" }, { "input": "7\n200 200 200 100 200 200 200", "output": "NO" }, { "input": "4\n100 100 200 200", "output": "YES" }, { "input": "6\n100 100 100 200 200 200", "output": "NO" }, { "input": "4\n200 100 100 200", "output": "YES" }, { "input": "5\n100 100 100 100 200", "output": "YES" } ]
1,661,856,616
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
4
46
0
n=int(input()) dic={} for i in input().split(" "): if i in list(dic.keys()): dic[i]+=1 else: dic[i]=1 if {"100":2*n/3,"200":n/3}==dic or {"200":2*n/3,"100":n/3}==dic: print("YES") else: print("NO")
Title: Kitahara Haruki's Gift Time Limit: None seconds Memory Limit: None megabytes Problem Description: Kitahara Haruki has bought *n* apples for Touma Kazusa and Ogiso Setsuna. Now he wants to divide all the apples between the friends. Each apple weights 100 grams or 200 grams. Of course Kitahara Haruki doesn't want to offend any of his friend. Therefore the total weight of the apples given to Touma Kazusa must be equal to the total weight of the apples given to Ogiso Setsuna. But unfortunately Kitahara Haruki doesn't have a knife right now, so he cannot split any apple into some parts. Please, tell him: is it possible to divide all the apples in a fair way between his friends? Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of apples. The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (*w**i*<==<=100 or *w**i*<==<=200), where *w**i* is the weight of the *i*-th apple. Output Specification: In a single line print "YES" (without the quotes) if it is possible to divide all the apples between his friends. Otherwise print "NO" (without the quotes). Demo Input: ['3\n100 200 100\n', '4\n100 100 100 200\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first test sample Kitahara Haruki can give the first and the last apple to Ogiso Setsuna and the middle apple to Touma Kazusa.
```python n=int(input()) dic={} for i in input().split(" "): if i in list(dic.keys()): dic[i]+=1 else: dic[i]=1 if {"100":2*n/3,"200":n/3}==dic or {"200":2*n/3,"100":n/3}==dic: print("YES") else: print("NO") ```
0
9
A
Die Roll
PROGRAMMING
800
[ "math", "probabilities" ]
A. Die Roll
1
64
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
[ "4 2\n" ]
[ "1/2\n" ]
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
0
[ { "input": "4 2", "output": "1/2" }, { "input": "1 1", "output": "1/1" }, { "input": "1 2", "output": "5/6" }, { "input": "1 3", "output": "2/3" }, { "input": "1 4", "output": "1/2" }, { "input": "1 5", "output": "1/3" }, { "input": "1 6", "output": "1/6" }, { "input": "2 1", "output": "5/6" }, { "input": "2 2", "output": "5/6" }, { "input": "2 3", "output": "2/3" }, { "input": "2 4", "output": "1/2" }, { "input": "2 5", "output": "1/3" }, { "input": "2 6", "output": "1/6" }, { "input": "3 1", "output": "2/3" }, { "input": "3 2", "output": "2/3" }, { "input": "3 3", "output": "2/3" }, { "input": "3 4", "output": "1/2" }, { "input": "3 5", "output": "1/3" }, { "input": "3 6", "output": "1/6" }, { "input": "4 1", "output": "1/2" }, { "input": "4 3", "output": "1/2" }, { "input": "4 4", "output": "1/2" }, { "input": "4 5", "output": "1/3" }, { "input": "4 6", "output": "1/6" }, { "input": "5 1", "output": "1/3" }, { "input": "5 2", "output": "1/3" }, { "input": "5 3", "output": "1/3" }, { "input": "5 4", "output": "1/3" }, { "input": "5 5", "output": "1/3" }, { "input": "5 6", "output": "1/6" }, { "input": "6 1", "output": "1/6" }, { "input": "6 2", "output": "1/6" }, { "input": "6 3", "output": "1/6" }, { "input": "6 4", "output": "1/6" }, { "input": "6 5", "output": "1/6" }, { "input": "6 6", "output": "1/6" } ]
1,627,271,791
2,147,483,647
Python 3
OK
TESTS
36
154
6,758,400
y,w = map(int,input().split()) y = max(y,w) hm={0:"0/1",1:"1/6",2:"1/3",3:"1/2",4:"2/3",5:"5/6",6:"1/1"} print(hm[6-y+1])
Title: Die Roll Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win. Input Specification: The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls. Output Specification: Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1». Demo Input: ['4 2\n'] Demo Output: ['1/2\n'] Note: Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
```python y,w = map(int,input().split()) y = max(y,w) hm={0:"0/1",1:"1/6",2:"1/3",3:"1/2",4:"2/3",5:"5/6",6:"1/1"} print(hm[6-y+1]) ```
3.872646
387
A
George and Sleep
PROGRAMMING
900
[ "implementation" ]
null
null
George woke up and saw the current time *s* on the digital clock. Besides, George knows that he has slept for time *t*. Help George! Write a program that will, given time *s* and *t*, determine the time *p* when George went to bed. Note that George could have gone to bed yesterday relatively to the current time (see the second test sample).
The first line contains current time *s* as a string in the format "hh:mm". The second line contains time *t* in the format "hh:mm" — the duration of George's sleep. It is guaranteed that the input contains the correct time in the 24-hour format, that is, 00<=≤<=*hh*<=≤<=23, 00<=≤<=*mm*<=≤<=59.
In the single line print time *p* — the time George went to bed in the format similar to the format of the time in the input.
[ "05:50\n05:44\n", "00:00\n01:00\n", "00:01\n00:00\n" ]
[ "00:06\n", "23:00\n", "00:01\n" ]
In the first sample George went to bed at "00:06". Note that you should print the time only in the format "00:06". That's why answers "0:06", "00:6" and others will be considered incorrect. In the second sample, George went to bed yesterday. In the third sample, George didn't do to bed at all.
500
[ { "input": "05:50\n05:44", "output": "00:06" }, { "input": "00:00\n01:00", "output": "23:00" }, { "input": "00:01\n00:00", "output": "00:01" }, { "input": "23:59\n23:59", "output": "00:00" }, { "input": "23:44\n23:55", "output": "23:49" }, { "input": "00:00\n13:12", "output": "10:48" }, { "input": "12:00\n23:59", "output": "12:01" }, { "input": "12:44\n12:44", "output": "00:00" }, { "input": "05:55\n07:12", "output": "22:43" }, { "input": "07:12\n05:55", "output": "01:17" }, { "input": "22:22\n22:22", "output": "00:00" }, { "input": "22:22\n22:23", "output": "23:59" }, { "input": "23:24\n23:23", "output": "00:01" }, { "input": "00:00\n00:00", "output": "00:00" }, { "input": "23:30\n00:00", "output": "23:30" }, { "input": "01:00\n00:00", "output": "01:00" }, { "input": "05:44\n06:00", "output": "23:44" }, { "input": "00:00\n23:59", "output": "00:01" }, { "input": "21:00\n01:00", "output": "20:00" }, { "input": "21:21\n12:21", "output": "09:00" }, { "input": "12:21\n21:12", "output": "15:09" }, { "input": "12:33\n23:33", "output": "13:00" }, { "input": "07:55\n05:53", "output": "02:02" }, { "input": "19:30\n02:00", "output": "17:30" }, { "input": "21:30\n02:00", "output": "19:30" }, { "input": "19:30\n09:30", "output": "10:00" }, { "input": "13:08\n00:42", "output": "12:26" }, { "input": "13:04\n09:58", "output": "03:06" }, { "input": "21:21\n23:06", "output": "22:15" }, { "input": "20:53\n10:23", "output": "10:30" }, { "input": "12:59\n00:45", "output": "12:14" }, { "input": "12:39\n22:21", "output": "14:18" }, { "input": "21:10\n13:50", "output": "07:20" }, { "input": "03:38\n23:46", "output": "03:52" }, { "input": "03:48\n00:41", "output": "03:07" }, { "input": "07:43\n12:27", "output": "19:16" }, { "input": "03:23\n08:52", "output": "18:31" }, { "input": "16:04\n10:28", "output": "05:36" }, { "input": "12:53\n08:37", "output": "04:16" }, { "input": "13:43\n17:23", "output": "20:20" }, { "input": "00:00\n00:01", "output": "23:59" }, { "input": "10:10\n01:01", "output": "09:09" }, { "input": "10:05\n00:00", "output": "10:05" }, { "input": "09:09\n00:00", "output": "09:09" }, { "input": "09:10\n00:01", "output": "09:09" }, { "input": "23:24\n00:28", "output": "22:56" }, { "input": "10:00\n01:00", "output": "09:00" } ]
1,586,094,698
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
4
139
0
a=input() b=input() p=int(a[0:2])-int(b[0:2]) if p<0: p = 24 + p m = int(a[3:])-int(b[3:]) if m<0: m= 60+m p-=1 if len(str(p))==1: if p==0: p = str(p)+'0' else: p= '0'+str(p) if len(str(m))==1: if m==0: m= str(m)+'0' else: m= '0' + str(m) print(str(p)+':'+str(m))
Title: George and Sleep Time Limit: None seconds Memory Limit: None megabytes Problem Description: George woke up and saw the current time *s* on the digital clock. Besides, George knows that he has slept for time *t*. Help George! Write a program that will, given time *s* and *t*, determine the time *p* when George went to bed. Note that George could have gone to bed yesterday relatively to the current time (see the second test sample). Input Specification: The first line contains current time *s* as a string in the format "hh:mm". The second line contains time *t* in the format "hh:mm" — the duration of George's sleep. It is guaranteed that the input contains the correct time in the 24-hour format, that is, 00<=≤<=*hh*<=≤<=23, 00<=≤<=*mm*<=≤<=59. Output Specification: In the single line print time *p* — the time George went to bed in the format similar to the format of the time in the input. Demo Input: ['05:50\n05:44\n', '00:00\n01:00\n', '00:01\n00:00\n'] Demo Output: ['00:06\n', '23:00\n', '00:01\n'] Note: In the first sample George went to bed at "00:06". Note that you should print the time only in the format "00:06". That's why answers "0:06", "00:6" and others will be considered incorrect. In the second sample, George went to bed yesterday. In the third sample, George didn't do to bed at all.
```python a=input() b=input() p=int(a[0:2])-int(b[0:2]) if p<0: p = 24 + p m = int(a[3:])-int(b[3:]) if m<0: m= 60+m p-=1 if len(str(p))==1: if p==0: p = str(p)+'0' else: p= '0'+str(p) if len(str(m))==1: if m==0: m= str(m)+'0' else: m= '0' + str(m) print(str(p)+':'+str(m)) ```
0
118
A
String Task
PROGRAMMING
1,000
[ "implementation", "strings" ]
null
null
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it: - deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones. Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string. Help Petya cope with this easy task.
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
Print the resulting string. It is guaranteed that this string is not empty.
[ "tour\n", "Codeforces\n", "aBAcAba\n" ]
[ ".t.r\n", ".c.d.f.r.c.s\n", ".b.c.b\n" ]
none
500
[ { "input": "tour", "output": ".t.r" }, { "input": "Codeforces", "output": ".c.d.f.r.c.s" }, { "input": "aBAcAba", "output": ".b.c.b" }, { "input": "obn", "output": ".b.n" }, { "input": "wpwl", "output": ".w.p.w.l" }, { "input": "ggdvq", "output": ".g.g.d.v.q" }, { "input": "pumesz", "output": ".p.m.s.z" }, { "input": "g", "output": ".g" }, { "input": "zjuotps", "output": ".z.j.t.p.s" }, { "input": "jzbwuehe", "output": ".j.z.b.w.h" }, { "input": "tnkgwuugu", "output": ".t.n.k.g.w.g" }, { "input": "kincenvizh", "output": ".k.n.c.n.v.z.h" }, { "input": "xattxjenual", "output": ".x.t.t.x.j.n.l" }, { "input": "ktajqhpqsvhw", "output": ".k.t.j.q.h.p.q.s.v.h.w" }, { "input": "xnhcigytnqcmy", "output": ".x.n.h.c.g.t.n.q.c.m" }, { "input": "jfmtbejyilxcec", "output": ".j.f.m.t.b.j.l.x.c.c" }, { "input": "D", "output": ".d" }, { "input": "ab", "output": ".b" }, { "input": "Ab", "output": ".b" }, { "input": "aB", "output": ".b" }, { "input": "AB", "output": ".b" }, { "input": "ba", "output": ".b" }, { "input": "bA", "output": ".b" }, { "input": "Ba", "output": ".b" }, { "input": "BA", "output": ".b" }, { "input": "aab", "output": ".b" }, { "input": "baa", "output": ".b" }, { "input": "femOZeCArKCpUiHYnbBPTIOFmsHmcpObtPYcLCdjFrUMIyqYzAokKUiiKZRouZiNMoiOuGVoQzaaCAOkquRjmmKKElLNqCnhGdQM", "output": ".f.m.z.c.r.k.c.p.h.n.b.b.p.t.f.m.s.h.m.c.p.b.t.p.c.l.c.d.j.f.r.m.q.z.k.k.k.z.r.z.n.m.g.v.q.z.c.k.q.r.j.m.m.k.k.l.l.n.q.c.n.h.g.d.q.m" }, { "input": "VMBPMCmMDCLFELLIISUJDWQRXYRDGKMXJXJHXVZADRZWVWJRKFRRNSAWKKDPZZLFLNSGUNIVJFBEQsMDHSBJVDTOCSCgZWWKvZZN", "output": ".v.m.b.p.m.c.m.m.d.c.l.f.l.l.s.j.d.w.q.r.x.r.d.g.k.m.x.j.x.j.h.x.v.z.d.r.z.w.v.w.j.r.k.f.r.r.n.s.w.k.k.d.p.z.z.l.f.l.n.s.g.n.v.j.f.b.q.s.m.d.h.s.b.j.v.d.t.c.s.c.g.z.w.w.k.v.z.z.n" }, { "input": "MCGFQQJNUKuAEXrLXibVjClSHjSxmlkQGTKZrRaDNDomIPOmtSgjJAjNVIVLeUGUAOHNkCBwNObVCHOWvNkLFQQbFnugYVMkJruJ", "output": ".m.c.g.f.q.q.j.n.k.x.r.l.x.b.v.j.c.l.s.h.j.s.x.m.l.k.q.g.t.k.z.r.r.d.n.d.m.p.m.t.s.g.j.j.j.n.v.v.l.g.h.n.k.c.b.w.n.b.v.c.h.w.v.n.k.l.f.q.q.b.f.n.g.v.m.k.j.r.j" }, { "input": "iyaiuiwioOyzUaOtAeuEYcevvUyveuyioeeueoeiaoeiavizeeoeyYYaaAOuouueaUioueauayoiuuyiuovyOyiyoyioaoyuoyea", "output": ".w.z.t.c.v.v.v.v.z.v" }, { "input": "yjnckpfyLtzwjsgpcrgCfpljnjwqzgVcufnOvhxplvflxJzqxnhrwgfJmPzifgubvspffmqrwbzivatlmdiBaddiaktdsfPwsevl", "output": ".j.n.c.k.p.f.l.t.z.w.j.s.g.p.c.r.g.c.f.p.l.j.n.j.w.q.z.g.v.c.f.n.v.h.x.p.l.v.f.l.x.j.z.q.x.n.h.r.w.g.f.j.m.p.z.f.g.b.v.s.p.f.f.m.q.r.w.b.z.v.t.l.m.d.b.d.d.k.t.d.s.f.p.w.s.v.l" }, { "input": "RIIIUaAIYJOiuYIUWFPOOAIuaUEZeIooyUEUEAoIyIHYOEAlVAAIiLUAUAeiUIEiUMuuOiAgEUOIAoOUYYEYFEoOIIVeOOAOIIEg", "output": ".r.j.w.f.p.z.h.l.v.l.m.g.f.v.g" }, { "input": "VBKQCFBMQHDMGNSGBQVJTGQCNHHRJMNKGKDPPSQRRVQTZNKBZGSXBPBRXPMVFTXCHZMSJVBRNFNTHBHGJLMDZJSVPZZBCCZNVLMQ", "output": ".v.b.k.q.c.f.b.m.q.h.d.m.g.n.s.g.b.q.v.j.t.g.q.c.n.h.h.r.j.m.n.k.g.k.d.p.p.s.q.r.r.v.q.t.z.n.k.b.z.g.s.x.b.p.b.r.x.p.m.v.f.t.x.c.h.z.m.s.j.v.b.r.n.f.n.t.h.b.h.g.j.l.m.d.z.j.s.v.p.z.z.b.c.c.z.n.v.l.m.q" }, { "input": "iioyoaayeuyoolyiyoeuouiayiiuyTueyiaoiueyioiouyuauouayyiaeoeiiigmioiououeieeeyuyyaYyioiiooaiuouyoeoeg", "output": ".l.t.g.m.g" }, { "input": "ueyiuiauuyyeueykeioouiiauzoyoeyeuyiaoaiiaaoaueyaeydaoauexuueafouiyioueeaaeyoeuaueiyiuiaeeayaioeouiuy", "output": ".k.z.d.x.f" }, { "input": "FSNRBXLFQHZXGVMKLQDVHWLDSLKGKFMDRQWMWSSKPKKQBNDZRSCBLRSKCKKFFKRDMZFZGCNSMXNPMZVDLKXGNXGZQCLRTTDXLMXQ", "output": ".f.s.n.r.b.x.l.f.q.h.z.x.g.v.m.k.l.q.d.v.h.w.l.d.s.l.k.g.k.f.m.d.r.q.w.m.w.s.s.k.p.k.k.q.b.n.d.z.r.s.c.b.l.r.s.k.c.k.k.f.f.k.r.d.m.z.f.z.g.c.n.s.m.x.n.p.m.z.v.d.l.k.x.g.n.x.g.z.q.c.l.r.t.t.d.x.l.m.x.q" }, { "input": "EYAYAYIOIOYOOAUOEUEUOUUYIYUUMOEOIIIAOIUOAAOIYOIOEUIERCEYYAOIOIGYUIAOYUEOEUAEAYPOYEYUUAUOAOEIYIEYUEEY", "output": ".m.r.c.g.p" }, { "input": "jvvzcdcxjstbbksmqjsngxkgtttdxrljjxtwptgwwqzpvqchvgrkqlzxmptzblxhhsmrkmzzmgdfskhtmmnqzzflpmqdctvrfgtx", "output": ".j.v.v.z.c.d.c.x.j.s.t.b.b.k.s.m.q.j.s.n.g.x.k.g.t.t.t.d.x.r.l.j.j.x.t.w.p.t.g.w.w.q.z.p.v.q.c.h.v.g.r.k.q.l.z.x.m.p.t.z.b.l.x.h.h.s.m.r.k.m.z.z.m.g.d.f.s.k.h.t.m.m.n.q.z.z.f.l.p.m.q.d.c.t.v.r.f.g.t.x" }, { "input": "YB", "output": ".b" }, { "input": "fly", "output": ".f.l" }, { "input": "YyyYYYyyYxdwdawdDAWDdaddYYYY", "output": ".x.d.w.d.w.d.d.w.d.d.d.d" } ]
1,698,323,045
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
14
122
0
s=input().lower() v=['a','e','i','o','u'] v=set(v) for i in s: if i not in v: print(f".{i}",end="")
Title: String Task Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it: - deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones. Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string. Help Petya cope with this easy task. Input Specification: The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive. Output Specification: Print the resulting string. It is guaranteed that this string is not empty. Demo Input: ['tour\n', 'Codeforces\n', 'aBAcAba\n'] Demo Output: ['.t.r\n', '.c.d.f.r.c.s\n', '.b.c.b\n'] Note: none
```python s=input().lower() v=['a','e','i','o','u'] v=set(v) for i in s: if i not in v: print(f".{i}",end="") ```
0
19
B
Checkout Assistant
PROGRAMMING
1,900
[ "dp" ]
B. Checkout Assistant
1
256
Bob came to a cash &amp; carry store, put *n* items into his trolley, and went to the checkout counter to pay. Each item is described by its price *c**i* and time *t**i* in seconds that a checkout assistant spends on this item. While the checkout assistant is occupied with some item, Bob can steal some other items from his trolley. To steal one item Bob needs exactly 1 second. What is the minimum amount of money that Bob will have to pay to the checkout assistant? Remember, please, that it is Bob, who determines the order of items for the checkout assistant.
The first input line contains number *n* (1<=≤<=*n*<=≤<=2000). In each of the following *n* lines each item is described by a pair of numbers *t**i*, *c**i* (0<=≤<=*t**i*<=≤<=2000,<=1<=≤<=*c**i*<=≤<=109). If *t**i* is 0, Bob won't be able to steal anything, while the checkout assistant is occupied with item *i*.
Output one number — answer to the problem: what is the minimum amount of money that Bob will have to pay.
[ "4\n2 10\n0 20\n1 5\n1 3\n", "3\n0 1\n0 10\n0 100\n" ]
[ "8\n", "111\n" ]
none
0
[ { "input": "4\n2 10\n0 20\n1 5\n1 3", "output": "8" }, { "input": "3\n0 1\n0 10\n0 100", "output": "111" }, { "input": "2\n0 635254032\n0 75159864", "output": "710413896" }, { "input": "2\n0 861438648\n1 469893784", "output": "469893784" }, { "input": "2\n2 87623264\n0 864627704", "output": "87623264" }, { "input": "5\n0 51690939\n0 62436494\n0 39009053\n0 70426298\n0 631569476", "output": "855132260" }, { "input": "5\n0 968804136\n0 736567537\n2 343136264\n0 259899572\n1 425744418", "output": "768880682" }, { "input": "5\n4 33400980\n2 410698581\n4 794747123\n0 301889198\n3 219919361", "output": "33400980" }, { "input": "5\n5 491957578\n4 747764103\n3 446810728\n4 896625835\n4 190748656", "output": "190748656" }, { "input": "10\n3 512981548\n0 214269975\n2 603901234\n3 772872647\n0 224281389\n4 561877930\n1 809519308\n4 883486551\n1 114469023\n2 184038037", "output": "860384990" } ]
1,658,308,342
2,147,483,647
PyPy 3-64
OK
TESTS
34
140
5,734,400
n=int(input()) ar=[float('inf')]*(n+1) ar[0]=0 for i in range(n): t,c=map(int,input().split()) for j in range(n-1,-1,-1): w=min(j+t+1,n) ar[w]=min(ar[w],ar[j]+c) print(ar[n])
Title: Checkout Assistant Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Bob came to a cash &amp; carry store, put *n* items into his trolley, and went to the checkout counter to pay. Each item is described by its price *c**i* and time *t**i* in seconds that a checkout assistant spends on this item. While the checkout assistant is occupied with some item, Bob can steal some other items from his trolley. To steal one item Bob needs exactly 1 second. What is the minimum amount of money that Bob will have to pay to the checkout assistant? Remember, please, that it is Bob, who determines the order of items for the checkout assistant. Input Specification: The first input line contains number *n* (1<=≤<=*n*<=≤<=2000). In each of the following *n* lines each item is described by a pair of numbers *t**i*, *c**i* (0<=≤<=*t**i*<=≤<=2000,<=1<=≤<=*c**i*<=≤<=109). If *t**i* is 0, Bob won't be able to steal anything, while the checkout assistant is occupied with item *i*. Output Specification: Output one number — answer to the problem: what is the minimum amount of money that Bob will have to pay. Demo Input: ['4\n2 10\n0 20\n1 5\n1 3\n', '3\n0 1\n0 10\n0 100\n'] Demo Output: ['8\n', '111\n'] Note: none
```python n=int(input()) ar=[float('inf')]*(n+1) ar[0]=0 for i in range(n): t,c=map(int,input().split()) for j in range(n-1,-1,-1): w=min(j+t+1,n) ar[w]=min(ar[w],ar[j]+c) print(ar[n]) ```
3.919319
1
A
Theatre Square
PROGRAMMING
1,000
[ "math" ]
A. Theatre Square
1
256
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Write the needed number of flagstones.
[ "6 6 4\n" ]
[ "4\n" ]
none
0
[ { "input": "6 6 4", "output": "4" }, { "input": "1 1 1", "output": "1" }, { "input": "2 1 1", "output": "2" }, { "input": "1 2 1", "output": "2" }, { "input": "2 2 1", "output": "4" }, { "input": "2 1 2", "output": "1" }, { "input": "1 1 3", "output": "1" }, { "input": "2 3 4", "output": "1" }, { "input": "1000000000 1000000000 1", "output": "1000000000000000000" }, { "input": "12 13 4", "output": "12" }, { "input": "222 332 5", "output": "3015" }, { "input": "1000 1000 10", "output": "10000" }, { "input": "1001 1000 10", "output": "10100" }, { "input": "100 10001 1000000000", "output": "1" }, { "input": "1000000000 1000000000 1000000000", "output": "1" }, { "input": "1000000000 1000000000 999999999", "output": "4" }, { "input": "1000000000 1000000000 192", "output": "27126743055556" }, { "input": "1000000000 987654321 1", "output": "987654321000000000" }, { "input": "456784567 1000000000 51", "output": "175618850864484" }, { "input": "39916800 134217728 40320", "output": "3295710" } ]
1,691,503,599
2,147,483,647
PyPy 3
OK
TESTS
20
93
0
from math import ceil n,m,a = map(int,input().split()) x = int(ceil(n/a)*ceil(m/a)) print(x)
Title: Theatre Square Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. Input Specification: The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). Output Specification: Write the needed number of flagstones. Demo Input: ['6 6 4\n'] Demo Output: ['4\n'] Note: none
```python from math import ceil n,m,a = map(int,input().split()) x = int(ceil(n/a)*ceil(m/a)) print(x) ```
3.9535
234
D
Cinema
PROGRAMMING
1,600
[ "implementation" ]
null
null
Overall there are *m* actors in Berland. Each actor has a personal identifier — an integer from 1 to *m* (distinct actors have distinct identifiers). Vasya likes to watch Berland movies with Berland actors, and he has *k* favorite actors. He watched the movie trailers for the next month and wrote the following information for every movie: the movie title, the number of actors who starred in it, and the identifiers of these actors. Besides, he managed to copy the movie titles and how many actors starred there, but he didn't manage to write down the identifiers of some actors. Vasya looks at his records and wonders which movies may be his favourite, and which ones may not be. Once Vasya learns the exact cast of all movies, his favorite movies will be determined as follows: a movie becomes favorite movie, if no other movie from Vasya's list has more favorite actors. Help the boy to determine the following for each movie: - whether it surely will be his favourite movie;- whether it surely won't be his favourite movie; - can either be favourite or not.
The first line of the input contains two integers *m* and *k* (1<=≤<=*m*<=≤<=100,<=1<=≤<=*k*<=≤<=*m*) — the number of actors in Berland and the number of Vasya's favourite actors. The second line contains *k* distinct integers *a**i* (1<=≤<=*a**i*<=≤<=*m*) — the identifiers of Vasya's favourite actors. The third line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of movies in Vasya's list. Then follow *n* blocks of lines, each block contains a movie's description. The *i*-th movie's description contains three lines: - the first line contains string *s**i* (*s**i* consists of lowercase English letters and can have the length of from 1 to 10 characters, inclusive) — the movie's title, - the second line contains a non-negative integer *d**i* (1<=≤<=*d**i*<=≤<=*m*) — the number of actors who starred in this movie,- the third line has *d**i* integers *b**i*,<=*j* (0<=≤<=*b**i*,<=*j*<=≤<=*m*) — the identifiers of the actors who star in this movie. If *b**i*,<=*j*<==<=0, than Vasya doesn't remember the identifier of the *j*-th actor. It is guaranteed that the list of actors for a movie doesn't contain the same actors. All movies have distinct names. The numbers on the lines are separated by single spaces.
Print *n* lines in the output. In the *i*-th line print: - 0, if the *i*-th movie will surely be the favourite; - 1, if the *i*-th movie won't surely be the favourite; - 2, if the *i*-th movie can either be favourite, or not favourite.
[ "5 3\n1 2 3\n6\nfirstfilm\n3\n0 0 0\nsecondfilm\n4\n0 0 4 5\nthirdfilm\n1\n2\nfourthfilm\n1\n5\nfifthfilm\n1\n4\nsixthfilm\n2\n1 0\n", "5 3\n1 3 5\n4\njumanji\n3\n0 0 0\ntheeagle\n5\n1 2 3 4 0\nmatrix\n3\n2 4 0\nsourcecode\n2\n2 4\n" ]
[ "2\n2\n1\n1\n1\n2\n", "2\n0\n1\n1\n" ]
Note to the second sample: - Movie jumanji can theoretically have from 1 to 3 Vasya's favourite actors. - Movie theeagle has all three favourite actors, as the actor Vasya failed to remember, can only have identifier 5. - Movie matrix can have exactly one favourite actor. - Movie sourcecode doesn't have any favourite actors. Thus, movie theeagle will surely be favourite, movies matrix and sourcecode won't surely be favourite, and movie jumanji can be either favourite (if it has all three favourite actors), or not favourite.
0
[ { "input": "5 3\n1 2 3\n6\nfirstfilm\n3\n0 0 0\nsecondfilm\n4\n0 0 4 5\nthirdfilm\n1\n2\nfourthfilm\n1\n5\nfifthfilm\n1\n4\nsixthfilm\n2\n1 0", "output": "2\n2\n1\n1\n1\n2" }, { "input": "5 3\n1 3 5\n4\njumanji\n3\n0 0 0\ntheeagle\n5\n1 2 3 4 0\nmatrix\n3\n2 4 0\nsourcecode\n2\n2 4", "output": "2\n0\n1\n1" }, { "input": "10 1\n1\n4\na\n1\n3\nb\n1\n4\nc\n1\n5\nd\n1\n2", "output": "0\n0\n0\n0" }, { "input": "2 1\n1\n2\na\n1\n2\nb\n1\n1", "output": "1\n0" }, { "input": "6 4\n3 4 2 1\n10\na\n4\n1 2 3 5\nbe\n3\n0 0 0\nc\n6\n1 2 3 4 5 6\ndr\n4\n5 6 0 0\ne\n6\n0 0 0 0 0 0\nff\n5\n0 0 0 0 6\ng\n2\n6 5\nfdfk\n4\n1 2 3 4\nreer\n2\n5 6\nudfyhusd\n1\n6", "output": "1\n1\n0\n1\n0\n2\n1\n0\n1\n1" }, { "input": "10 4\n2 7 9 10\n10\nfr\n5\n1 0 0 0 0\nedweer\n9\n1 2 3 4 5 6 7 0 0\nfddf\n4\n4 5 2 1\ndsd\n1\n0\nr\n2\n1 5\njh\n1\n4\nj\n2\n0 0\nuyuy\n3\n0 4 6\na\n4\n4 6 3 1\nq\n1\n1", "output": "2\n2\n1\n1\n1\n1\n1\n1\n1\n1" }, { "input": "100 1\n1\n2\nab\n17\n0 0 0 0 0 0 0 0 0 0 0 2 3 4 5 6 7\nabb\n1\n2", "output": "0\n2" }, { "input": "15 15\n1 2 3 4 5 6 7 8 9 11 10 12 13 14 15\n1\nabvabab\n15\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "8 2\n7 3\n5\na\n1\n8\nb\n2\n5 6\nc\n1\n7\nd\n1\n3\ne\n1\n0", "output": "1\n1\n0\n0\n2" }, { "input": "2 1\n2\n10\na\n1\n1\nb\n1\n1\nc\n2\n0 0\nd\n2\n0 1\ne\n2\n1 0\nf\n2\n0 0\ng\n1\n1\ndkjs\n1\n1\nfdkj\n2\n1 2\nedwe\n1\n2", "output": "1\n1\n0\n0\n0\n0\n1\n1\n0\n0" }, { "input": "4 3\n1 3 4\n5\njfmiwymydm\n3\n0 2 1\neky\n2\n4 1\njw\n1\n4\ndfrfaeppgj\n2\n3 0\notot\n3\n4 0 1", "output": "2\n2\n1\n2\n0" }, { "input": "5 3\n4 2 5\n4\nwcrqskxp\n1\n0\niafxiw\n1\n0\noaxzffavxx\n4\n0 2 1 5\nyttce\n2\n1 3", "output": "1\n1\n0\n1" }, { "input": "10 9\n10 4 1 7 2 6 5 9 3\n7\ngipjuaw\n2\n0 7\npogyiwr\n9\n6 2 3 0 10 0 1 5 7\nqkzg\n1\n0\nfdunuu\n8\n4 1 0 7 3 9 0 0\nig\n3\n0 0 9\nqzispi\n7\n3 0 8 10 6 2 1\nviktz\n8\n8 7 4 6 0 9 0 0", "output": "1\n0\n1\n2\n1\n1\n1" }, { "input": "100 50\n73 58 66 59 89 41 95 14 53 76 29 74 28 9 21 72 77 40 55 62 93 99 4 57 67 24 17 46 8 64 26 34 30 96 3 18 63 92 27 79 87 85 86 91 88 7 71 84 69 52\n1\nna\n19\n0 72 0 0 0 1 5 54 33 74 97 64 0 4 79 49 0 0 0", "output": "0" }, { "input": "70 3\n40 16 4\n3\nwueq\n5\n67 68 48 0 25\nm\n49\n0 48 0 0 0 33 65 41 7 23 38 68 59 40 67 9 51 64 0 6 0 0 58 14 0 43 24 37 0 1 0 10 39 3 54 53 56 0 22 12 32 0 27 0 11 61 0 13 0\noy\n57\n34 0 10 17 32 6 65 69 0 63 26 0 42 60 20 58 24 45 61 0 47 16 38 68 54 11 62 70 0 0 14 56 67 15 57 35 51 4 2 66 0 46 25 0 59 43 0 5 37 28 0 22 12 36 3 13 0", "output": "1\n2\n2" }, { "input": "100 3\n21 78 39\n4\nfwwra\n12\n0 0 38 97 76 4 12 0 99 79 80 89\neyba\n51\n3 52 0 68 27 72 80 19 0 54 93 53 46 29 7 61 67 9 42 47 43 49 94 0 63 0 0 0 69 0 58 18 0 25 34 51 36 0 24 56 83 76 0 71 62 81 0 0 40 11 1\nynzr\n5\n54 56 32 19 35\ndrcltuxj\n22\n0 68 100 19 42 36 0 0 0 75 14 0 65 2 0 38 0 21 92 86 84 0", "output": "2\n2\n1\n2" }, { "input": "50 25\n8 18 41 25 16 39 2 47 49 37 40 23 3 35 15 7 11 28 22 48 10 17 38 46 44\n4\nswyzirxhx\n28\n43 32 14 5 0 17 25 39 0 0 36 0 0 34 27 22 6 13 26 0 0 41 12 16 0 0 0 23\nzyn\n3\n36 12 47\np\n33\n38 0 35 0 6 20 43 9 15 37 17 23 2 0 0 0 0 0 34 0 28 10 33 0 5 4 7 12 36 46 0 0 45\nycaqpkbu\n31\n41 26 16 0 0 36 0 23 0 34 0 0 0 10 42 28 29 22 0 12 0 39 0 0 5 0 13 46 0 17 0", "output": "2\n1\n2\n2" }, { "input": "45 15\n17 34 27 3 39 40 2 22 7 36 8 23 20 26 16\n5\nu\n8\n40 9 17 35 44 0 7 27\njyabbcffhq\n25\n42 11 0 10 24 36 0 0 0 0 0 25 34 0 0 19 0 14 26 0 0 32 16 30 0\nkxtcfi\n37\n0 0 23 31 18 15 10 0 0 0 13 0 0 16 14 42 3 44 39 32 7 26 0 0 11 2 4 33 35 5 0 22 21 27 0 0 37\nc\n3\n24 35 23\nmwljvf\n7\n23 24 16 43 44 0 0", "output": "1\n2\n2\n1\n1" } ]
1,620,453,923
2,147,483,647
Python 3
OK
TESTS
40
124
6,963,200
import sys try: sys.stdin = open('input.txt') sys.stdout = open('output.txt', 'w') except: pass def compl(n, s): return set(filter(lambda x: x not in s, range(1, n + 1))) m, k = list(map(int, input().split())) id = list(map(int, input().split())) n = int(input()) favorite = set(id) if n == 1: print(0) exit() best = [] guaranteed = [] for i in range(n): name = input() cnt = int(input()) tmp = list(map(int, input().split())) s = set() cnt_zero = 0 for elem in tmp: if elem != 0: s.add(elem) else: cnt_zero += 1 inter = s & favorite comp = compl(m, favorite | s) pred = max(0, cnt_zero - len(comp)) g = len(inter) + pred guaranteed.append(g) cnt_zero -= pred b = g + min(cnt_zero, len(favorite - s) - pred) best.append(b) max_g = max(guaranteed) for i in range(n): max_b = 0 for j in range(n): if i == j: continue max_b = max(max_b, best[j]) if guaranteed[i] >= max_b: print(0) elif best[i] < max_g: print(1) else: print(2)
Title: Cinema Time Limit: None seconds Memory Limit: None megabytes Problem Description: Overall there are *m* actors in Berland. Each actor has a personal identifier — an integer from 1 to *m* (distinct actors have distinct identifiers). Vasya likes to watch Berland movies with Berland actors, and he has *k* favorite actors. He watched the movie trailers for the next month and wrote the following information for every movie: the movie title, the number of actors who starred in it, and the identifiers of these actors. Besides, he managed to copy the movie titles and how many actors starred there, but he didn't manage to write down the identifiers of some actors. Vasya looks at his records and wonders which movies may be his favourite, and which ones may not be. Once Vasya learns the exact cast of all movies, his favorite movies will be determined as follows: a movie becomes favorite movie, if no other movie from Vasya's list has more favorite actors. Help the boy to determine the following for each movie: - whether it surely will be his favourite movie;- whether it surely won't be his favourite movie; - can either be favourite or not. Input Specification: The first line of the input contains two integers *m* and *k* (1<=≤<=*m*<=≤<=100,<=1<=≤<=*k*<=≤<=*m*) — the number of actors in Berland and the number of Vasya's favourite actors. The second line contains *k* distinct integers *a**i* (1<=≤<=*a**i*<=≤<=*m*) — the identifiers of Vasya's favourite actors. The third line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of movies in Vasya's list. Then follow *n* blocks of lines, each block contains a movie's description. The *i*-th movie's description contains three lines: - the first line contains string *s**i* (*s**i* consists of lowercase English letters and can have the length of from 1 to 10 characters, inclusive) — the movie's title, - the second line contains a non-negative integer *d**i* (1<=≤<=*d**i*<=≤<=*m*) — the number of actors who starred in this movie,- the third line has *d**i* integers *b**i*,<=*j* (0<=≤<=*b**i*,<=*j*<=≤<=*m*) — the identifiers of the actors who star in this movie. If *b**i*,<=*j*<==<=0, than Vasya doesn't remember the identifier of the *j*-th actor. It is guaranteed that the list of actors for a movie doesn't contain the same actors. All movies have distinct names. The numbers on the lines are separated by single spaces. Output Specification: Print *n* lines in the output. In the *i*-th line print: - 0, if the *i*-th movie will surely be the favourite; - 1, if the *i*-th movie won't surely be the favourite; - 2, if the *i*-th movie can either be favourite, or not favourite. Demo Input: ['5 3\n1 2 3\n6\nfirstfilm\n3\n0 0 0\nsecondfilm\n4\n0 0 4 5\nthirdfilm\n1\n2\nfourthfilm\n1\n5\nfifthfilm\n1\n4\nsixthfilm\n2\n1 0\n', '5 3\n1 3 5\n4\njumanji\n3\n0 0 0\ntheeagle\n5\n1 2 3 4 0\nmatrix\n3\n2 4 0\nsourcecode\n2\n2 4\n'] Demo Output: ['2\n2\n1\n1\n1\n2\n', '2\n0\n1\n1\n'] Note: Note to the second sample: - Movie jumanji can theoretically have from 1 to 3 Vasya's favourite actors. - Movie theeagle has all three favourite actors, as the actor Vasya failed to remember, can only have identifier 5. - Movie matrix can have exactly one favourite actor. - Movie sourcecode doesn't have any favourite actors. Thus, movie theeagle will surely be favourite, movies matrix and sourcecode won't surely be favourite, and movie jumanji can be either favourite (if it has all three favourite actors), or not favourite.
```python import sys try: sys.stdin = open('input.txt') sys.stdout = open('output.txt', 'w') except: pass def compl(n, s): return set(filter(lambda x: x not in s, range(1, n + 1))) m, k = list(map(int, input().split())) id = list(map(int, input().split())) n = int(input()) favorite = set(id) if n == 1: print(0) exit() best = [] guaranteed = [] for i in range(n): name = input() cnt = int(input()) tmp = list(map(int, input().split())) s = set() cnt_zero = 0 for elem in tmp: if elem != 0: s.add(elem) else: cnt_zero += 1 inter = s & favorite comp = compl(m, favorite | s) pred = max(0, cnt_zero - len(comp)) g = len(inter) + pred guaranteed.append(g) cnt_zero -= pred b = g + min(cnt_zero, len(favorite - s) - pred) best.append(b) max_g = max(guaranteed) for i in range(n): max_b = 0 for j in range(n): if i == j: continue max_b = max(max_b, best[j]) if guaranteed[i] >= max_b: print(0) elif best[i] < max_g: print(1) else: print(2) ```
3
892
A
Greed
PROGRAMMING
900
[ "greedy", "implementation" ]
null
null
Jafar has *n* cans of cola. Each can is described by two integers: remaining volume of cola *a**i* and can's capacity *b**i* (*a**i* <=≤<= *b**i*). Jafar has decided to pour all remaining cola into just 2 cans, determine if he can do this or not!
The first line of the input contains one integer *n* (2<=≤<=*n*<=≤<=100<=000) — number of cola cans. The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — volume of remaining cola in cans. The third line contains *n* space-separated integers that *b*1,<=*b*2,<=...,<=*b**n* (*a**i*<=≤<=*b**i*<=≤<=109) — capacities of the cans.
Print "YES" (without quotes) if it is possible to pour all remaining cola in 2 cans. Otherwise print "NO" (without quotes). You can print each letter in any case (upper or lower).
[ "2\n3 5\n3 6\n", "3\n6 8 9\n6 10 12\n", "5\n0 0 5 0 0\n1 1 8 10 5\n", "4\n4 1 0 3\n5 2 2 3\n" ]
[ "YES\n", "NO\n", "YES\n", "YES\n" ]
In the first sample, there are already 2 cans, so the answer is "YES".
500
[ { "input": "2\n3 5\n3 6", "output": "YES" }, { "input": "3\n6 8 9\n6 10 12", "output": "NO" }, { "input": "5\n0 0 5 0 0\n1 1 8 10 5", "output": "YES" }, { "input": "4\n4 1 0 3\n5 2 2 3", "output": "YES" }, { "input": "10\n9 10 24 11 1 7 8 3 28 14\n86 20 34 11 22 94 8 16 73 85", "output": "YES" }, { "input": "4\n25 35 7 31\n70 37 43 35", "output": "YES" }, { "input": "10\n15 26 15 14 14 39 40 4 25 39\n27 72 16 44 69 48 53 17 63 42", "output": "NO" }, { "input": "5\n22 5 19 16 32\n26 10 43 38 37", "output": "NO" }, { "input": "5\n32 4 22 40 26\n39 20 36 98 44", "output": "YES" }, { "input": "6\n18 25 3 10 13 37\n38 73 19 35 24 37", "output": "YES" }, { "input": "2\n2 2\n2 2", "output": "YES" }, { "input": "2\n2 5\n2 5", "output": "YES" }, { "input": "2\n1000 1008\n10000 2352", "output": "YES" }, { "input": "5\n1 2 3 4 5\n1 2 3 4 11", "output": "YES" }, { "input": "4\n1 0 0 0\n2 0 0 0", "output": "YES" }, { "input": "2\n0 0\n1 2", "output": "YES" }, { "input": "3\n9 13 4\n10 14 5", "output": "NO" }, { "input": "2\n0 0\n1 1", "output": "YES" }, { "input": "5\n1 1 2 3 1\n1 1 2 3 4", "output": "NO" }, { "input": "2\n0 0\n0 0", "output": "YES" }, { "input": "3\n5 1 1\n5 5 5", "output": "YES" } ]
1,678,368,072
2,147,483,647
PyPy 3
OK
TESTS
39
280
13,414,400
n = int(input()) a = list(map(int, input().split())) b = list(map(int, input().split())) largest_can = 0 second_largest_can = 0 for i in b: if i >= largest_can: second_largest_can = largest_can largest_can = i elif i > second_largest_can: second_largest_can = i remaining = largest_can + second_largest_can flag = "YES" for i in range(len(a)): remaining -= a[i] if remaining < 0: flag = "NO" break print(flag)
Title: Greed Time Limit: None seconds Memory Limit: None megabytes Problem Description: Jafar has *n* cans of cola. Each can is described by two integers: remaining volume of cola *a**i* and can's capacity *b**i* (*a**i* <=≤<= *b**i*). Jafar has decided to pour all remaining cola into just 2 cans, determine if he can do this or not! Input Specification: The first line of the input contains one integer *n* (2<=≤<=*n*<=≤<=100<=000) — number of cola cans. The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — volume of remaining cola in cans. The third line contains *n* space-separated integers that *b*1,<=*b*2,<=...,<=*b**n* (*a**i*<=≤<=*b**i*<=≤<=109) — capacities of the cans. Output Specification: Print "YES" (without quotes) if it is possible to pour all remaining cola in 2 cans. Otherwise print "NO" (without quotes). You can print each letter in any case (upper or lower). Demo Input: ['2\n3 5\n3 6\n', '3\n6 8 9\n6 10 12\n', '5\n0 0 5 0 0\n1 1 8 10 5\n', '4\n4 1 0 3\n5 2 2 3\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n', 'YES\n'] Note: In the first sample, there are already 2 cans, so the answer is "YES".
```python n = int(input()) a = list(map(int, input().split())) b = list(map(int, input().split())) largest_can = 0 second_largest_can = 0 for i in b: if i >= largest_can: second_largest_can = largest_can largest_can = i elif i > second_largest_can: second_largest_can = i remaining = largest_can + second_largest_can flag = "YES" for i in range(len(a)): remaining -= a[i] if remaining < 0: flag = "NO" break print(flag) ```
3
989
A
A Blend of Springtime
PROGRAMMING
900
[ "implementation", "strings" ]
null
null
"What a pity it's already late spring," sighs Mino with regret, "one more drizzling night and they'd be gone." "But these blends are at their best, aren't they?" Absorbed in the landscape, Kanno remains optimistic. The landscape can be expressed as a row of consecutive cells, each of which either contains a flower of colour amber or buff or canary yellow, or is empty. When a flower withers, it disappears from the cell that it originally belonged to, and it spreads petals of its colour in its two neighbouring cells (or outside the field if the cell is on the side of the landscape). In case petals fall outside the given cells, they simply become invisible. You are to help Kanno determine whether it's possible that after some (possibly none or all) flowers shed their petals, at least one of the cells contains all three colours, considering both petals and flowers. Note that flowers can wither in arbitrary order.
The first and only line of input contains a non-empty string $s$ consisting of uppercase English letters 'A', 'B', 'C' and characters '.' (dots) only ($\lvert s \rvert \leq 100$) — denoting cells containing an amber flower, a buff one, a canary yellow one, and no flowers, respectively.
Output "Yes" if it's possible that all three colours appear in some cell, and "No" otherwise. You can print each letter in any case (upper or lower).
[ ".BAC.\n", "AA..CB\n" ]
[ "Yes\n", "No\n" ]
In the first example, the buff and canary yellow flowers can leave their petals in the central cell, blending all three colours in it. In the second example, it's impossible to satisfy the requirement because there is no way that amber and buff meet in any cell.
500
[ { "input": ".BAC.", "output": "Yes" }, { "input": "AA..CB", "output": "No" }, { "input": ".", "output": "No" }, { "input": "ACB.AAAAAA", "output": "Yes" }, { "input": "B.BC.BBBCA", "output": "Yes" }, { "input": "BA..CAB..B", "output": "Yes" }, { "input": "CACCBAA.BC", "output": "Yes" }, { "input": ".CAACCBBA.CBB.AC..BABCCBCCB..B.BC..CBC.CA.CC.C.CC.B.A.CC.BBCCBB..ACAACAC.CBCCB.AABAAC.CBCC.BA..CCBC.", "output": "Yes" }, { "input": "A", "output": "No" }, { "input": "..", "output": "No" }, { "input": "BC", "output": "No" }, { "input": "CAB", "output": "Yes" }, { "input": "A.CB", "output": "No" }, { "input": "B.ACAA.CA..CBCBBAA.B.CCBCB.CAC.ABC...BC.BCCC.BC.CB", "output": "Yes" }, { "input": "B.B...CC.B..CCCB.CB..CBCB..CBCC.CCBC.B.CB..CA.C.C.", "output": "No" }, { "input": "AA.CBAABABCCC..B..B.ABBABAB.B.B.CCA..CB.B...A..CBC", "output": "Yes" }, { "input": "CA.ABB.CC.B.C.BBBABAAB.BBBAACACAAA.C.AACA.AAC.C.BCCB.CCBC.C..CCACA.CBCCB.CCAABAAB.AACAA..A.AAA.", "output": "No" }, { "input": "CBC...AC.BBBB.BBABABA.CAAACC.AAABB..A.BA..BC.CBBBC.BBBBCCCAA.ACCBB.AB.C.BA..CC..AAAC...AB.A.AAABBA.A", "output": "No" }, { "input": "CC.AAAC.BA.BBB.AABABBCCAA.A.CBCCB.B.BC.ABCBCBBAA.CACA.CCCA.CB.CCB.A.BCCCB...C.A.BCCBC..B.ABABB.C.BCB", "output": "Yes" }, { "input": "CCC..A..CACACCA.CA.ABAAB.BBA..C.AAA...ACB.ACA.CA.B.AB.A..C.BC.BC.A.C....ABBCCACCCBCC.BBBAA.ACCACB.BB", "output": "Yes" }, { "input": "BC.ABACAACC..AC.A..CCCAABBCCACAC.AA.CC.BAABABABBCBB.BA..C.C.C.A.BBA.C..BC.ACACCC.AAAACCCCC.AAC.AC.AB", "output": "Yes" }, { "input": "ACAC.BAA.C..CAAC..ABBAACC..BAA...CC...ACCBBCA.BAABABAACCAC.A.BBCACCC..BCB.BABAAAACCBCB.BCAABBC.C.BBB", "output": "Yes" }, { "input": "CCAC.BCBC.A.ABBAB.C.C.BC.CCABBCBCCBC..B.AA.C.BC...B..BAA.ACCCCBBB.AAAACA.CAACCB.CCB.CC.BCCAB.BBBBABB", "output": "Yes" }, { "input": ".AACAA.AAAAC.BBBB.BC...CCACCACAAA.A..CCA..BCC.AB.ABAAB..AABA...B.C.CBAB.BAAB.A.C.AAC.BBBA.ACAAA.BB.C", "output": "Yes" }, { "input": "CC.ACCC.BCCCCAA.BBAACB.ABABAAAA.A.CBAB.CBACBBC..C.CA.AAA..AA..ABBB.A.C..CBBCAAACC.B..CC.AC..CAABACB.", "output": "Yes" }, { "input": ".BAB.", "output": "No" }, { "input": "BBBBBBBBB", "output": "No" }, { "input": "..AAC..", "output": "No" }, { "input": ".AAABBBCCC.", "output": "No" }, { "input": "AAABC", "output": "Yes" }, { "input": "BBB", "output": "No" }, { "input": "AAAAABABAAAAA", "output": "No" }, { "input": "AABBCC", "output": "No" }, { "input": ".BA", "output": "No" }, { "input": "CAAAAB", "output": "No" } ]
1,618,490,635
2,147,483,647
Python 3
OK
TESTS
37
62
0
s = input() flag = 0 for i in range(len(s)-2): if s[i:i+3] == 'BAC' or s[i:i+3] == 'ABC' or s[i:i+3] == 'CAB' or s[i:i+3] == 'ACB' or s[i:i+3] == 'BCA' or s[i:i+3] == 'CBA': flag = 1 print("Yes") break if flag != 1: print('No')
Title: A Blend of Springtime Time Limit: None seconds Memory Limit: None megabytes Problem Description: "What a pity it's already late spring," sighs Mino with regret, "one more drizzling night and they'd be gone." "But these blends are at their best, aren't they?" Absorbed in the landscape, Kanno remains optimistic. The landscape can be expressed as a row of consecutive cells, each of which either contains a flower of colour amber or buff or canary yellow, or is empty. When a flower withers, it disappears from the cell that it originally belonged to, and it spreads petals of its colour in its two neighbouring cells (or outside the field if the cell is on the side of the landscape). In case petals fall outside the given cells, they simply become invisible. You are to help Kanno determine whether it's possible that after some (possibly none or all) flowers shed their petals, at least one of the cells contains all three colours, considering both petals and flowers. Note that flowers can wither in arbitrary order. Input Specification: The first and only line of input contains a non-empty string $s$ consisting of uppercase English letters 'A', 'B', 'C' and characters '.' (dots) only ($\lvert s \rvert \leq 100$) — denoting cells containing an amber flower, a buff one, a canary yellow one, and no flowers, respectively. Output Specification: Output "Yes" if it's possible that all three colours appear in some cell, and "No" otherwise. You can print each letter in any case (upper or lower). Demo Input: ['.BAC.\n', 'AA..CB\n'] Demo Output: ['Yes\n', 'No\n'] Note: In the first example, the buff and canary yellow flowers can leave their petals in the central cell, blending all three colours in it. In the second example, it's impossible to satisfy the requirement because there is no way that amber and buff meet in any cell.
```python s = input() flag = 0 for i in range(len(s)-2): if s[i:i+3] == 'BAC' or s[i:i+3] == 'ABC' or s[i:i+3] == 'CAB' or s[i:i+3] == 'ACB' or s[i:i+3] == 'BCA' or s[i:i+3] == 'CBA': flag = 1 print("Yes") break if flag != 1: print('No') ```
3
977
D
Divide by three, multiply by two
PROGRAMMING
1,400
[ "dfs and similar", "math", "sortings" ]
null
null
Polycarp likes to play with numbers. He takes some integer number $x$, writes it down on the board, and then performs with it $n - 1$ operations of the two kinds: - divide the number $x$ by $3$ ($x$ must be divisible by $3$); - multiply the number $x$ by $2$. After each operation, Polycarp writes down the result on the board and replaces $x$ by the result. So there will be $n$ numbers on the board after all. You are given a sequence of length $n$ — the numbers that Polycarp wrote down. This sequence is given in arbitrary order, i.e. the order of the sequence can mismatch the order of the numbers written on the board. Your problem is to rearrange (reorder) elements of this sequence in such a way that it can match possible Polycarp's game in the order of the numbers written on the board. I.e. each next number will be exactly two times of the previous number or exactly one third of previous number. It is guaranteed that the answer exists.
The first line of the input contatins an integer number $n$ ($2 \le n \le 100$) — the number of the elements in the sequence. The second line of the input contains $n$ integer numbers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 3 \cdot 10^{18}$) — rearranged (reordered) sequence that Polycarp can wrote down on the board.
Print $n$ integer numbers — rearranged (reordered) input sequence that can be the sequence that Polycarp could write down on the board. It is guaranteed that the answer exists.
[ "6\n4 8 6 3 12 9\n", "4\n42 28 84 126\n", "2\n1000000000000000000 3000000000000000000\n" ]
[ "9 3 6 12 4 8 \n", "126 42 84 28 \n", "3000000000000000000 1000000000000000000 \n" ]
In the first example the given sequence can be rearranged in the following way: $[9, 3, 6, 12, 4, 8]$. It can match possible Polycarp's game which started with $x = 9$.
0
[ { "input": "6\n4 8 6 3 12 9", "output": "9 3 6 12 4 8 " }, { "input": "4\n42 28 84 126", "output": "126 42 84 28 " }, { "input": "2\n1000000000000000000 3000000000000000000", "output": "3000000000000000000 1000000000000000000 " }, { "input": "19\n46875000000000000 732421875000000 5859375000000000 11444091796875 2929687500000000 187500000000000000 91552734375000 11718750000000000 3000000000000000000 22888183593750 1464843750000000 375000000000000000 45776367187500 183105468750000 93750000000000000 366210937500000 23437500000000000 750000000000000000 1500000000000000000", "output": "11444091796875 22888183593750 45776367187500 91552734375000 183105468750000 366210937500000 732421875000000 1464843750000000 2929687500000000 5859375000000000 11718750000000000 23437500000000000 46875000000000000 93750000000000000 187500000000000000 375000000000000000 750000000000000000 1500000000000000000 3000000000000000000 " }, { "input": "6\n558 744 1488 279 2232 1116", "output": "279 558 1116 2232 744 1488 " }, { "input": "17\n2985984 2239488 7077888 5971968 10616832 746496 28311552 3538944 7962624 3145728 15925248 1492992 14155776 5308416 3981312 11943936 9437184", "output": "2239488 746496 1492992 2985984 5971968 11943936 3981312 7962624 15925248 5308416 10616832 3538944 7077888 14155776 28311552 9437184 3145728 " }, { "input": "18\n47775744 7077888 5971968 3538944 4478976 3145728 2985984 4718592 1572864 5308416 1048576 1492992 23887872 10616832 2239488 11943936 15925248 14155776", "output": "2239488 4478976 1492992 2985984 5971968 11943936 23887872 47775744 15925248 5308416 10616832 3538944 7077888 14155776 4718592 1572864 3145728 1048576 " }, { "input": "3\n9000 1000 3000", "output": "9000 3000 1000 " }, { "input": "2\n3000 9000", "output": "9000 3000 " }, { "input": "2\n3000000000000000000 1000000000000000000", "output": "3000000000000000000 1000000000000000000 " }, { "input": "2\n1 3", "output": "3 1 " }, { "input": "2\n1500000000000000000 3000000000000000000", "output": "1500000000000000000 3000000000000000000 " }, { "input": "3\n4 1 2", "output": "1 2 4 " }, { "input": "2\n2000000000000000004 1000000000000000002", "output": "1000000000000000002 2000000000000000004 " }, { "input": "2\n2999999999999999997 999999999999999999", "output": "2999999999999999997 999999999999999999 " }, { "input": "2\n999999999999999999 1999999999999999998", "output": "999999999999999999 1999999999999999998 " }, { "input": "2\n1999999999999999998 999999999999999999", "output": "999999999999999999 1999999999999999998 " }, { "input": "2\n10 5", "output": "5 10 " } ]
1,695,773,719
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
3
46
32,358,400
ln = int(input()) arr = list(map(int,input().split())) dc = {} ans = [] dcans = {} def check(num,cnt,anss): global dc,ln,ans,dcans if num in dc and dc[num]: if cnt==ln: ans = anss dcans = dc.copy() return dc[num]-=1 else: return if cnt>ln: return if num%3==0: check(int(num/3),cnt+1,anss+[num]) check(num*2,cnt+1,anss+[num]) for i in arr: if i in dc: dc[i]+=1 else: dc[i]=1 spare = dc.copy() for i in arr: check(i,1,[]) dc = spare.copy() for i in dcans: if dcans[i]: ans.append(i) break print(*ans)
Title: Divide by three, multiply by two Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp likes to play with numbers. He takes some integer number $x$, writes it down on the board, and then performs with it $n - 1$ operations of the two kinds: - divide the number $x$ by $3$ ($x$ must be divisible by $3$); - multiply the number $x$ by $2$. After each operation, Polycarp writes down the result on the board and replaces $x$ by the result. So there will be $n$ numbers on the board after all. You are given a sequence of length $n$ — the numbers that Polycarp wrote down. This sequence is given in arbitrary order, i.e. the order of the sequence can mismatch the order of the numbers written on the board. Your problem is to rearrange (reorder) elements of this sequence in such a way that it can match possible Polycarp's game in the order of the numbers written on the board. I.e. each next number will be exactly two times of the previous number or exactly one third of previous number. It is guaranteed that the answer exists. Input Specification: The first line of the input contatins an integer number $n$ ($2 \le n \le 100$) — the number of the elements in the sequence. The second line of the input contains $n$ integer numbers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 3 \cdot 10^{18}$) — rearranged (reordered) sequence that Polycarp can wrote down on the board. Output Specification: Print $n$ integer numbers — rearranged (reordered) input sequence that can be the sequence that Polycarp could write down on the board. It is guaranteed that the answer exists. Demo Input: ['6\n4 8 6 3 12 9\n', '4\n42 28 84 126\n', '2\n1000000000000000000 3000000000000000000\n'] Demo Output: ['9 3 6 12 4 8 \n', '126 42 84 28 \n', '3000000000000000000 1000000000000000000 \n'] Note: In the first example the given sequence can be rearranged in the following way: $[9, 3, 6, 12, 4, 8]$. It can match possible Polycarp's game which started with $x = 9$.
```python ln = int(input()) arr = list(map(int,input().split())) dc = {} ans = [] dcans = {} def check(num,cnt,anss): global dc,ln,ans,dcans if num in dc and dc[num]: if cnt==ln: ans = anss dcans = dc.copy() return dc[num]-=1 else: return if cnt>ln: return if num%3==0: check(int(num/3),cnt+1,anss+[num]) check(num*2,cnt+1,anss+[num]) for i in arr: if i in dc: dc[i]+=1 else: dc[i]=1 spare = dc.copy() for i in arr: check(i,1,[]) dc = spare.copy() for i in dcans: if dcans[i]: ans.append(i) break print(*ans) ```
0
189
A
Cut Ribbon
PROGRAMMING
1,300
[ "brute force", "dp" ]
null
null
Polycarpus has a ribbon, its length is *n*. He wants to cut the ribbon in a way that fulfils the following two conditions: - After the cutting each ribbon piece should have length *a*, *b* or *c*. - After the cutting the number of ribbon pieces should be maximum. Help Polycarpus and find the number of ribbon pieces after the required cutting.
The first line contains four space-separated integers *n*, *a*, *b* and *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=4000) — the length of the original ribbon and the acceptable lengths of the ribbon pieces after the cutting, correspondingly. The numbers *a*, *b* and *c* can coincide.
Print a single number — the maximum possible number of ribbon pieces. It is guaranteed that at least one correct ribbon cutting exists.
[ "5 5 3 2\n", "7 5 5 2\n" ]
[ "2\n", "2\n" ]
In the first example Polycarpus can cut the ribbon in such way: the first piece has length 2, the second piece has length 3. In the second example Polycarpus can cut the ribbon in such way: the first piece has length 5, the second piece has length 2.
500
[ { "input": "5 5 3 2", "output": "2" }, { "input": "7 5 5 2", "output": "2" }, { "input": "4 4 4 4", "output": "1" }, { "input": "1 1 1 1", "output": "1" }, { "input": "4000 1 2 3", "output": "4000" }, { "input": "4000 3 4 5", "output": "1333" }, { "input": "10 3 4 5", "output": "3" }, { "input": "100 23 15 50", "output": "2" }, { "input": "3119 3515 1021 7", "output": "11" }, { "input": "918 102 1327 1733", "output": "9" }, { "input": "3164 42 430 1309", "output": "15" }, { "input": "3043 317 1141 2438", "output": "7" }, { "input": "26 1 772 2683", "output": "26" }, { "input": "370 2 1 15", "output": "370" }, { "input": "734 12 6 2", "output": "367" }, { "input": "418 18 14 17", "output": "29" }, { "input": "18 16 28 9", "output": "2" }, { "input": "14 6 2 17", "output": "7" }, { "input": "29 27 18 2", "output": "2" }, { "input": "29 12 7 10", "output": "3" }, { "input": "27 23 4 3", "output": "9" }, { "input": "5 14 5 2", "output": "1" }, { "input": "5 17 26 5", "output": "1" }, { "input": "9 1 10 3", "output": "9" }, { "input": "2 19 15 1", "output": "2" }, { "input": "4 6 4 9", "output": "1" }, { "input": "10 6 2 9", "output": "5" }, { "input": "2 2 9 6", "output": "1" }, { "input": "6 2 4 1", "output": "6" }, { "input": "27 24 5 27", "output": "1" }, { "input": "2683 83 26 2709", "output": "101" }, { "input": "728 412 789 158", "output": "3" }, { "input": "3964 4 2916 176", "output": "991" }, { "input": "3399 2035 2 3334", "output": "683" }, { "input": "3455 244 3301 3", "output": "991" }, { "input": "595 2263 3625 1", "output": "595" }, { "input": "4000 1 1 1", "output": "4000" }, { "input": "3999 2 2 3999", "output": "1" }, { "input": "25 6 8 11", "output": "3" }, { "input": "4000 500 1000 2000", "output": "8" }, { "input": "53 10 11 23", "output": "5" }, { "input": "100 100 1 1", "output": "100" }, { "input": "17 3 4 10", "output": "5" }, { "input": "413 101 102 105", "output": "4" }, { "input": "490 4 49 50", "output": "111" }, { "input": "3999 2 3 3", "output": "1999" }, { "input": "8 3 8 4", "output": "2" }, { "input": "5 1 3 3", "output": "5" }, { "input": "100 3 17 22", "output": "27" }, { "input": "4000 2 3 4", "output": "2000" }, { "input": "4000 3 3 5", "output": "1332" }, { "input": "13 4 6 7", "output": "2" }, { "input": "4000 5 2 2", "output": "2000" }, { "input": "3999 2 2 3", "output": "1999" }, { "input": "4000 33 7 3333", "output": "564" }, { "input": "60 33 20 9", "output": "4" }, { "input": "100 9 11 99", "output": "10" }, { "input": "2009 6 8 9", "output": "334" } ]
1,683,968,840
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
4
1,000
0
m = list(map(int,input().split())) n = m.pop(0) k = 0 for i in range(0,n//m[0]+1): for j in range(0,(n-m[0]*i)//m[1]+1): z = n-i*m[0]-j*m[1] if z%m[2]==0: k = max(k,i+j+z//m[2]) print(k)
Title: Cut Ribbon Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarpus has a ribbon, its length is *n*. He wants to cut the ribbon in a way that fulfils the following two conditions: - After the cutting each ribbon piece should have length *a*, *b* or *c*. - After the cutting the number of ribbon pieces should be maximum. Help Polycarpus and find the number of ribbon pieces after the required cutting. Input Specification: The first line contains four space-separated integers *n*, *a*, *b* and *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=4000) — the length of the original ribbon and the acceptable lengths of the ribbon pieces after the cutting, correspondingly. The numbers *a*, *b* and *c* can coincide. Output Specification: Print a single number — the maximum possible number of ribbon pieces. It is guaranteed that at least one correct ribbon cutting exists. Demo Input: ['5 5 3 2\n', '7 5 5 2\n'] Demo Output: ['2\n', '2\n'] Note: In the first example Polycarpus can cut the ribbon in such way: the first piece has length 2, the second piece has length 3. In the second example Polycarpus can cut the ribbon in such way: the first piece has length 5, the second piece has length 2.
```python m = list(map(int,input().split())) n = m.pop(0) k = 0 for i in range(0,n//m[0]+1): for j in range(0,(n-m[0]*i)//m[1]+1): z = n-i*m[0]-j*m[1] if z%m[2]==0: k = max(k,i+j+z//m[2]) print(k) ```
0
50
A
Domino piling
PROGRAMMING
800
[ "greedy", "math" ]
A. Domino piling
2
256
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions.
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output one number — the maximal number of dominoes, which can be placed.
[ "2 4\n", "3 3\n" ]
[ "4\n", "4\n" ]
none
500
[ { "input": "2 4", "output": "4" }, { "input": "3 3", "output": "4" }, { "input": "1 5", "output": "2" }, { "input": "1 6", "output": "3" }, { "input": "1 15", "output": "7" }, { "input": "1 16", "output": "8" }, { "input": "2 5", "output": "5" }, { "input": "2 6", "output": "6" }, { "input": "2 7", "output": "7" }, { "input": "2 14", "output": "14" }, { "input": "2 15", "output": "15" }, { "input": "1 4", "output": "2" }, { "input": "2 16", "output": "16" }, { "input": "3 5", "output": "7" }, { "input": "3 6", "output": "9" }, { "input": "3 10", "output": "15" }, { "input": "3 14", "output": "21" }, { "input": "3 15", "output": "22" }, { "input": "3 16", "output": "24" }, { "input": "5 7", "output": "17" }, { "input": "16 16", "output": "128" }, { "input": "15 16", "output": "120" }, { "input": "2 3", "output": "3" }, { "input": "15 15", "output": "112" }, { "input": "14 16", "output": "112" }, { "input": "11 13", "output": "71" }, { "input": "5 16", "output": "40" }, { "input": "8 15", "output": "60" }, { "input": "2 2", "output": "2" }, { "input": "3 4", "output": "6" }, { "input": "4 4", "output": "8" }, { "input": "1 1", "output": "0" }, { "input": "1 2", "output": "1" }, { "input": "1 3", "output": "1" }, { "input": "14 15", "output": "105" } ]
1,696,141,923
2,147,483,647
Python 3
OK
TESTS
35
62
0
m, n = [int(e) for e in input().strip().split()] cells_amount = m * n print((m*n)//2)
Title: Domino piling Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions. Input Specification: In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). Output Specification: Output one number — the maximal number of dominoes, which can be placed. Demo Input: ['2 4\n', '3 3\n'] Demo Output: ['4\n', '4\n'] Note: none
```python m, n = [int(e) for e in input().strip().split()] cells_amount = m * n print((m*n)//2) ```
3.9845
0
none
none
none
0
[ "none" ]
null
null
Once upon a time in the Kingdom of Far Far Away lived Sir Lancelot, the chief Royal General. He was very proud of his men and he liked to invite the King to come and watch drill exercises which demonstrated the fighting techniques and tactics of the squad he was in charge of. But time went by and one day Sir Lancelot had a major argument with the Fairy Godmother (there were rumors that the argument occurred after the general spoke badly of the Godmother's flying techniques. That seemed to hurt the Fairy Godmother very deeply). As the result of the argument, the Godmother put a rather strange curse upon the general. It sounded all complicated and quite harmless: "If the squared distance between some two soldiers equals to 5, then those soldiers will conflict with each other!" The drill exercises are held on a rectangular *n*<=×<=*m* field, split into *nm* square 1<=×<=1 segments for each soldier. Thus, the square of the distance between the soldiers that stand on squares (*x*1,<=*y*1) and (*x*2,<=*y*2) equals exactly (*x*1<=-<=*x*2)2<=+<=(*y*1<=-<=*y*2)2. Now not all *nm* squad soldiers can participate in the drill exercises as it was before the Fairy Godmother's curse. Unless, of course, the general wants the soldiers to fight with each other or even worse... For example, if he puts a soldier in the square (2,<=2), then he cannot put soldiers in the squares (1,<=4), (3,<=4), (4,<=1) and (4,<=3) — each of them will conflict with the soldier in the square (2,<=2). Your task is to help the general. You are given the size of the drill exercise field. You are asked to calculate the maximum number of soldiers that can be simultaneously positioned on this field, so that no two soldiers fall under the Fairy Godmother's curse.
The single line contains space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) that represent the size of the drill exercise field.
Print the desired maximum number of warriors.
[ "2 4\n", "3 4\n" ]
[ "4", "6" ]
In the first sample test Sir Lancelot can place his 4 soldiers on the 2 × 4 court as follows (the soldiers' locations are marked with gray circles on the scheme): In the second sample test he can place 6 soldiers on the 3 × 4 site in the following manner:
0
[ { "input": "2 4", "output": "4" }, { "input": "3 4", "output": "6" }, { "input": "4 4", "output": "8" }, { "input": "4 3", "output": "6" }, { "input": "4 2", "output": "4" }, { "input": "1 1", "output": "1" }, { "input": "3 5", "output": "8" }, { "input": "5 3", "output": "8" }, { "input": "506 44", "output": "11132" }, { "input": "555 349", "output": "96848" }, { "input": "757 210", "output": "79485" }, { "input": "419 503", "output": "105379" }, { "input": "515 19", "output": "4893" }, { "input": "204 718", "output": "73236" }, { "input": "862 330", "output": "142230" }, { "input": "494 982", "output": "242554" }, { "input": "967 4", "output": "1934" }, { "input": "449 838", "output": "188131" }, { "input": "635 458", "output": "145415" }, { "input": "156 911", "output": "71058" }, { "input": "409 295", "output": "60328" }, { "input": "755 458", "output": "172895" }, { "input": "936 759", "output": "355212" }, { "input": "771 460", "output": "177330" }, { "input": "563 802", "output": "225763" }, { "input": "953 874", "output": "416461" }, { "input": "354 720", "output": "127440" }, { "input": "915 72", "output": "32940" }, { "input": "860 762", "output": "327660" }, { "input": "396 387", "output": "76626" }, { "input": "675 710", "output": "239625" }, { "input": "728 174", "output": "63336" }, { "input": "883 312", "output": "137748" }, { "input": "701 600", "output": "210300" }, { "input": "824 729", "output": "300348" }, { "input": "886 80", "output": "35440" }, { "input": "762 742", "output": "282702" }, { "input": "781 586", "output": "228833" }, { "input": "44 343", "output": "7546" }, { "input": "847 237", "output": "100370" }, { "input": "169 291", "output": "24590" }, { "input": "961 61", "output": "29311" }, { "input": "695 305", "output": "105988" }, { "input": "854 503", "output": "214781" }, { "input": "1 744", "output": "744" }, { "input": "1 383", "output": "383" }, { "input": "1 166", "output": "166" }, { "input": "557 1", "output": "557" }, { "input": "650 1", "output": "650" }, { "input": "1 995", "output": "995" }, { "input": "1 865", "output": "865" }, { "input": "1 393", "output": "393" }, { "input": "363 1", "output": "363" }, { "input": "1 506", "output": "506" }, { "input": "2 348", "output": "348" }, { "input": "583 2", "output": "584" }, { "input": "2 89", "output": "90" }, { "input": "576 2", "output": "576" }, { "input": "180 2", "output": "180" }, { "input": "719 2", "output": "720" }, { "input": "2 951", "output": "952" }, { "input": "313 2", "output": "314" }, { "input": "433 2", "output": "434" }, { "input": "804 2", "output": "804" }, { "input": "1 991", "output": "991" }, { "input": "1 992", "output": "992" }, { "input": "1 993", "output": "993" }, { "input": "994 1", "output": "994" }, { "input": "995 1", "output": "995" }, { "input": "996 1", "output": "996" }, { "input": "997 1", "output": "997" }, { "input": "1 998", "output": "998" }, { "input": "1 999", "output": "999" }, { "input": "1 1000", "output": "1000" }, { "input": "991 2", "output": "992" }, { "input": "2 992", "output": "992" }, { "input": "993 2", "output": "994" }, { "input": "994 2", "output": "996" }, { "input": "995 2", "output": "996" }, { "input": "2 996", "output": "996" }, { "input": "997 2", "output": "998" }, { "input": "2 998", "output": "1000" }, { "input": "2 999", "output": "1000" }, { "input": "2 1000", "output": "1000" }, { "input": "997 997", "output": "497005" }, { "input": "997 998", "output": "497503" }, { "input": "997 999", "output": "498002" }, { "input": "997 1000", "output": "498500" }, { "input": "998 997", "output": "497503" }, { "input": "998 998", "output": "498002" }, { "input": "998 999", "output": "498501" }, { "input": "998 1000", "output": "499000" }, { "input": "999 997", "output": "498002" }, { "input": "999 998", "output": "498501" }, { "input": "999 999", "output": "499001" }, { "input": "999 1000", "output": "499500" }, { "input": "1000 997", "output": "498500" }, { "input": "1000 998", "output": "499000" }, { "input": "1000 999", "output": "499500" }, { "input": "1000 1000", "output": "500000" }, { "input": "3 3", "output": "5" }, { "input": "1 2", "output": "2" }, { "input": "2 2", "output": "4" } ]
1,676,467,876
4,576
PyPy 3-64
WRONG_ANSWER
TESTS
8
218
4,198,400
n,m = map(int,input().split()) ans = 0 for i in range(2): rs = (n+2)//3 rrss = n-rs p = m//10 q = m%10 tmp = rs*p*5+rs*min(q, 5) + p*rrss if q >= 8: tmp += rrss ans = max(ans,tmp) dp = [[0]*m for i in range(n)] dp[0][0] = 1 cnt = 1 for i in range(n): for j in range(m): if i == 0 and j == 0: continue now = 0 if i >= 5: now |= dp[i-5][j] if j >= 5: now |= dp[i][j-5] if i >= 2 and j >= 1: now |= dp[i-2][j-1] if i >= 2 and j+1 <m: now |= dp[i-2][j+1] if i >= 1 and j >= 2: now |= dp[i-1][j-2] if i >= 1 and j+2 < m: now |= dp[i-1][j+2] dp[i][j] = 1-now cnt += 1-now ans = max(ans, cnt) n,m = m,n print(ans)
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once upon a time in the Kingdom of Far Far Away lived Sir Lancelot, the chief Royal General. He was very proud of his men and he liked to invite the King to come and watch drill exercises which demonstrated the fighting techniques and tactics of the squad he was in charge of. But time went by and one day Sir Lancelot had a major argument with the Fairy Godmother (there were rumors that the argument occurred after the general spoke badly of the Godmother's flying techniques. That seemed to hurt the Fairy Godmother very deeply). As the result of the argument, the Godmother put a rather strange curse upon the general. It sounded all complicated and quite harmless: "If the squared distance between some two soldiers equals to 5, then those soldiers will conflict with each other!" The drill exercises are held on a rectangular *n*<=×<=*m* field, split into *nm* square 1<=×<=1 segments for each soldier. Thus, the square of the distance between the soldiers that stand on squares (*x*1,<=*y*1) and (*x*2,<=*y*2) equals exactly (*x*1<=-<=*x*2)2<=+<=(*y*1<=-<=*y*2)2. Now not all *nm* squad soldiers can participate in the drill exercises as it was before the Fairy Godmother's curse. Unless, of course, the general wants the soldiers to fight with each other or even worse... For example, if he puts a soldier in the square (2,<=2), then he cannot put soldiers in the squares (1,<=4), (3,<=4), (4,<=1) and (4,<=3) — each of them will conflict with the soldier in the square (2,<=2). Your task is to help the general. You are given the size of the drill exercise field. You are asked to calculate the maximum number of soldiers that can be simultaneously positioned on this field, so that no two soldiers fall under the Fairy Godmother's curse. Input Specification: The single line contains space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) that represent the size of the drill exercise field. Output Specification: Print the desired maximum number of warriors. Demo Input: ['2 4\n', '3 4\n'] Demo Output: ['4', '6'] Note: In the first sample test Sir Lancelot can place his 4 soldiers on the 2 × 4 court as follows (the soldiers' locations are marked with gray circles on the scheme): In the second sample test he can place 6 soldiers on the 3 × 4 site in the following manner:
```python n,m = map(int,input().split()) ans = 0 for i in range(2): rs = (n+2)//3 rrss = n-rs p = m//10 q = m%10 tmp = rs*p*5+rs*min(q, 5) + p*rrss if q >= 8: tmp += rrss ans = max(ans,tmp) dp = [[0]*m for i in range(n)] dp[0][0] = 1 cnt = 1 for i in range(n): for j in range(m): if i == 0 and j == 0: continue now = 0 if i >= 5: now |= dp[i-5][j] if j >= 5: now |= dp[i][j-5] if i >= 2 and j >= 1: now |= dp[i-2][j-1] if i >= 2 and j+1 <m: now |= dp[i-2][j+1] if i >= 1 and j >= 2: now |= dp[i-1][j-2] if i >= 1 and j+2 < m: now |= dp[i-1][j+2] dp[i][j] = 1-now cnt += 1-now ans = max(ans, cnt) n,m = m,n print(ans) ```
0
567
A
Lineland Mail
PROGRAMMING
900
[ "greedy", "implementation" ]
null
null
All cities of Lineland are located on the *Ox* coordinate axis. Thus, each city is associated with its position *x**i* — a coordinate on the *Ox* axis. No two cities are located at a single point. Lineland residents love to send letters to each other. A person may send a letter only if the recipient lives in another city (because if they live in the same city, then it is easier to drop in). Strange but true, the cost of sending the letter is exactly equal to the distance between the sender's city and the recipient's city. For each city calculate two values ​​*min**i* and *max**i*, where *min**i* is the minimum cost of sending a letter from the *i*-th city to some other city, and *max**i* is the the maximum cost of sending a letter from the *i*-th city to some other city
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=105) — the number of cities in Lineland. The second line contains the sequence of *n* distinct integers *x*1,<=*x*2,<=...,<=*x**n* (<=-<=109<=≤<=*x**i*<=≤<=109), where *x**i* is the *x*-coordinate of the *i*-th city. All the *x**i*'s are distinct and follow in ascending order.
Print *n* lines, the *i*-th line must contain two integers *min**i*,<=*max**i*, separated by a space, where *min**i* is the minimum cost of sending a letter from the *i*-th city, and *max**i* is the maximum cost of sending a letter from the *i*-th city.
[ "4\n-5 -2 2 7\n", "2\n-1 1\n" ]
[ "3 12\n3 9\n4 7\n5 12\n", "2 2\n2 2\n" ]
none
500
[ { "input": "4\n-5 -2 2 7", "output": "3 12\n3 9\n4 7\n5 12" }, { "input": "2\n-1 1", "output": "2 2\n2 2" }, { "input": "3\n-1 0 1", "output": "1 2\n1 1\n1 2" }, { "input": "4\n-1 0 1 3", "output": "1 4\n1 3\n1 2\n2 4" }, { "input": "3\n-1000000000 0 1000000000", "output": "1000000000 2000000000\n1000000000 1000000000\n1000000000 2000000000" }, { "input": "2\n-1000000000 1000000000", "output": "2000000000 2000000000\n2000000000 2000000000" }, { "input": "10\n1 10 12 15 59 68 130 912 1239 9123", "output": "9 9122\n2 9113\n2 9111\n3 9108\n9 9064\n9 9055\n62 8993\n327 8211\n327 7884\n7884 9122" }, { "input": "5\n-2 -1 0 1 2", "output": "1 4\n1 3\n1 2\n1 3\n1 4" }, { "input": "5\n-2 -1 0 1 3", "output": "1 5\n1 4\n1 3\n1 3\n2 5" }, { "input": "3\n-10000 1 10000", "output": "10001 20000\n9999 10001\n9999 20000" }, { "input": "5\n-1000000000 -999999999 -999999998 -999999997 -999999996", "output": "1 4\n1 3\n1 2\n1 3\n1 4" }, { "input": "10\n-857422304 -529223472 82412729 145077145 188538640 265299215 527377039 588634631 592896147 702473706", "output": "328198832 1559896010\n328198832 1231697178\n62664416 939835033\n43461495 1002499449\n43461495 1045960944\n76760575 1122721519\n61257592 1384799343\n4261516 1446056935\n4261516 1450318451\n109577559 1559896010" }, { "input": "10\n-876779400 -829849659 -781819137 -570920213 18428128 25280705 121178189 219147240 528386329 923854124", "output": "46929741 1800633524\n46929741 1753703783\n48030522 1705673261\n210898924 1494774337\n6852577 905425996\n6852577 902060105\n95897484 997957589\n97969051 1095926640\n309239089 1405165729\n395467795 1800633524" }, { "input": "30\n-15 1 21 25 30 40 59 60 77 81 97 100 103 123 139 141 157 158 173 183 200 215 226 231 244 256 267 279 289 292", "output": "16 307\n16 291\n4 271\n4 267\n5 262\n10 252\n1 233\n1 232\n4 215\n4 211\n3 195\n3 192\n3 189\n16 169\n2 154\n2 156\n1 172\n1 173\n10 188\n10 198\n15 215\n11 230\n5 241\n5 246\n12 259\n11 271\n11 282\n10 294\n3 304\n3 307" }, { "input": "10\n-1000000000 -999999999 -999999997 -999999996 -999999995 -999999994 -999999992 -999999990 -999999988 -999999986", "output": "1 14\n1 13\n1 11\n1 10\n1 9\n1 8\n2 8\n2 10\n2 12\n2 14" }, { "input": "50\n-50000 -49459 -48875 -48456 -48411 -48096 -47901 -47500 -47150 -46808 -46687 -46679 -46337 -45747 -45604 -45194 -44752 -44242 -44231 -44122 -43636 -43274 -42916 -42881 -42386 -42095 -41830 -41618 -41145 -40897 -40534 -40007 -39761 -39389 -39104 -38909 -38630 -38561 -38364 -38255 -38214 -38084 -37959 -37607 -37202 -36890 -36681 -36136 -36123 -35886", "output": "541 14114\n541 13573\n419 12989\n45 12570\n45 12525\n195 12210\n195 12015\n350 11614\n342 11264\n121 10922\n8 10801\n8 10793\n342 10451\n143 9861\n143 9718\n410 9308\n442 8866\n11 8356\n11 8345\n109 8236\n362 7750\n358 7388\n35 7084\n35 7119\n291 7614\n265 7905\n212 8170\n212 8382\n248 8855\n248 9103\n363 9466\n246 9993\n246 10239\n285 10611\n195 10896\n195 11091\n69 11370\n69 11439\n109 11636\n41 11745\n41 11786\n125 11916\n125 12041\n352 12393\n312 12798\n209 13110\n209 13319\n13 13864\n13 13877\n237 141..." }, { "input": "3\n-1000000000 999999999 1000000000", "output": "1999999999 2000000000\n1 1999999999\n1 2000000000" } ]
1,675,081,715
2,147,483,647
PyPy 3-64
OK
TESTS
54
187
16,179,200
n=int(input()) City=[int( x ) for x in input().split()] for i in range(n): if i==0: minNode=abs(City[i] - City[i+1]) maxNode = abs(City[i] - City[-1]) elif i==n-1: minNode = abs(City[i] - City[i-1]) maxNode = abs(City[i] - City[0]) else: minNode = min(abs(City[i]-City[i-1]), abs(City[i]-City[i+1])) maxNode = max(abs(City[i]-City[0]), abs(City[i]-City[n-1])) print(minNode,maxNode)
Title: Lineland Mail Time Limit: None seconds Memory Limit: None megabytes Problem Description: All cities of Lineland are located on the *Ox* coordinate axis. Thus, each city is associated with its position *x**i* — a coordinate on the *Ox* axis. No two cities are located at a single point. Lineland residents love to send letters to each other. A person may send a letter only if the recipient lives in another city (because if they live in the same city, then it is easier to drop in). Strange but true, the cost of sending the letter is exactly equal to the distance between the sender's city and the recipient's city. For each city calculate two values ​​*min**i* and *max**i*, where *min**i* is the minimum cost of sending a letter from the *i*-th city to some other city, and *max**i* is the the maximum cost of sending a letter from the *i*-th city to some other city Input Specification: The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=105) — the number of cities in Lineland. The second line contains the sequence of *n* distinct integers *x*1,<=*x*2,<=...,<=*x**n* (<=-<=109<=≤<=*x**i*<=≤<=109), where *x**i* is the *x*-coordinate of the *i*-th city. All the *x**i*'s are distinct and follow in ascending order. Output Specification: Print *n* lines, the *i*-th line must contain two integers *min**i*,<=*max**i*, separated by a space, where *min**i* is the minimum cost of sending a letter from the *i*-th city, and *max**i* is the maximum cost of sending a letter from the *i*-th city. Demo Input: ['4\n-5 -2 2 7\n', '2\n-1 1\n'] Demo Output: ['3 12\n3 9\n4 7\n5 12\n', '2 2\n2 2\n'] Note: none
```python n=int(input()) City=[int( x ) for x in input().split()] for i in range(n): if i==0: minNode=abs(City[i] - City[i+1]) maxNode = abs(City[i] - City[-1]) elif i==n-1: minNode = abs(City[i] - City[i-1]) maxNode = abs(City[i] - City[0]) else: minNode = min(abs(City[i]-City[i-1]), abs(City[i]-City[i+1])) maxNode = max(abs(City[i]-City[0]), abs(City[i]-City[n-1])) print(minNode,maxNode) ```
3
884
D
Boxes And Balls
PROGRAMMING
2,300
[ "data structures", "greedy" ]
null
null
Ivan has *n* different boxes. The first of them contains some balls of *n* different colors. Ivan wants to play a strange game. He wants to distribute the balls into boxes in such a way that for every *i* (1<=≤<=*i*<=≤<=*n*) *i*-th box will contain all balls with color *i*. In order to do this, Ivan will make some turns. Each turn he does the following: 1. Ivan chooses any non-empty box and takes all balls from this box; 1. Then Ivan chooses any *k* empty boxes (the box from the first step becomes empty, and Ivan is allowed to choose it), separates the balls he took on the previous step into *k* non-empty groups and puts each group into one of the boxes. He should put each group into a separate box. He can choose either *k*<==<=2 or *k*<==<=3. The penalty of the turn is the number of balls Ivan takes from the box during the first step of the turn. And penalty of the game is the total penalty of turns made by Ivan until he distributes all balls to corresponding boxes. Help Ivan to determine the minimum possible penalty of the game!
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200000) — the number of boxes and colors. The second line contains *n* integer numbers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=109), where *a**i* is the number of balls with color *i*.
Print one number — the minimum possible penalty of the game.
[ "3\n1 2 3\n", "4\n2 3 4 5\n" ]
[ "6\n", "19\n" ]
In the first example you take all the balls from the first box, choose *k* = 3 and sort all colors to corresponding boxes. Penalty is 6. In the second example you make two turns: 1. Take all the balls from the first box, choose *k* = 3, put balls of color 3 to the third box, of color 4 — to the fourth box and the rest put back into the first box. Penalty is 14; 1. Take all the balls from the first box, choose *k* = 2, put balls of color 1 to the first box, of color 2 — to the second box. Penalty is 5. Total penalty is 19.
0
[ { "input": "3\n1 2 3", "output": "6" }, { "input": "4\n2 3 4 5", "output": "19" }, { "input": "6\n1 4 4 4 4 4", "output": "38" }, { "input": "8\n821407370 380061316 428719552 90851747 825473738 704702117 845629927 245820158", "output": "8176373828" }, { "input": "1\n10", "output": "0" }, { "input": "1\n4", "output": "0" }, { "input": "1\n12312", "output": "0" }, { "input": "1\n1", "output": "0" }, { "input": "2\n3 4", "output": "7" } ]
1,509,712,828
2,147,483,647
Python 3
OK
TESTS
32
530
16,486,400
import heapq n = int(input()) colors_lens = list(map(int, input().split())) if len(colors_lens) % 2 == 0: colors_lens.append(0) heapq.heapify(colors_lens) ans = 0 l = len(colors_lens) while l > 1: su = 0 su += heapq.heappop(colors_lens) su += heapq.heappop(colors_lens) su += heapq.heappop(colors_lens) ans += su heapq.heappush(colors_lens, su) l -= 2 print(ans)
Title: Boxes And Balls Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ivan has *n* different boxes. The first of them contains some balls of *n* different colors. Ivan wants to play a strange game. He wants to distribute the balls into boxes in such a way that for every *i* (1<=≤<=*i*<=≤<=*n*) *i*-th box will contain all balls with color *i*. In order to do this, Ivan will make some turns. Each turn he does the following: 1. Ivan chooses any non-empty box and takes all balls from this box; 1. Then Ivan chooses any *k* empty boxes (the box from the first step becomes empty, and Ivan is allowed to choose it), separates the balls he took on the previous step into *k* non-empty groups and puts each group into one of the boxes. He should put each group into a separate box. He can choose either *k*<==<=2 or *k*<==<=3. The penalty of the turn is the number of balls Ivan takes from the box during the first step of the turn. And penalty of the game is the total penalty of turns made by Ivan until he distributes all balls to corresponding boxes. Help Ivan to determine the minimum possible penalty of the game! Input Specification: The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200000) — the number of boxes and colors. The second line contains *n* integer numbers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=109), where *a**i* is the number of balls with color *i*. Output Specification: Print one number — the minimum possible penalty of the game. Demo Input: ['3\n1 2 3\n', '4\n2 3 4 5\n'] Demo Output: ['6\n', '19\n'] Note: In the first example you take all the balls from the first box, choose *k* = 3 and sort all colors to corresponding boxes. Penalty is 6. In the second example you make two turns: 1. Take all the balls from the first box, choose *k* = 3, put balls of color 3 to the third box, of color 4 — to the fourth box and the rest put back into the first box. Penalty is 14; 1. Take all the balls from the first box, choose *k* = 2, put balls of color 1 to the first box, of color 2 — to the second box. Penalty is 5. Total penalty is 19.
```python import heapq n = int(input()) colors_lens = list(map(int, input().split())) if len(colors_lens) % 2 == 0: colors_lens.append(0) heapq.heapify(colors_lens) ans = 0 l = len(colors_lens) while l > 1: su = 0 su += heapq.heappop(colors_lens) su += heapq.heappop(colors_lens) su += heapq.heappop(colors_lens) ans += su heapq.heappush(colors_lens, su) l -= 2 print(ans) ```
3
514
A
Chewbaсca and Number
PROGRAMMING
1,200
[ "greedy", "implementation" ]
null
null
Luke Skywalker gave Chewbacca an integer number *x*. Chewbacca isn't good at numbers but he loves inverting digits in them. Inverting digit *t* means replacing it with digit 9<=-<=*t*. Help Chewbacca to transform the initial number *x* to the minimum possible positive number by inverting some (possibly, zero) digits. The decimal representation of the final number shouldn't start with a zero.
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=1018) — the number that Luke Skywalker gave to Chewbacca.
Print the minimum possible positive number that Chewbacca can obtain after inverting some digits. The number shouldn't contain leading zeroes.
[ "27\n", "4545\n" ]
[ "22\n", "4444\n" ]
none
500
[ { "input": "27", "output": "22" }, { "input": "4545", "output": "4444" }, { "input": "1", "output": "1" }, { "input": "9", "output": "9" }, { "input": "8772", "output": "1222" }, { "input": "81", "output": "11" }, { "input": "71723447", "output": "21223442" }, { "input": "91730629", "output": "91230320" }, { "input": "420062703497", "output": "420032203402" }, { "input": "332711047202", "output": "332211042202" }, { "input": "3395184971407775", "output": "3304114021402224" }, { "input": "8464062628894325", "output": "1434032321104324" }, { "input": "164324828731963982", "output": "134324121231033012" }, { "input": "384979173822804784", "output": "314020123122104214" }, { "input": "41312150450968417", "output": "41312140440031412" }, { "input": "2156", "output": "2143" }, { "input": "1932", "output": "1032" }, { "input": "5902", "output": "4002" }, { "input": "5728", "output": "4221" }, { "input": "8537", "output": "1432" }, { "input": "55403857", "output": "44403142" }, { "input": "270739", "output": "220230" }, { "input": "28746918", "output": "21243011" }, { "input": "10279211", "output": "10220211" }, { "input": "40289679", "output": "40210320" }, { "input": "545203238506", "output": "444203231403" }, { "input": "461117063340", "output": "431112033340" }, { "input": "658492686568", "output": "341402313431" }, { "input": "857373361868", "output": "142323331131" }, { "input": "429325660016", "output": "420324330013" }, { "input": "9894448650287940", "output": "9104441340212040" }, { "input": "6354510839296263", "output": "3344410130203233" }, { "input": "6873575462224593", "output": "3123424432224403" }, { "input": "4237951492601449", "output": "4232041402301440" }, { "input": "2680352384836991", "output": "2310342314133001" }, { "input": "606187734191890310", "output": "303112234101100310" }, { "input": "351499943576823355", "output": "341400043423123344" }, { "input": "180593481782177068", "output": "110403411212122031" }, { "input": "999999999999999999", "output": "900000000000000000" }, { "input": "1000000000000000000", "output": "1000000000000000000" }, { "input": "9999", "output": "9000" }, { "input": "99", "output": "90" }, { "input": "9991", "output": "9001" } ]
1,677,128,912
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
7
46
0
x = int(input()) y = str(x) z = "" for i in range(len(y)): if (y[i]=='9'): z+='9' else: if (y[i]>='5'): z+=(str(9-int(y[i]))) else: z+=y[i] print(z)
Title: Chewbaсca and Number Time Limit: None seconds Memory Limit: None megabytes Problem Description: Luke Skywalker gave Chewbacca an integer number *x*. Chewbacca isn't good at numbers but he loves inverting digits in them. Inverting digit *t* means replacing it with digit 9<=-<=*t*. Help Chewbacca to transform the initial number *x* to the minimum possible positive number by inverting some (possibly, zero) digits. The decimal representation of the final number shouldn't start with a zero. Input Specification: The first line contains a single integer *x* (1<=≤<=*x*<=≤<=1018) — the number that Luke Skywalker gave to Chewbacca. Output Specification: Print the minimum possible positive number that Chewbacca can obtain after inverting some digits. The number shouldn't contain leading zeroes. Demo Input: ['27\n', '4545\n'] Demo Output: ['22\n', '4444\n'] Note: none
```python x = int(input()) y = str(x) z = "" for i in range(len(y)): if (y[i]=='9'): z+='9' else: if (y[i]>='5'): z+=(str(9-int(y[i]))) else: z+=y[i] print(z) ```
0
788
A
Functions again
PROGRAMMING
1,600
[ "dp", "two pointers" ]
null
null
Something happened in Uzhlyandia again... There are riots on the streets... Famous Uzhlyandian superheroes Shean the Sheep and Stas the Giraffe were called in order to save the situation. Upon the arriving, they found that citizens are worried about maximum values of the Main Uzhlyandian Function *f*, which is defined as follows: In the above formula, 1<=≤<=*l*<=&lt;<=*r*<=≤<=*n* must hold, where *n* is the size of the Main Uzhlyandian Array *a*, and |*x*| means absolute value of *x*. But the heroes skipped their math lessons in school, so they asked you for help. Help them calculate the maximum value of *f* among all possible values of *l* and *r* for the given array *a*.
The first line contains single integer *n* (2<=≤<=*n*<=≤<=105) — the size of the array *a*. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (-109<=≤<=*a**i*<=≤<=109) — the array elements.
Print the only integer — the maximum value of *f*.
[ "5\n1 4 2 3 1\n", "4\n1 5 4 7\n" ]
[ "3", "6" ]
In the first sample case, the optimal value of *f* is reached on intervals [1, 2] and [2, 5]. In the second case maximal value of *f* is reachable only on the whole array.
500
[ { "input": "5\n1 4 2 3 1", "output": "3" }, { "input": "4\n1 5 4 7", "output": "6" }, { "input": "8\n16 14 12 10 8 100 50 0", "output": "92" }, { "input": "2\n1 1", "output": "0" }, { "input": "50\n-5 -9 0 44 -10 37 34 -49 11 -22 -26 44 8 -13 23 -46 34 12 -24 2 -40 -15 -28 38 -40 -42 -42 7 -43 5 2 -11 10 43 9 49 -13 36 2 24 46 50 -15 -26 -6 -6 8 4 -44 -3", "output": "208" }, { "input": "100\n23 64 60 -45 -36 -64 -59 15 -75 69 -30 -7 -20 17 -77 58 93 -76 -98 -22 -31 16 -50 6 -20 -85 1 64 -88 -8 -15 -6 -57 25 91 10 2 -90 74 -66 -42 73 28 49 -85 59 96 79 -25 49 -59 -89 -75 12 -96 -33 -65 -8 -100 -81 17 99 -91 -5 7 -21 1 85 63 86 -26 85 -31 11 -75 35 -82 15 98 93 -55 66 70 36 -38 8 92 -63 -5 60 -78 -7 -22 -1 4 54 36 16 32 -20", "output": "632" }, { "input": "3\n0 0 0", "output": "0" }, { "input": "3\n0 1 -1", "output": "2" }, { "input": "5\n1000000000 0 0 1000000000 -1000000000", "output": "2000000000" }, { "input": "2\n1000000000 -1000000000", "output": "2000000000" }, { "input": "4\n1000000000 0 0 -1000000000", "output": "2000000000" }, { "input": "4\n1 0 1 0", "output": "1" }, { "input": "5\n0 10 20 30 40", "output": "10" }, { "input": "2\n-1000000000 1000000000", "output": "2000000000" }, { "input": "2\n1 2", "output": "1" }, { "input": "9\n1000000000 0 0 1000000000 1000000000 0 0 1000000000 1000000000", "output": "4000000000" }, { "input": "16\n-1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000", "output": "16000000000" }, { "input": "6\n1000000000 0 0 1000000000 1000000000 0", "output": "3000000000" }, { "input": "17\n1000000000 0 0 1000000000 1000000000 0 0 1000000000 1000000000 0 0 1000000000 1000000000 0 0 1000000000 1000000000", "output": "8000000000" }, { "input": "11\n1000000000 0 1 1000000000 999999999 1 0 1000000000 999999999 1 1000000000", "output": "4999999991" }, { "input": "4\n1000000000 -1000000000 -1000000000 1000000000", "output": "4000000000" }, { "input": "10\n1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000", "output": "10000000000" } ]
1,624,880,786
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
4
93
0
def ii(): return int(input()) def si(): return input() def mi(): return map(int,input().split()) def msi(): return map(str,input().split()) def li(): return list(mi()) n=ii() a=li() dp=[[0,0] for i in range(n)] for i in range(1,n): curr=abs(a[i]-a[i-1]) if dp[i-1][0]>0: dp[i][1]=curr dp[i][0]=curr-dp[i-1][1] else: dp[i][1]=curr-dp[i-1][0] if dp[i-1][1]<0: dp[i][0]=curr else: dp[i][0]=curr-dp[i-1][1] print(dp[n-1][1])
Title: Functions again Time Limit: None seconds Memory Limit: None megabytes Problem Description: Something happened in Uzhlyandia again... There are riots on the streets... Famous Uzhlyandian superheroes Shean the Sheep and Stas the Giraffe were called in order to save the situation. Upon the arriving, they found that citizens are worried about maximum values of the Main Uzhlyandian Function *f*, which is defined as follows: In the above formula, 1<=≤<=*l*<=&lt;<=*r*<=≤<=*n* must hold, where *n* is the size of the Main Uzhlyandian Array *a*, and |*x*| means absolute value of *x*. But the heroes skipped their math lessons in school, so they asked you for help. Help them calculate the maximum value of *f* among all possible values of *l* and *r* for the given array *a*. Input Specification: The first line contains single integer *n* (2<=≤<=*n*<=≤<=105) — the size of the array *a*. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (-109<=≤<=*a**i*<=≤<=109) — the array elements. Output Specification: Print the only integer — the maximum value of *f*. Demo Input: ['5\n1 4 2 3 1\n', '4\n1 5 4 7\n'] Demo Output: ['3', '6'] Note: In the first sample case, the optimal value of *f* is reached on intervals [1, 2] and [2, 5]. In the second case maximal value of *f* is reachable only on the whole array.
```python def ii(): return int(input()) def si(): return input() def mi(): return map(int,input().split()) def msi(): return map(str,input().split()) def li(): return list(mi()) n=ii() a=li() dp=[[0,0] for i in range(n)] for i in range(1,n): curr=abs(a[i]-a[i-1]) if dp[i-1][0]>0: dp[i][1]=curr dp[i][0]=curr-dp[i-1][1] else: dp[i][1]=curr-dp[i-1][0] if dp[i-1][1]<0: dp[i][0]=curr else: dp[i][0]=curr-dp[i-1][1] print(dp[n-1][1]) ```
0
137
B
Permutation
PROGRAMMING
1,000
[ "greedy" ]
null
null
"Hey, it's homework time" — thought Polycarpus and of course he started with his favourite subject, IT. Polycarpus managed to solve all tasks but for the last one in 20 minutes. However, as he failed to solve the last task after some considerable time, the boy asked you to help him. The sequence of *n* integers is called a permutation if it contains all integers from 1 to *n* exactly once. You are given an arbitrary sequence *a*1,<=*a*2,<=...,<=*a**n* containing *n* integers. Each integer is not less than 1 and not greater than 5000. Determine what minimum number of elements Polycarpus needs to change to get a permutation (he should not delete or add numbers). In a single change he can modify any single sequence element (i. e. replace it with another integer).
The first line of the input data contains an integer *n* (1<=≤<=*n*<=≤<=5000) which represents how many numbers are in the sequence. The second line contains a sequence of integers *a**i* (1<=≤<=*a**i*<=≤<=5000,<=1<=≤<=*i*<=≤<=*n*).
Print the only number — the minimum number of changes needed to get the permutation.
[ "3\n3 1 2\n", "2\n2 2\n", "5\n5 3 3 3 1\n" ]
[ "0\n", "1\n", "2\n" ]
The first sample contains the permutation, which is why no replacements are required. In the second sample it is enough to replace the first element with the number 1 and that will make the sequence the needed permutation. In the third sample we can replace the second element with number 4 and the fourth element with number 2.
1,000
[ { "input": "3\n3 1 2", "output": "0" }, { "input": "2\n2 2", "output": "1" }, { "input": "5\n5 3 3 3 1", "output": "2" }, { "input": "5\n6 6 6 6 6", "output": "5" }, { "input": "10\n1 1 2 2 8 8 7 7 9 9", "output": "5" }, { "input": "8\n9 8 7 6 5 4 3 2", "output": "1" }, { "input": "15\n1 2 3 4 5 5 4 3 2 1 1 2 3 4 5", "output": "10" }, { "input": "1\n1", "output": "0" }, { "input": "1\n5000", "output": "1" }, { "input": "4\n5000 5000 5000 5000", "output": "4" }, { "input": "5\n3366 3461 4 5 4370", "output": "3" }, { "input": "10\n8 2 10 3 4 6 1 7 9 5", "output": "0" }, { "input": "10\n551 3192 3213 2846 3068 1224 3447 1 10 9", "output": "7" }, { "input": "15\n4 1459 12 4281 3241 2748 10 3590 14 845 3518 1721 2 2880 1974", "output": "10" }, { "input": "15\n15 1 8 2 13 11 12 7 3 14 6 10 9 4 5", "output": "0" }, { "input": "15\n2436 2354 4259 1210 2037 2665 700 3578 2880 973 1317 1024 24 3621 4142", "output": "15" }, { "input": "30\n28 1 3449 9 3242 4735 26 3472 15 21 2698 7 4073 3190 10 3 29 1301 4526 22 345 3876 19 12 4562 2535 2 630 18 27", "output": "14" }, { "input": "100\n50 39 95 30 66 78 2169 4326 81 31 74 34 80 40 19 48 97 63 82 6 88 16 21 57 92 77 10 1213 17 93 32 91 38 4375 29 75 44 22 4 45 14 2395 3254 59 3379 2 85 96 8 83 27 94 1512 2960 100 9 73 79 7 25 55 69 90 99 51 87 98 62 18 35 43 4376 4668 28 72 56 4070 61 65 36 54 4106 11 24 15 86 70 71 4087 23 13 76 20 4694 26 4962 4726 37 14 64", "output": "18" }, { "input": "100\n340 14 3275 2283 2673 1107 817 2243 1226 32 2382 3638 4652 418 68 4962 387 764 4647 159 1846 225 2760 4904 3150 403 3 2439 91 4428 92 4705 75 348 1566 1465 69 6 49 4 62 4643 564 1090 3447 1871 2255 139 24 99 2669 969 86 61 4550 158 4537 3993 1589 872 2907 1888 401 80 1825 1483 63 1 2264 4068 4113 2548 41 885 4806 36 67 167 4447 34 1248 2593 82 202 81 1783 1284 4973 16 43 95 7 865 2091 3008 1793 20 947 4912 3604", "output": "70" }, { "input": "1\n2", "output": "1" }, { "input": "2\n5000 5000", "output": "2" }, { "input": "2\n1 2", "output": "0" }, { "input": "2\n1 1", "output": "1" }, { "input": "2\n2 3", "output": "1" }, { "input": "2\n3 4", "output": "2" }, { "input": "10\n1 2 3 4 5 6 7 1000 10 10", "output": "2" } ]
1,610,569,594
2,147,483,647
Python 3
OK
TESTS
48
154
819,200
from collections import Counter n = int(input()) s = [int(i) for i in input().split()] c = Counter(s) ans = 0 for k, v in c.items(): if k <= n: ans += v - 1 else: ans += v print(ans)
Title: Permutation Time Limit: None seconds Memory Limit: None megabytes Problem Description: "Hey, it's homework time" — thought Polycarpus and of course he started with his favourite subject, IT. Polycarpus managed to solve all tasks but for the last one in 20 minutes. However, as he failed to solve the last task after some considerable time, the boy asked you to help him. The sequence of *n* integers is called a permutation if it contains all integers from 1 to *n* exactly once. You are given an arbitrary sequence *a*1,<=*a*2,<=...,<=*a**n* containing *n* integers. Each integer is not less than 1 and not greater than 5000. Determine what minimum number of elements Polycarpus needs to change to get a permutation (he should not delete or add numbers). In a single change he can modify any single sequence element (i. e. replace it with another integer). Input Specification: The first line of the input data contains an integer *n* (1<=≤<=*n*<=≤<=5000) which represents how many numbers are in the sequence. The second line contains a sequence of integers *a**i* (1<=≤<=*a**i*<=≤<=5000,<=1<=≤<=*i*<=≤<=*n*). Output Specification: Print the only number — the minimum number of changes needed to get the permutation. Demo Input: ['3\n3 1 2\n', '2\n2 2\n', '5\n5 3 3 3 1\n'] Demo Output: ['0\n', '1\n', '2\n'] Note: The first sample contains the permutation, which is why no replacements are required. In the second sample it is enough to replace the first element with the number 1 and that will make the sequence the needed permutation. In the third sample we can replace the second element with number 4 and the fourth element with number 2.
```python from collections import Counter n = int(input()) s = [int(i) for i in input().split()] c = Counter(s) ans = 0 for k, v in c.items(): if k <= n: ans += v - 1 else: ans += v print(ans) ```
3
272
A
Dima and Friends
PROGRAMMING
1,000
[ "implementation", "math" ]
null
null
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place. To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment. For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place. Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show. The numbers in the lines are separated by a single space.
In a single line print the answer to the problem.
[ "1\n1\n", "1\n2\n", "2\n3 5\n" ]
[ "3\n", "2\n", "3\n" ]
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend. In the second sample Dima can show 2 or 4 fingers.
500
[ { "input": "1\n1", "output": "3" }, { "input": "1\n2", "output": "2" }, { "input": "2\n3 5", "output": "3" }, { "input": "2\n3 5", "output": "3" }, { "input": "1\n5", "output": "3" }, { "input": "5\n4 4 3 5 1", "output": "4" }, { "input": "6\n2 3 2 2 1 3", "output": "4" }, { "input": "8\n2 2 5 3 4 3 3 2", "output": "4" }, { "input": "7\n4 1 3 2 2 4 5", "output": "4" }, { "input": "3\n3 5 1", "output": "4" }, { "input": "95\n4 2 3 4 4 5 2 2 4 4 3 5 3 3 3 5 4 2 5 4 2 1 1 3 4 2 1 3 5 4 2 1 1 5 1 1 2 2 4 4 5 4 5 5 2 1 2 2 2 4 5 5 2 4 3 4 4 3 5 2 4 1 5 4 5 1 3 2 4 2 2 1 5 3 1 5 3 4 3 3 2 1 2 2 1 3 1 5 2 3 1 1 2 5 2", "output": "5" }, { "input": "31\n3 2 3 3 3 3 4 4 1 5 5 4 2 4 3 2 2 1 4 4 1 2 3 1 1 5 5 3 4 4 1", "output": "4" }, { "input": "42\n3 1 2 2 5 1 2 2 4 5 4 5 2 5 4 5 4 4 1 4 3 3 4 4 4 4 3 2 1 3 4 5 5 2 1 2 1 5 5 2 4 4", "output": "5" }, { "input": "25\n4 5 5 5 3 1 1 4 4 4 3 5 4 4 1 4 4 1 2 4 2 5 4 5 3", "output": "5" }, { "input": "73\n3 4 3 4 5 1 3 4 2 1 4 2 2 3 5 3 1 4 2 3 2 1 4 5 3 5 2 2 4 3 2 2 5 3 2 3 5 1 3 1 1 4 5 2 4 2 5 1 4 3 1 3 1 4 2 3 3 3 3 5 5 2 5 2 5 4 3 1 1 5 5 2 3", "output": "4" }, { "input": "46\n1 4 4 5 4 5 2 3 5 5 3 2 5 4 1 3 2 2 1 4 3 1 5 5 2 2 2 2 4 4 1 1 4 3 4 3 1 4 2 2 4 2 3 2 5 2", "output": "4" }, { "input": "23\n5 2 1 1 4 2 5 5 3 5 4 5 5 1 1 5 2 4 5 3 4 4 3", "output": "5" }, { "input": "6\n4 2 3 1 3 5", "output": "4" }, { "input": "15\n5 5 5 3 5 4 1 3 3 4 3 4 1 4 4", "output": "5" }, { "input": "93\n1 3 1 4 3 3 5 3 1 4 5 4 3 2 2 4 3 1 4 1 2 3 3 3 2 5 1 3 1 4 5 1 1 1 4 2 1 2 3 1 1 1 5 1 5 5 1 2 5 4 3 2 2 4 4 2 5 4 5 5 3 1 3 1 2 1 3 1 1 2 3 4 4 5 5 3 2 1 3 3 5 1 3 5 4 4 1 3 3 4 2 3 2", "output": "5" }, { "input": "96\n1 5 1 3 2 1 2 2 2 2 3 4 1 1 5 4 4 1 2 3 5 1 4 4 4 1 3 3 1 4 5 4 1 3 5 3 4 4 3 2 1 1 4 4 5 1 1 2 5 1 2 3 1 4 1 2 2 2 3 2 3 3 2 5 2 2 3 3 3 3 2 1 2 4 5 5 1 5 3 2 1 4 3 5 5 5 3 3 5 3 4 3 4 2 1 3", "output": "5" }, { "input": "49\n1 4 4 3 5 2 2 1 5 1 2 1 2 5 1 4 1 4 5 2 4 5 3 5 2 4 2 1 3 4 2 1 4 2 1 1 3 3 2 3 5 4 3 4 2 4 1 4 1", "output": "5" }, { "input": "73\n4 1 3 3 3 1 5 2 1 4 1 1 3 5 1 1 4 5 2 1 5 4 1 5 3 1 5 2 4 5 1 4 3 3 5 2 2 3 3 2 5 1 4 5 2 3 1 4 4 3 5 2 3 5 1 4 3 5 1 2 4 1 3 3 5 4 2 4 2 4 1 2 5", "output": "5" }, { "input": "41\n5 3 5 4 2 5 4 3 1 1 1 5 4 3 4 3 5 4 2 5 4 1 1 3 2 4 5 3 5 1 5 5 1 1 1 4 4 1 2 4 3", "output": "5" }, { "input": "100\n3 3 1 4 2 4 4 3 1 5 1 1 4 4 3 4 4 3 5 4 5 2 4 3 4 1 2 4 5 4 2 1 5 4 1 1 4 3 2 4 1 2 1 4 4 5 5 4 4 5 3 2 5 1 4 2 2 1 1 2 5 2 5 1 5 3 1 4 3 2 4 3 2 2 4 5 5 1 2 3 1 4 1 2 2 2 5 5 2 3 2 4 3 1 1 2 1 2 1 2", "output": "5" }, { "input": "100\n2 1 1 3 5 4 4 2 3 4 3 4 5 4 5 4 2 4 5 3 4 5 4 1 1 4 4 1 1 2 5 4 2 4 5 3 2 5 4 3 4 5 1 3 4 2 5 4 5 4 5 2 4 1 2 5 3 1 4 4 5 3 4 3 1 2 5 4 2 5 4 1 5 3 5 4 1 2 5 3 1 1 1 1 5 3 4 3 5 1 1 5 5 1 1 2 2 1 5 1", "output": "5" }, { "input": "100\n4 4 3 3 2 5 4 4 2 1 4 4 4 5 4 1 2 1 5 2 4 3 4 1 4 1 2 5 1 4 5 4 2 1 2 5 3 4 5 5 2 1 2 2 2 2 2 3 2 5 1 2 2 3 2 5 5 1 3 4 5 2 1 3 4 2 2 4 4 3 3 3 2 3 2 1 5 5 5 2 1 4 2 3 5 1 4 4 2 3 2 5 5 4 3 5 1 3 5 5", "output": "5" }, { "input": "100\n4 4 2 5 4 2 2 3 4 4 3 2 3 3 1 3 4 3 3 4 1 3 1 4 5 3 4 3 1 1 1 3 3 2 3 4 3 4 2 2 1 5 1 4 5 1 1 1 3 3 1 1 3 2 5 4 2 5 2 4 5 4 4 1 1 2 1 1 4 5 1 1 5 3 3 2 5 5 5 1 4 1 4 1 1 3 2 3 4 4 2 5 5 2 5 1 1 3 5 3", "output": "5" }, { "input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "4" }, { "input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5", "output": "5" } ]
1,588,274,581
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
0
216
0
n = int(input())+1 f = sum(map(int,input().split())) l = [x for x in range(1,6) if (f+x)%n+1!=1] print(len(l))
Title: Dima and Friends Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place. To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment. For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place. Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show. The numbers in the lines are separated by a single space. Output Specification: In a single line print the answer to the problem. Demo Input: ['1\n1\n', '1\n2\n', '2\n3 5\n'] Demo Output: ['3\n', '2\n', '3\n'] Note: In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend. In the second sample Dima can show 2 or 4 fingers.
```python n = int(input())+1 f = sum(map(int,input().split())) l = [x for x in range(1,6) if (f+x)%n+1!=1] print(len(l)) ```
0
1,011
A
Stages
PROGRAMMING
900
[ "greedy", "implementation", "sortings" ]
null
null
Natasha is going to fly to Mars. She needs to build a rocket, which consists of several stages in some order. Each of the stages is defined by a lowercase Latin letter. This way, the rocket can be described by the string — concatenation of letters, which correspond to the stages. There are $n$ stages available. The rocket must contain exactly $k$ of them. Stages in the rocket should be ordered by their weight. So, after the stage with some letter can go only stage with a letter, which is at least two positions after in the alphabet (skipping one letter in between, or even more). For example, after letter 'c' can't go letters 'a', 'b', 'c' and 'd', but can go letters 'e', 'f', ..., 'z'. For the rocket to fly as far as possible, its weight should be minimal. The weight of the rocket is equal to the sum of the weights of its stages. The weight of the stage is the number of its letter in the alphabet. For example, the stage 'a 'weighs one ton,' b 'weighs two tons, and' z' — $26$ tons. Build the rocket with the minimal weight or determine, that it is impossible to build a rocket at all. Each stage can be used at most once.
The first line of input contains two integers — $n$ and $k$ ($1 \le k \le n \le 50$) – the number of available stages and the number of stages to use in the rocket. The second line contains string $s$, which consists of exactly $n$ lowercase Latin letters. Each letter defines a new stage, which can be used to build the rocket. Each stage can be used at most once.
Print a single integer — the minimal total weight of the rocket or -1, if it is impossible to build the rocket at all.
[ "5 3\nxyabd\n", "7 4\nproblem\n", "2 2\nab\n", "12 1\nabaabbaaabbb\n" ]
[ "29", "34", "-1", "1" ]
In the first example, the following rockets satisfy the condition: - "adx" (weight is $1+4+24=29$);- "ady" (weight is $1+4+25=30$);- "bdx" (weight is $2+4+24=30$);- "bdy" (weight is $2+4+25=31$). Rocket "adx" has the minimal weight, so the answer is $29$. In the second example, target rocket is "belo". Its weight is $2+5+12+15=34$. In the third example, $n=k=2$, so the rocket must have both stages: 'a' and 'b'. This rocket doesn't satisfy the condition, because these letters are adjacent in the alphabet. Answer is -1.
500
[ { "input": "5 3\nxyabd", "output": "29" }, { "input": "7 4\nproblem", "output": "34" }, { "input": "2 2\nab", "output": "-1" }, { "input": "12 1\nabaabbaaabbb", "output": "1" }, { "input": "50 13\nqwertyuiopasdfghjklzxcvbnmaaaaaaaaaaaaaaaaaaaaaaaa", "output": "169" }, { "input": "50 14\nqwertyuiopasdfghjklzxcvbnmaaaaaaaaaaaaaaaaaaaaaaaa", "output": "-1" }, { "input": "1 1\na", "output": "1" }, { "input": "50 1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "1" }, { "input": "50 2\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "-1" }, { "input": "13 13\nuwgmkyqeiaocs", "output": "169" }, { "input": "13 13\nhzdxpbfvrltnj", "output": "182" }, { "input": "1 1\nn", "output": "14" }, { "input": "10 8\nsmzeblyjqw", "output": "113" }, { "input": "20 20\ntzmvhskkyugkuuxpvtbh", "output": "-1" }, { "input": "30 15\nwjzolzzkfulwgioksfxmcxmnnjtoav", "output": "-1" }, { "input": "40 30\nxumfrflllrrgswehqtsskefixhcxjrxbjmrpsshv", "output": "-1" }, { "input": "50 31\nahbyyoxltryqdmvenemaqnbakglgqolxnaifnqtoclnnqiabpz", "output": "-1" }, { "input": "10 7\niuiukrxcml", "output": "99" }, { "input": "38 2\nvjzarfykmrsrvwbwfwldsulhxtykmjbnwmdufa", "output": "5" }, { "input": "12 6\nfwseyrarkwcd", "output": "61" }, { "input": "2 2\nac", "output": "4" }, { "input": "1 1\nc", "output": "3" }, { "input": "2 2\nad", "output": "5" }, { "input": "2 1\nac", "output": "1" }, { "input": "4 3\nadjz", "output": "15" }, { "input": "3 3\naoz", "output": "42" }, { "input": "3 1\nzzz", "output": "26" }, { "input": "2 1\nxz", "output": "24" }, { "input": "5 1\naaddd", "output": "1" } ]
1,602,521,710
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
4
109
204,800
inp = input().split(' ') n,k = int(inp[0]),int(inp[1]) s = input() arr = [] for i in s: arr.append(ord(i)-96) arr.sort() sum,count,i = 0,0,0 while i < n: sum+=arr[i] if arr[i]+1 == arr[i+1]: i+=2 else: i+=1 count +=1 if count == k: break if count < k: print(-1) else: print(sum)
Title: Stages Time Limit: None seconds Memory Limit: None megabytes Problem Description: Natasha is going to fly to Mars. She needs to build a rocket, which consists of several stages in some order. Each of the stages is defined by a lowercase Latin letter. This way, the rocket can be described by the string — concatenation of letters, which correspond to the stages. There are $n$ stages available. The rocket must contain exactly $k$ of them. Stages in the rocket should be ordered by their weight. So, after the stage with some letter can go only stage with a letter, which is at least two positions after in the alphabet (skipping one letter in between, or even more). For example, after letter 'c' can't go letters 'a', 'b', 'c' and 'd', but can go letters 'e', 'f', ..., 'z'. For the rocket to fly as far as possible, its weight should be minimal. The weight of the rocket is equal to the sum of the weights of its stages. The weight of the stage is the number of its letter in the alphabet. For example, the stage 'a 'weighs one ton,' b 'weighs two tons, and' z' — $26$ tons. Build the rocket with the minimal weight or determine, that it is impossible to build a rocket at all. Each stage can be used at most once. Input Specification: The first line of input contains two integers — $n$ and $k$ ($1 \le k \le n \le 50$) – the number of available stages and the number of stages to use in the rocket. The second line contains string $s$, which consists of exactly $n$ lowercase Latin letters. Each letter defines a new stage, which can be used to build the rocket. Each stage can be used at most once. Output Specification: Print a single integer — the minimal total weight of the rocket or -1, if it is impossible to build the rocket at all. Demo Input: ['5 3\nxyabd\n', '7 4\nproblem\n', '2 2\nab\n', '12 1\nabaabbaaabbb\n'] Demo Output: ['29', '34', '-1', '1'] Note: In the first example, the following rockets satisfy the condition: - "adx" (weight is $1+4+24=29$);- "ady" (weight is $1+4+25=30$);- "bdx" (weight is $2+4+24=30$);- "bdy" (weight is $2+4+25=31$). Rocket "adx" has the minimal weight, so the answer is $29$. In the second example, target rocket is "belo". Its weight is $2+5+12+15=34$. In the third example, $n=k=2$, so the rocket must have both stages: 'a' and 'b'. This rocket doesn't satisfy the condition, because these letters are adjacent in the alphabet. Answer is -1.
```python inp = input().split(' ') n,k = int(inp[0]),int(inp[1]) s = input() arr = [] for i in s: arr.append(ord(i)-96) arr.sort() sum,count,i = 0,0,0 while i < n: sum+=arr[i] if arr[i]+1 == arr[i+1]: i+=2 else: i+=1 count +=1 if count == k: break if count < k: print(-1) else: print(sum) ```
0
257
C
View Angle
PROGRAMMING
1,800
[ "brute force", "geometry", "math" ]
null
null
Flatland has recently introduced a new type of an eye check for the driver's licence. The check goes like that: there is a plane with mannequins standing on it. You should tell the value of the minimum angle with the vertex at the origin of coordinates and with all mannequins standing inside or on the boarder of this angle. As you spend lots of time "glued to the screen", your vision is impaired. So you have to write a program that will pass the check for you.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of mannequins. Next *n* lines contain two space-separated integers each: *x**i*,<=*y**i* (|*x**i*|,<=|*y**i*|<=≤<=1000) — the coordinates of the *i*-th mannequin. It is guaranteed that the origin of the coordinates has no mannequin. It is guaranteed that no two mannequins are located in the same point on the plane.
Print a single real number — the value of the sought angle in degrees. The answer will be considered valid if the relative or absolute error doesn't exceed 10<=-<=6.
[ "2\n2 0\n0 2\n", "3\n2 0\n0 2\n-2 2\n", "4\n2 0\n0 2\n-2 0\n0 -2\n", "2\n2 1\n1 2\n" ]
[ "90.0000000000\n", "135.0000000000\n", "270.0000000000\n", "36.8698976458\n" ]
Solution for the first sample test is shown below: Solution for the second sample test is shown below: Solution for the third sample test is shown below: Solution for the fourth sample test is shown below:
1,500
[ { "input": "2\n2 0\n0 2", "output": "90.0000000000" }, { "input": "3\n2 0\n0 2\n-2 2", "output": "135.0000000000" }, { "input": "4\n2 0\n0 2\n-2 0\n0 -2", "output": "270.0000000000" }, { "input": "2\n2 1\n1 2", "output": "36.8698976458" }, { "input": "1\n1 1", "output": "0.0000000000" }, { "input": "10\n9 7\n10 7\n6 5\n6 10\n7 6\n5 10\n6 7\n10 9\n5 5\n5 8", "output": "28.4429286244" }, { "input": "10\n-1 28\n1 28\n1 25\n0 23\n-1 24\n-1 22\n1 27\n0 30\n1 22\n1 21", "output": "5.3288731964" }, { "input": "10\n-5 9\n-10 6\n-8 8\n-9 9\n-6 5\n-8 9\n-5 7\n-6 6\n-5 10\n-8 7", "output": "32.4711922908" }, { "input": "10\n6 -9\n9 -5\n10 -5\n7 -5\n8 -7\n8 -10\n8 -5\n6 -10\n7 -6\n8 -9", "output": "32.4711922908" }, { "input": "10\n-5 -7\n-8 -10\n-9 -5\n-5 -9\n-9 -8\n-7 -7\n-6 -8\n-6 -10\n-10 -7\n-9 -6", "output": "31.8907918018" }, { "input": "10\n-1 -29\n-1 -26\n1 -26\n-1 -22\n-1 -24\n-1 -21\n1 -24\n-1 -20\n-1 -23\n-1 -25", "output": "5.2483492565" }, { "input": "10\n21 0\n22 1\n30 0\n20 0\n28 0\n29 0\n21 -1\n30 1\n24 1\n26 0", "output": "5.3288731964" }, { "input": "10\n-20 0\n-22 1\n-26 0\n-22 -1\n-30 -1\n-30 0\n-28 0\n-24 1\n-23 -1\n-29 1", "output": "5.2051244050" }, { "input": "10\n-5 -5\n5 -5\n-4 -5\n4 -5\n1 -5\n0 -5\n3 -5\n-2 -5\n2 -5\n-3 -5", "output": "90.0000000000" }, { "input": "10\n-5 -5\n-4 -5\n-2 -5\n4 -5\n5 -5\n3 -5\n2 -5\n-1 -5\n-3 -5\n0 -5", "output": "90.0000000000" }, { "input": "10\n-1 -5\n-5 -5\n2 -5\n-2 -5\n1 -5\n5 -5\n0 -5\n3 -5\n-4 -5\n-3 -5", "output": "90.0000000000" }, { "input": "10\n-1 -5\n-5 -5\n-4 -5\n3 -5\n0 -5\n4 -5\n1 -5\n-2 -5\n5 -5\n-3 -5", "output": "90.0000000000" }, { "input": "10\n5 -5\n4 -5\n-1 -5\n1 -5\n-4 -5\n3 -5\n0 -5\n-5 -5\n-2 -5\n-3 -5", "output": "90.0000000000" }, { "input": "10\n2 -5\n-4 -5\n-2 -5\n4 -5\n-5 -5\n-1 -5\n0 -5\n-3 -5\n3 -5\n1 -5", "output": "83.6598082541" }, { "input": "5\n2 1\n0 1\n2 -1\n-2 -1\n2 0", "output": "233.1301023542" }, { "input": "5\n-2 -2\n2 2\n2 -1\n-2 0\n1 -1", "output": "225.0000000000" }, { "input": "5\n0 -2\n-2 -1\n-1 2\n0 -1\n-1 0", "output": "153.4349488229" }, { "input": "5\n-1 -1\n-2 -1\n1 0\n-1 -2\n-1 1", "output": "225.0000000000" }, { "input": "5\n1 -1\n0 2\n-2 2\n-2 1\n2 1", "output": "198.4349488229" }, { "input": "5\n2 2\n1 2\n-2 -1\n1 1\n-2 -2", "output": "180.0000000000" }, { "input": "2\n1 1\n2 2", "output": "0.0000000000" }, { "input": "27\n-592 -96\n-925 -150\n-111 -18\n-259 -42\n-370 -60\n-740 -120\n-629 -102\n-333 -54\n-407 -66\n-296 -48\n-37 -6\n-999 -162\n-222 -36\n-555 -90\n-814 -132\n-444 -72\n-74 -12\n-185 -30\n-148 -24\n-962 -156\n-777 -126\n-518 -84\n-888 -144\n-666 -108\n-481 -78\n-851 -138\n-703 -114", "output": "0.0000000000" }, { "input": "38\n96 416\n24 104\n6 26\n12 52\n210 910\n150 650\n54 234\n174 754\n114 494\n18 78\n90 390\n36 156\n222 962\n186 806\n126 546\n78 338\n108 468\n180 780\n120 520\n84 364\n66 286\n138 598\n30 130\n228 988\n72 312\n144 624\n198 858\n60 260\n48 208\n102 442\n42 182\n162 702\n132 572\n156 676\n204 884\n216 936\n168 728\n192 832", "output": "0.0000000000" }, { "input": "14\n-2 -134\n-4 -268\n-11 -737\n-7 -469\n-14 -938\n-10 -670\n-3 -201\n-1 -67\n-9 -603\n-6 -402\n-13 -871\n-12 -804\n-8 -536\n-5 -335", "output": "0.0000000000" }, { "input": "14\n588 938\n420 670\n210 335\n252 402\n504 804\n126 201\n42 67\n546 871\n294 469\n84 134\n336 536\n462 737\n168 268\n378 603", "output": "0.0000000000" }, { "input": "20\n-45 147\n-240 784\n-135 441\n-60 196\n-105 343\n-285 931\n-195 637\n-300 980\n-165 539\n-210 686\n-75 245\n-15 49\n-30 98\n-270 882\n-120 392\n-90 294\n-150 490\n-180 588\n-255 833\n-225 735", "output": "0.0000000000" }, { "input": "2\n1 1\n1 -1", "output": "90.0000000000" } ]
1,670,851,629
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
30
0
import math as m n = int(input()) for i in range(n): x,y = map(int,input().split()) if x==0 and y==0: theta = 0 elif x==0 or y==0: if x==0: if y>0: theta = 90 else: theta = 270 if y==0: if x>0: theta = 0 else: theta = 180 elif x>=0 and y>=0: theta = 180*m.atan(y/x)/m.pi elif x>=0 and y<0: theta = 360+180*m.atan(y/x)/m.pi elif x<0 and y>=0: theta = 180+180*m.atan(y/x)/m.pi else: theta = 180+180*m.atan(y/x)/m.pi a.append(theta) a = sorted(a) m = len(a) mx = 0 for i in range(1,m): mx = max(mx,a[i]-a[i-1]) #print(a) y = 360-a[-1] x = a[0] mx = max(mx,x+y) print(360-mx)
Title: View Angle Time Limit: None seconds Memory Limit: None megabytes Problem Description: Flatland has recently introduced a new type of an eye check for the driver's licence. The check goes like that: there is a plane with mannequins standing on it. You should tell the value of the minimum angle with the vertex at the origin of coordinates and with all mannequins standing inside or on the boarder of this angle. As you spend lots of time "glued to the screen", your vision is impaired. So you have to write a program that will pass the check for you. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of mannequins. Next *n* lines contain two space-separated integers each: *x**i*,<=*y**i* (|*x**i*|,<=|*y**i*|<=≤<=1000) — the coordinates of the *i*-th mannequin. It is guaranteed that the origin of the coordinates has no mannequin. It is guaranteed that no two mannequins are located in the same point on the plane. Output Specification: Print a single real number — the value of the sought angle in degrees. The answer will be considered valid if the relative or absolute error doesn't exceed 10<=-<=6. Demo Input: ['2\n2 0\n0 2\n', '3\n2 0\n0 2\n-2 2\n', '4\n2 0\n0 2\n-2 0\n0 -2\n', '2\n2 1\n1 2\n'] Demo Output: ['90.0000000000\n', '135.0000000000\n', '270.0000000000\n', '36.8698976458\n'] Note: Solution for the first sample test is shown below: Solution for the second sample test is shown below: Solution for the third sample test is shown below: Solution for the fourth sample test is shown below:
```python import math as m n = int(input()) for i in range(n): x,y = map(int,input().split()) if x==0 and y==0: theta = 0 elif x==0 or y==0: if x==0: if y>0: theta = 90 else: theta = 270 if y==0: if x>0: theta = 0 else: theta = 180 elif x>=0 and y>=0: theta = 180*m.atan(y/x)/m.pi elif x>=0 and y<0: theta = 360+180*m.atan(y/x)/m.pi elif x<0 and y>=0: theta = 180+180*m.atan(y/x)/m.pi else: theta = 180+180*m.atan(y/x)/m.pi a.append(theta) a = sorted(a) m = len(a) mx = 0 for i in range(1,m): mx = max(mx,a[i]-a[i-1]) #print(a) y = 360-a[-1] x = a[0] mx = max(mx,x+y) print(360-mx) ```
-1
621
A
Wet Shark and Odd and Even
PROGRAMMING
900
[ "implementation" ]
null
null
Today, Wet Shark is given *n* integers. Using any of these integers no more than once, Wet Shark wants to get maximum possible even (divisible by 2) sum. Please, calculate this value for Wet Shark. Note, that if Wet Shark uses no integers from the *n* integers, the sum is an even integer 0.
The first line of the input contains one integer, *n* (1<=≤<=*n*<=≤<=100<=000). The next line contains *n* space separated integers given to Wet Shark. Each of these integers is in range from 1 to 109, inclusive.
Print the maximum possible even sum that can be obtained if we use some of the given integers.
[ "3\n1 2 3\n", "5\n999999999 999999999 999999999 999999999 999999999\n" ]
[ "6", "3999999996" ]
In the first sample, we can simply take all three integers for a total sum of 6. In the second sample Wet Shark should take any four out of five integers 999 999 999.
500
[ { "input": "3\n1 2 3", "output": "6" }, { "input": "5\n999999999 999999999 999999999 999999999 999999999", "output": "3999999996" }, { "input": "1\n1", "output": "0" }, { "input": "15\n39 52 88 78 46 95 84 98 55 3 68 42 6 18 98", "output": "870" }, { "input": "15\n59 96 34 48 8 72 67 90 15 85 7 90 97 47 25", "output": "840" }, { "input": "15\n87 37 91 29 58 45 51 74 70 71 47 38 91 89 44", "output": "922" }, { "input": "15\n11 81 49 7 11 14 30 67 29 50 90 81 77 18 59", "output": "674" }, { "input": "15\n39 21 95 89 73 90 9 55 85 32 30 21 68 59 82", "output": "848" }, { "input": "15\n59 70 48 54 26 67 84 39 40 18 77 69 70 88 93", "output": "902" }, { "input": "15\n87 22 98 32 88 36 72 31 100 97 17 16 60 22 20", "output": "798" }, { "input": "15\n15 63 51 13 37 9 43 19 55 79 57 60 50 59 31", "output": "632" }, { "input": "1\n4", "output": "4" }, { "input": "2\n1 4", "output": "4" }, { "input": "3\n1 2 4", "output": "6" }, { "input": "2\n9 3", "output": "12" }, { "input": "2\n1000000000 1001", "output": "1000000000" }, { "input": "3\n1 8 4", "output": "12" }, { "input": "3\n7 4 4", "output": "8" }, { "input": "5\n2 3 4 5 3", "output": "14" }, { "input": "2\n4 5", "output": "4" }, { "input": "3\n2 4 5", "output": "6" }, { "input": "3\n2 2 3", "output": "4" }, { "input": "2\n2 3", "output": "2" }, { "input": "4\n2 3 7 7", "output": "16" }, { "input": "2\n999999999 2", "output": "2" }, { "input": "2\n2 5", "output": "2" }, { "input": "3\n5 3 1", "output": "8" }, { "input": "4\n3 2 5 7", "output": "14" } ]
1,515,847,903
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
46
5,632,000
l = int(input()) x = str(input()) Sum = 0 odd = [] temp = 0 for n in range(0,len(x)): if x[n] == '\n': if(temp%2 == 0): Sum += temp else: odd += [temp] temp = 0 else: temp = temp*10 + int(x[n]) if len(odd)%2 == 0: Sum+=add1(odd) else: Sum+=add2(odd) print(sum) def add1(x): temp = 0 for n in range(0,len(x)): temp += x[n] def add2(x): temp = 0 min = x[0] for n in range(0,len(x)): if x[n] < min: temp += min min = x[n] else: temp += x[n]
Title: Wet Shark and Odd and Even Time Limit: None seconds Memory Limit: None megabytes Problem Description: Today, Wet Shark is given *n* integers. Using any of these integers no more than once, Wet Shark wants to get maximum possible even (divisible by 2) sum. Please, calculate this value for Wet Shark. Note, that if Wet Shark uses no integers from the *n* integers, the sum is an even integer 0. Input Specification: The first line of the input contains one integer, *n* (1<=≤<=*n*<=≤<=100<=000). The next line contains *n* space separated integers given to Wet Shark. Each of these integers is in range from 1 to 109, inclusive. Output Specification: Print the maximum possible even sum that can be obtained if we use some of the given integers. Demo Input: ['3\n1 2 3\n', '5\n999999999 999999999 999999999 999999999 999999999\n'] Demo Output: ['6', '3999999996'] Note: In the first sample, we can simply take all three integers for a total sum of 6. In the second sample Wet Shark should take any four out of five integers 999 999 999.
```python l = int(input()) x = str(input()) Sum = 0 odd = [] temp = 0 for n in range(0,len(x)): if x[n] == '\n': if(temp%2 == 0): Sum += temp else: odd += [temp] temp = 0 else: temp = temp*10 + int(x[n]) if len(odd)%2 == 0: Sum+=add1(odd) else: Sum+=add2(odd) print(sum) def add1(x): temp = 0 for n in range(0,len(x)): temp += x[n] def add2(x): temp = 0 min = x[0] for n in range(0,len(x)): if x[n] < min: temp += min min = x[n] else: temp += x[n] ```
-1
228
A
Is your horseshoe on the other hoof?
PROGRAMMING
800
[ "implementation" ]
null
null
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers.
Print a single integer — the minimum number of horseshoes Valera needs to buy.
[ "1 7 3 3\n", "7 7 7 7\n" ]
[ "1\n", "3\n" ]
none
500
[ { "input": "1 7 3 3", "output": "1" }, { "input": "7 7 7 7", "output": "3" }, { "input": "81170865 673572653 756938629 995577259", "output": "0" }, { "input": "3491663 217797045 522540872 715355328", "output": "0" }, { "input": "251590420 586975278 916631563 586975278", "output": "1" }, { "input": "259504825 377489979 588153796 377489979", "output": "1" }, { "input": "652588203 931100304 931100304 652588203", "output": "2" }, { "input": "391958720 651507265 391958720 651507265", "output": "2" }, { "input": "90793237 90793237 90793237 90793237", "output": "3" }, { "input": "551651653 551651653 551651653 551651653", "output": "3" }, { "input": "156630260 609654355 668943582 973622757", "output": "0" }, { "input": "17061017 110313588 434481173 796661222", "output": "0" }, { "input": "24975422 256716298 337790533 690960249", "output": "0" }, { "input": "255635360 732742923 798648949 883146723", "output": "0" }, { "input": "133315691 265159773 734556507 265159773", "output": "1" }, { "input": "28442865 741657755 978106882 978106882", "output": "1" }, { "input": "131245479 174845575 497483467 131245479", "output": "1" }, { "input": "139159884 616215581 958341883 616215581", "output": "1" }, { "input": "147784432 947653080 947653080 947653080", "output": "2" }, { "input": "94055790 756126496 756126496 94055790", "output": "2" }, { "input": "240458500 511952208 240458500 511952208", "output": "2" }, { "input": "681828506 972810624 972810624 681828506", "output": "2" }, { "input": "454961014 454961014 454961014 454961014", "output": "3" }, { "input": "915819430 915819430 915819430 915819430", "output": "3" }, { "input": "671645142 671645142 671645142 671645142", "output": "3" }, { "input": "132503558 132503558 132503558 132503558", "output": "3" }, { "input": "5 5 999999 6", "output": "1" }, { "input": "1 1 2 5", "output": "1" }, { "input": "2 1 2 3", "output": "1" }, { "input": "1 1 3 5", "output": "1" }, { "input": "1 1 3 3", "output": "2" }, { "input": "2 2 2 1", "output": "2" }, { "input": "3 1 1 1", "output": "2" }, { "input": "1 2 2 2", "output": "2" } ]
1,699,084,210
2,147,483,647
Python 3
OK
TESTS
34
92
0
n = str(input()) n = n.split() moreuseful = set(n) horseshoes = len(n) - len(moreuseful) print(horseshoes)
Title: Is your horseshoe on the other hoof? Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party. Input Specification: The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers. Output Specification: Print a single integer — the minimum number of horseshoes Valera needs to buy. Demo Input: ['1 7 3 3\n', '7 7 7 7\n'] Demo Output: ['1\n', '3\n'] Note: none
```python n = str(input()) n = n.split() moreuseful = set(n) horseshoes = len(n) - len(moreuseful) print(horseshoes) ```
3
805
B
3-palindrome
PROGRAMMING
1,000
[ "constructive algorithms" ]
null
null
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick. He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
Print the string that satisfies all the constraints. If there are multiple answers, print any of them.
[ "2\n", "3\n" ]
[ "aa\n", "bba\n" ]
A palindrome is a sequence of characters which reads the same backward and forward.
1,000
[ { "input": "2", "output": "aa" }, { "input": "3", "output": "aab" }, { "input": "38", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaa" }, { "input": "47", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab" }, { "input": "59", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab" }, { "input": "67", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab" }, { "input": "77", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba" }, { "input": "89", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba" }, { "input": "98", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaa" }, { "input": "109", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba" }, { "input": "117", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba" }, { "input": "1", "output": "a" }, { "input": "200000", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "100000", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "143670", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "104217", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "17879", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "131809", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "140873", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "77859", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "153022", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "179227", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "182801", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "5188", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "86539", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "12802", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "120289", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "132866", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "133377", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "31775", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "160397", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "161415", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "163623", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "22942", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "134767", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "52257", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "64905", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "183758", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "60131", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "146883", "output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..." }, { "input": "6", "output": "aabbaa" }, { "input": "4", "output": "aabb" } ]
1,596,873,577
2,147,483,647
PyPy 3
TIME_LIMIT_EXCEEDED
TESTS
12
1,000
31,539,200
import math n = int(input()) ans = "" last = None if n % 2: if n % 4 == 1: last = "a" else: last = "b" n -= 1 j = (n)//2 ans = "" for i in range(j): if i % 2 == 0: ans += "aa" else: ans += "bb" if last: ans += last print(ans)
Title: 3-palindrome Time Limit: None seconds Memory Limit: None megabytes Problem Description: In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick. He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible. Input Specification: The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string. Output Specification: Print the string that satisfies all the constraints. If there are multiple answers, print any of them. Demo Input: ['2\n', '3\n'] Demo Output: ['aa\n', 'bba\n'] Note: A palindrome is a sequence of characters which reads the same backward and forward.
```python import math n = int(input()) ans = "" last = None if n % 2: if n % 4 == 1: last = "a" else: last = "b" n -= 1 j = (n)//2 ans = "" for i in range(j): if i % 2 == 0: ans += "aa" else: ans += "bb" if last: ans += last print(ans) ```
0
6
A
Triangle
PROGRAMMING
900
[ "brute force", "geometry" ]
A. Triangle
2
64
Johnny has a younger sister Anne, who is very clever and smart. As she came home from the kindergarten, she told his brother about the task that her kindergartener asked her to solve. The task was just to construct a triangle out of four sticks of different colours. Naturally, one of the sticks is extra. It is not allowed to break the sticks or use their partial length. Anne has perfectly solved this task, now she is asking Johnny to do the same. The boy answered that he would cope with it without any difficulty. However, after a while he found out that different tricky things can occur. It can happen that it is impossible to construct a triangle of a positive area, but it is possible to construct a degenerate triangle. It can be so, that it is impossible to construct a degenerate triangle even. As Johnny is very lazy, he does not want to consider such a big amount of cases, he asks you to help him.
The first line of the input contains four space-separated positive integer numbers not exceeding 100 — lengthes of the sticks.
Output TRIANGLE if it is possible to construct a non-degenerate triangle. Output SEGMENT if the first case cannot take place and it is possible to construct a degenerate triangle. Output IMPOSSIBLE if it is impossible to construct any triangle. Remember that you are to use three sticks. It is not allowed to break the sticks or use their partial length.
[ "4 2 1 3\n", "7 2 2 4\n", "3 5 9 1\n" ]
[ "TRIANGLE\n", "SEGMENT\n", "IMPOSSIBLE\n" ]
none
0
[ { "input": "4 2 1 3", "output": "TRIANGLE" }, { "input": "7 2 2 4", "output": "SEGMENT" }, { "input": "3 5 9 1", "output": "IMPOSSIBLE" }, { "input": "3 1 5 1", "output": "IMPOSSIBLE" }, { "input": "10 10 10 10", "output": "TRIANGLE" }, { "input": "11 5 6 11", "output": "TRIANGLE" }, { "input": "1 1 1 1", "output": "TRIANGLE" }, { "input": "10 20 30 40", "output": "TRIANGLE" }, { "input": "45 25 5 15", "output": "IMPOSSIBLE" }, { "input": "20 5 8 13", "output": "TRIANGLE" }, { "input": "10 30 7 20", "output": "SEGMENT" }, { "input": "3 2 3 2", "output": "TRIANGLE" }, { "input": "70 10 100 30", "output": "SEGMENT" }, { "input": "4 8 16 2", "output": "IMPOSSIBLE" }, { "input": "3 3 3 10", "output": "TRIANGLE" }, { "input": "1 5 5 5", "output": "TRIANGLE" }, { "input": "13 25 12 1", "output": "SEGMENT" }, { "input": "10 100 7 3", "output": "SEGMENT" }, { "input": "50 1 50 100", "output": "TRIANGLE" }, { "input": "50 1 100 49", "output": "SEGMENT" }, { "input": "49 51 100 1", "output": "SEGMENT" }, { "input": "5 11 2 25", "output": "IMPOSSIBLE" }, { "input": "91 50 9 40", "output": "IMPOSSIBLE" }, { "input": "27 53 7 97", "output": "IMPOSSIBLE" }, { "input": "51 90 24 8", "output": "IMPOSSIBLE" }, { "input": "3 5 1 1", "output": "IMPOSSIBLE" }, { "input": "13 49 69 15", "output": "IMPOSSIBLE" }, { "input": "16 99 9 35", "output": "IMPOSSIBLE" }, { "input": "27 6 18 53", "output": "IMPOSSIBLE" }, { "input": "57 88 17 8", "output": "IMPOSSIBLE" }, { "input": "95 20 21 43", "output": "IMPOSSIBLE" }, { "input": "6 19 32 61", "output": "IMPOSSIBLE" }, { "input": "100 21 30 65", "output": "IMPOSSIBLE" }, { "input": "85 16 61 9", "output": "IMPOSSIBLE" }, { "input": "5 6 19 82", "output": "IMPOSSIBLE" }, { "input": "1 5 1 3", "output": "IMPOSSIBLE" }, { "input": "65 10 36 17", "output": "IMPOSSIBLE" }, { "input": "81 64 9 7", "output": "IMPOSSIBLE" }, { "input": "11 30 79 43", "output": "IMPOSSIBLE" }, { "input": "1 1 5 3", "output": "IMPOSSIBLE" }, { "input": "21 94 61 31", "output": "IMPOSSIBLE" }, { "input": "49 24 9 74", "output": "IMPOSSIBLE" }, { "input": "11 19 5 77", "output": "IMPOSSIBLE" }, { "input": "52 10 19 71", "output": "SEGMENT" }, { "input": "2 3 7 10", "output": "SEGMENT" }, { "input": "1 2 6 3", "output": "SEGMENT" }, { "input": "2 6 1 8", "output": "SEGMENT" }, { "input": "1 2 4 1", "output": "SEGMENT" }, { "input": "4 10 6 2", "output": "SEGMENT" }, { "input": "2 10 7 3", "output": "SEGMENT" }, { "input": "5 2 3 9", "output": "SEGMENT" }, { "input": "6 1 4 10", "output": "SEGMENT" }, { "input": "10 6 4 1", "output": "SEGMENT" }, { "input": "3 2 9 1", "output": "SEGMENT" }, { "input": "22 80 29 7", "output": "SEGMENT" }, { "input": "2 6 3 9", "output": "SEGMENT" }, { "input": "3 1 2 1", "output": "SEGMENT" }, { "input": "3 4 7 1", "output": "SEGMENT" }, { "input": "8 4 3 1", "output": "SEGMENT" }, { "input": "2 8 3 5", "output": "SEGMENT" }, { "input": "4 1 2 1", "output": "SEGMENT" }, { "input": "8 1 3 2", "output": "SEGMENT" }, { "input": "6 2 1 8", "output": "SEGMENT" }, { "input": "3 3 3 6", "output": "TRIANGLE" }, { "input": "3 6 3 3", "output": "TRIANGLE" }, { "input": "4 10 4 4", "output": "TRIANGLE" }, { "input": "1 1 2 1", "output": "TRIANGLE" }, { "input": "3 3 3 6", "output": "TRIANGLE" }, { "input": "5 4 5 5", "output": "TRIANGLE" }, { "input": "8 7 8 8", "output": "TRIANGLE" }, { "input": "3 3 3 1", "output": "TRIANGLE" }, { "input": "1 1 6 6", "output": "TRIANGLE" }, { "input": "1 9 1 9", "output": "TRIANGLE" }, { "input": "7 2 2 7", "output": "TRIANGLE" }, { "input": "7 2 3 2", "output": "TRIANGLE" }, { "input": "4 4 10 10", "output": "TRIANGLE" }, { "input": "7 7 10 7", "output": "TRIANGLE" }, { "input": "4 4 4 5", "output": "TRIANGLE" }, { "input": "1 10 9 2", "output": "TRIANGLE" }, { "input": "1 8 2 7", "output": "TRIANGLE" }, { "input": "4 3 2 8", "output": "TRIANGLE" }, { "input": "5 9 5 3", "output": "TRIANGLE" }, { "input": "4 10 3 5", "output": "TRIANGLE" } ]
1,619,247,909
2,147,483,647
PyPy 3
OK
TESTS
83
186
0
a=[] a.extend(map(int,input().split())) a.sort() s1=a[0]+a[1] s2=a[1]+a[2] if s1>a[2] or s2>a[3]: print("TRIANGLE") elif s1==a[2] or s2==a[3]: print("SEGMENT") else: print("IMPOSSIBLE")
Title: Triangle Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: Johnny has a younger sister Anne, who is very clever and smart. As she came home from the kindergarten, she told his brother about the task that her kindergartener asked her to solve. The task was just to construct a triangle out of four sticks of different colours. Naturally, one of the sticks is extra. It is not allowed to break the sticks or use their partial length. Anne has perfectly solved this task, now she is asking Johnny to do the same. The boy answered that he would cope with it without any difficulty. However, after a while he found out that different tricky things can occur. It can happen that it is impossible to construct a triangle of a positive area, but it is possible to construct a degenerate triangle. It can be so, that it is impossible to construct a degenerate triangle even. As Johnny is very lazy, he does not want to consider such a big amount of cases, he asks you to help him. Input Specification: The first line of the input contains four space-separated positive integer numbers not exceeding 100 — lengthes of the sticks. Output Specification: Output TRIANGLE if it is possible to construct a non-degenerate triangle. Output SEGMENT if the first case cannot take place and it is possible to construct a degenerate triangle. Output IMPOSSIBLE if it is impossible to construct any triangle. Remember that you are to use three sticks. It is not allowed to break the sticks or use their partial length. Demo Input: ['4 2 1 3\n', '7 2 2 4\n', '3 5 9 1\n'] Demo Output: ['TRIANGLE\n', 'SEGMENT\n', 'IMPOSSIBLE\n'] Note: none
```python a=[] a.extend(map(int,input().split())) a.sort() s1=a[0]+a[1] s2=a[1]+a[2] if s1>a[2] or s2>a[3]: print("TRIANGLE") elif s1==a[2] or s2==a[3]: print("SEGMENT") else: print("IMPOSSIBLE") ```
3.9535
9
A
Die Roll
PROGRAMMING
800
[ "math", "probabilities" ]
A. Die Roll
1
64
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
[ "4 2\n" ]
[ "1/2\n" ]
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
0
[ { "input": "4 2", "output": "1/2" }, { "input": "1 1", "output": "1/1" }, { "input": "1 2", "output": "5/6" }, { "input": "1 3", "output": "2/3" }, { "input": "1 4", "output": "1/2" }, { "input": "1 5", "output": "1/3" }, { "input": "1 6", "output": "1/6" }, { "input": "2 1", "output": "5/6" }, { "input": "2 2", "output": "5/6" }, { "input": "2 3", "output": "2/3" }, { "input": "2 4", "output": "1/2" }, { "input": "2 5", "output": "1/3" }, { "input": "2 6", "output": "1/6" }, { "input": "3 1", "output": "2/3" }, { "input": "3 2", "output": "2/3" }, { "input": "3 3", "output": "2/3" }, { "input": "3 4", "output": "1/2" }, { "input": "3 5", "output": "1/3" }, { "input": "3 6", "output": "1/6" }, { "input": "4 1", "output": "1/2" }, { "input": "4 3", "output": "1/2" }, { "input": "4 4", "output": "1/2" }, { "input": "4 5", "output": "1/3" }, { "input": "4 6", "output": "1/6" }, { "input": "5 1", "output": "1/3" }, { "input": "5 2", "output": "1/3" }, { "input": "5 3", "output": "1/3" }, { "input": "5 4", "output": "1/3" }, { "input": "5 5", "output": "1/3" }, { "input": "5 6", "output": "1/6" }, { "input": "6 1", "output": "1/6" }, { "input": "6 2", "output": "1/6" }, { "input": "6 3", "output": "1/6" }, { "input": "6 4", "output": "1/6" }, { "input": "6 5", "output": "1/6" }, { "input": "6 6", "output": "1/6" } ]
1,664,781,872
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
62
0
x=[] k=input().split() for i in k: x.append(int(i)) m=7-max(x) if 6%m==0: print(f'{1}/{6//m}') elif 6%m==3/2: print('2/3') else: print(f'{m}/{6}')
Title: Die Roll Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win. Input Specification: The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls. Output Specification: Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1». Demo Input: ['4 2\n'] Demo Output: ['1/2\n'] Note: Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
```python x=[] k=input().split() for i in k: x.append(int(i)) m=7-max(x) if 6%m==0: print(f'{1}/{6//m}') elif 6%m==3/2: print('2/3') else: print(f'{m}/{6}') ```
0
996
A
Hit the Lottery
PROGRAMMING
800
[ "dp", "greedy" ]
null
null
Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance?
The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$).
Output the minimum number of bills that Allen could receive.
[ "125\n", "43\n", "1000000000\n" ]
[ "3\n", "5\n", "10000000\n" ]
In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills. In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills. In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
500
[ { "input": "125", "output": "3" }, { "input": "43", "output": "5" }, { "input": "1000000000", "output": "10000000" }, { "input": "4", "output": "4" }, { "input": "5", "output": "1" }, { "input": "1", "output": "1" }, { "input": "74", "output": "8" }, { "input": "31", "output": "3" }, { "input": "59", "output": "8" }, { "input": "79", "output": "9" }, { "input": "7", "output": "3" }, { "input": "55", "output": "4" }, { "input": "40", "output": "2" }, { "input": "719", "output": "13" }, { "input": "847", "output": "13" }, { "input": "225", "output": "4" }, { "input": "4704", "output": "51" }, { "input": "1132", "output": "15" }, { "input": "7811", "output": "80" }, { "input": "7981", "output": "84" }, { "input": "82655", "output": "830" }, { "input": "6364", "output": "70" }, { "input": "74611", "output": "748" }, { "input": "45391", "output": "459" }, { "input": "620448", "output": "6210" }, { "input": "265145", "output": "2654" }, { "input": "671704", "output": "6721" }, { "input": "365173", "output": "3658" }, { "input": "7130872", "output": "71314" }, { "input": "9628747", "output": "96292" }, { "input": "8898399", "output": "88993" }, { "input": "9497953", "output": "94985" }, { "input": "19070947", "output": "190714" }, { "input": "20185520", "output": "201856" }, { "input": "91402248", "output": "914028" }, { "input": "27035533", "output": "270360" }, { "input": "22717528", "output": "227180" }, { "input": "24403439", "output": "244041" }, { "input": "163565555", "output": "1635659" }, { "input": "152541908", "output": "1525423" }, { "input": "668439837", "output": "6684403" }, { "input": "20", "output": "1" }, { "input": "999999999", "output": "10000009" }, { "input": "10", "output": "1" }, { "input": "7", "output": "3" }, { "input": "6", "output": "2" }, { "input": "99999999", "output": "1000009" }, { "input": "1000001", "output": "10001" }, { "input": "2521", "output": "27" } ]
1,683,467,528
2,147,483,647
PyPy 3-64
OK
TESTS
49
61
0
ct=0 a=int(input()) while a>0: if a>=1000: c=a//100 ct+=c a=a-c*100 elif a>=100: a-=100 ct+=1 elif a>=20: a-=20 ct+=1 elif a>=10: a-=10 ct+=1 elif a>=5: a-=5 ct+=1 elif a>=1: a-=1 ct+=1 print(ct)
Title: Hit the Lottery Time Limit: None seconds Memory Limit: None megabytes Problem Description: Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance? Input Specification: The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$). Output Specification: Output the minimum number of bills that Allen could receive. Demo Input: ['125\n', '43\n', '1000000000\n'] Demo Output: ['3\n', '5\n', '10000000\n'] Note: In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills. In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills. In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
```python ct=0 a=int(input()) while a>0: if a>=1000: c=a//100 ct+=c a=a-c*100 elif a>=100: a-=100 ct+=1 elif a>=20: a-=20 ct+=1 elif a>=10: a-=10 ct+=1 elif a>=5: a-=5 ct+=1 elif a>=1: a-=1 ct+=1 print(ct) ```
3
835
A
Key races
PROGRAMMING
800
[ "math" ]
null
null
Two boys decided to compete in text typing on the site "Key races". During the competition, they have to type a text consisting of *s* characters. The first participant types one character in *v*1 milliseconds and has ping *t*1 milliseconds. The second participant types one character in *v*2 milliseconds and has ping *t*2 milliseconds. If connection ping (delay) is *t* milliseconds, the competition passes for a participant as follows: 1. Exactly after *t* milliseconds after the start of the competition the participant receives the text to be entered. 1. Right after that he starts to type it. 1. Exactly *t* milliseconds after he ends typing all the text, the site receives information about it. The winner is the participant whose information on the success comes earlier. If the information comes from both participants at the same time, it is considered that there is a draw. Given the length of the text and the information about participants, determine the result of the game.
The first line contains five integers *s*, *v*1, *v*2, *t*1, *t*2 (1<=≤<=*s*,<=*v*1,<=*v*2,<=*t*1,<=*t*2<=≤<=1000) — the number of characters in the text, the time of typing one character for the first participant, the time of typing one character for the the second participant, the ping of the first participant and the ping of the second participant.
If the first participant wins, print "First". If the second participant wins, print "Second". In case of a draw print "Friendship".
[ "5 1 2 1 2\n", "3 3 1 1 1\n", "4 5 3 1 5\n" ]
[ "First\n", "Second\n", "Friendship\n" ]
In the first example, information on the success of the first participant comes in 7 milliseconds, of the second participant — in 14 milliseconds. So, the first wins. In the second example, information on the success of the first participant comes in 11 milliseconds, of the second participant — in 5 milliseconds. So, the second wins. In the third example, information on the success of the first participant comes in 22 milliseconds, of the second participant — in 22 milliseconds. So, it is be a draw.
500
[ { "input": "5 1 2 1 2", "output": "First" }, { "input": "3 3 1 1 1", "output": "Second" }, { "input": "4 5 3 1 5", "output": "Friendship" }, { "input": "1000 1000 1000 1000 1000", "output": "Friendship" }, { "input": "1 1 1 1 1", "output": "Friendship" }, { "input": "8 8 1 1 1", "output": "Second" }, { "input": "15 14 32 65 28", "output": "First" }, { "input": "894 197 325 232 902", "output": "First" }, { "input": "1 2 8 8 5", "output": "Friendship" }, { "input": "37 261 207 1 1000", "output": "Friendship" }, { "input": "29 344 406 900 1", "output": "Friendship" }, { "input": "1 2 8 9 8", "output": "First" }, { "input": "2 9 8 8 9", "output": "Friendship" }, { "input": "213 480 811 134 745", "output": "First" }, { "input": "2 313 856 964 421", "output": "Friendship" }, { "input": "1 10 2 6 10", "output": "Friendship" }, { "input": "2 7 6 2 3", "output": "Friendship" }, { "input": "637 324 69 612 998", "output": "Second" }, { "input": "13 849 819 723 918", "output": "Friendship" }, { "input": "9 5 7 8 7", "output": "First" }, { "input": "6 5 7 10 4", "output": "Friendship" }, { "input": "61 464 623 89 548", "output": "First" }, { "input": "641 31 29 161 802", "output": "Friendship" }, { "input": "3 3 1 6 9", "output": "Friendship" }, { "input": "2 3 9 8 2", "output": "Friendship" }, { "input": "485 117 368 567 609", "output": "First" }, { "input": "4 202 512 995 375", "output": "Friendship" }, { "input": "424 41 41 909 909", "output": "Friendship" }, { "input": "884 913 263 641 265", "output": "Second" }, { "input": "12 462 8 311 327", "output": "Second" }, { "input": "436 306 266 493 580", "output": "Second" }, { "input": "69 1 2 1 2", "output": "First" } ]
1,634,309,822
2,147,483,647
Python 3
COMPILATION_ERROR
TESTS
0
0
0
/****************************************************************************** Welcome to GDB Online. GDB online is an online compiler and debugger tool for C, C++, Python, Java, PHP, Ruby, Perl, C#, VB, Swift, Pascal, Fortran, Haskell, Objective-C, Assembly, HTML, CSS, JS, SQLite, Prolog. Code, Compile, Run and Debug online from anywhere in world. *******************************************************************************/ #include <iostream> using namespace std; int main() { int c,v1,v2,t1,t2; cin>>c>>v1>>v2>>t1>>t2; if (c*v1+2*t1<c*v2+t2*2){ cout<<"First";} else if (c*v1+2*t1>c*v2+2*t2) { cout<<"Second";} else { cout<<"Friendship";} return 0; }
Title: Key races Time Limit: None seconds Memory Limit: None megabytes Problem Description: Two boys decided to compete in text typing on the site "Key races". During the competition, they have to type a text consisting of *s* characters. The first participant types one character in *v*1 milliseconds and has ping *t*1 milliseconds. The second participant types one character in *v*2 milliseconds and has ping *t*2 milliseconds. If connection ping (delay) is *t* milliseconds, the competition passes for a participant as follows: 1. Exactly after *t* milliseconds after the start of the competition the participant receives the text to be entered. 1. Right after that he starts to type it. 1. Exactly *t* milliseconds after he ends typing all the text, the site receives information about it. The winner is the participant whose information on the success comes earlier. If the information comes from both participants at the same time, it is considered that there is a draw. Given the length of the text and the information about participants, determine the result of the game. Input Specification: The first line contains five integers *s*, *v*1, *v*2, *t*1, *t*2 (1<=≤<=*s*,<=*v*1,<=*v*2,<=*t*1,<=*t*2<=≤<=1000) — the number of characters in the text, the time of typing one character for the first participant, the time of typing one character for the the second participant, the ping of the first participant and the ping of the second participant. Output Specification: If the first participant wins, print "First". If the second participant wins, print "Second". In case of a draw print "Friendship". Demo Input: ['5 1 2 1 2\n', '3 3 1 1 1\n', '4 5 3 1 5\n'] Demo Output: ['First\n', 'Second\n', 'Friendship\n'] Note: In the first example, information on the success of the first participant comes in 7 milliseconds, of the second participant — in 14 milliseconds. So, the first wins. In the second example, information on the success of the first participant comes in 11 milliseconds, of the second participant — in 5 milliseconds. So, the second wins. In the third example, information on the success of the first participant comes in 22 milliseconds, of the second participant — in 22 milliseconds. So, it is be a draw.
```python /****************************************************************************** Welcome to GDB Online. GDB online is an online compiler and debugger tool for C, C++, Python, Java, PHP, Ruby, Perl, C#, VB, Swift, Pascal, Fortran, Haskell, Objective-C, Assembly, HTML, CSS, JS, SQLite, Prolog. Code, Compile, Run and Debug online from anywhere in world. *******************************************************************************/ #include <iostream> using namespace std; int main() { int c,v1,v2,t1,t2; cin>>c>>v1>>v2>>t1>>t2; if (c*v1+2*t1<c*v2+t2*2){ cout<<"First";} else if (c*v1+2*t1>c*v2+2*t2) { cout<<"Second";} else { cout<<"Friendship";} return 0; } ```
-1
780
A
Andryusha and Socks
PROGRAMMING
800
[ "implementation" ]
null
null
Andryusha is an orderly boy and likes to keep things in their place. Today he faced a problem to put his socks in the wardrobe. He has *n* distinct pairs of socks which are initially in a bag. The pairs are numbered from 1 to *n*. Andryusha wants to put paired socks together and put them in the wardrobe. He takes the socks one by one from the bag, and for each sock he looks whether the pair of this sock has been already took out of the bag, or not. If not (that means the pair of this sock is still in the bag), he puts the current socks on the table in front of him. Otherwise, he puts both socks from the pair to the wardrobe. Andryusha remembers the order in which he took the socks from the bag. Can you tell him what is the maximum number of socks that were on the table at the same time?
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=105) — the number of sock pairs. The second line contains 2*n* integers *x*1,<=*x*2,<=...,<=*x*2*n* (1<=≤<=*x**i*<=≤<=*n*), which describe the order in which Andryusha took the socks from the bag. More precisely, *x**i* means that the *i*-th sock Andryusha took out was from pair *x**i*. It is guaranteed that Andryusha took exactly two socks of each pair.
Print single integer — the maximum number of socks that were on the table at the same time.
[ "1\n1 1\n", "3\n2 1 1 3 2 3\n" ]
[ "1\n", "2\n" ]
In the first example Andryusha took a sock from the first pair and put it on the table. Then he took the next sock which is from the first pair as well, so he immediately puts both socks to the wardrobe. Thus, at most one sock was on the table at the same time. In the second example Andryusha behaved as follows: - Initially the table was empty, he took out a sock from pair 2 and put it on the table. - Sock (2) was on the table. Andryusha took out a sock from pair 1 and put it on the table. - Socks (1, 2) were on the table. Andryusha took out a sock from pair 1, and put this pair into the wardrobe. - Sock (2) was on the table. Andryusha took out a sock from pair 3 and put it on the table. - Socks (2, 3) were on the table. Andryusha took out a sock from pair 2, and put this pair into the wardrobe. - Sock (3) was on the table. Andryusha took out a sock from pair 3 and put this pair into the wardrobe.
500
[ { "input": "1\n1 1", "output": "1" }, { "input": "3\n2 1 1 3 2 3", "output": "2" }, { "input": "5\n5 1 3 2 4 3 1 2 4 5", "output": "5" }, { "input": "10\n4 2 6 3 4 8 7 1 1 5 2 10 6 8 3 5 10 9 9 7", "output": "6" }, { "input": "50\n30 47 31 38 37 50 36 43 9 23 2 2 15 31 14 49 9 16 6 44 27 14 5 6 3 47 25 26 1 35 3 15 24 19 8 46 49 41 4 26 40 28 42 11 34 35 46 18 7 28 18 40 19 42 4 41 38 48 50 12 29 39 33 17 25 22 22 21 36 45 27 30 20 7 13 29 39 44 21 8 37 45 34 1 20 10 11 17 33 12 43 13 10 16 48 24 32 5 23 32", "output": "25" }, { "input": "50\n1 1 2 2 3 3 4 4 5 5 6 6 7 7 8 8 9 9 10 10 11 11 12 12 13 13 14 14 15 15 16 16 17 17 18 18 19 19 20 20 21 21 22 22 23 23 24 24 25 25 26 26 27 27 28 28 29 29 30 30 31 31 32 32 33 33 34 34 35 35 36 36 37 37 38 38 39 39 40 40 41 41 42 42 43 43 44 44 45 45 46 46 47 47 48 48 49 49 50 50", "output": "1" }, { "input": "50\n50 50 49 49 48 48 47 47 46 46 45 45 44 44 43 43 42 42 41 41 40 40 39 39 38 38 37 37 36 36 35 35 34 34 33 33 32 32 31 31 30 30 29 29 28 28 27 27 26 26 25 25 24 24 23 23 22 22 21 21 20 20 19 19 18 18 17 17 16 16 15 15 14 14 13 13 12 12 11 11 10 10 9 9 8 8 7 7 6 6 5 5 4 4 3 3 2 2 1 1", "output": "1" }, { "input": "50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50", "output": "50" }, { "input": "50\n50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "50" }, { "input": "10\n2 9 4 1 6 7 10 3 1 5 8 6 2 3 10 7 4 8 5 9", "output": "9" } ]
1,645,810,852
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
3
2,000
13,107,200
n= input() box_socks = [int(x) for x in input().split()] table = [] socks_on_table = 0 max_count = 0 for i in box_socks: if i not in table: socks_on_table +=1 table.append(i) else: if socks_on_table > max_count: max_count = socks_on_table socks_on_table -= 1 table.remove(i) print(max_count)
Title: Andryusha and Socks Time Limit: None seconds Memory Limit: None megabytes Problem Description: Andryusha is an orderly boy and likes to keep things in their place. Today he faced a problem to put his socks in the wardrobe. He has *n* distinct pairs of socks which are initially in a bag. The pairs are numbered from 1 to *n*. Andryusha wants to put paired socks together and put them in the wardrobe. He takes the socks one by one from the bag, and for each sock he looks whether the pair of this sock has been already took out of the bag, or not. If not (that means the pair of this sock is still in the bag), he puts the current socks on the table in front of him. Otherwise, he puts both socks from the pair to the wardrobe. Andryusha remembers the order in which he took the socks from the bag. Can you tell him what is the maximum number of socks that were on the table at the same time? Input Specification: The first line contains the single integer *n* (1<=≤<=*n*<=≤<=105) — the number of sock pairs. The second line contains 2*n* integers *x*1,<=*x*2,<=...,<=*x*2*n* (1<=≤<=*x**i*<=≤<=*n*), which describe the order in which Andryusha took the socks from the bag. More precisely, *x**i* means that the *i*-th sock Andryusha took out was from pair *x**i*. It is guaranteed that Andryusha took exactly two socks of each pair. Output Specification: Print single integer — the maximum number of socks that were on the table at the same time. Demo Input: ['1\n1 1\n', '3\n2 1 1 3 2 3\n'] Demo Output: ['1\n', '2\n'] Note: In the first example Andryusha took a sock from the first pair and put it on the table. Then he took the next sock which is from the first pair as well, so he immediately puts both socks to the wardrobe. Thus, at most one sock was on the table at the same time. In the second example Andryusha behaved as follows: - Initially the table was empty, he took out a sock from pair 2 and put it on the table. - Sock (2) was on the table. Andryusha took out a sock from pair 1 and put it on the table. - Socks (1, 2) were on the table. Andryusha took out a sock from pair 1, and put this pair into the wardrobe. - Sock (2) was on the table. Andryusha took out a sock from pair 3 and put it on the table. - Socks (2, 3) were on the table. Andryusha took out a sock from pair 2, and put this pair into the wardrobe. - Sock (3) was on the table. Andryusha took out a sock from pair 3 and put this pair into the wardrobe.
```python n= input() box_socks = [int(x) for x in input().split()] table = [] socks_on_table = 0 max_count = 0 for i in box_socks: if i not in table: socks_on_table +=1 table.append(i) else: if socks_on_table > max_count: max_count = socks_on_table socks_on_table -= 1 table.remove(i) print(max_count) ```
0
658
A
Bear and Reverse Radewoosh
PROGRAMMING
800
[ "implementation" ]
null
null
Limak and Radewoosh are going to compete against each other in the upcoming algorithmic contest. They are equally skilled but they won't solve problems in the same order. There will be *n* problems. The *i*-th problem has initial score *p**i* and it takes exactly *t**i* minutes to solve it. Problems are sorted by difficulty — it's guaranteed that *p**i*<=&lt;<=*p**i*<=+<=1 and *t**i*<=&lt;<=*t**i*<=+<=1. A constant *c* is given too, representing the speed of loosing points. Then, submitting the *i*-th problem at time *x* (*x* minutes after the start of the contest) gives *max*(0,<= *p**i*<=-<=*c*·*x*) points. Limak is going to solve problems in order 1,<=2,<=...,<=*n* (sorted increasingly by *p**i*). Radewoosh is going to solve them in order *n*,<=*n*<=-<=1,<=...,<=1 (sorted decreasingly by *p**i*). Your task is to predict the outcome — print the name of the winner (person who gets more points at the end) or a word "Tie" in case of a tie. You may assume that the duration of the competition is greater or equal than the sum of all *t**i*. That means both Limak and Radewoosh will accept all *n* problems.
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=50,<=1<=≤<=*c*<=≤<=1000) — the number of problems and the constant representing the speed of loosing points. The second line contains *n* integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=1000,<=*p**i*<=&lt;<=*p**i*<=+<=1) — initial scores. The third line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000,<=*t**i*<=&lt;<=*t**i*<=+<=1) where *t**i* denotes the number of minutes one needs to solve the *i*-th problem.
Print "Limak" (without quotes) if Limak will get more points in total. Print "Radewoosh" (without quotes) if Radewoosh will get more points in total. Print "Tie" (without quotes) if Limak and Radewoosh will get the same total number of points.
[ "3 2\n50 85 250\n10 15 25\n", "3 6\n50 85 250\n10 15 25\n", "8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76\n" ]
[ "Limak\n", "Radewoosh\n", "Tie\n" ]
In the first sample, there are 3 problems. Limak solves them as follows: 1. Limak spends 10 minutes on the 1-st problem and he gets 50 - *c*·10 = 50 - 2·10 = 30 points. 1. Limak spends 15 minutes on the 2-nd problem so he submits it 10 + 15 = 25 minutes after the start of the contest. For the 2-nd problem he gets 85 - 2·25 = 35 points. 1. He spends 25 minutes on the 3-rd problem so he submits it 10 + 15 + 25 = 50 minutes after the start. For this problem he gets 250 - 2·50 = 150 points. So, Limak got 30 + 35 + 150 = 215 points. Radewoosh solves problem in the reversed order: 1. Radewoosh solves 3-rd problem after 25 minutes so he gets 250 - 2·25 = 200 points. 1. He spends 15 minutes on the 2-nd problem so he submits it 25 + 15 = 40 minutes after the start. He gets 85 - 2·40 = 5 points for this problem. 1. He spends 10 minutes on the 1-st problem so he submits it 25 + 15 + 10 = 50 minutes after the start. He gets *max*(0, 50 - 2·50) = *max*(0,  - 50) = 0 points. Radewoosh got 200 + 5 + 0 = 205 points in total. Limak has 215 points so Limak wins. In the second sample, Limak will get 0 points for each problem and Radewoosh will first solve the hardest problem and he will get 250 - 6·25 = 100 points for that. Radewoosh will get 0 points for other two problems but he is the winner anyway. In the third sample, Limak will get 2 points for the 1-st problem and 2 points for the 2-nd problem. Radewoosh will get 4 points for the 8-th problem. They won't get points for other problems and thus there is a tie because 2 + 2 = 4.
500
[ { "input": "3 2\n50 85 250\n10 15 25", "output": "Limak" }, { "input": "3 6\n50 85 250\n10 15 25", "output": "Radewoosh" }, { "input": "8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76", "output": "Tie" }, { "input": "4 1\n3 5 6 9\n1 2 4 8", "output": "Limak" }, { "input": "4 1\n1 3 6 10\n1 5 7 8", "output": "Radewoosh" }, { "input": "4 1\n2 4 5 10\n2 3 9 10", "output": "Tie" }, { "input": "18 4\n68 97 121 132 146 277 312 395 407 431 458 461 595 634 751 855 871 994\n1 2 3 4 9 10 13 21 22 29 31 34 37 38 39 41 48 49", "output": "Radewoosh" }, { "input": "50 1\n5 14 18 73 137 187 195 197 212 226 235 251 262 278 287 304 310 322 342 379 393 420 442 444 448 472 483 485 508 515 517 523 559 585 618 627 636 646 666 682 703 707 780 853 937 951 959 989 991 992\n30 84 113 173 199 220 235 261 266 277 300 306 310 312 347 356 394 396 397 409 414 424 446 462 468 487 507 517 537 566 594 643 656 660 662 668 706 708 773 774 779 805 820 827 868 896 929 942 961 995", "output": "Tie" }, { "input": "4 1\n4 6 9 10\n2 3 4 5", "output": "Radewoosh" }, { "input": "4 1\n4 6 9 10\n3 4 5 7", "output": "Radewoosh" }, { "input": "4 1\n1 6 7 10\n2 7 8 10", "output": "Tie" }, { "input": "4 1\n4 5 7 9\n1 4 5 8", "output": "Limak" }, { "input": "50 1\n6 17 44 82 94 127 134 156 187 211 212 252 256 292 294 303 352 355 379 380 398 409 424 434 480 524 584 594 631 714 745 756 777 778 789 793 799 821 841 849 859 878 879 895 925 932 944 952 958 990\n15 16 40 42 45 71 99 100 117 120 174 181 186 204 221 268 289 332 376 394 403 409 411 444 471 487 499 539 541 551 567 589 619 623 639 669 689 722 735 776 794 822 830 840 847 907 917 927 936 988", "output": "Radewoosh" }, { "input": "50 10\n25 49 52 73 104 117 127 136 149 164 171 184 226 251 257 258 286 324 337 341 386 390 428 453 464 470 492 517 543 565 609 634 636 660 678 693 710 714 729 736 739 749 781 836 866 875 956 960 977 979\n2 4 7 10 11 22 24 26 27 28 31 35 37 38 42 44 45 46 52 53 55 56 57 59 60 61 64 66 67 68 69 71 75 76 77 78 79 81 83 85 86 87 89 90 92 93 94 98 99 100", "output": "Limak" }, { "input": "50 10\n11 15 25 71 77 83 95 108 143 150 182 183 198 203 213 223 279 280 346 348 350 355 375 376 412 413 415 432 470 545 553 562 589 595 607 633 635 637 688 719 747 767 771 799 842 883 905 924 942 944\n1 3 5 6 7 10 11 12 13 14 15 16 19 20 21 23 25 32 35 36 37 38 40 41 42 43 47 50 51 54 55 56 57 58 59 60 62 63 64 65 66 68 69 70 71 72 73 75 78 80", "output": "Radewoosh" }, { "input": "32 6\n25 77 141 148 157 159 192 196 198 244 245 255 332 392 414 457 466 524 575 603 629 700 738 782 838 841 845 847 870 945 984 985\n1 2 4 5 8 9 10 12 13 14 15 16 17 18 20 21 22 23 24 26 28 31 38 39 40 41 42 43 45 47 48 49", "output": "Radewoosh" }, { "input": "5 1\n256 275 469 671 842\n7 9 14 17 26", "output": "Limak" }, { "input": "2 1000\n1 2\n1 2", "output": "Tie" }, { "input": "3 1\n1 50 809\n2 8 800", "output": "Limak" }, { "input": "1 13\n866\n10", "output": "Tie" }, { "input": "15 1\n9 11 66 128 199 323 376 386 393 555 585 718 935 960 971\n3 11 14 19 20 21 24 26 32 38 40 42 44 47 50", "output": "Limak" }, { "input": "1 10\n546\n45", "output": "Tie" }, { "input": "50 20\n21 43 51 99 117 119 158 167 175 190 196 244 250 316 335 375 391 403 423 428 451 457 460 480 487 522 539 559 566 584 598 602 604 616 626 666 675 730 771 787 828 841 861 867 886 889 898 970 986 991\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50", "output": "Limak" }, { "input": "50 21\n13 20 22 38 62 84 118 135 141 152 170 175 194 218 227 229 232 253 260 263 278 313 329 357 396 402 422 452 454 533 575 576 580 594 624 644 653 671 676 759 789 811 816 823 831 833 856 924 933 987\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50", "output": "Tie" }, { "input": "1 36\n312\n42", "output": "Tie" }, { "input": "1 1000\n1\n1000", "output": "Tie" }, { "input": "1 1\n1000\n1", "output": "Tie" }, { "input": "50 35\n9 17 28 107 136 152 169 174 186 188 201 262 291 312 324 330 341 358 385 386 393 397 425 431 479 498 502 523 530 540 542 554 578 588 622 623 684 696 709 722 784 819 836 845 850 932 945 969 983 984\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50", "output": "Tie" }, { "input": "50 20\n12 113 116 120 138 156 167 183 185 194 211 228 234 261 278 287 310 317 346 361 364 397 424 470 496 522 527 536 611 648 668 704 707 712 717 752 761 766 815 828 832 864 872 885 889 901 904 929 982 993\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50", "output": "Limak" } ]
1,550,129,984
2,147,483,647
Python 3
OK
TESTS
29
109
0
a, b = [int(x) for x in input().split()] scores = [int(x) for x in input().split()] times = [int(x) for x in input().split()] l, r, cur_t_1, cur_t_2 = 0, 0, 0, 0 for i in range(0, a): cur_t_1, cur_t_2 = cur_t_1+times[i], cur_t_2+times[a-i-1] l, r = l+max(0, scores[i]-b*cur_t_1), r+max(0, scores[a-i-1]-b*cur_t_2) if l == r: print('Tie') elif l > r: print('Limak') else: print('Radewoosh')
Title: Bear and Reverse Radewoosh Time Limit: None seconds Memory Limit: None megabytes Problem Description: Limak and Radewoosh are going to compete against each other in the upcoming algorithmic contest. They are equally skilled but they won't solve problems in the same order. There will be *n* problems. The *i*-th problem has initial score *p**i* and it takes exactly *t**i* minutes to solve it. Problems are sorted by difficulty — it's guaranteed that *p**i*<=&lt;<=*p**i*<=+<=1 and *t**i*<=&lt;<=*t**i*<=+<=1. A constant *c* is given too, representing the speed of loosing points. Then, submitting the *i*-th problem at time *x* (*x* minutes after the start of the contest) gives *max*(0,<= *p**i*<=-<=*c*·*x*) points. Limak is going to solve problems in order 1,<=2,<=...,<=*n* (sorted increasingly by *p**i*). Radewoosh is going to solve them in order *n*,<=*n*<=-<=1,<=...,<=1 (sorted decreasingly by *p**i*). Your task is to predict the outcome — print the name of the winner (person who gets more points at the end) or a word "Tie" in case of a tie. You may assume that the duration of the competition is greater or equal than the sum of all *t**i*. That means both Limak and Radewoosh will accept all *n* problems. Input Specification: The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=50,<=1<=≤<=*c*<=≤<=1000) — the number of problems and the constant representing the speed of loosing points. The second line contains *n* integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=1000,<=*p**i*<=&lt;<=*p**i*<=+<=1) — initial scores. The third line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000,<=*t**i*<=&lt;<=*t**i*<=+<=1) where *t**i* denotes the number of minutes one needs to solve the *i*-th problem. Output Specification: Print "Limak" (without quotes) if Limak will get more points in total. Print "Radewoosh" (without quotes) if Radewoosh will get more points in total. Print "Tie" (without quotes) if Limak and Radewoosh will get the same total number of points. Demo Input: ['3 2\n50 85 250\n10 15 25\n', '3 6\n50 85 250\n10 15 25\n', '8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76\n'] Demo Output: ['Limak\n', 'Radewoosh\n', 'Tie\n'] Note: In the first sample, there are 3 problems. Limak solves them as follows: 1. Limak spends 10 minutes on the 1-st problem and he gets 50 - *c*·10 = 50 - 2·10 = 30 points. 1. Limak spends 15 minutes on the 2-nd problem so he submits it 10 + 15 = 25 minutes after the start of the contest. For the 2-nd problem he gets 85 - 2·25 = 35 points. 1. He spends 25 minutes on the 3-rd problem so he submits it 10 + 15 + 25 = 50 minutes after the start. For this problem he gets 250 - 2·50 = 150 points. So, Limak got 30 + 35 + 150 = 215 points. Radewoosh solves problem in the reversed order: 1. Radewoosh solves 3-rd problem after 25 minutes so he gets 250 - 2·25 = 200 points. 1. He spends 15 minutes on the 2-nd problem so he submits it 25 + 15 = 40 minutes after the start. He gets 85 - 2·40 = 5 points for this problem. 1. He spends 10 minutes on the 1-st problem so he submits it 25 + 15 + 10 = 50 minutes after the start. He gets *max*(0, 50 - 2·50) = *max*(0,  - 50) = 0 points. Radewoosh got 200 + 5 + 0 = 205 points in total. Limak has 215 points so Limak wins. In the second sample, Limak will get 0 points for each problem and Radewoosh will first solve the hardest problem and he will get 250 - 6·25 = 100 points for that. Radewoosh will get 0 points for other two problems but he is the winner anyway. In the third sample, Limak will get 2 points for the 1-st problem and 2 points for the 2-nd problem. Radewoosh will get 4 points for the 8-th problem. They won't get points for other problems and thus there is a tie because 2 + 2 = 4.
```python a, b = [int(x) for x in input().split()] scores = [int(x) for x in input().split()] times = [int(x) for x in input().split()] l, r, cur_t_1, cur_t_2 = 0, 0, 0, 0 for i in range(0, a): cur_t_1, cur_t_2 = cur_t_1+times[i], cur_t_2+times[a-i-1] l, r = l+max(0, scores[i]-b*cur_t_1), r+max(0, scores[a-i-1]-b*cur_t_2) if l == r: print('Tie') elif l > r: print('Limak') else: print('Radewoosh') ```
3
550
A
Two Substrings
PROGRAMMING
1,500
[ "brute force", "dp", "greedy", "implementation", "strings" ]
null
null
You are given string *s*. Your task is to determine if the given string *s* contains two non-overlapping substrings "AB" and "BA" (the substrings can go in any order).
The only line of input contains a string *s* of length between 1 and 105 consisting of uppercase Latin letters.
Print "YES" (without the quotes), if string *s* contains two non-overlapping substrings "AB" and "BA", and "NO" otherwise.
[ "ABA\n", "BACFAB\n", "AXBYBXA\n" ]
[ "NO\n", "YES\n", "NO\n" ]
In the first sample test, despite the fact that there are substrings "AB" and "BA", their occurrences overlap, so the answer is "NO". In the second sample test there are the following occurrences of the substrings: BACFAB. In the third sample test there is no substring "AB" nor substring "BA".
1,000
[ { "input": "ABA", "output": "NO" }, { "input": "BACFAB", "output": "YES" }, { "input": "AXBYBXA", "output": "NO" }, { "input": "ABABAB", "output": "YES" }, { "input": "BBBBBBBBBB", "output": "NO" }, { "input": "ABBA", "output": "YES" }, { "input": "ABAXXXAB", "output": "YES" }, { "input": "TESTABAXXABTEST", "output": "YES" }, { "input": "A", "output": "NO" }, { "input": "B", "output": "NO" }, { "input": "X", "output": "NO" }, { "input": "BA", "output": "NO" }, { "input": "AB", "output": "NO" }, { "input": "AA", "output": "NO" }, { "input": "BB", "output": "NO" }, { "input": "BAB", "output": "NO" }, { "input": "AAB", "output": "NO" }, { "input": "BAA", "output": "NO" }, { "input": "ABB", "output": "NO" }, { "input": "BBA", "output": "NO" }, { "input": "AAA", "output": "NO" }, { "input": "BBB", "output": "NO" }, { "input": "AXBXBXA", "output": "NO" }, { "input": "SKDSKDJABSDBADKFJDK", "output": "YES" }, { "input": "ABAXXBBXXAA", "output": "NO" }, { "input": "ABAB", "output": "NO" }, { "input": "BABA", "output": "NO" }, { "input": "AAAB", "output": "NO" }, { "input": "AAAA", "output": "NO" }, { "input": "AABA", "output": "NO" }, { "input": "ABAA", "output": "NO" }, { "input": "BAAA", "output": "NO" }, { "input": "AABB", "output": "NO" }, { "input": "BAAB", "output": "YES" }, { "input": "BBAA", "output": "NO" }, { "input": "BBBA", "output": "NO" }, { "input": "BBAB", "output": "NO" }, { "input": "BABB", "output": "NO" }, { "input": "ABBB", "output": "NO" }, { "input": "BBBB", "output": "NO" }, { "input": "BABAB", "output": "YES" }, { "input": "ABABA", "output": "YES" }, { "input": "AAABAAACBBBC", "output": "NO" }, { "input": "AABBBACBBBBBBAACBCCACBBAABBBBBCAACABAACABCACCBCBCCCBCBCABCBBCCBCBBAACBACAABACBBCACCBCCACCABBCBABBAAC", "output": "YES" }, { "input": "CBBABDDBBADAC", "output": "YES" }, { "input": "ABYFAB", "output": "NO" }, { "input": "BABXXAB", "output": "YES" }, { "input": "ABAXAB", "output": "YES" }, { "input": "ABABXAB", "output": "YES" }, { "input": "ABXABXABXABXABXBAXBAXBAXBA", "output": "YES" }, { "input": "QQQQQQQQQABABQQQQQQQQ", "output": "NO" } ]
1,695,465,723
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
1
46
0
s = input().strip() found_ab = found_ba = False for i in range(len(s) - 1): if s[i:i+2] == "AB" and not found_ba: found_ab = True if s[i:i+2] == "BA" and not found_ab: found_ba = True if found_ab and found_ba: print("YES") else: print("NO")
Title: Two Substrings Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given string *s*. Your task is to determine if the given string *s* contains two non-overlapping substrings "AB" and "BA" (the substrings can go in any order). Input Specification: The only line of input contains a string *s* of length between 1 and 105 consisting of uppercase Latin letters. Output Specification: Print "YES" (without the quotes), if string *s* contains two non-overlapping substrings "AB" and "BA", and "NO" otherwise. Demo Input: ['ABA\n', 'BACFAB\n', 'AXBYBXA\n'] Demo Output: ['NO\n', 'YES\n', 'NO\n'] Note: In the first sample test, despite the fact that there are substrings "AB" and "BA", their occurrences overlap, so the answer is "NO". In the second sample test there are the following occurrences of the substrings: BACFAB. In the third sample test there is no substring "AB" nor substring "BA".
```python s = input().strip() found_ab = found_ba = False for i in range(len(s) - 1): if s[i:i+2] == "AB" and not found_ba: found_ab = True if s[i:i+2] == "BA" and not found_ab: found_ba = True if found_ab and found_ba: print("YES") else: print("NO") ```
0
2
A
Winner
PROGRAMMING
1,500
[ "hashing", "implementation" ]
A. Winner
1
64
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
Print the name of the winner.
[ "3\nmike 3\nandrew 5\nmike 2\n", "3\nandrew 3\nandrew 2\nmike 5\n" ]
[ "andrew\n", "andrew\n" ]
none
0
[ { "input": "3\nmike 3\nandrew 5\nmike 2", "output": "andrew" }, { "input": "3\nandrew 3\nandrew 2\nmike 5", "output": "andrew" }, { "input": "5\nkaxqybeultn -352\nmgochgrmeyieyskhuourfg -910\nkaxqybeultn 691\nmgochgrmeyieyskhuourfg -76\nkaxqybeultn -303", "output": "kaxqybeultn" }, { "input": "7\nksjuuerbnlklcfdjeyq 312\ndthjlkrvvbyahttifpdewvyslsh -983\nksjuuerbnlklcfdjeyq 268\ndthjlkrvvbyahttifpdewvyslsh 788\nksjuuerbnlklcfdjeyq -79\nksjuuerbnlklcfdjeyq -593\nksjuuerbnlklcfdjeyq 734", "output": "ksjuuerbnlklcfdjeyq" }, { "input": "12\natrtthfpcvishmqbakprquvnejr 185\natrtthfpcvishmqbakprquvnejr -699\natrtthfpcvishmqbakprquvnejr -911\natrtthfpcvishmqbakprquvnejr -220\nfcgslzkicjrpbqaifgweyzreajjfdo 132\nfcgslzkicjrpbqaifgweyzreajjfdo -242\nm 177\nm -549\natrtthfpcvishmqbakprquvnejr -242\nm 38\natrtthfpcvishmqbakprquvnejr -761\nfcgslzkicjrpbqaifgweyzreajjfdo 879", "output": "fcgslzkicjrpbqaifgweyzreajjfdo" }, { "input": "15\naawtvezfntstrcpgbzjbf 681\nzhahpvqiptvksnbjkdvmknb -74\naawtvezfntstrcpgbzjbf 661\njpdwmyke 474\naawtvezfntstrcpgbzjbf -547\naawtvezfntstrcpgbzjbf 600\nzhahpvqiptvksnbjkdvmknb -11\njpdwmyke 711\nbjmj 652\naawtvezfntstrcpgbzjbf -1000\naawtvezfntstrcpgbzjbf -171\nbjmj -302\naawtvezfntstrcpgbzjbf 961\nzhahpvqiptvksnbjkdvmknb 848\nbjmj -735", "output": "aawtvezfntstrcpgbzjbf" }, { "input": "17\nqdplghhx -649\nivhgbxiv 424\nivhgbxiv -72\nivhgbxiv 479\nugowfouebkelargxylsxn 83\nugowfouebkelargxylsxn -840\nivhgbxiv 382\nqdplghhx -904\nivhgbxiv -710\nugowfouebkelargxylsxn -838\nqdplghhx -974\nqdplghhx 571\nivhgbxiv -145\nugowfouebkelargxylsxn -788\nivhgbxiv 209\nivhgbxiv 420\nqdplghhx -158", "output": "ivhgbxiv" } ]
1,690,618,652
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
62
0
#CodeForce Round 2a Winner scorelist = {} max = 0 winner = "" instruction_list = [] ia = instruction_list.append n = int(input()) name, score = input("Please give input for 2a : Winner\n").split() scorelist[name] = int(score) for i in range(n-1): name, strscore = input().split() score = int(strscore) ia([name, score]) if name not in scorelist: scorelist[name] = score else: scorelist[name] += score if scorelist[name] > max: max = scorelist[name] winner = name ls = list(scorelist[ppl] for ppl in scorelist) realmax = max(ls) if max != realmax: if ls.count(realmax)> 1: temp_ppl = [] for ppl in scorelist: if scorelist[ppl] == realmax: temp_ppl.append(ppl) temp_score = {} for ins in instruction_list: if ins[0] in temp_ppl: if ins[0] not in temp_score: temp_score[ins[0]] = ins[1] else: temp_score[ins[0]] += ins[1] if temp_score[ins[0]] == realmax: winner = temp_ppl break else: for ppl in scorelist: if scorelist[ppl] == realmax: winner = ppl break print(winner)
Title: Winner Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points. Input Specification: The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive. Output Specification: Print the name of the winner. Demo Input: ['3\nmike 3\nandrew 5\nmike 2\n', '3\nandrew 3\nandrew 2\nmike 5\n'] Demo Output: ['andrew\n', 'andrew\n'] Note: none
```python #CodeForce Round 2a Winner scorelist = {} max = 0 winner = "" instruction_list = [] ia = instruction_list.append n = int(input()) name, score = input("Please give input for 2a : Winner\n").split() scorelist[name] = int(score) for i in range(n-1): name, strscore = input().split() score = int(strscore) ia([name, score]) if name not in scorelist: scorelist[name] = score else: scorelist[name] += score if scorelist[name] > max: max = scorelist[name] winner = name ls = list(scorelist[ppl] for ppl in scorelist) realmax = max(ls) if max != realmax: if ls.count(realmax)> 1: temp_ppl = [] for ppl in scorelist: if scorelist[ppl] == realmax: temp_ppl.append(ppl) temp_score = {} for ins in instruction_list: if ins[0] in temp_ppl: if ins[0] not in temp_score: temp_score[ins[0]] = ins[1] else: temp_score[ins[0]] += ins[1] if temp_score[ins[0]] == realmax: winner = temp_ppl break else: for ppl in scorelist: if scorelist[ppl] == realmax: winner = ppl break print(winner) ```
-1
404
A
Valera and X
PROGRAMMING
1,000
[ "implementation" ]
null
null
Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet. Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if: - on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals. Help Valera, write the program that completes the described task for him.
The first line contains integer *n* (3<=≤<=*n*<=&lt;<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper.
Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes.
[ "5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n", "3\nwsw\nsws\nwsw\n", "3\nxpx\npxp\nxpe\n" ]
[ "NO\n", "YES\n", "NO\n" ]
none
500
[ { "input": "5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox", "output": "NO" }, { "input": "3\nwsw\nsws\nwsw", "output": "YES" }, { "input": "3\nxpx\npxp\nxpe", "output": "NO" }, { "input": "5\nliiil\nilili\niilii\nilili\nliiil", "output": "YES" }, { "input": "7\nbwccccb\nckcccbj\nccbcbcc\ncccbccc\nccbcbcc\ncbcccbc\nbccccdt", "output": "NO" }, { "input": "13\nsooooooooooos\nosoooooooooso\noosooooooosoo\nooosooooosooo\noooosooosoooo\nooooososooooo\noooooosoooooo\nooooososooooo\noooosooosoooo\nooosooooosooo\noosooooooosoo\nosoooooooooso\nsooooooooooos", "output": "YES" }, { "input": "3\naaa\naaa\naaa", "output": "NO" }, { "input": "3\naca\noec\nzba", "output": "NO" }, { "input": "15\nrxeeeeeeeeeeeer\nereeeeeeeeeeere\needeeeeeeeeeoee\neeereeeeeeeewee\neeeereeeeebeeee\nqeeeereeejedyee\neeeeeerereeeeee\neeeeeeereeeeeee\neeeeeerereeeeze\neeeeereeereeeee\neeeereeeeegeeee\neeereeeeeeereee\neereeeeeeqeeved\ncreeeeeeceeeere\nreeerneeeeeeeer", "output": "NO" }, { "input": "5\nxxxxx\nxxxxx\nxxxxx\nxxxxx\nxxxxx", "output": "NO" }, { "input": "5\nxxxxx\nxxxxx\nxoxxx\nxxxxx\nxxxxx", "output": "NO" }, { "input": "5\noxxxo\nxoxox\nxxxxx\nxoxox\noxxxo", "output": "NO" }, { "input": "5\noxxxo\nxoxox\nxxoox\nxoxox\noxxxo", "output": "NO" }, { "input": "5\noxxxo\nxoxox\nxxaxx\nxoxox\noxxxo", "output": "NO" }, { "input": "5\noxxxo\nxoxox\noxoxx\nxoxox\noxxxo", "output": "NO" }, { "input": "3\nxxx\naxa\nxax", "output": "NO" }, { "input": "3\nxax\naxx\nxax", "output": "NO" }, { "input": "3\nxax\naxa\nxxx", "output": "NO" }, { "input": "3\nxax\nxxa\nxax", "output": "NO" }, { "input": "3\nxax\naaa\nxax", "output": "NO" }, { "input": "3\naax\naxa\nxax", "output": "NO" }, { "input": "3\nxaa\naxa\nxax", "output": "NO" }, { "input": "3\nxax\naxa\naax", "output": "NO" }, { "input": "3\nxax\naxa\nxaa", "output": "NO" }, { "input": "3\nxfx\naxa\nxax", "output": "NO" }, { "input": "3\nxax\nafa\nxax", "output": "NO" }, { "input": "3\nxax\naxa\nxaf", "output": "NO" }, { "input": "3\nxox\nxxx\nxxx", "output": "NO" }, { "input": "3\naxa\naax\nxxa", "output": "NO" }, { "input": "3\nxox\noxx\nxox", "output": "NO" }, { "input": "3\nxox\nooo\nxox", "output": "NO" }, { "input": "3\naaa\naab\nbbb", "output": "NO" }, { "input": "3\nxxx\nsxs\nxsx", "output": "NO" }, { "input": "5\nabbba\nbabab\nbbbbb\nbaaab\nabbba", "output": "NO" }, { "input": "5\nabaaa\nbbbbb\nbbabb\nbabab\nabbba", "output": "NO" }, { "input": "5\nxoxox\noxoxo\nooxoo\noxoxo\nxooox", "output": "NO" }, { "input": "3\nxox\noxx\nxxx", "output": "NO" }, { "input": "5\nxoooo\noxooo\nooxoo\noooxo\noooox", "output": "NO" }, { "input": "5\nxoooo\noxoxx\nooxoo\noxoxo\noxoox", "output": "NO" }, { "input": "3\naaa\nbab\naba", "output": "NO" } ]
1,625,728,477
2,147,483,647
PyPy 3
OK
TESTS
47
124
5,120,000
n = int(input()) s = [] a = [] for _ in range(n): t = input() a.append(t) s.extend(list(t)) s = set(s) if len(s) != 2: print("NO") else: d1 = '' d2 = '' for i in range(n): for j in range(n): if i == j: d1 += a[i][j] if i + j == n - 1: d2 += a[i][j] st = ''.join(a) #print(d1, d2) #dt = set(list(d1)) #print(dt) if d1 == d2 and len(set(list(d1))) == 1: if st.count(d1[0]) == n * 2 - 1: if st.count(a[0][1]) == n * n - 2 * n + 1: print("YES") else: print("NO") else: print("NO") else: print("NO")
Title: Valera and X Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet. Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if: - on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals. Help Valera, write the program that completes the described task for him. Input Specification: The first line contains integer *n* (3<=≤<=*n*<=&lt;<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper. Output Specification: Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes. Demo Input: ['5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n', '3\nwsw\nsws\nwsw\n', '3\nxpx\npxp\nxpe\n'] Demo Output: ['NO\n', 'YES\n', 'NO\n'] Note: none
```python n = int(input()) s = [] a = [] for _ in range(n): t = input() a.append(t) s.extend(list(t)) s = set(s) if len(s) != 2: print("NO") else: d1 = '' d2 = '' for i in range(n): for j in range(n): if i == j: d1 += a[i][j] if i + j == n - 1: d2 += a[i][j] st = ''.join(a) #print(d1, d2) #dt = set(list(d1)) #print(dt) if d1 == d2 and len(set(list(d1))) == 1: if st.count(d1[0]) == n * 2 - 1: if st.count(a[0][1]) == n * n - 2 * n + 1: print("YES") else: print("NO") else: print("NO") else: print("NO") ```
3
0
none
none
none
0
[ "none" ]
null
null
The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper. To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes). The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation.
The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits.
In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem.
[ "101\n", "110010\n" ]
[ "11\n", "11010\n" ]
In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>. In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>.
0
[ { "input": "101", "output": "11" }, { "input": "110010", "output": "11010" }, { "input": "10000", "output": "1000" }, { "input": "1111111110", "output": "111111111" }, { "input": "10100101011110101", "output": "1100101011110101" }, { "input": "111010010111", "output": "11110010111" }, { "input": "11110111011100000000", "output": "1111111011100000000" }, { "input": "11110010010100001110110101110011110110100111101", "output": "1111010010100001110110101110011110110100111101" }, { "input": "1001011111010010100111111", "output": "101011111010010100111111" }, { "input": "1111111111", "output": "111111111" }, { "input": "1111111111111111111100111101001110110111111000001111110101001101001110011000001011001111111000110101", "output": "111111111111111111110111101001110110111111000001111110101001101001110011000001011001111111000110101" }, { "input": "11010110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100", "output": "1110110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100" }, { "input": "11111111111111111111111110110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011", "output": "1111111111111111111111111110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011" }, { "input": "11100010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011", "output": "1110010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011" }, { "input": "11", "output": "1" }, { "input": "111", "output": "11" }, { "input": "111111", "output": "11111" }, { "input": "11111", "output": "1111" }, { "input": "1111", "output": "111" } ]
1,377,327,522
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
9
92
0
import re print(re.sub('0','',input(),1))
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper. To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes). The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation. Input Specification: The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits. Output Specification: In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem. Demo Input: ['101\n', '110010\n'] Demo Output: ['11\n', '11010\n'] Note: In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>. In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>.
```python import re print(re.sub('0','',input(),1)) ```
0
998
A
Balloons
PROGRAMMING
1,000
[ "constructive algorithms", "implementation" ]
null
null
There are quite a lot of ways to have fun with inflatable balloons. For example, you can fill them with water and see what happens. Grigory and Andrew have the same opinion. So, once upon a time, they went to the shop and bought $n$ packets with inflatable balloons, where $i$-th of them has exactly $a_i$ balloons inside. They want to divide the balloons among themselves. In addition, there are several conditions to hold: - Do not rip the packets (both Grigory and Andrew should get unbroken packets); - Distribute all packets (every packet should be given to someone); - Give both Grigory and Andrew at least one packet; - To provide more fun, the total number of balloons in Grigory's packets should not be equal to the total number of balloons in Andrew's packets. Help them to divide the balloons or determine that it's impossible under these conditions.
The first line of input contains a single integer $n$ ($1 \le n \le 10$) — the number of packets with balloons. The second line contains $n$ integers: $a_1$, $a_2$, $\ldots$, $a_n$ ($1 \le a_i \le 1000$) — the number of balloons inside the corresponding packet.
If it's impossible to divide the balloons satisfying the conditions above, print $-1$. Otherwise, print an integer $k$ — the number of packets to give to Grigory followed by $k$ distinct integers from $1$ to $n$ — the indices of those. The order of packets doesn't matter. If there are multiple ways to divide balloons, output any of them.
[ "3\n1 2 1\n", "2\n5 5\n", "1\n10\n" ]
[ "2\n1 2\n", "-1\n", "-1\n" ]
In the first test Grigory gets $3$ balloons in total while Andrey gets $1$. In the second test there's only one way to divide the packets which leads to equal numbers of balloons. In the third test one of the boys won't get a packet at all.
500
[ { "input": "3\n1 2 1", "output": "1\n1" }, { "input": "2\n5 5", "output": "-1" }, { "input": "1\n10", "output": "-1" }, { "input": "1\n1", "output": "-1" }, { "input": "10\n1 1 1 1 1 1 1 1 1 1", "output": "1\n1" }, { "input": "10\n1 1 1 1 1 1 1 1 1 9", "output": "1\n1" }, { "input": "10\n26 723 970 13 422 968 875 329 234 983", "output": "1\n4" }, { "input": "3\n3 2 1", "output": "1\n3" }, { "input": "10\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000", "output": "1\n1" }, { "input": "10\n1 9 7 6 2 4 7 8 1 3", "output": "1\n1" }, { "input": "2\n9 6", "output": "1\n2" }, { "input": "2\n89 7", "output": "1\n2" }, { "input": "2\n101 807", "output": "1\n1" }, { "input": "5\n8 7 4 8 3", "output": "1\n5" }, { "input": "5\n55 62 70 100 90", "output": "1\n1" }, { "input": "5\n850 840 521 42 169", "output": "1\n4" }, { "input": "6\n7 1 4 1 6 1", "output": "1\n2" }, { "input": "6\n36 80 38 88 79 69", "output": "1\n1" }, { "input": "6\n108 318 583 10 344 396", "output": "1\n4" }, { "input": "9\n10 9 10 10 8 3 5 10 2", "output": "1\n9" }, { "input": "9\n90 31 28 63 57 57 27 62 42", "output": "1\n7" }, { "input": "9\n665 646 152 829 190 64 555 536 321", "output": "1\n6" }, { "input": "10\n99 62 10 47 53 9 83 33 15 24", "output": "1\n6" }, { "input": "4\n600 200 100 300", "output": "1\n3" }, { "input": "2\n4 5", "output": "1\n1" }, { "input": "2\n5 12", "output": "1\n1" }, { "input": "2\n1 2", "output": "1\n1" }, { "input": "3\n1 1 2", "output": "1\n1" }, { "input": "2\n3 2", "output": "1\n2" }, { "input": "3\n1 4 5", "output": "1\n1" }, { "input": "4\n5 5 5 5", "output": "1\n1" }, { "input": "1\n5", "output": "-1" }, { "input": "3\n5 5 5", "output": "1\n1" }, { "input": "5\n5 5 5 5 5", "output": "1\n1" }, { "input": "4\n2 7 10 1", "output": "1\n4" }, { "input": "3\n1 1 1", "output": "1\n1" }, { "input": "4\n8 4 2 2", "output": "1\n3" }, { "input": "2\n3 4", "output": "1\n1" }, { "input": "4\n1 1 3 1", "output": "1\n1" }, { "input": "7\n1 2 3 4 5 6 7", "output": "1\n1" }, { "input": "2\n18 19", "output": "1\n1" }, { "input": "2\n17 18", "output": "1\n1" }, { "input": "2\n1 3", "output": "1\n1" }, { "input": "4\n5 5 4 4", "output": "1\n3" }, { "input": "2\n10 11", "output": "1\n1" }, { "input": "2\n10 20", "output": "1\n1" }, { "input": "2\n2 1", "output": "1\n2" }, { "input": "4\n2 3 2 3", "output": "1\n1" }, { "input": "2\n5 6", "output": "1\n1" } ]
1,587,409,178
2,147,483,647
PyPy 3
OK
TESTS
49
140
0
n=int(input()) s=list(map(int,input().split( ))) p=s[:] s.sort() if n==1: print(-1) elif n==2 and (s[0]==s[1]): print(-1) else: print(1) print(p.index(s[0])+1)
Title: Balloons Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are quite a lot of ways to have fun with inflatable balloons. For example, you can fill them with water and see what happens. Grigory and Andrew have the same opinion. So, once upon a time, they went to the shop and bought $n$ packets with inflatable balloons, where $i$-th of them has exactly $a_i$ balloons inside. They want to divide the balloons among themselves. In addition, there are several conditions to hold: - Do not rip the packets (both Grigory and Andrew should get unbroken packets); - Distribute all packets (every packet should be given to someone); - Give both Grigory and Andrew at least one packet; - To provide more fun, the total number of balloons in Grigory's packets should not be equal to the total number of balloons in Andrew's packets. Help them to divide the balloons or determine that it's impossible under these conditions. Input Specification: The first line of input contains a single integer $n$ ($1 \le n \le 10$) — the number of packets with balloons. The second line contains $n$ integers: $a_1$, $a_2$, $\ldots$, $a_n$ ($1 \le a_i \le 1000$) — the number of balloons inside the corresponding packet. Output Specification: If it's impossible to divide the balloons satisfying the conditions above, print $-1$. Otherwise, print an integer $k$ — the number of packets to give to Grigory followed by $k$ distinct integers from $1$ to $n$ — the indices of those. The order of packets doesn't matter. If there are multiple ways to divide balloons, output any of them. Demo Input: ['3\n1 2 1\n', '2\n5 5\n', '1\n10\n'] Demo Output: ['2\n1 2\n', '-1\n', '-1\n'] Note: In the first test Grigory gets $3$ balloons in total while Andrey gets $1$. In the second test there's only one way to divide the packets which leads to equal numbers of balloons. In the third test one of the boys won't get a packet at all.
```python n=int(input()) s=list(map(int,input().split( ))) p=s[:] s.sort() if n==1: print(-1) elif n==2 and (s[0]==s[1]): print(-1) else: print(1) print(p.index(s[0])+1) ```
3
353
A
Domino
PROGRAMMING
1,200
[ "implementation", "math" ]
null
null
Valera has got *n* domino pieces in a row. Each piece consists of two halves — the upper one and the lower one. Each of the halves contains a number from 1 to 6. Valera loves even integers very much, so he wants the sum of the numbers on the upper halves and the sum of the numbers on the lower halves to be even. To do that, Valera can rotate the dominoes by 180 degrees. After the rotation the upper and the lower halves swap places. This action takes one second. Help Valera find out the minimum time he must spend rotating dominoes to make his wish come true.
The first line contains integer *n* (1<=≤<=*n*<=≤<=100), denoting the number of dominoes Valera has. Next *n* lines contain two space-separated integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=6). Number *x**i* is initially written on the upper half of the *i*-th domino, *y**i* is initially written on the lower half.
Print a single number — the minimum required number of seconds. If Valera can't do the task in any time, print <=-<=1.
[ "2\n4 2\n6 4\n", "1\n2 3\n", "3\n1 4\n2 3\n4 4\n" ]
[ "0\n", "-1\n", "1\n" ]
In the first test case the sum of the numbers on the upper halves equals 10 and the sum of the numbers on the lower halves equals 6. Both numbers are even, so Valera doesn't required to do anything. In the second sample Valera has only one piece of domino. It is written 3 on the one of its halves, therefore one of the sums will always be odd. In the third case Valera can rotate the first piece, and after that the sum on the upper halves will be equal to 10, and the sum on the lower halves will be equal to 8.
500
[ { "input": "2\n4 2\n6 4", "output": "0" }, { "input": "1\n2 3", "output": "-1" }, { "input": "3\n1 4\n2 3\n4 4", "output": "1" }, { "input": "5\n5 4\n5 4\n1 5\n5 5\n3 3", "output": "1" }, { "input": "20\n1 3\n5 2\n5 2\n2 6\n2 4\n1 1\n1 3\n1 4\n2 6\n4 2\n5 6\n2 2\n6 2\n4 3\n2 1\n6 2\n6 5\n4 5\n2 4\n1 4", "output": "-1" }, { "input": "100\n2 3\n2 4\n3 3\n1 4\n5 2\n5 4\n6 6\n3 4\n1 1\n4 2\n5 1\n5 5\n5 3\n3 6\n4 1\n1 6\n1 1\n3 2\n4 5\n6 1\n6 4\n1 1\n3 4\n3 3\n2 2\n1 1\n4 4\n6 4\n3 2\n5 2\n6 4\n3 2\n3 5\n4 4\n1 4\n5 2\n3 4\n1 4\n2 2\n5 6\n3 5\n6 1\n5 5\n1 6\n6 3\n1 4\n1 5\n5 5\n4 1\n3 2\n4 1\n5 5\n5 5\n1 5\n1 2\n6 4\n1 3\n3 6\n4 3\n3 5\n6 4\n2 6\n5 5\n1 4\n2 2\n2 3\n5 1\n2 5\n1 2\n2 6\n5 5\n4 6\n1 4\n3 6\n2 3\n6 1\n6 5\n3 2\n6 4\n4 5\n4 5\n2 6\n1 3\n6 2\n1 2\n2 3\n4 3\n5 4\n3 4\n1 6\n6 6\n2 4\n4 1\n3 1\n2 6\n5 4\n1 2\n6 5\n3 6\n2 4", "output": "-1" }, { "input": "1\n2 4", "output": "0" }, { "input": "1\n1 1", "output": "-1" }, { "input": "1\n1 2", "output": "-1" }, { "input": "2\n1 1\n3 3", "output": "0" }, { "input": "2\n1 1\n2 2", "output": "-1" }, { "input": "2\n1 1\n1 2", "output": "-1" }, { "input": "5\n1 2\n6 6\n1 1\n3 3\n6 1", "output": "1" }, { "input": "5\n5 4\n2 6\n6 2\n1 4\n6 2", "output": "0" }, { "input": "10\n4 1\n3 2\n1 2\n2 6\n3 5\n2 1\n5 2\n4 6\n5 6\n3 1", "output": "0" }, { "input": "10\n6 1\n4 4\n2 6\n6 5\n3 6\n6 3\n2 4\n5 1\n1 6\n1 5", "output": "-1" }, { "input": "15\n1 2\n5 1\n6 4\n5 1\n1 6\n2 6\n3 1\n6 4\n3 1\n2 1\n6 4\n3 5\n6 2\n1 6\n1 1", "output": "1" }, { "input": "15\n3 3\n2 1\n5 4\n3 3\n5 3\n5 4\n2 5\n1 3\n3 2\n3 3\n3 5\n2 5\n4 1\n2 3\n5 4", "output": "-1" }, { "input": "20\n1 5\n6 4\n4 3\n6 2\n1 1\n1 5\n6 3\n2 3\n3 6\n3 6\n3 6\n2 5\n4 3\n4 6\n5 5\n4 6\n3 4\n4 2\n3 3\n5 2", "output": "0" }, { "input": "20\n2 1\n6 5\n3 1\n2 5\n3 5\n4 1\n1 1\n5 4\n5 1\n2 4\n1 5\n3 2\n1 2\n3 5\n5 2\n1 2\n1 3\n4 2\n2 3\n4 5", "output": "-1" }, { "input": "25\n4 1\n6 3\n1 3\n2 3\n2 4\n6 6\n4 2\n4 2\n1 5\n5 4\n1 2\n2 5\n3 6\n4 1\n3 4\n2 6\n6 1\n5 6\n6 6\n4 2\n1 5\n3 3\n3 3\n6 5\n1 4", "output": "-1" }, { "input": "25\n5 5\n4 3\n2 5\n4 3\n4 6\n4 2\n5 6\n2 1\n5 4\n6 6\n1 3\n1 4\n2 3\n5 6\n5 4\n5 6\n5 4\n6 3\n3 5\n1 3\n2 5\n2 2\n4 4\n2 1\n4 4", "output": "-1" }, { "input": "30\n3 5\n2 5\n1 6\n1 6\n2 4\n5 5\n5 4\n5 6\n5 4\n2 1\n2 4\n1 6\n3 5\n1 1\n3 6\n5 5\n1 6\n3 4\n1 4\n4 6\n2 1\n3 3\n1 3\n4 5\n1 4\n1 6\n2 1\n4 6\n3 5\n5 6", "output": "1" }, { "input": "30\n2 3\n3 1\n6 6\n1 3\n5 5\n3 6\n4 5\n2 1\n1 3\n2 3\n4 4\n2 4\n6 4\n2 4\n5 4\n2 1\n2 5\n2 5\n4 2\n1 4\n2 6\n3 2\n3 2\n6 6\n4 2\n3 4\n6 3\n6 6\n6 6\n5 5", "output": "1" }, { "input": "35\n6 1\n4 3\n1 2\n4 3\n6 4\n4 6\n3 1\n5 5\n3 4\n5 4\n4 6\n1 6\n2 4\n6 6\n5 4\n5 2\n1 3\n1 4\n3 5\n1 4\n2 3\n4 5\n4 3\n6 1\n5 3\n3 2\n5 6\n3 5\n6 5\n4 1\n1 3\n5 5\n4 6\n6 1\n1 3", "output": "1" }, { "input": "35\n4 3\n5 6\n4 5\n2 5\n6 6\n4 1\n2 2\n4 2\n3 4\n4 1\n6 6\n6 3\n1 5\n1 5\n5 6\n4 2\n4 6\n5 5\n2 2\n5 2\n1 2\n4 6\n6 6\n6 5\n2 1\n3 5\n2 5\n3 1\n5 3\n6 4\n4 6\n5 6\n5 1\n3 4\n3 5", "output": "1" }, { "input": "40\n5 6\n1 1\n3 3\n2 6\n6 6\n5 4\n6 4\n3 5\n1 3\n4 4\n4 4\n2 5\n1 3\n3 6\n5 2\n4 3\n4 4\n5 6\n2 3\n1 1\n3 1\n1 1\n1 5\n4 3\n5 5\n3 4\n6 6\n5 6\n2 2\n6 6\n2 1\n2 4\n5 2\n2 2\n1 1\n1 4\n4 2\n3 5\n5 5\n4 5", "output": "-1" }, { "input": "40\n3 2\n5 3\n4 6\n3 5\n6 1\n5 2\n1 2\n6 2\n5 3\n3 2\n4 4\n3 3\n5 2\n4 5\n1 4\n5 1\n3 3\n1 3\n1 3\n2 1\n3 6\n4 2\n4 6\n6 2\n2 5\n2 2\n2 5\n3 3\n5 3\n2 1\n3 2\n2 3\n6 3\n6 3\n3 4\n3 2\n4 3\n5 4\n2 4\n4 6", "output": "-1" }, { "input": "45\n2 4\n3 4\n6 1\n5 5\n1 1\n3 5\n4 3\n5 2\n3 6\n6 1\n4 4\n6 1\n2 1\n6 1\n3 6\n3 3\n6 1\n1 2\n1 5\n6 5\n1 3\n5 6\n6 1\n4 5\n3 6\n2 2\n1 2\n4 5\n5 6\n1 5\n6 2\n2 4\n3 3\n3 1\n6 5\n6 5\n2 1\n5 2\n2 1\n3 3\n2 2\n1 4\n2 2\n3 3\n2 1", "output": "-1" }, { "input": "45\n6 6\n1 6\n1 2\n3 5\n4 4\n2 1\n5 3\n2 1\n5 2\n5 3\n1 4\n5 2\n4 2\n3 6\n5 2\n1 5\n4 4\n5 5\n6 5\n2 1\n2 6\n5 5\n2 1\n6 1\n1 6\n6 5\n2 4\n4 3\n2 6\n2 4\n6 5\n6 4\n6 3\n6 6\n2 1\n6 4\n5 6\n5 4\n1 5\n5 1\n3 3\n5 6\n2 5\n4 5\n3 6", "output": "-1" }, { "input": "50\n4 4\n5 1\n6 4\n6 2\n6 2\n1 4\n5 5\n4 2\n5 5\n5 4\n1 3\n3 5\n6 1\n6 1\n1 4\n4 3\n5 1\n3 6\n2 2\n6 2\n4 4\n2 3\n4 2\n6 5\n5 6\n2 2\n2 4\n3 5\n1 5\n3 2\n3 4\n5 6\n4 6\n1 6\n4 5\n2 6\n2 2\n3 5\n6 4\n5 1\n4 3\n3 4\n3 5\n3 3\n2 3\n3 2\n2 2\n1 4\n3 1\n4 4", "output": "1" }, { "input": "50\n1 2\n1 4\n1 1\n4 5\n4 4\n3 2\n4 5\n3 5\n1 1\n3 4\n3 2\n2 4\n2 6\n2 6\n3 2\n4 6\n1 6\n3 1\n1 6\n2 1\n4 1\n1 6\n4 3\n6 6\n5 2\n6 4\n2 1\n4 3\n6 4\n5 1\n5 5\n3 1\n1 1\n5 5\n2 2\n2 3\n2 3\n3 5\n5 5\n1 6\n1 5\n3 6\n3 6\n1 1\n3 3\n2 6\n5 5\n1 3\n6 3\n6 6", "output": "-1" }, { "input": "55\n3 2\n5 6\n5 1\n3 5\n5 5\n1 5\n5 4\n6 3\n5 6\n4 2\n3 1\n1 2\n5 5\n1 1\n5 2\n6 3\n5 4\n3 6\n4 6\n2 6\n6 4\n1 4\n1 6\n4 1\n2 5\n4 3\n2 1\n2 1\n6 2\n3 1\n2 5\n4 4\n6 3\n2 2\n3 5\n5 1\n3 6\n5 4\n4 6\n6 5\n5 6\n2 2\n3 2\n5 2\n6 5\n2 2\n5 3\n3 1\n4 5\n6 4\n2 4\n1 2\n5 6\n2 6\n5 2", "output": "0" }, { "input": "55\n4 6\n3 3\n6 5\n5 3\n5 6\n2 3\n2 2\n3 4\n3 1\n5 4\n5 4\n2 4\n3 4\n4 5\n1 5\n6 3\n1 1\n5 1\n3 4\n1 5\n3 1\n2 5\n3 3\n4 3\n3 3\n3 1\n6 6\n3 3\n3 3\n5 6\n5 3\n3 5\n1 4\n5 5\n1 3\n1 4\n3 5\n3 6\n2 4\n2 4\n5 1\n6 4\n5 1\n5 5\n1 1\n3 2\n4 3\n5 4\n5 1\n2 4\n4 3\n6 1\n3 4\n1 5\n6 3", "output": "-1" }, { "input": "60\n2 6\n1 4\n3 2\n1 2\n3 2\n2 4\n6 4\n4 6\n1 3\n3 1\n6 5\n2 4\n5 4\n4 2\n1 6\n3 4\n4 5\n5 2\n1 5\n5 4\n3 4\n3 4\n4 4\n4 1\n6 6\n3 6\n2 4\n2 1\n4 4\n6 5\n3 1\n4 3\n1 3\n6 3\n5 5\n1 4\n3 1\n3 6\n1 5\n3 1\n1 5\n4 4\n1 3\n2 4\n6 2\n4 1\n5 3\n3 4\n5 6\n1 2\n1 6\n6 3\n1 6\n3 6\n3 4\n6 2\n4 6\n2 3\n3 3\n3 3", "output": "-1" }, { "input": "60\n2 3\n4 6\n2 4\n1 3\n5 6\n1 5\n1 2\n1 3\n5 6\n4 3\n4 2\n3 1\n1 3\n3 5\n1 5\n3 4\n2 4\n3 5\n4 5\n1 2\n3 1\n1 5\n2 5\n6 2\n1 6\n3 3\n6 2\n5 3\n1 3\n1 4\n6 4\n6 3\n4 2\n4 2\n1 4\n1 3\n3 2\n3 1\n2 1\n1 2\n3 1\n2 6\n1 4\n3 6\n3 3\n1 5\n2 4\n5 5\n6 2\n5 2\n3 3\n5 3\n3 4\n4 5\n5 6\n2 4\n5 3\n3 1\n2 4\n5 4", "output": "-1" }, { "input": "65\n5 4\n3 3\n1 2\n4 3\n3 5\n1 5\n4 5\n2 6\n1 2\n1 5\n6 3\n2 6\n4 3\n3 6\n1 5\n3 5\n4 6\n2 5\n6 5\n1 4\n3 4\n4 3\n1 4\n2 5\n6 5\n3 1\n4 3\n1 2\n1 1\n6 1\n5 2\n3 2\n1 6\n2 6\n3 3\n6 6\n4 6\n1 5\n5 1\n4 5\n1 4\n3 2\n5 4\n4 2\n6 2\n1 3\n4 2\n5 3\n6 4\n3 6\n1 2\n6 1\n6 6\n3 3\n4 2\n3 5\n4 6\n4 1\n5 4\n6 1\n5 1\n5 6\n6 1\n4 6\n5 5", "output": "1" }, { "input": "65\n5 4\n6 3\n5 4\n4 5\n5 3\n3 6\n1 3\n3 1\n1 3\n6 1\n6 4\n1 3\n2 2\n4 6\n4 1\n5 6\n6 5\n1 1\n1 3\n6 6\n4 1\n2 4\n5 4\n4 1\n5 5\n5 3\n6 2\n2 6\n4 2\n2 2\n6 2\n3 3\n4 5\n4 3\n3 1\n1 4\n4 5\n3 2\n5 5\n4 6\n5 1\n3 4\n5 4\n5 2\n1 6\n4 2\n3 4\n3 4\n1 3\n1 2\n3 3\n3 6\n6 4\n4 6\n6 2\n6 5\n3 2\n2 1\n6 4\n2 1\n1 5\n5 2\n6 5\n3 6\n5 1", "output": "1" }, { "input": "70\n4 1\n2 6\n1 1\n5 6\n5 1\n2 3\n3 5\n1 1\n1 1\n4 6\n4 3\n1 5\n2 2\n2 3\n3 1\n6 4\n3 1\n4 2\n5 4\n1 3\n3 5\n5 2\n5 6\n4 4\n4 5\n2 2\n4 5\n3 2\n3 5\n2 5\n2 6\n5 5\n2 6\n5 1\n1 1\n2 5\n3 1\n1 2\n6 4\n6 5\n5 5\n5 1\n1 5\n2 2\n6 3\n4 3\n6 2\n5 5\n1 1\n6 2\n6 6\n3 4\n2 2\n3 5\n1 5\n2 5\n4 5\n2 4\n6 3\n5 1\n2 6\n4 2\n1 4\n1 6\n6 2\n5 2\n5 6\n2 5\n5 6\n5 5", "output": "-1" }, { "input": "70\n4 3\n6 4\n5 5\n3 1\n1 2\n2 5\n4 6\n4 2\n3 2\n4 2\n1 5\n2 2\n4 3\n1 2\n6 1\n6 6\n1 6\n5 1\n2 2\n6 3\n4 2\n4 3\n1 2\n6 6\n3 3\n6 5\n6 2\n3 6\n6 6\n4 6\n5 2\n5 4\n3 3\n1 6\n5 6\n2 3\n4 6\n1 1\n1 2\n6 6\n1 1\n3 4\n1 6\n2 6\n3 4\n6 3\n5 3\n1 2\n2 3\n4 6\n2 1\n6 4\n4 6\n4 6\n4 2\n5 5\n3 5\n3 2\n4 3\n3 6\n1 4\n3 6\n1 4\n1 6\n1 5\n5 6\n4 4\n3 3\n3 5\n2 2", "output": "0" }, { "input": "75\n1 3\n4 5\n4 1\n6 5\n2 1\n1 4\n5 4\n1 5\n5 3\n1 2\n4 1\n1 1\n5 1\n5 3\n1 5\n4 2\n2 2\n6 3\n1 2\n4 3\n2 5\n5 3\n5 5\n4 1\n4 6\n2 5\n6 1\n2 4\n6 4\n5 2\n6 2\n2 4\n1 3\n5 4\n6 5\n5 4\n6 4\n1 5\n4 6\n1 5\n1 1\n4 4\n3 5\n6 3\n6 5\n1 5\n2 1\n1 5\n6 6\n2 2\n2 2\n4 4\n6 6\n5 4\n4 5\n3 2\n2 4\n1 1\n4 3\n3 2\n5 4\n1 6\n1 2\n2 2\n3 5\n2 6\n1 1\n2 2\n2 3\n6 2\n3 6\n4 4\n5 1\n4 1\n4 1", "output": "0" }, { "input": "75\n1 1\n2 1\n5 5\n6 5\n6 3\n1 6\n6 1\n4 4\n2 1\n6 2\n3 1\n6 4\n1 6\n2 2\n4 3\n4 2\n1 2\n6 2\n4 2\n5 1\n1 2\n3 2\n6 6\n6 3\n2 4\n4 1\n4 1\n2 4\n5 5\n2 3\n5 5\n4 5\n3 1\n1 5\n4 3\n2 3\n3 5\n4 6\n5 6\n1 6\n2 3\n2 2\n1 2\n5 6\n1 4\n1 5\n1 3\n6 2\n1 2\n4 2\n2 1\n1 3\n6 4\n4 1\n5 2\n6 2\n3 5\n2 3\n4 2\n5 1\n5 6\n3 2\n2 1\n6 6\n2 1\n6 2\n1 1\n3 2\n1 2\n3 5\n4 6\n1 3\n3 4\n5 5\n6 2", "output": "1" }, { "input": "80\n3 1\n6 3\n2 2\n2 2\n6 3\n6 1\n6 5\n1 4\n3 6\n6 5\n1 3\n2 4\n1 4\n3 1\n5 3\n5 3\n1 4\n2 5\n4 3\n4 4\n4 5\n6 1\n3 1\n2 6\n4 2\n3 1\n6 5\n2 6\n2 2\n5 1\n1 3\n5 1\n2 1\n4 3\n6 3\n3 5\n4 3\n5 6\n3 3\n4 1\n5 1\n6 5\n5 1\n2 5\n6 1\n3 2\n4 3\n3 3\n5 6\n1 6\n5 2\n1 5\n5 6\n6 4\n2 2\n4 2\n4 6\n4 2\n4 4\n6 5\n5 2\n6 2\n4 6\n6 4\n4 3\n5 1\n4 1\n3 5\n3 2\n3 2\n5 3\n5 4\n3 4\n1 3\n1 2\n6 6\n6 3\n6 1\n5 6\n3 2", "output": "0" }, { "input": "80\n4 5\n3 3\n3 6\n4 5\n3 4\n6 5\n1 5\n2 5\n5 6\n5 1\n5 1\n1 2\n5 5\n5 1\n2 3\n1 1\n4 5\n4 1\n1 1\n5 5\n5 6\n5 2\n5 4\n4 2\n6 2\n5 3\n3 2\n4 2\n1 3\n1 6\n2 1\n6 6\n4 5\n6 4\n2 2\n1 6\n6 2\n4 3\n2 3\n4 6\n4 6\n6 2\n3 4\n4 3\n5 5\n1 6\n3 2\n4 6\n2 3\n1 6\n5 4\n4 2\n5 4\n1 1\n4 3\n5 1\n3 6\n6 2\n3 1\n4 1\n5 3\n2 2\n3 4\n3 6\n3 5\n5 5\n5 1\n3 5\n2 6\n6 3\n6 5\n3 3\n5 6\n1 2\n3 1\n6 3\n3 4\n6 6\n6 6\n1 2", "output": "-1" }, { "input": "85\n6 3\n4 1\n1 2\n3 5\n6 4\n6 2\n2 6\n1 2\n1 5\n6 2\n1 4\n6 6\n2 4\n4 6\n4 5\n1 6\n3 1\n2 5\n5 1\n5 2\n3 5\n1 1\n4 1\n2 3\n1 1\n3 3\n6 4\n1 4\n1 1\n3 6\n1 5\n1 6\n2 5\n2 2\n5 1\n6 6\n1 3\n1 5\n5 6\n4 5\n4 3\n5 5\n1 3\n6 3\n4 6\n2 4\n5 6\n6 2\n4 5\n1 4\n1 4\n6 5\n1 6\n6 1\n1 6\n5 5\n2 1\n5 2\n2 3\n1 6\n1 6\n1 6\n5 6\n2 4\n6 5\n6 5\n4 2\n5 4\n3 4\n4 3\n6 6\n3 3\n3 2\n3 6\n2 5\n2 1\n2 5\n3 4\n1 2\n5 4\n6 2\n5 1\n1 4\n3 4\n4 5", "output": "0" }, { "input": "85\n3 1\n3 2\n6 3\n1 3\n2 1\n3 6\n1 4\n2 5\n6 5\n1 6\n1 5\n1 1\n4 3\n3 5\n4 6\n3 2\n6 6\n4 4\n4 1\n5 5\n4 2\n6 2\n2 2\n4 5\n6 1\n3 4\n4 5\n3 5\n4 2\n3 5\n4 4\n3 1\n4 4\n6 4\n1 4\n5 5\n1 5\n2 2\n6 5\n5 6\n6 5\n3 2\n3 2\n6 1\n6 5\n2 1\n4 6\n2 1\n3 1\n5 6\n1 3\n5 4\n1 4\n1 4\n5 3\n2 3\n1 3\n2 2\n5 3\n2 3\n2 3\n1 3\n3 6\n4 4\n6 6\n6 2\n5 1\n5 5\n5 5\n1 2\n1 4\n2 4\n3 6\n4 6\n6 3\n6 4\n5 5\n3 2\n5 4\n5 4\n4 5\n6 4\n2 1\n5 2\n5 1", "output": "-1" }, { "input": "90\n5 2\n5 5\n5 1\n4 6\n4 3\n5 3\n5 6\n5 1\n3 4\n1 3\n4 2\n1 6\n6 4\n1 2\n6 1\n4 1\n6 2\n6 5\n6 2\n5 4\n3 6\n1 1\n5 5\n2 2\n1 6\n3 5\n6 5\n1 6\n1 5\n2 3\n2 6\n2 3\n3 3\n1 3\n5 1\n2 5\n3 6\n1 2\n4 4\n1 6\n2 3\n1 5\n2 5\n1 3\n2 2\n4 6\n3 6\n6 3\n1 2\n4 3\n4 5\n4 6\n3 2\n6 5\n6 2\n2 5\n2 4\n1 3\n1 6\n4 3\n1 3\n6 4\n4 6\n4 1\n1 1\n4 1\n4 4\n6 2\n6 5\n1 1\n2 2\n3 1\n1 4\n6 2\n5 2\n1 4\n1 3\n6 5\n3 2\n6 4\n3 4\n2 6\n2 2\n6 3\n4 6\n1 2\n4 2\n3 4\n2 3\n1 5", "output": "-1" }, { "input": "90\n1 4\n3 5\n4 2\n2 5\n4 3\n2 6\n2 6\n3 2\n4 4\n6 1\n4 3\n2 3\n5 3\n6 6\n2 2\n6 3\n4 1\n4 4\n5 6\n6 4\n4 2\n5 6\n4 6\n4 4\n6 4\n4 1\n5 3\n3 2\n4 4\n5 2\n5 4\n6 4\n1 2\n3 3\n3 4\n6 4\n1 6\n4 2\n3 2\n1 1\n2 2\n5 1\n6 6\n4 1\n5 2\n3 6\n2 1\n2 2\n4 6\n6 5\n4 4\n5 5\n5 6\n1 6\n1 4\n5 6\n3 6\n6 3\n5 6\n6 5\n5 1\n6 1\n6 6\n6 3\n1 5\n4 5\n3 1\n6 6\n3 4\n6 2\n1 4\n2 2\n3 2\n5 6\n2 4\n1 4\n6 3\n4 6\n1 4\n5 2\n1 2\n6 5\n1 5\n1 4\n4 2\n2 5\n3 2\n5 1\n5 4\n5 3", "output": "-1" }, { "input": "95\n4 3\n3 2\n5 5\n5 3\n1 6\n4 4\n5 5\n6 5\n3 5\n1 5\n4 2\n5 1\n1 2\n2 3\n6 4\n2 3\n6 3\n6 5\n5 6\n1 4\n2 6\n2 6\n2 5\n2 1\n3 1\n3 5\n2 2\n6 1\n2 4\n4 6\n6 6\n6 4\n3 2\n5 1\n4 3\n6 5\n2 3\n4 1\n2 5\n6 5\n6 5\n6 5\n5 1\n5 4\n4 6\n3 2\n2 5\n2 6\n4 6\n6 3\n6 4\n5 6\n4 6\n2 4\n3 4\n1 4\n2 4\n2 3\n5 6\n6 4\n3 1\n5 1\n3 6\n3 5\n2 6\n6 3\n4 3\n3 1\n6 1\n2 2\n6 3\n2 2\n2 2\n6 4\n6 1\n2 1\n5 6\n5 4\n5 2\n3 4\n3 6\n2 1\n1 6\n5 5\n2 6\n2 3\n3 6\n1 3\n1 5\n5 1\n1 2\n2 2\n5 3\n6 4\n4 5", "output": "0" }, { "input": "95\n4 5\n5 6\n3 2\n5 1\n4 3\n4 1\n6 1\n5 2\n2 4\n5 3\n2 3\n6 4\n4 1\n1 6\n2 6\n2 3\n4 6\n2 4\n3 4\n4 2\n5 5\n1 1\n1 5\n4 3\n4 5\n6 2\n6 1\n6 3\n5 5\n4 1\n5 1\n2 3\n5 1\n3 6\n6 6\n4 5\n4 4\n4 3\n1 6\n6 6\n4 6\n6 4\n1 2\n6 2\n4 6\n6 6\n5 5\n6 1\n5 2\n4 5\n6 6\n6 5\n4 4\n1 5\n4 6\n4 1\n3 6\n5 1\n3 1\n4 6\n4 5\n1 3\n5 4\n4 5\n2 2\n6 1\n5 2\n6 5\n2 2\n1 1\n6 3\n6 1\n2 6\n3 3\n2 1\n4 6\n2 4\n5 5\n5 2\n3 2\n1 2\n6 6\n6 2\n5 1\n2 6\n5 2\n2 2\n5 5\n3 5\n3 3\n2 6\n5 3\n4 3\n1 6\n5 4", "output": "-1" }, { "input": "100\n1 1\n3 5\n2 1\n1 2\n3 4\n5 6\n5 6\n6 1\n5 5\n2 4\n5 5\n5 6\n6 2\n6 6\n2 6\n1 4\n2 2\n3 2\n1 3\n5 5\n6 3\n5 6\n1 1\n1 2\n1 2\n2 1\n2 3\n1 6\n4 3\n1 1\n2 5\n2 4\n4 4\n1 5\n3 3\n6 1\n3 5\n1 1\n3 6\n3 1\n4 2\n4 3\n3 6\n6 6\n1 6\n6 2\n2 5\n5 4\n6 3\n1 4\n2 6\n6 2\n3 4\n6 1\n6 5\n4 6\n6 5\n4 4\n3 1\n6 3\n5 1\n2 4\n5 1\n1 2\n2 4\n2 1\n6 6\n5 3\n4 6\n6 3\n5 5\n3 3\n1 1\n6 5\n4 3\n2 6\n1 5\n3 5\n2 4\n4 5\n1 6\n2 3\n6 3\n5 5\n2 6\n2 6\n3 4\n3 2\n6 1\n3 4\n6 4\n3 3\n2 3\n5 1\n3 1\n6 2\n2 3\n6 4\n1 4\n1 2", "output": "-1" }, { "input": "100\n1 1\n5 5\n1 2\n5 3\n5 5\n2 2\n1 5\n3 4\n3 2\n1 3\n5 6\n4 5\n2 1\n5 5\n2 2\n1 6\n6 1\n5 1\n4 1\n4 6\n3 5\n6 1\n2 3\n5 6\n3 6\n2 3\n5 6\n1 6\n3 2\n2 2\n3 3\n6 5\n5 5\n1 4\n5 6\n6 4\n1 4\n1 2\n2 6\n3 2\n6 4\n5 3\n3 3\n6 4\n4 6\n2 2\n5 6\n5 1\n1 2\n3 4\n4 5\n1 1\n3 4\n5 2\n4 5\n3 3\n1 1\n3 4\n1 6\n2 4\n1 3\n3 2\n6 5\n1 6\n3 6\n2 3\n2 6\n5 1\n5 5\n5 6\n4 1\n6 2\n3 6\n5 3\n2 2\n2 4\n6 6\n3 6\n4 6\n2 5\n5 3\n1 2\n3 4\n3 4\n6 2\n2 4\n2 2\n4 6\n3 5\n4 2\n5 6\n4 2\n2 3\n6 2\n5 6\n2 1\n3 3\n6 6\n4 3\n4 2", "output": "1" }, { "input": "1\n2 2", "output": "0" }, { "input": "3\n2 4\n6 6\n3 3", "output": "-1" }, { "input": "2\n3 6\n4 1", "output": "1" }, { "input": "3\n1 1\n1 1\n3 3", "output": "-1" }, { "input": "3\n2 3\n1 1\n2 3", "output": "1" }, { "input": "3\n2 2\n2 1\n1 2", "output": "1" }, { "input": "3\n1 1\n1 1\n1 1", "output": "-1" } ]
1,611,426,076
2,147,483,647
PyPy 3
TIME_LIMIT_EXCEEDED
TESTS
7
1,000
1,740,800
n = int(input()) upper, lower = [], [] for _ in range(n): x, y = map(int, input().split()) upper += [x % 2] lower += [y % 2] c = 0 while sum(upper) % 2 == 1 and sum(lower) % 2 == 1: for i in range(n): if (upper[i] == 1 and lower[i] == 0) or (upper[i] == 0 and lower[i] == 1): upper[i], lower[i] = lower[i], upper[i] if sum(upper) % 2 == 0 and sum(lower) % 2 == 0: break c += 1 if c == 0 and (sum(upper) % 2 == 1 or sum(lower) % 2 == 1): c = -1 print(c)
Title: Domino Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera has got *n* domino pieces in a row. Each piece consists of two halves — the upper one and the lower one. Each of the halves contains a number from 1 to 6. Valera loves even integers very much, so he wants the sum of the numbers on the upper halves and the sum of the numbers on the lower halves to be even. To do that, Valera can rotate the dominoes by 180 degrees. After the rotation the upper and the lower halves swap places. This action takes one second. Help Valera find out the minimum time he must spend rotating dominoes to make his wish come true. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=100), denoting the number of dominoes Valera has. Next *n* lines contain two space-separated integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=6). Number *x**i* is initially written on the upper half of the *i*-th domino, *y**i* is initially written on the lower half. Output Specification: Print a single number — the minimum required number of seconds. If Valera can't do the task in any time, print <=-<=1. Demo Input: ['2\n4 2\n6 4\n', '1\n2 3\n', '3\n1 4\n2 3\n4 4\n'] Demo Output: ['0\n', '-1\n', '1\n'] Note: In the first test case the sum of the numbers on the upper halves equals 10 and the sum of the numbers on the lower halves equals 6. Both numbers are even, so Valera doesn't required to do anything. In the second sample Valera has only one piece of domino. It is written 3 on the one of its halves, therefore one of the sums will always be odd. In the third case Valera can rotate the first piece, and after that the sum on the upper halves will be equal to 10, and the sum on the lower halves will be equal to 8.
```python n = int(input()) upper, lower = [], [] for _ in range(n): x, y = map(int, input().split()) upper += [x % 2] lower += [y % 2] c = 0 while sum(upper) % 2 == 1 and sum(lower) % 2 == 1: for i in range(n): if (upper[i] == 1 and lower[i] == 0) or (upper[i] == 0 and lower[i] == 1): upper[i], lower[i] = lower[i], upper[i] if sum(upper) % 2 == 0 and sum(lower) % 2 == 0: break c += 1 if c == 0 and (sum(upper) % 2 == 1 or sum(lower) % 2 == 1): c = -1 print(c) ```
0
182
B
Vasya's Calendar
PROGRAMMING
1,000
[ "implementation" ]
null
null
Vasya lives in a strange world. The year has *n* months and the *i*-th month has *a**i* days. Vasya got a New Year present — the clock that shows not only the time, but also the date. The clock's face can display any number from 1 to *d*. It is guaranteed that *a**i*<=≤<=*d* for all *i* from 1 to *n*. The clock does not keep information about the current month, so when a new day comes, it simply increases the current day number by one. The clock cannot display number *d*<=+<=1, so after day number *d* it shows day 1 (the current day counter resets). The mechanism of the clock allows you to increase the day number by one manually. When you execute this operation, day *d* is also followed by day 1. Vasya begins each day checking the day number on the clock. If the day number on the clock does not match the actual day number in the current month, then Vasya manually increases it by one. Vasya is persistent and repeats this operation until the day number on the clock matches the actual number of the current day in the current month. A year passed and Vasya wonders how many times he manually increased the day number by one, from the first day of the first month to the last day of the *n*-th month inclusive, considering that on the first day of the first month the clock display showed day 1.
The first line contains the single number *d* — the maximum number of the day that Vasya's clock can show (1<=≤<=*d*<=≤<=106). The second line contains a single integer *n* — the number of months in the year (1<=≤<=*n*<=≤<=2000). The third line contains *n* space-separated integers: *a**i* (1<=≤<=*a**i*<=≤<=*d*) — the number of days in each month in the order in which they follow, starting from the first one.
Print a single number — the number of times Vasya manually increased the day number by one throughout the last year.
[ "4\n2\n2 2\n", "5\n3\n3 4 3\n", "31\n12\n31 28 31 30 31 30 31 31 30 31 30 31\n" ]
[ "2\n", "3\n", "7\n" ]
In the first sample the situation is like this: - Day 1. Month 1. The clock shows 1. Vasya changes nothing. - Day 2. Month 1. The clock shows 2. Vasya changes nothing. - Day 1. Month 2. The clock shows 3. Vasya manually increases the day number by 1. After that the clock shows 4. Vasya increases the day number by 1 manually. After that the clock shows 1. - Day 2. Month 2. The clock shows 2. Vasya changes nothing.
500
[ { "input": "4\n2\n2 2", "output": "2" }, { "input": "5\n3\n3 4 3", "output": "3" }, { "input": "31\n12\n31 28 31 30 31 30 31 31 30 31 30 31", "output": "7" }, { "input": "1\n1\n1", "output": "0" }, { "input": "1\n2\n1 1", "output": "0" }, { "input": "2\n2\n1 1", "output": "1" }, { "input": "10\n2\n10 2", "output": "0" }, { "input": "10\n3\n6 3 6", "output": "11" }, { "input": "10\n4\n8 7 1 5", "output": "14" }, { "input": "10\n5\n2 7 8 4 4", "output": "19" }, { "input": "10\n6\n8 3 4 9 6 1", "output": "20" }, { "input": "10\n7\n10 5 3 1 1 9 1", "output": "31" }, { "input": "10\n8\n6 5 10 6 8 1 3 2", "output": "31" }, { "input": "10\n9\n6 2 7 5 5 4 8 6 2", "output": "37" }, { "input": "10\n10\n1 10 1 10 1 1 7 8 6 7", "output": "45" }, { "input": "100\n100\n85 50 17 89 65 89 5 20 86 26 16 21 85 14 44 31 87 31 6 2 48 67 8 80 79 1 48 36 97 1 5 30 79 50 78 12 2 55 76 100 54 40 26 81 97 96 68 56 87 14 51 17 54 37 52 33 69 62 38 63 74 15 62 78 9 19 67 2 60 58 93 60 18 96 55 48 34 7 79 82 32 58 90 67 20 50 27 15 7 89 98 10 11 15 99 49 4 51 77 52", "output": "5099" }, { "input": "101\n100\n19 17 15 16 28 69 41 47 75 42 19 98 16 90 92 47 21 4 98 17 27 31 90 10 14 92 62 73 56 55 6 60 62 22 78 1 3 86 18 59 92 41 21 34 67 9 92 78 77 45 50 92 57 61 11 98 89 72 57 93 100 12 61 48 5 48 38 9 65 64 77 29 18 55 94 42 10 77 43 46 7 89 8 13 5 53 80 59 23 100 30 28 29 24 85 56 10 22 24 16", "output": "5301" }, { "input": "102\n100\n31 22 59 16 11 56 81 4 19 31 8 72 4 92 18 7 13 12 62 40 34 67 40 23 96 4 90 28 3 18 54 49 10 71 73 79 69 7 41 75 59 13 2 78 72 6 95 33 52 97 7 86 57 94 12 93 19 94 59 28 5 96 46 102 2 101 57 85 53 69 72 39 14 75 8 16 10 57 26 4 85 18 89 84 48 93 54 21 78 6 67 35 11 78 91 91 97 15 8 32", "output": "5447" }, { "input": "103\n100\n68 38 41 54 37 11 35 26 43 97 70 3 13 11 64 83 3 95 99 16 4 13 22 27 64 20 95 38 40 87 6 17 95 67 31 24 85 33 98 24 89 101 66 38 42 5 95 18 95 13 103 85 72 73 68 93 22 59 48 59 72 46 5 41 54 32 48 69 3 76 2 26 102 44 39 58 55 85 40 16 81 78 92 63 25 97 83 2 54 16 20 63 19 8 84 34 1 22 43 93", "output": "5358" }, { "input": "104\n100\n65 74 94 71 98 38 88 67 71 84 45 79 55 86 55 51 27 89 14 66 29 63 8 103 98 94 87 81 58 68 24 96 60 36 48 95 28 72 95 42 87 7 14 23 99 77 34 14 90 31 8 99 29 30 9 88 42 1 77 61 55 85 17 98 62 78 27 1 58 69 82 62 62 81 56 104 66 8 17 23 7 61 59 70 79 64 78 16 32 11 59 4 24 73 55 2 95 39 62 13", "output": "4773" } ]
1,553,526,969
2,147,483,647
PyPy 3
OK
TESTS
40
280
204,800
d = int(input()) s = int(input()) a = list(map(int,input ().split ())) print((s-1)*d-sum(a[:-1]))
Title: Vasya's Calendar Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya lives in a strange world. The year has *n* months and the *i*-th month has *a**i* days. Vasya got a New Year present — the clock that shows not only the time, but also the date. The clock's face can display any number from 1 to *d*. It is guaranteed that *a**i*<=≤<=*d* for all *i* from 1 to *n*. The clock does not keep information about the current month, so when a new day comes, it simply increases the current day number by one. The clock cannot display number *d*<=+<=1, so after day number *d* it shows day 1 (the current day counter resets). The mechanism of the clock allows you to increase the day number by one manually. When you execute this operation, day *d* is also followed by day 1. Vasya begins each day checking the day number on the clock. If the day number on the clock does not match the actual day number in the current month, then Vasya manually increases it by one. Vasya is persistent and repeats this operation until the day number on the clock matches the actual number of the current day in the current month. A year passed and Vasya wonders how many times he manually increased the day number by one, from the first day of the first month to the last day of the *n*-th month inclusive, considering that on the first day of the first month the clock display showed day 1. Input Specification: The first line contains the single number *d* — the maximum number of the day that Vasya's clock can show (1<=≤<=*d*<=≤<=106). The second line contains a single integer *n* — the number of months in the year (1<=≤<=*n*<=≤<=2000). The third line contains *n* space-separated integers: *a**i* (1<=≤<=*a**i*<=≤<=*d*) — the number of days in each month in the order in which they follow, starting from the first one. Output Specification: Print a single number — the number of times Vasya manually increased the day number by one throughout the last year. Demo Input: ['4\n2\n2 2\n', '5\n3\n3 4 3\n', '31\n12\n31 28 31 30 31 30 31 31 30 31 30 31\n'] Demo Output: ['2\n', '3\n', '7\n'] Note: In the first sample the situation is like this: - Day 1. Month 1. The clock shows 1. Vasya changes nothing. - Day 2. Month 1. The clock shows 2. Vasya changes nothing. - Day 1. Month 2. The clock shows 3. Vasya manually increases the day number by 1. After that the clock shows 4. Vasya increases the day number by 1 manually. After that the clock shows 1. - Day 2. Month 2. The clock shows 2. Vasya changes nothing.
```python d = int(input()) s = int(input()) a = list(map(int,input ().split ())) print((s-1)*d-sum(a[:-1])) ```
3
348
A
Mafia
PROGRAMMING
1,600
[ "binary search", "math", "sortings" ]
null
null
One day *n* friends gathered together to play "Mafia". During each round of the game some player must be the supervisor and other *n*<=-<=1 people take part in the game. For each person we know in how many rounds he wants to be a player, not the supervisor: the *i*-th person wants to play *a**i* rounds. What is the minimum number of rounds of the "Mafia" game they need to play to let each person play at least as many rounds as they want?
The first line contains integer *n* (3<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the *i*-th number in the list is the number of rounds the *i*-th person wants to play.
In a single line print a single integer — the minimum number of game rounds the friends need to let the *i*-th person play at least *a**i* rounds. Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
[ "3\n3 2 2\n", "4\n2 2 2 2\n" ]
[ "4\n", "3\n" ]
You don't need to know the rules of "Mafia" to solve this problem. If you're curious, it's a game Russia got from the Soviet times: http://en.wikipedia.org/wiki/Mafia_(party_game).
500
[ { "input": "3\n3 2 2", "output": "4" }, { "input": "4\n2 2 2 2", "output": "3" }, { "input": "7\n9 7 7 8 8 7 8", "output": "9" }, { "input": "10\n13 12 10 13 13 14 10 10 12 12", "output": "14" }, { "input": "10\n94 96 91 95 99 94 96 92 95 99", "output": "106" }, { "input": "100\n1 555 876 444 262 234 231 598 416 261 206 165 181 988 469 123 602 592 533 97 864 716 831 156 962 341 207 377 892 51 866 96 757 317 832 476 549 472 770 1000 887 145 956 515 992 653 972 677 973 527 984 559 280 346 580 30 372 547 209 929 492 520 446 726 47 170 699 560 814 206 688 955 308 287 26 102 77 430 262 71 415 586 532 562 419 615 732 658 108 315 268 574 86 12 23 429 640 995 342 305", "output": "1000" }, { "input": "3\n1 1 1", "output": "2" }, { "input": "30\n94 93 90 94 90 91 93 91 93 94 93 90 100 94 97 94 94 95 94 96 94 98 97 95 97 91 91 95 98 96", "output": "100" }, { "input": "5\n1000000000 5 5 4 4", "output": "1000000000" }, { "input": "3\n1 2 1", "output": "2" }, { "input": "3\n2 1 1", "output": "2" }, { "input": "4\n1 2 3 4", "output": "4" }, { "input": "3\n1000000000 1000000000 10000000", "output": "1005000000" }, { "input": "3\n677876423 834056477 553175531", "output": "1032554216" }, { "input": "5\n1000000000 1 1 1 1", "output": "1000000000" }, { "input": "4\n1000000000 1000000000 1000000000 1000000000", "output": "1333333334" }, { "input": "3\n4 10 11", "output": "13" }, { "input": "5\n1000000000 1000000000 1000000000 1000000000 1000000000", "output": "1250000000" } ]
1,671,855,708
2,147,483,647
Python 3
COMPILATION_ERROR
TESTS
0
0
0
n=input() a=map(int,raw_input().split()) print max(max(a),-(-sum(a)/(n-1)))
Title: Mafia Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day *n* friends gathered together to play "Mafia". During each round of the game some player must be the supervisor and other *n*<=-<=1 people take part in the game. For each person we know in how many rounds he wants to be a player, not the supervisor: the *i*-th person wants to play *a**i* rounds. What is the minimum number of rounds of the "Mafia" game they need to play to let each person play at least as many rounds as they want? Input Specification: The first line contains integer *n* (3<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the *i*-th number in the list is the number of rounds the *i*-th person wants to play. Output Specification: In a single line print a single integer — the minimum number of game rounds the friends need to let the *i*-th person play at least *a**i* rounds. Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier. Demo Input: ['3\n3 2 2\n', '4\n2 2 2 2\n'] Demo Output: ['4\n', '3\n'] Note: You don't need to know the rules of "Mafia" to solve this problem. If you're curious, it's a game Russia got from the Soviet times: http://en.wikipedia.org/wiki/Mafia_(party_game).
```python n=input() a=map(int,raw_input().split()) print max(max(a),-(-sum(a)/(n-1))) ```
-1
821
B
Okabe and Banana Trees
PROGRAMMING
1,300
[ "brute force", "math" ]
null
null
Okabe needs bananas for one of his experiments for some strange reason. So he decides to go to the forest and cut banana trees. Consider the point (*x*,<=*y*) in the 2D plane such that *x* and *y* are integers and 0<=≤<=*x*,<=*y*. There is a tree in such a point, and it has *x*<=+<=*y* bananas. There are no trees nor bananas in other points. Now, Okabe draws a line with equation . Okabe can select a single rectangle with axis aligned sides with all points on or under the line and cut all the trees in all points that are inside or on the border of this rectangle and take their bananas. Okabe's rectangle can be degenerate; that is, it can be a line segment or even a point. Help Okabe and find the maximum number of bananas he can get if he chooses the rectangle wisely. Okabe is sure that the answer does not exceed 1018. You can trust him.
The first line of input contains two space-separated integers *m* and *b* (1<=≤<=*m*<=≤<=1000, 1<=≤<=*b*<=≤<=10000).
Print the maximum number of bananas Okabe can get from the trees he cuts.
[ "1 5\n", "2 3\n" ]
[ "30\n", "25\n" ]
The graph above corresponds to sample test 1. The optimal rectangle is shown in red and has 30 bananas.
1,000
[ { "input": "1 5", "output": "30" }, { "input": "2 3", "output": "25" }, { "input": "4 6", "output": "459" }, { "input": "6 3", "output": "171" }, { "input": "1 1", "output": "1" }, { "input": "10 1", "output": "55" }, { "input": "20 10", "output": "40326" }, { "input": "1000 10000", "output": "74133360011484445" }, { "input": "139 9252", "output": "1137907933561080" }, { "input": "859 8096", "output": "29032056230649780" }, { "input": "987 4237", "output": "5495451829240878" }, { "input": "411 3081", "output": "366755153481948" }, { "input": "539 9221", "output": "16893595018603386" }, { "input": "259 770", "output": "2281741798549" }, { "input": "387 5422", "output": "1771610559998400" }, { "input": "515 1563", "output": "75233740231341" }, { "input": "939 407", "output": "4438222781916" }, { "input": "518 6518", "output": "5511730799718825" }, { "input": "646 1171", "output": "49802404050106" }, { "input": "70 7311", "output": "142915220249910" }, { "input": "494 6155", "output": "4221391613846823" }, { "input": "918 7704", "output": "28569727339126165" }, { "input": "46 3844", "output": "9007500020760" }, { "input": "174 2688", "output": "43730657099581" }, { "input": "894 4637", "output": "5909849585253250" }, { "input": "22 3481", "output": "1548544125646" }, { "input": "446 5030", "output": "1878390629993745" }, { "input": "440 8704", "output": "9470470760118060" }, { "input": "569 7548", "output": "10326205017481606" }, { "input": "289 6393", "output": "1620061541812350" }, { "input": "417 1045", "output": "14758909519725" }, { "input": "841 7185", "output": "19452619774222875" }, { "input": "969 6030", "output": "15265318959845745" }, { "input": "393 4874", "output": "1327174123029975" }, { "input": "817 3719", "output": "2546859449982016" }, { "input": "945 2563", "output": "1115613396515835" }, { "input": "369 4511", "output": "927715710215505" }, { "input": "555 3594", "output": "1061060598862891" } ]
1,498,405,294
3,994
Python 3
COMPILATION_ERROR
PRETESTS
0
0
0
#include <iostream> using namespace std; int main() { int m,b; cin >> m >> b; long long t = 0; long long ans = 0; for(int x=0;x<=m*b;x++) { int y = int(-float(x)/m+b); t=((x+1)*(y+1)*(x+y))/2; ans = max(ans,t); } cout << ans; }
Title: Okabe and Banana Trees Time Limit: None seconds Memory Limit: None megabytes Problem Description: Okabe needs bananas for one of his experiments for some strange reason. So he decides to go to the forest and cut banana trees. Consider the point (*x*,<=*y*) in the 2D plane such that *x* and *y* are integers and 0<=≤<=*x*,<=*y*. There is a tree in such a point, and it has *x*<=+<=*y* bananas. There are no trees nor bananas in other points. Now, Okabe draws a line with equation . Okabe can select a single rectangle with axis aligned sides with all points on or under the line and cut all the trees in all points that are inside or on the border of this rectangle and take their bananas. Okabe's rectangle can be degenerate; that is, it can be a line segment or even a point. Help Okabe and find the maximum number of bananas he can get if he chooses the rectangle wisely. Okabe is sure that the answer does not exceed 1018. You can trust him. Input Specification: The first line of input contains two space-separated integers *m* and *b* (1<=≤<=*m*<=≤<=1000, 1<=≤<=*b*<=≤<=10000). Output Specification: Print the maximum number of bananas Okabe can get from the trees he cuts. Demo Input: ['1 5\n', '2 3\n'] Demo Output: ['30\n', '25\n'] Note: The graph above corresponds to sample test 1. The optimal rectangle is shown in red and has 30 bananas.
```python #include <iostream> using namespace std; int main() { int m,b; cin >> m >> b; long long t = 0; long long ans = 0; for(int x=0;x<=m*b;x++) { int y = int(-float(x)/m+b); t=((x+1)*(y+1)*(x+y))/2; ans = max(ans,t); } cout << ans; } ```
-1
982
A
Row
PROGRAMMING
1,200
[ "brute force", "constructive algorithms" ]
null
null
You're given a row with $n$ chairs. We call a seating of people "maximal" if the two following conditions hold: 1. There are no neighbors adjacent to anyone seated. 1. It's impossible to seat one more person without violating the first rule. The seating is given as a string consisting of zeros and ones ($0$ means that the corresponding seat is empty, $1$ — occupied). The goal is to determine whether this seating is "maximal". Note that the first and last seats are not adjacent (if $n \ne 2$).
The first line contains a single integer $n$ ($1 \leq n \leq 1000$) — the number of chairs. The next line contains a string of $n$ characters, each of them is either zero or one, describing the seating.
Output "Yes" (without quotation marks) if the seating is "maximal". Otherwise print "No". You are allowed to print letters in whatever case you'd like (uppercase or lowercase).
[ "3\n101\n", "4\n1011\n", "5\n10001\n" ]
[ "Yes\n", "No\n", "No\n" ]
In sample case one the given seating is maximal. In sample case two the person at chair three has a neighbour to the right. In sample case three it is possible to seat yet another person into chair three.
500
[ { "input": "3\n101", "output": "Yes" }, { "input": "4\n1011", "output": "No" }, { "input": "5\n10001", "output": "No" }, { "input": "1\n0", "output": "No" }, { "input": "1\n1", "output": "Yes" }, { "input": "100\n0101001010101001010010010101001010100101001001001010010101010010101001001010101001001001010100101010", "output": "Yes" }, { "input": "4\n0100", "output": "No" }, { "input": "42\n011000100101001001101011011010100010011010", "output": "No" }, { "input": "3\n001", "output": "No" }, { "input": "64\n1001001010010010100101010010010100100101001001001001010100101001", "output": "Yes" }, { "input": "3\n111", "output": "No" }, { "input": "4\n0000", "output": "No" }, { "input": "4\n0001", "output": "No" }, { "input": "4\n0010", "output": "No" }, { "input": "4\n0011", "output": "No" }, { "input": "4\n0101", "output": "Yes" }, { "input": "4\n0110", "output": "No" }, { "input": "4\n0111", "output": "No" }, { "input": "4\n1000", "output": "No" }, { "input": "4\n1001", "output": "Yes" }, { "input": "4\n1010", "output": "Yes" }, { "input": "4\n1100", "output": "No" }, { "input": "4\n1101", "output": "No" }, { "input": "4\n1110", "output": "No" }, { "input": "4\n1111", "output": "No" }, { "input": "2\n00", "output": "No" }, { "input": "2\n01", "output": "Yes" }, { "input": "2\n10", "output": "Yes" }, { "input": "2\n11", "output": "No" }, { "input": "3\n000", "output": "No" }, { "input": "3\n010", "output": "Yes" }, { "input": "3\n011", "output": "No" }, { "input": "3\n100", "output": "No" }, { "input": "3\n110", "output": "No" }, { "input": "100\n0111001010101110001100000010011000100101110010001100111110101110001110101010111000010010011000000110", "output": "No" }, { "input": "357\n100101010010010010010100101001001010101010100100100100101001010101001010010100101001010100101001010010100100101001010101010101001001010100101010010100101001010100100100101010010010010100101010010010101001010010010101001001010010010101010100100101010010100100101001010100101001010100101001010010010010100101001010100100100100100100100101010101010010010100101", "output": "Yes" }, { "input": "459\n000111000101010000100001001010111110011011010001100101111010111011101110111101111101100101100011011001100110001001111001101000111001011100110100011111011111000010000110010011100110011011111110011100001101001111000100111011001000001011111100110100001001001100101011100001110110100101011011110100100111101011000101110000100110100100010000000100001001111111000011101010010011001111010111001100000100111001010111011010000011000011100101101011101000011011000110011", "output": "No" }, { "input": "3\n001", "output": "No" }, { "input": "4\n0010", "output": "No" }, { "input": "3\n111", "output": "No" }, { "input": "4\n0110", "output": "No" }, { "input": "2\n11", "output": "No" }, { "input": "2\n10", "output": "Yes" }, { "input": "2\n01", "output": "Yes" }, { "input": "4\n1101", "output": "No" }, { "input": "2\n00", "output": "No" }, { "input": "4\n1111", "output": "No" }, { "input": "15\n000010101010000", "output": "No" }, { "input": "8\n10010100", "output": "No" }, { "input": "5\n00100", "output": "No" }, { "input": "6\n100100", "output": "No" }, { "input": "7\n1000001", "output": "No" }, { "input": "98\n10101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010", "output": "Yes" } ]
1,584,282,647
2,147,483,647
PyPy 3
OK
TESTS
55
155
0
n=int(input()) s=input() s='0'+s+'0' if('000' in s or '11' in s): print('No') else: print('Yes')
Title: Row Time Limit: None seconds Memory Limit: None megabytes Problem Description: You're given a row with $n$ chairs. We call a seating of people "maximal" if the two following conditions hold: 1. There are no neighbors adjacent to anyone seated. 1. It's impossible to seat one more person without violating the first rule. The seating is given as a string consisting of zeros and ones ($0$ means that the corresponding seat is empty, $1$ — occupied). The goal is to determine whether this seating is "maximal". Note that the first and last seats are not adjacent (if $n \ne 2$). Input Specification: The first line contains a single integer $n$ ($1 \leq n \leq 1000$) — the number of chairs. The next line contains a string of $n$ characters, each of them is either zero or one, describing the seating. Output Specification: Output "Yes" (without quotation marks) if the seating is "maximal". Otherwise print "No". You are allowed to print letters in whatever case you'd like (uppercase or lowercase). Demo Input: ['3\n101\n', '4\n1011\n', '5\n10001\n'] Demo Output: ['Yes\n', 'No\n', 'No\n'] Note: In sample case one the given seating is maximal. In sample case two the person at chair three has a neighbour to the right. In sample case three it is possible to seat yet another person into chair three.
```python n=int(input()) s=input() s='0'+s+'0' if('000' in s or '11' in s): print('No') else: print('Yes') ```
3
577
A
Multiplication Table
PROGRAMMING
1,000
[ "implementation", "number theory" ]
null
null
Let's consider a table consisting of *n* rows and *n* columns. The cell located at the intersection of *i*-th row and *j*-th column contains number *i*<=×<=*j*. The rows and columns are numbered starting from 1. You are given a positive integer *x*. Your task is to count the number of cells in a table that contain number *x*.
The single line contains numbers *n* and *x* (1<=≤<=*n*<=≤<=105, 1<=≤<=*x*<=≤<=109) — the size of the table and the number that we are looking for in the table.
Print a single number: the number of times *x* occurs in the table.
[ "10 5\n", "6 12\n", "5 13\n" ]
[ "2\n", "4\n", "0\n" ]
A table for the second sample test is given below. The occurrences of number 12 are marked bold.
500
[ { "input": "10 5", "output": "2" }, { "input": "6 12", "output": "4" }, { "input": "5 13", "output": "0" }, { "input": "1 1", "output": "1" }, { "input": "2 1", "output": "1" }, { "input": "100000 1", "output": "1" }, { "input": "1 1000000000", "output": "0" }, { "input": "100000 1000000000", "output": "16" }, { "input": "100000 362880", "output": "154" }, { "input": "1 4", "output": "0" }, { "input": "9 12", "output": "4" }, { "input": "10 123", "output": "0" }, { "input": "9551 975275379", "output": "0" }, { "input": "17286 948615687", "output": "0" }, { "input": "58942 936593001", "output": "0" }, { "input": "50000 989460910", "output": "4" }, { "input": "22741 989460910", "output": "0" }, { "input": "22740 989460910", "output": "0" }, { "input": "100000 989460910", "output": "4" }, { "input": "100000 98280", "output": "128" }, { "input": "100000 997920", "output": "222" }, { "input": "100000 720720", "output": "226" }, { "input": "100000 2162160", "output": "282" }, { "input": "100000 4324320", "output": "320" }, { "input": "100000 8648640", "output": "348" }, { "input": "100000 183783600", "output": "438" }, { "input": "100000 551350800", "output": "392" }, { "input": "40000 551350800", "output": "150" }, { "input": "20000 400000000", "output": "1" }, { "input": "19999 400000000", "output": "0" }, { "input": "19999 399960001", "output": "1" }, { "input": "31621 999887641", "output": "1" }, { "input": "31622 999887641", "output": "1" }, { "input": "31620 999887641", "output": "0" }, { "input": "100000 999887641", "output": "3" }, { "input": "100000 25", "output": "3" }, { "input": "100000 1", "output": "1" }, { "input": "100000 3628800", "output": "220" }, { "input": "100000 39916800", "output": "328" }, { "input": "100000 479001600", "output": "254" }, { "input": "4 9", "output": "1" }, { "input": "2 6", "output": "0" }, { "input": "20 100", "output": "3" }, { "input": "10 3", "output": "2" }, { "input": "4 4", "output": "3" }, { "input": "2 4", "output": "1" }, { "input": "89874 1", "output": "1" } ]
1,642,001,777
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
4
46
0
n, x = map(int, input().split()) count = 0 if n * n == x: print('1') else: for i in range(1, n+1): for j in range(i, n+1): if i * j == x: count += 1 print(count*2)
Title: Multiplication Table Time Limit: None seconds Memory Limit: None megabytes Problem Description: Let's consider a table consisting of *n* rows and *n* columns. The cell located at the intersection of *i*-th row and *j*-th column contains number *i*<=×<=*j*. The rows and columns are numbered starting from 1. You are given a positive integer *x*. Your task is to count the number of cells in a table that contain number *x*. Input Specification: The single line contains numbers *n* and *x* (1<=≤<=*n*<=≤<=105, 1<=≤<=*x*<=≤<=109) — the size of the table and the number that we are looking for in the table. Output Specification: Print a single number: the number of times *x* occurs in the table. Demo Input: ['10 5\n', '6 12\n', '5 13\n'] Demo Output: ['2\n', '4\n', '0\n'] Note: A table for the second sample test is given below. The occurrences of number 12 are marked bold.
```python n, x = map(int, input().split()) count = 0 if n * n == x: print('1') else: for i in range(1, n+1): for j in range(i, n+1): if i * j == x: count += 1 print(count*2) ```
0
378
A
Playing with Dice
PROGRAMMING
800
[ "brute force" ]
null
null
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw. The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
[ "2 5\n", "2 4\n" ]
[ "3 0 3\n", "2 1 3\n" ]
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct. You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| &lt; |*b* - *x*|.
500
[ { "input": "2 5", "output": "3 0 3" }, { "input": "2 4", "output": "2 1 3" }, { "input": "5 3", "output": "2 1 3" }, { "input": "1 6", "output": "3 0 3" }, { "input": "5 1", "output": "3 1 2" }, { "input": "6 3", "output": "2 0 4" }, { "input": "2 3", "output": "2 0 4" }, { "input": "5 6", "output": "5 0 1" }, { "input": "4 4", "output": "0 6 0" }, { "input": "1 1", "output": "0 6 0" }, { "input": "6 4", "output": "1 1 4" }, { "input": "1 4", "output": "2 0 4" }, { "input": "5 5", "output": "0 6 0" }, { "input": "4 5", "output": "4 0 2" }, { "input": "4 3", "output": "3 0 3" }, { "input": "1 5", "output": "2 1 3" }, { "input": "6 5", "output": "1 0 5" }, { "input": "2 2", "output": "0 6 0" }, { "input": "1 3", "output": "1 1 4" }, { "input": "3 6", "output": "4 0 2" }, { "input": "3 1", "output": "4 1 1" }, { "input": "3 2", "output": "4 0 2" }, { "input": "3 5", "output": "3 1 2" }, { "input": "3 3", "output": "0 6 0" }, { "input": "6 2", "output": "2 1 3" }, { "input": "4 1", "output": "4 0 2" }, { "input": "5 2", "output": "3 0 3" }, { "input": "4 2", "output": "3 1 2" }, { "input": "2 1", "output": "5 0 1" }, { "input": "6 1", "output": "3 0 3" }, { "input": "4 6", "output": "4 1 1" }, { "input": "2 6", "output": "3 1 2" }, { "input": "3 4", "output": "3 0 3" }, { "input": "1 2", "output": "1 0 5" }, { "input": "6 6", "output": "0 6 0" }, { "input": "5 4", "output": "2 0 4" }, { "input": "3 3", "output": "0 6 0" }, { "input": "1 1", "output": "0 6 0" } ]
1,614,076,643
2,147,483,647
Python 3
OK
TESTS
38
62
307,200
a, b = list(map(int, input().split())) first_player_wins = 0 second_player_wins = 0 draw = 0 for i in range(1, 7): p = abs(a-i) q = abs(b-i) if p < q: first_player_wins += 1 elif p > q: second_player_wins += 1 elif p == q: draw += 1 print(first_player_wins, end = " ") print(draw, end = " ") print(second_player_wins)
Title: Playing with Dice Time Limit: None seconds Memory Limit: None megabytes Problem Description: Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw. The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins? Input Specification: The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly. Output Specification: Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly. Demo Input: ['2 5\n', '2 4\n'] Demo Output: ['3 0 3\n', '2 1 3\n'] Note: The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct. You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| &lt; |*b* - *x*|.
```python a, b = list(map(int, input().split())) first_player_wins = 0 second_player_wins = 0 draw = 0 for i in range(1, 7): p = abs(a-i) q = abs(b-i) if p < q: first_player_wins += 1 elif p > q: second_player_wins += 1 elif p == q: draw += 1 print(first_player_wins, end = " ") print(draw, end = " ") print(second_player_wins) ```
3
451
A
Game With Sticks
PROGRAMMING
900
[ "implementation" ]
null
null
After winning gold and silver in IOI 2014, Akshat and Malvika want to have some fun. Now they are playing a game on a grid made of *n* horizontal and *m* vertical sticks. An intersection point is any point on the grid which is formed by the intersection of one horizontal stick and one vertical stick. In the grid shown below, *n*<==<=3 and *m*<==<=3. There are *n*<=+<=*m*<==<=6 sticks in total (horizontal sticks are shown in red and vertical sticks are shown in green). There are *n*·*m*<==<=9 intersection points, numbered from 1 to 9. The rules of the game are very simple. The players move in turns. Akshat won gold, so he makes the first move. During his/her move, a player must choose any remaining intersection point and remove from the grid all sticks which pass through this point. A player will lose the game if he/she cannot make a move (i.e. there are no intersection points remaining on the grid at his/her move). Assume that both players play optimally. Who will win the game?
The first line of input contains two space-separated integers, *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Print a single line containing "Akshat" or "Malvika" (without the quotes), depending on the winner of the game.
[ "2 2\n", "2 3\n", "3 3\n" ]
[ "Malvika\n", "Malvika\n", "Akshat\n" ]
Explanation of the first sample: The grid has four intersection points, numbered from 1 to 4. If Akshat chooses intersection point 1, then he will remove two sticks (1 - 2 and 1 - 3). The resulting grid will look like this. Now there is only one remaining intersection point (i.e. 4). Malvika must choose it and remove both remaining sticks. After her move the grid will be empty. In the empty grid, Akshat cannot make any move, hence he will lose. Since all 4 intersection points of the grid are equivalent, Akshat will lose no matter which one he picks.
500
[ { "input": "2 2", "output": "Malvika" }, { "input": "2 3", "output": "Malvika" }, { "input": "3 3", "output": "Akshat" }, { "input": "20 68", "output": "Malvika" }, { "input": "1 1", "output": "Akshat" }, { "input": "1 2", "output": "Akshat" }, { "input": "1 3", "output": "Akshat" }, { "input": "2 1", "output": "Akshat" }, { "input": "2 2", "output": "Malvika" }, { "input": "3 1", "output": "Akshat" }, { "input": "3 2", "output": "Malvika" }, { "input": "68 42", "output": "Malvika" }, { "input": "1 35", "output": "Akshat" }, { "input": "25 70", "output": "Akshat" }, { "input": "59 79", "output": "Akshat" }, { "input": "65 63", "output": "Akshat" }, { "input": "46 6", "output": "Malvika" }, { "input": "28 82", "output": "Malvika" }, { "input": "98 98", "output": "Malvika" }, { "input": "98 99", "output": "Malvika" }, { "input": "98 100", "output": "Malvika" }, { "input": "99 98", "output": "Malvika" }, { "input": "99 99", "output": "Akshat" }, { "input": "99 100", "output": "Akshat" }, { "input": "100 98", "output": "Malvika" }, { "input": "100 99", "output": "Akshat" }, { "input": "100 100", "output": "Malvika" }, { "input": "3 4", "output": "Akshat" } ]
1,683,898,777
2,147,483,647
PyPy 3-64
RUNTIME_ERROR
TESTS
0
61
2,764,800
n=int(input()) m=int(input()) turn=0 while(n*m!=0): n=n-1 m=m-1 turn=turn+1 if turn%2!=0: print("malvika") else: print("akshat")
Title: Game With Sticks Time Limit: None seconds Memory Limit: None megabytes Problem Description: After winning gold and silver in IOI 2014, Akshat and Malvika want to have some fun. Now they are playing a game on a grid made of *n* horizontal and *m* vertical sticks. An intersection point is any point on the grid which is formed by the intersection of one horizontal stick and one vertical stick. In the grid shown below, *n*<==<=3 and *m*<==<=3. There are *n*<=+<=*m*<==<=6 sticks in total (horizontal sticks are shown in red and vertical sticks are shown in green). There are *n*·*m*<==<=9 intersection points, numbered from 1 to 9. The rules of the game are very simple. The players move in turns. Akshat won gold, so he makes the first move. During his/her move, a player must choose any remaining intersection point and remove from the grid all sticks which pass through this point. A player will lose the game if he/she cannot make a move (i.e. there are no intersection points remaining on the grid at his/her move). Assume that both players play optimally. Who will win the game? Input Specification: The first line of input contains two space-separated integers, *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). Output Specification: Print a single line containing "Akshat" or "Malvika" (without the quotes), depending on the winner of the game. Demo Input: ['2 2\n', '2 3\n', '3 3\n'] Demo Output: ['Malvika\n', 'Malvika\n', 'Akshat\n'] Note: Explanation of the first sample: The grid has four intersection points, numbered from 1 to 4. If Akshat chooses intersection point 1, then he will remove two sticks (1 - 2 and 1 - 3). The resulting grid will look like this. Now there is only one remaining intersection point (i.e. 4). Malvika must choose it and remove both remaining sticks. After her move the grid will be empty. In the empty grid, Akshat cannot make any move, hence he will lose. Since all 4 intersection points of the grid are equivalent, Akshat will lose no matter which one he picks.
```python n=int(input()) m=int(input()) turn=0 while(n*m!=0): n=n-1 m=m-1 turn=turn+1 if turn%2!=0: print("malvika") else: print("akshat") ```
-1
808
B
Average Sleep Time
PROGRAMMING
1,300
[ "data structures", "implementation", "math" ]
null
null
It's been almost a week since Polycarp couldn't get rid of insomnia. And as you may already know, one week in Berland lasts *k* days! When Polycarp went to a doctor with his problem, the doctor asked him about his sleeping schedule (more specifically, the average amount of hours of sleep per week). Luckily, Polycarp kept records of sleep times for the last *n* days. So now he has a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* is the sleep time on the *i*-th day. The number of records is so large that Polycarp is unable to calculate the average value by himself. Thus he is asking you to help him with the calculations. To get the average Polycarp is going to consider *k* consecutive days as a week. So there will be *n*<=-<=*k*<=+<=1 weeks to take into consideration. For example, if *k*<==<=2, *n*<==<=3 and *a*<==<=[3,<=4,<=7], then the result is . You should write a program which will calculate average sleep times of Polycarp over all weeks.
The first line contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=2·105). The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105).
Output average sleeping time over all weeks. The answer is considered to be correct if its absolute or relative error does not exceed 10<=-<=6. In particular, it is enough to output real number with at least 6 digits after the decimal point.
[ "3 2\n3 4 7\n", "1 1\n10\n", "8 2\n1 2 4 100000 123 456 789 1\n" ]
[ "9.0000000000\n", "10.0000000000\n", "28964.2857142857\n" ]
In the third example there are *n* - *k* + 1 = 7 weeks, so the answer is sums of all weeks divided by 7.
0
[ { "input": "3 2\n3 4 7", "output": "9.0000000000" }, { "input": "1 1\n10", "output": "10.0000000000" }, { "input": "8 2\n1 2 4 100000 123 456 789 1", "output": "28964.2857142857" }, { "input": "1 1\n1", "output": "1.0000000000" }, { "input": "1 1\n100000", "output": "100000.0000000000" }, { "input": "3 1\n1 2 3", "output": "2.0000000000" }, { "input": "10 4\n11 3 5 20 12 7 9 2 2 20", "output": "36.2857142857" }, { "input": "10 5\n15 9 3 2 17 10 9 18 4 19", "output": "50.3333333333" }, { "input": "10 6\n19 3 20 16 14 10 1 13 7 3", "output": "65.8000000000" }, { "input": "10 7\n8 16 2 13 15 9 5 13 9 2", "output": "68.2500000000" }, { "input": "10 4\n127 1459 718 1183 880 1044 1857 1340 725 1496", "output": "4574.4285714286" }, { "input": "10 5\n1384 1129 1780 1960 1567 1928 12 1523 1165 344", "output": "6931.3333333333" } ]
1,497,223,771
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
46
0
n,k = map(int,input().split()) a = list(map(int,input().split())) pref = [0] for i in a: pref.append(i+pref[-1]) cnt = 0 cur = 0 for i in range(k,n): cnt += 1 cur += pref[i]-pref[i-k] print(cur/cnt)
Title: Average Sleep Time Time Limit: None seconds Memory Limit: None megabytes Problem Description: It's been almost a week since Polycarp couldn't get rid of insomnia. And as you may already know, one week in Berland lasts *k* days! When Polycarp went to a doctor with his problem, the doctor asked him about his sleeping schedule (more specifically, the average amount of hours of sleep per week). Luckily, Polycarp kept records of sleep times for the last *n* days. So now he has a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* is the sleep time on the *i*-th day. The number of records is so large that Polycarp is unable to calculate the average value by himself. Thus he is asking you to help him with the calculations. To get the average Polycarp is going to consider *k* consecutive days as a week. So there will be *n*<=-<=*k*<=+<=1 weeks to take into consideration. For example, if *k*<==<=2, *n*<==<=3 and *a*<==<=[3,<=4,<=7], then the result is . You should write a program which will calculate average sleep times of Polycarp over all weeks. Input Specification: The first line contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=2·105). The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105). Output Specification: Output average sleeping time over all weeks. The answer is considered to be correct if its absolute or relative error does not exceed 10<=-<=6. In particular, it is enough to output real number with at least 6 digits after the decimal point. Demo Input: ['3 2\n3 4 7\n', '1 1\n10\n', '8 2\n1 2 4 100000 123 456 789 1\n'] Demo Output: ['9.0000000000\n', '10.0000000000\n', '28964.2857142857\n'] Note: In the third example there are *n* - *k* + 1 = 7 weeks, so the answer is sums of all weeks divided by 7.
```python n,k = map(int,input().split()) a = list(map(int,input().split())) pref = [0] for i in a: pref.append(i+pref[-1]) cnt = 0 cur = 0 for i in range(k,n): cnt += 1 cur += pref[i]-pref[i-k] print(cur/cnt) ```
0
731
A
Night at the Museum
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition. Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture: After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'. Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
[ "zeus\n", "map\n", "ares\n" ]
[ "18\n", "35\n", "34\n" ]
To print the string from the first sample it would be optimal to perform the following sequence of rotations: 1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
500
[ { "input": "zeus", "output": "18" }, { "input": "map", "output": "35" }, { "input": "ares", "output": "34" }, { "input": "l", "output": "11" }, { "input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv", "output": "99" }, { "input": "gngvi", "output": "44" }, { "input": "aaaaa", "output": "0" }, { "input": "a", "output": "0" }, { "input": "z", "output": "1" }, { "input": "vyadeehhikklnoqrs", "output": "28" }, { "input": "jjiihhhhgggfedcccbazyxx", "output": "21" }, { "input": "fyyptqqxuciqvwdewyppjdzur", "output": "117" }, { "input": "fqcnzmzmbobmancqcoalzmanaobpdse", "output": "368" }, { "input": "zzzzzaaaaaaazzzzzzaaaaaaazzzzzzaaaazzzza", "output": "8" }, { "input": "aucnwhfixuruefkypvrvnvznwtjgwlghoqtisbkhuwxmgzuljvqhmnwzisnsgjhivnjmbknptxatdkelhzkhsuxzrmlcpeoyukiy", "output": "644" }, { "input": "sssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss", "output": "8" }, { "input": "nypjygrdtpzpigzyrisqeqfriwgwlengnezppgttgtndbrryjdl", "output": "421" }, { "input": "pnllnnmmmmoqqqqqrrtssssuuvtsrpopqoonllmonnnpppopnonoopooqpnopppqppqstuuuwwwwvxzxzzaa", "output": "84" }, { "input": "btaoahqgxnfsdmzsjxgvdwjukcvereqeskrdufqfqgzqfsftdqcthtkcnaipftcnco", "output": "666" }, { "input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeerrrrrrrrrrrrrrrrwwwwwwwwww", "output": "22" }, { "input": "uyknzcrwjyzmscqucclvacmorepdgmnyhmakmmnygqwglrxkxhkpansbmruwxdeoprxzmpsvwackopujxbbkpwyeggsvjykpxh", "output": "643" }, { "input": "gzwpooohffcxwtpjgfzwtooiccxsrrokezutoojdzwsrmmhecaxwrojcbyrqlfdwwrliiib", "output": "245" }, { "input": "dbvnkktasjdwqsrzfwwtmjgbcxggdxsoeilecihduypktkkbwfbruxzzhlttrssicgdwqruddwrlbtxgmhdbatzvdxbbro", "output": "468" }, { "input": "mdtvowlktxzzbuaeiuebfeorgbdczauxsovbucactkvyvemsknsjfhifqgycqredzchipmkvzbxdjkcbyukomjlzvxzoswumned", "output": "523" }, { "input": "kkkkkkkaaaaxxaaaaaaaxxxxxxxxaaaaaaxaaaaaaaaaakkkkkkkkkaaaaaaannnnnxxxxkkkkkkkkaannnnnnna", "output": "130" }, { "input": "dffiknqqrsvwzcdgjkmpqtuwxadfhkkkmpqrtwxyadfggjmpppsuuwyyzcdgghhknnpsvvvwwwyabccffiloqruwwyyzabeeehh", "output": "163" }, { "input": "qpppmmkjihgecbyvvsppnnnkjiffeebaaywutrrqpmkjhgddbzzzywtssssqnmmljheddbbaxvusrqonmlifedbbzyywwtqnkheb", "output": "155" }, { "input": "wvvwwwvvwxxxyyyxxwwvwwvuttttttuvvwxxwxxyxxwwwwwvvuttssrssstsssssrqpqqppqrssrsrrssrssssrrsrqqrrqpppqp", "output": "57" }, { "input": "dqcpcobpcobnznamznamzlykxkxlxlylzmaobnaobpbnanbpcoaobnboaoboanzlymzmykylymylzlylymanboanaocqdqesfrfs", "output": "1236" }, { "input": "nnnnnnnnnnnnnnnnnnnnaaaaaaaaaaaaaaaaaaaakkkkkkkkkkkkkkkkkkkkkkaaaaaaaaaaaaaaaaaaaaxxxxxxxxxxxxxxxxxx", "output": "49" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "0" }, { "input": "cgilqsuwzaffilptwwbgmnttyyejkorxzflqvzbddhmnrvxchijpuwaeiimosxyycejlpquuwbfkpvbgijkqvxybdjjjptxcfkqt", "output": "331" }, { "input": "ufsepwgtzgtgjssxaitgpailuvgqweoppszjwhoxdhhhpwwdorwfrdjwcdekxiktwziqwbkvbknrtvajpyeqbjvhiikxxaejjpte", "output": "692" }, { "input": "uhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuh", "output": "1293" }, { "input": "vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvgggggggggggggggggggggggggggggggggggggggggggggggggg", "output": "16" }, { "input": "lyidmjyzbszgiwkxhhpnnthfwcvvstueionspfrvqgkvngmwyhezlosrpdnbvtcjjxxsykixwnepbumaacdzadlqhnjlcejovple", "output": "616" }, { "input": "etzqqbaveffalkdguunfmyyrzkccnxmlluxeasqmopxzfvlkbhipqdwjgrttoemruohgwukfisdhznqyvhswbbypoxgtxyappcrl", "output": "605" }, { "input": "lizussgedcbdjhrbeskhgatyozvwwekanlggcstijrniivupmcoofbaxfqrxddyzzptwxcftlhajsmmkkriarrqtkoauhcqefyud", "output": "549" }, { "input": "dvjuvgfdogpknmbowlsfjzcimnygbtjiucyeeroqwhmzwpjqxlbjkqawrdtmvxbiqufllfuqibxvmtdrwaqkjblxqjpwzmhwqore", "output": "688" }, { "input": "eeycuijtbgynmiczjfslwobmnkpgodfgvujvduyfeqchuaoktqrrairkkmmsjahltfcxwtpzzyddxrqfxabfoocmpuviinrjitsc", "output": "604" }, { "input": "cgglnakewwvzoytaghksebrhjdbcdegssuzilrcppayxtgxopybbwshvyqnzhdsifkuwghourmeottrgjwdqpihbklvfzxpomqsa", "output": "572" }, { "input": "aexullmxncckzryymfnuugdklaffevabqqztelpvojecljnhqldazdcaamubpenwxikysxxjjctvbndprsolzehywmgnvkgqvrfp", "output": "609" }, { "input": "psnoieutsvvcwfhtnnphhxkwigzsbzyjmdiyl", "output": "223" }, { "input": "aa", "output": "0" } ]
1,630,336,963
2,147,483,647
PyPy 3
OK
TESTS
44
155
20,172,800
def rotating(a,b): rotation=0 singleDir= abs(ord(a)-ord(b)) if singleDir>13: rotation=26-singleDir else: rotation=singleDir return rotation name=input().lower() firstRotation=abs(ord("a")-ord(name[0])) if firstRotation > 13: count = 26 - firstRotation else: count = firstRotation for i in range(len(name)-1): count=count+rotating(name[i],name[i+1]) print(count)
Title: Night at the Museum Time Limit: None seconds Memory Limit: None megabytes Problem Description: Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition. Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture: After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'. Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it. Input Specification: The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters. Output Specification: Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input. Demo Input: ['zeus\n', 'map\n', 'ares\n'] Demo Output: ['18\n', '35\n', '34\n'] Note: To print the string from the first sample it would be optimal to perform the following sequence of rotations: 1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
```python def rotating(a,b): rotation=0 singleDir= abs(ord(a)-ord(b)) if singleDir>13: rotation=26-singleDir else: rotation=singleDir return rotation name=input().lower() firstRotation=abs(ord("a")-ord(name[0])) if firstRotation > 13: count = 26 - firstRotation else: count = firstRotation for i in range(len(name)-1): count=count+rotating(name[i],name[i+1]) print(count) ```
3
760
B
Frodo and pillows
PROGRAMMING
1,500
[ "binary search", "greedy" ]
null
null
*n* hobbits are planning to spend the night at Frodo's house. Frodo has *n* beds standing in a row and *m* pillows (*n*<=≤<=*m*). Each hobbit needs a bed and at least one pillow to sleep, however, everyone wants as many pillows as possible. Of course, it's not always possible to share pillows equally, but any hobbit gets hurt if he has at least two pillows less than some of his neighbors have. Frodo will sleep on the *k*-th bed in the row. What is the maximum number of pillows he can have so that every hobbit has at least one pillow, every pillow is given to some hobbit and no one is hurt?
The only line contain three integers *n*, *m* and *k* (1<=≤<=*n*<=≤<=*m*<=≤<=109, 1<=≤<=*k*<=≤<=*n*) — the number of hobbits, the number of pillows and the number of Frodo's bed.
Print single integer — the maximum number of pillows Frodo can have so that no one is hurt.
[ "4 6 2\n", "3 10 3\n", "3 6 1\n" ]
[ "2\n", "4\n", "3\n" ]
In the first example Frodo can have at most two pillows. In this case, he can give two pillows to the hobbit on the first bed, and one pillow to each of the hobbits on the third and the fourth beds. In the second example Frodo can take at most four pillows, giving three pillows to each of the others. In the third example Frodo can take three pillows, giving two pillows to the hobbit in the middle and one pillow to the hobbit on the third bed.
1,000
[ { "input": "4 6 2", "output": "2" }, { "input": "3 10 3", "output": "4" }, { "input": "3 6 1", "output": "3" }, { "input": "3 3 3", "output": "1" }, { "input": "1 1 1", "output": "1" }, { "input": "1 1000000000 1", "output": "1000000000" }, { "input": "100 1000000000 20", "output": "10000034" }, { "input": "1000 1000 994", "output": "1" }, { "input": "100000000 200000000 54345", "output": "10001" }, { "input": "1000000000 1000000000 1", "output": "1" }, { "input": "1000000000 1000000000 1000000000", "output": "1" }, { "input": "1000000000 1000000000 500000000", "output": "1" }, { "input": "1000 1000 3", "output": "1" }, { "input": "100000000 200020000 54345", "output": "10001" }, { "input": "100 108037 18", "output": "1115" }, { "input": "100000000 200020001 54345", "output": "10002" }, { "input": "200 6585 2", "output": "112" }, { "input": "30000 30593 5980", "output": "25" }, { "input": "40000 42107 10555", "output": "46" }, { "input": "50003 50921 192", "output": "31" }, { "input": "100000 113611 24910", "output": "117" }, { "input": "1000000 483447163 83104", "output": "21965" }, { "input": "10000000 10021505 600076", "output": "147" }, { "input": "100000000 102144805 2091145", "output": "1465" }, { "input": "1000000000 1000000000 481982093", "output": "1" }, { "input": "100 999973325 5", "output": "9999778" }, { "input": "200 999999109 61", "output": "5000053" }, { "input": "30000 999999384 5488", "output": "43849" }, { "input": "40000 999997662 8976", "output": "38038" }, { "input": "50003 999999649 405", "output": "44320" }, { "input": "100000 999899822 30885", "output": "31624" }, { "input": "1000000 914032367 528790", "output": "30217" }, { "input": "10000000 999617465 673112", "output": "31459" }, { "input": "100000000 993180275 362942", "output": "29887" }, { "input": "1000000000 1000000000 331431458", "output": "1" }, { "input": "100 10466 89", "output": "144" }, { "input": "200 5701 172", "output": "84" }, { "input": "30000 36932 29126", "output": "84" }, { "input": "40000 40771 22564", "output": "28" }, { "input": "50003 51705 49898", "output": "42" }, { "input": "100000 149408 74707", "output": "223" }, { "input": "1000000 194818222 998601", "output": "18389" }, { "input": "10000000 10748901 8882081", "output": "866" }, { "input": "100000000 106296029 98572386", "output": "2510" }, { "input": "1000000000 1000000000 193988157", "output": "1" }, { "input": "100 999981057 92", "output": "9999852" }, { "input": "200 999989691 199", "output": "5000046" }, { "input": "30000 999995411 24509", "output": "43846" }, { "input": "40000 999998466 30827", "output": "37930" }, { "input": "50003 999997857 48387", "output": "43163" }, { "input": "100000 999731886 98615", "output": "43371" }, { "input": "1000000 523220797 654341", "output": "22853" }, { "input": "10000000 999922591 8157724", "output": "31464" }, { "input": "100000000 999834114 93836827", "output": "29998" }, { "input": "1000000000 1000000000 912549504", "output": "1" }, { "input": "1000 97654978 234", "output": "97976" }, { "input": "1000 97654977 234", "output": "97975" }, { "input": "1000234 97653889 1", "output": "13903" }, { "input": "1000234 97653890 1", "output": "13904" }, { "input": "3450234 97656670 3000000", "output": "9707" }, { "input": "3450234 97656669 3000000", "output": "9706" }, { "input": "3 1000000000 2", "output": "333333334" }, { "input": "2 1000000000 1", "output": "500000000" }, { "input": "2 1000000000 2", "output": "500000000" }, { "input": "3 1000000000 1", "output": "333333334" }, { "input": "3 1000000000 3", "output": "333333334" }, { "input": "2 999999999 1", "output": "500000000" }, { "input": "2 999999999 2", "output": "500000000" }, { "input": "1 999999999 1", "output": "999999999" } ]
1,485,111,578
2,678
Python 3
WRONG_ANSWER
PRETESTS
8
61
4,608,000
def partSum(a, b): if a < 0:a = 1 return b * (b + 1) // 2 - (a - 1) * (a - 1 + 1) // 2 def f(v, l, r): return v + partSum(v - l, v - 1) + partSum(v - r, v - 1) n, m, k = [int(item) for item in input().split()] l = k - 1 r = n - k bound = m - (n - 1) a, b = 1, bound while a <= b: mi = (a + b) // 2 if f(mi, l, r) > m: b = mi - 1 elif f(mi, l, r) < m: a = mi + 1 else: print(mi) break #print(a,b, m) else: if f(mi, l, r) < m : print(mi) else:print(mi - 1)
Title: Frodo and pillows Time Limit: None seconds Memory Limit: None megabytes Problem Description: *n* hobbits are planning to spend the night at Frodo's house. Frodo has *n* beds standing in a row and *m* pillows (*n*<=≤<=*m*). Each hobbit needs a bed and at least one pillow to sleep, however, everyone wants as many pillows as possible. Of course, it's not always possible to share pillows equally, but any hobbit gets hurt if he has at least two pillows less than some of his neighbors have. Frodo will sleep on the *k*-th bed in the row. What is the maximum number of pillows he can have so that every hobbit has at least one pillow, every pillow is given to some hobbit and no one is hurt? Input Specification: The only line contain three integers *n*, *m* and *k* (1<=≤<=*n*<=≤<=*m*<=≤<=109, 1<=≤<=*k*<=≤<=*n*) — the number of hobbits, the number of pillows and the number of Frodo's bed. Output Specification: Print single integer — the maximum number of pillows Frodo can have so that no one is hurt. Demo Input: ['4 6 2\n', '3 10 3\n', '3 6 1\n'] Demo Output: ['2\n', '4\n', '3\n'] Note: In the first example Frodo can have at most two pillows. In this case, he can give two pillows to the hobbit on the first bed, and one pillow to each of the hobbits on the third and the fourth beds. In the second example Frodo can take at most four pillows, giving three pillows to each of the others. In the third example Frodo can take three pillows, giving two pillows to the hobbit in the middle and one pillow to the hobbit on the third bed.
```python def partSum(a, b): if a < 0:a = 1 return b * (b + 1) // 2 - (a - 1) * (a - 1 + 1) // 2 def f(v, l, r): return v + partSum(v - l, v - 1) + partSum(v - r, v - 1) n, m, k = [int(item) for item in input().split()] l = k - 1 r = n - k bound = m - (n - 1) a, b = 1, bound while a <= b: mi = (a + b) // 2 if f(mi, l, r) > m: b = mi - 1 elif f(mi, l, r) < m: a = mi + 1 else: print(mi) break #print(a,b, m) else: if f(mi, l, r) < m : print(mi) else:print(mi - 1) ```
0
47
A
Triangular numbers
PROGRAMMING
800
[ "brute force", "math" ]
A. Triangular numbers
2
256
A triangular number is the number of dots in an equilateral triangle uniformly filled with dots. For example, three dots can be arranged in a triangle; thus three is a triangular number. The *n*-th triangular number is the number of dots in a triangle with *n* dots on a side. . You can learn more about these numbers from Wikipedia (http://en.wikipedia.org/wiki/Triangular_number). Your task is to find out if a given integer is a triangular number.
The first line contains the single number *n* (1<=≤<=*n*<=≤<=500) — the given integer.
If the given integer is a triangular number output YES, otherwise output NO.
[ "1\n", "2\n", "3\n" ]
[ "YES\n", "NO\n", "YES\n" ]
none
500
[ { "input": "1", "output": "YES" }, { "input": "2", "output": "NO" }, { "input": "3", "output": "YES" }, { "input": "4", "output": "NO" }, { "input": "5", "output": "NO" }, { "input": "6", "output": "YES" }, { "input": "7", "output": "NO" }, { "input": "8", "output": "NO" }, { "input": "12", "output": "NO" }, { "input": "10", "output": "YES" }, { "input": "11", "output": "NO" }, { "input": "9", "output": "NO" }, { "input": "14", "output": "NO" }, { "input": "15", "output": "YES" }, { "input": "16", "output": "NO" }, { "input": "20", "output": "NO" }, { "input": "21", "output": "YES" }, { "input": "22", "output": "NO" }, { "input": "121", "output": "NO" }, { "input": "135", "output": "NO" }, { "input": "136", "output": "YES" }, { "input": "137", "output": "NO" }, { "input": "152", "output": "NO" }, { "input": "153", "output": "YES" }, { "input": "154", "output": "NO" }, { "input": "171", "output": "YES" }, { "input": "189", "output": "NO" }, { "input": "190", "output": "YES" }, { "input": "191", "output": "NO" }, { "input": "210", "output": "YES" }, { "input": "211", "output": "NO" }, { "input": "231", "output": "YES" }, { "input": "232", "output": "NO" }, { "input": "252", "output": "NO" }, { "input": "253", "output": "YES" }, { "input": "254", "output": "NO" }, { "input": "275", "output": "NO" }, { "input": "276", "output": "YES" }, { "input": "277", "output": "NO" }, { "input": "299", "output": "NO" }, { "input": "300", "output": "YES" }, { "input": "301", "output": "NO" }, { "input": "324", "output": "NO" }, { "input": "325", "output": "YES" }, { "input": "326", "output": "NO" }, { "input": "350", "output": "NO" }, { "input": "351", "output": "YES" }, { "input": "352", "output": "NO" }, { "input": "377", "output": "NO" }, { "input": "378", "output": "YES" }, { "input": "406", "output": "YES" }, { "input": "434", "output": "NO" }, { "input": "435", "output": "YES" }, { "input": "464", "output": "NO" }, { "input": "465", "output": "YES" }, { "input": "495", "output": "NO" }, { "input": "496", "output": "YES" }, { "input": "497", "output": "NO" }, { "input": "331", "output": "NO" }, { "input": "413", "output": "NO" }, { "input": "177", "output": "NO" }, { "input": "122", "output": "NO" }, { "input": "478", "output": "NO" }, { "input": "188", "output": "NO" }, { "input": "21", "output": "YES" }, { "input": "474", "output": "NO" }, { "input": "21", "output": "YES" }, { "input": "48", "output": "NO" }, { "input": "498", "output": "NO" }, { "input": "499", "output": "NO" }, { "input": "500", "output": "NO" } ]
1,655,903,161
2,147,483,647
Python 3
OK
TESTS
71
92
0
n=int(input()) i=1 while n>0: n-=i i+=1 if n==0: print("YES") else: print("NO")
Title: Triangular numbers Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A triangular number is the number of dots in an equilateral triangle uniformly filled with dots. For example, three dots can be arranged in a triangle; thus three is a triangular number. The *n*-th triangular number is the number of dots in a triangle with *n* dots on a side. . You can learn more about these numbers from Wikipedia (http://en.wikipedia.org/wiki/Triangular_number). Your task is to find out if a given integer is a triangular number. Input Specification: The first line contains the single number *n* (1<=≤<=*n*<=≤<=500) — the given integer. Output Specification: If the given integer is a triangular number output YES, otherwise output NO. Demo Input: ['1\n', '2\n', '3\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: none
```python n=int(input()) i=1 while n>0: n-=i i+=1 if n==0: print("YES") else: print("NO") ```
3.977
727
A
Transformation: from A to B
PROGRAMMING
1,000
[ "brute force", "dfs and similar", "math" ]
null
null
Vasily has a number *a*, which he wants to turn into a number *b*. For this purpose, he can do two types of operations: - multiply the current number by 2 (that is, replace the number *x* by 2·*x*); - append the digit 1 to the right of current number (that is, replace the number *x* by 10·*x*<=+<=1). You need to help Vasily to transform the number *a* into the number *b* using only the operations described above, or find that it is impossible. Note that in this task you are not required to minimize the number of operations. It suffices to find any way to transform *a* into *b*.
The first line contains two positive integers *a* and *b* (1<=≤<=*a*<=&lt;<=*b*<=≤<=109) — the number which Vasily has and the number he wants to have.
If there is no way to get *b* from *a*, print "NO" (without quotes). Otherwise print three lines. On the first line print "YES" (without quotes). The second line should contain single integer *k* — the length of the transformation sequence. On the third line print the sequence of transformations *x*1,<=*x*2,<=...,<=*x**k*, where: - *x*1 should be equal to *a*, - *x**k* should be equal to *b*, - *x**i* should be obtained from *x**i*<=-<=1 using any of two described operations (1<=&lt;<=*i*<=≤<=*k*). If there are multiple answers, print any of them.
[ "2 162\n", "4 42\n", "100 40021\n" ]
[ "YES\n5\n2 4 8 81 162 \n", "NO\n", "YES\n5\n100 200 2001 4002 40021 \n" ]
none
1,000
[ { "input": "2 162", "output": "YES\n5\n2 4 8 81 162 " }, { "input": "4 42", "output": "NO" }, { "input": "100 40021", "output": "YES\n5\n100 200 2001 4002 40021 " }, { "input": "1 111111111", "output": "YES\n9\n1 11 111 1111 11111 111111 1111111 11111111 111111111 " }, { "input": "1 1000000000", "output": "NO" }, { "input": "999999999 1000000000", "output": "NO" }, { "input": "1 2", "output": "YES\n2\n1 2 " }, { "input": "1 536870912", "output": "YES\n30\n1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 65536 131072 262144 524288 1048576 2097152 4194304 8388608 16777216 33554432 67108864 134217728 268435456 536870912 " }, { "input": "11111 11111111", "output": "YES\n4\n11111 111111 1111111 11111111 " }, { "input": "59139 946224", "output": "YES\n5\n59139 118278 236556 473112 946224 " }, { "input": "9859 19718", "output": "YES\n2\n9859 19718 " }, { "input": "25987 51974222", "output": "YES\n5\n25987 259871 2598711 25987111 51974222 " }, { "input": "9411 188222222", "output": "YES\n6\n9411 94111 941111 9411111 94111111 188222222 " }, { "input": "25539 510782222", "output": "YES\n6\n25539 255391 2553911 25539111 255391111 510782222 " }, { "input": "76259 610072", "output": "YES\n4\n76259 152518 305036 610072 " }, { "input": "92387 184774", "output": "YES\n2\n92387 184774 " }, { "input": "8515 85151111", "output": "YES\n5\n8515 85151 851511 8515111 85151111 " }, { "input": "91939 9193911", "output": "YES\n3\n91939 919391 9193911 " }, { "input": "30518 610361", "output": "YES\n3\n30518 61036 610361 " }, { "input": "46646 373168844", "output": "YES\n7\n46646 466461 932922 9329221 93292211 186584422 373168844 " }, { "input": "30070 300701", "output": "YES\n2\n30070 300701 " }, { "input": "13494 1079528", "output": "YES\n5\n13494 134941 269882 539764 1079528 " }, { "input": "96918 775344422", "output": "YES\n7\n96918 193836 1938361 3876722 38767221 387672211 775344422 " }, { "input": "13046 260921", "output": "YES\n3\n13046 26092 260921 " }, { "input": "29174 5834811", "output": "YES\n4\n29174 58348 583481 5834811 " }, { "input": "79894 319576421", "output": "YES\n6\n79894 798941 1597882 15978821 31957642 319576421 " }, { "input": "96022 1920442", "output": "YES\n3\n96022 960221 1920442 " }, { "input": "79446 6355681", "output": "YES\n5\n79446 158892 317784 635568 6355681 " }, { "input": "5440 27853056", "output": "YES\n11\n5440 10880 108801 217602 435204 870408 1740816 3481632 6963264 13926528 27853056 " }, { "input": "250000000 705032705", "output": "NO" }, { "input": "17 35", "output": "NO" }, { "input": "1 3", "output": "NO" }, { "input": "2 11", "output": "NO" } ]
1,630,518,396
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
0
61
20,172,800
a,b=map(int,input().split()) can=1 arr=[] while(b>=a): arr.append(b) if(a==b): break elif(b%2==0): b=b//2 elif(b%10==1): b=b//10 else: can=0 break print(len(arr)) for i in range(len(arr)): print(arr[len(arr)-1-i],end=" ") print("")
Title: Transformation: from A to B Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasily has a number *a*, which he wants to turn into a number *b*. For this purpose, he can do two types of operations: - multiply the current number by 2 (that is, replace the number *x* by 2·*x*); - append the digit 1 to the right of current number (that is, replace the number *x* by 10·*x*<=+<=1). You need to help Vasily to transform the number *a* into the number *b* using only the operations described above, or find that it is impossible. Note that in this task you are not required to minimize the number of operations. It suffices to find any way to transform *a* into *b*. Input Specification: The first line contains two positive integers *a* and *b* (1<=≤<=*a*<=&lt;<=*b*<=≤<=109) — the number which Vasily has and the number he wants to have. Output Specification: If there is no way to get *b* from *a*, print "NO" (without quotes). Otherwise print three lines. On the first line print "YES" (without quotes). The second line should contain single integer *k* — the length of the transformation sequence. On the third line print the sequence of transformations *x*1,<=*x*2,<=...,<=*x**k*, where: - *x*1 should be equal to *a*, - *x**k* should be equal to *b*, - *x**i* should be obtained from *x**i*<=-<=1 using any of two described operations (1<=&lt;<=*i*<=≤<=*k*). If there are multiple answers, print any of them. Demo Input: ['2 162\n', '4 42\n', '100 40021\n'] Demo Output: ['YES\n5\n2 4 8 81 162 \n', 'NO\n', 'YES\n5\n100 200 2001 4002 40021 \n'] Note: none
```python a,b=map(int,input().split()) can=1 arr=[] while(b>=a): arr.append(b) if(a==b): break elif(b%2==0): b=b//2 elif(b%10==1): b=b//10 else: can=0 break print(len(arr)) for i in range(len(arr)): print(arr[len(arr)-1-i],end=" ") print("") ```
0
26
A
Almost Prime
PROGRAMMING
900
[ "number theory" ]
A. Almost Prime
2
256
A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive.
Input contains one integer number *n* (1<=≤<=*n*<=≤<=3000).
Output the amount of almost prime numbers between 1 and *n*, inclusive.
[ "10\n", "21\n" ]
[ "2\n", "8\n" ]
none
500
[ { "input": "10", "output": "2" }, { "input": "21", "output": "8" }, { "input": "1", "output": "0" }, { "input": "2", "output": "0" }, { "input": "4", "output": "0" }, { "input": "3", "output": "0" }, { "input": "8", "output": "1" }, { "input": "19", "output": "6" }, { "input": "40", "output": "19" }, { "input": "77", "output": "41" }, { "input": "222", "output": "125" }, { "input": "987", "output": "501" }, { "input": "1000", "output": "508" }, { "input": "2000", "output": "958" }, { "input": "3000", "output": "1375" }, { "input": "2999", "output": "1375" }, { "input": "2998", "output": "1375" }, { "input": "2997", "output": "1374" }, { "input": "1429", "output": "706" }, { "input": "1673", "output": "808" }, { "input": "1500", "output": "732" }, { "input": "500", "output": "266" }, { "input": "856", "output": "439" } ]
1,595,235,769
2,147,483,647
Python 3
OK
TESTS
23
560
6,963,200
def multiple(i): j = i while j <= n: yield j j += i def find_factor(n): divisor = [] for i in range(1,int(n**(1/2))+1): if n%i == 0: divisor.append(i) divisor.append(n//i) return set(divisor) count = 0 n = int(input()) prime = [i for i in range(2,n+1)] true_prime = [] while len(prime) > 0: # print(prime[0]) true_prime.append(prime[0]) cross = [a for a in multiple(prime[0])] prime = [i for i in prime if i not in cross] prime = [i for i in range(2,n+1)] for n in prime: factor = find_factor(n) count = count + 1 if len([i for i in factor if i in true_prime]) == 2 else count print(count)
Title: Almost Prime Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive. Input Specification: Input contains one integer number *n* (1<=≤<=*n*<=≤<=3000). Output Specification: Output the amount of almost prime numbers between 1 and *n*, inclusive. Demo Input: ['10\n', '21\n'] Demo Output: ['2\n', '8\n'] Note: none
```python def multiple(i): j = i while j <= n: yield j j += i def find_factor(n): divisor = [] for i in range(1,int(n**(1/2))+1): if n%i == 0: divisor.append(i) divisor.append(n//i) return set(divisor) count = 0 n = int(input()) prime = [i for i in range(2,n+1)] true_prime = [] while len(prime) > 0: # print(prime[0]) true_prime.append(prime[0]) cross = [a for a in multiple(prime[0])] prime = [i for i in prime if i not in cross] prime = [i for i in range(2,n+1)] for n in prime: factor = find_factor(n) count = count + 1 if len([i for i in factor if i in true_prime]) == 2 else count print(count) ```
3.84703
31
A
Worms Evolution
PROGRAMMING
1,200
[ "implementation" ]
A. Worms Evolution
2
256
Professor Vasechkin is studying evolution of worms. Recently he put forward hypotheses that all worms evolve by division. There are *n* forms of worms. Worms of these forms have lengths *a*1, *a*2, ..., *a**n*. To prove his theory, professor needs to find 3 different forms that the length of the first form is equal to sum of lengths of the other two forms. Help him to do this.
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of worm's forms. The second line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=1000) — lengths of worms of each form.
Output 3 distinct integers *i* *j* *k* (1<=≤<=*i*,<=*j*,<=*k*<=≤<=*n*) — such indexes of worm's forms that *a**i*<==<=*a**j*<=+<=*a**k*. If there is no such triple, output -1. If there are several solutions, output any of them. It possible that *a**j*<==<=*a**k*.
[ "5\n1 2 3 5 7\n", "5\n1 8 1 5 1\n" ]
[ "3 2 1\n", "-1\n" ]
none
500
[ { "input": "5\n1 2 3 5 7", "output": "3 2 1" }, { "input": "5\n1 8 1 5 1", "output": "-1" }, { "input": "4\n303 872 764 401", "output": "-1" }, { "input": "6\n86 402 133 524 405 610", "output": "6 4 1" }, { "input": "8\n217 779 418 895 996 473 3 22", "output": "5 2 1" }, { "input": "10\n858 972 670 15 662 114 33 273 53 310", "output": "2 6 1" }, { "input": "100\n611 697 572 770 603 870 128 245 49 904 468 982 788 943 549 288 668 796 803 515 999 735 912 49 298 80 412 841 494 434 543 298 17 571 271 105 70 313 178 755 194 279 585 766 412 164 907 841 776 556 731 268 735 880 176 267 287 65 239 588 155 658 821 47 783 595 585 69 226 906 429 161 999 148 7 484 362 585 952 365 92 749 904 525 307 626 883 367 450 755 564 950 728 724 69 106 119 157 96 290", "output": "1 38 25" }, { "input": "100\n713 572 318 890 577 657 646 146 373 783 392 229 455 871 20 593 573 336 26 381 280 916 907 732 820 713 111 840 570 446 184 711 481 399 788 647 492 15 40 530 549 506 719 782 126 20 778 996 712 761 9 74 812 418 488 175 103 585 900 3 604 521 109 513 145 708 990 361 682 827 791 22 596 780 596 385 450 643 158 496 876 975 319 783 654 895 891 361 397 81 682 899 347 623 809 557 435 279 513 438", "output": "1 63 61" }, { "input": "100\n156 822 179 298 981 82 610 345 373 378 895 734 768 15 78 335 764 608 932 297 717 553 916 367 425 447 361 195 66 70 901 236 905 744 919 564 296 610 963 628 840 52 100 750 345 308 37 687 192 704 101 815 10 990 216 358 823 546 578 821 706 148 182 582 421 482 829 425 121 337 500 301 402 868 66 935 625 527 746 585 308 523 488 914 608 709 875 252 151 781 447 2 756 176 976 302 450 35 680 791", "output": "1 98 69" }, { "input": "100\n54 947 785 838 359 647 92 445 48 465 323 486 101 86 607 31 860 420 709 432 435 372 272 37 903 814 309 197 638 58 259 822 793 564 309 22 522 907 101 853 486 824 614 734 630 452 166 532 256 499 470 9 933 452 256 450 7 26 916 406 257 285 895 117 59 369 424 133 16 417 352 440 806 236 478 34 889 469 540 806 172 296 73 655 261 792 868 380 204 454 330 53 136 629 236 850 134 560 264 291", "output": "2 29 27" }, { "input": "99\n175 269 828 129 499 890 127 263 995 807 508 289 996 226 437 320 365 642 757 22 190 8 345 499 834 713 962 889 336 171 608 492 320 257 472 801 176 325 301 306 198 729 933 4 640 322 226 317 567 586 249 237 202 633 287 128 911 654 719 988 420 855 361 574 716 899 317 356 581 440 284 982 541 111 439 29 37 560 961 224 478 906 319 416 736 603 808 87 762 697 392 713 19 459 262 238 239 599 997", "output": "1 44 30" }, { "input": "98\n443 719 559 672 16 69 529 632 953 999 725 431 54 22 346 968 558 696 48 669 963 129 257 712 39 870 498 595 45 821 344 925 179 388 792 346 755 213 423 365 344 659 824 356 773 637 628 897 841 155 243 536 951 361 192 105 418 431 635 596 150 162 145 548 473 531 750 306 377 354 450 975 79 743 656 733 440 940 19 139 237 346 276 227 64 799 479 633 199 17 796 362 517 234 729 62 995 535", "output": "2 70 40" }, { "input": "97\n359 522 938 862 181 600 283 1000 910 191 590 220 761 818 903 264 751 751 987 316 737 898 168 925 244 674 34 950 754 472 81 6 37 520 112 891 981 454 897 424 489 238 363 709 906 951 677 828 114 373 589 835 52 89 97 435 277 560 551 204 879 469 928 523 231 163 183 609 821 915 615 969 616 23 874 437 844 321 78 53 643 786 585 38 744 347 150 179 988 985 200 11 15 9 547 886 752", "output": "1 23 10" }, { "input": "4\n303 872 764 401", "output": "-1" }, { "input": "100\n328 397 235 453 188 254 879 225 423 36 384 296 486 592 231 849 856 255 213 898 234 800 701 529 951 693 507 326 15 905 618 348 967 927 28 979 752 850 343 35 84 302 36 390 482 826 249 918 91 289 973 457 557 348 365 239 709 565 320 560 153 130 647 708 483 469 788 473 322 844 830 562 611 961 397 673 69 960 74 703 369 968 382 451 328 160 211 230 566 208 7 545 293 73 806 375 157 410 303 58", "output": "1 79 6" }, { "input": "33\n52 145 137 734 180 847 178 286 716 134 181 630 358 764 593 762 785 28 1 468 189 540 764 485 165 656 114 58 628 108 605 584 257", "output": "8 30 7" }, { "input": "57\n75 291 309 68 444 654 985 158 514 204 116 918 374 806 176 31 49 455 269 66 722 713 164 818 317 295 546 564 134 641 28 13 987 478 146 219 213 940 289 173 157 666 168 391 392 71 870 477 446 988 414 568 964 684 409 671 454", "output": "2 41 29" }, { "input": "88\n327 644 942 738 84 118 981 686 530 404 137 197 434 16 693 183 423 325 410 345 941 329 7 106 79 867 584 358 533 675 192 718 641 329 900 768 404 301 101 538 954 590 401 954 447 14 559 337 756 586 934 367 538 928 945 936 770 641 488 579 206 869 902 139 216 446 723 150 829 205 373 578 357 368 960 40 121 206 503 385 521 161 501 694 138 370 709 308", "output": "1 77 61" }, { "input": "100\n804 510 266 304 788 625 862 888 408 82 414 470 777 991 729 229 933 406 601 1 596 720 608 706 432 361 527 548 59 548 474 515 4 991 263 568 681 24 117 563 576 587 281 643 904 521 891 106 842 884 943 54 605 815 504 757 311 374 335 192 447 652 633 410 455 402 382 150 432 836 413 819 669 875 638 925 217 805 632 520 605 266 728 795 162 222 603 159 284 790 914 443 775 97 789 606 859 13 851 47", "output": "1 77 42" }, { "input": "100\n449 649 615 713 64 385 927 466 138 126 143 886 80 199 208 43 196 694 92 89 264 180 617 970 191 196 910 150 275 89 693 190 191 99 542 342 45 592 114 56 451 170 64 589 176 102 308 92 402 153 414 675 352 157 69 150 91 288 163 121 816 184 20 234 836 12 593 150 793 439 540 93 99 663 186 125 349 247 476 106 77 523 215 7 363 278 441 745 337 25 148 384 15 915 108 211 240 58 23 408", "output": "1 6 5" }, { "input": "90\n881 436 52 308 97 261 153 931 670 538 702 156 114 445 154 685 452 76 966 790 93 42 547 65 736 364 136 489 719 322 239 628 696 735 55 703 622 375 100 188 804 341 546 474 484 446 729 290 974 301 602 225 996 244 488 983 882 460 962 754 395 617 61 640 534 292 158 375 632 902 420 979 379 38 100 67 963 928 190 456 545 571 45 716 153 68 844 2 102 116", "output": "1 14 2" }, { "input": "80\n313 674 262 240 697 146 391 221 793 504 896 818 92 899 86 370 341 339 306 887 937 570 830 683 729 519 240 833 656 847 427 958 435 704 853 230 758 347 660 575 843 293 649 396 437 787 654 599 35 103 779 783 447 379 444 585 902 713 791 150 851 228 306 721 996 471 617 403 102 168 197 741 877 481 968 545 331 715 236 654", "output": "1 13 8" }, { "input": "70\n745 264 471 171 946 32 277 511 269 469 89 831 69 2 369 407 583 602 646 633 429 747 113 302 722 321 344 824 241 372 263 287 822 24 652 758 246 967 219 313 882 597 752 965 389 775 227 556 95 904 308 340 899 514 400 187 275 318 621 546 659 488 199 154 811 1 725 79 925 82", "output": "1 63 60" }, { "input": "60\n176 502 680 102 546 917 516 801 392 435 635 492 398 456 653 444 472 513 634 378 273 276 44 920 68 124 800 167 825 250 452 264 561 344 98 933 381 939 426 51 568 548 206 887 342 763 151 514 156 354 486 546 998 649 356 438 295 570 450 589", "output": "2 26 20" }, { "input": "50\n608 92 889 33 146 803 402 91 868 400 828 505 375 558 584 129 361 776 974 123 765 804 326 186 61 927 904 511 762 775 640 593 300 664 897 461 869 911 986 789 607 500 309 457 294 104 724 471 216 155", "output": "3 25 11" }, { "input": "40\n40 330 98 612 747 336 640 381 991 366 22 167 352 12 868 166 603 40 313 869 609 981 609 804 54 729 8 854 347 300 828 922 39 633 695 988 4 530 545 176", "output": "5 10 8" }, { "input": "30\n471 920 308 544 347 222 878 671 467 332 215 180 681 114 151 203 492 951 653 614 453 510 540 422 399 532 113 198 932 825", "output": "2 21 9" }, { "input": "20\n551 158 517 475 595 108 764 961 590 297 761 841 659 568 82 888 733 214 993 359", "output": "3 20 2" }, { "input": "10\n983 748 726 406 196 993 2 251 66 263", "output": "-1" }, { "input": "9\n933 266 457 863 768 257 594 136 145", "output": "-1" }, { "input": "8\n537 198 48 771 944 868 700 163", "output": "7 8 1" }, { "input": "7\n140 779 639 679 768 479 158", "output": "2 3 1" }, { "input": "6\n744 359 230 586 944 442", "output": "-1" }, { "input": "5\n700 939 173 494 120", "output": "-1" }, { "input": "4\n303 872 764 401", "output": "-1" }, { "input": "3\n907 452 355", "output": "-1" }, { "input": "3\n963 630 333", "output": "1 3 2" }, { "input": "3\n2 2 4", "output": "3 2 1" }, { "input": "3\n2 4 100", "output": "-1" } ]
1,467,877,132
2,147,483,647
Python 3
OK
TESTS
39
154
0
n = int(input()) a = list(map(int, input().split())) for i in range(n): for j in range(i + 1 , n): for k in range(j + 1 , n): x = -1;y = -1;z = -1 if a[i] + a[j] == a[k]: x, y, z = k, i, j elif a[k] + a[j] == a[i]: x, y, z = i, k, j elif a[i] + a[k] == a[j]: x, y, z = j, i, k if x != -1 and y != -1 and z != -1: print(str(x + 1) + " " + str(y + 1) + " " + str(z + 1)) exit(0) print(-1)
Title: Worms Evolution Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Professor Vasechkin is studying evolution of worms. Recently he put forward hypotheses that all worms evolve by division. There are *n* forms of worms. Worms of these forms have lengths *a*1, *a*2, ..., *a**n*. To prove his theory, professor needs to find 3 different forms that the length of the first form is equal to sum of lengths of the other two forms. Help him to do this. Input Specification: The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of worm's forms. The second line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=1000) — lengths of worms of each form. Output Specification: Output 3 distinct integers *i* *j* *k* (1<=≤<=*i*,<=*j*,<=*k*<=≤<=*n*) — such indexes of worm's forms that *a**i*<==<=*a**j*<=+<=*a**k*. If there is no such triple, output -1. If there are several solutions, output any of them. It possible that *a**j*<==<=*a**k*. Demo Input: ['5\n1 2 3 5 7\n', '5\n1 8 1 5 1\n'] Demo Output: ['3 2 1\n', '-1\n'] Note: none
```python n = int(input()) a = list(map(int, input().split())) for i in range(n): for j in range(i + 1 , n): for k in range(j + 1 , n): x = -1;y = -1;z = -1 if a[i] + a[j] == a[k]: x, y, z = k, i, j elif a[k] + a[j] == a[i]: x, y, z = i, k, j elif a[i] + a[k] == a[j]: x, y, z = j, i, k if x != -1 and y != -1 and z != -1: print(str(x + 1) + " " + str(y + 1) + " " + str(z + 1)) exit(0) print(-1) ```
3.9615
460
A
Vasya and Socks
PROGRAMMING
900
[ "brute force", "implementation", "math" ]
null
null
Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks?
The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space.
Print a single integer — the answer to the problem.
[ "2 2\n", "9 3\n" ]
[ "3\n", "13\n" ]
In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two. In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day.
500
[ { "input": "2 2", "output": "3" }, { "input": "9 3", "output": "13" }, { "input": "1 2", "output": "1" }, { "input": "2 3", "output": "2" }, { "input": "1 99", "output": "1" }, { "input": "4 4", "output": "5" }, { "input": "10 2", "output": "19" }, { "input": "10 9", "output": "11" }, { "input": "100 100", "output": "101" }, { "input": "2 27", "output": "2" }, { "input": "99 100", "output": "99" }, { "input": "99 2", "output": "197" }, { "input": "100 3", "output": "149" }, { "input": "98 3", "output": "146" }, { "input": "4 4", "output": "5" }, { "input": "100 2", "output": "199" }, { "input": "62 4", "output": "82" }, { "input": "99 10", "output": "109" }, { "input": "100 5", "output": "124" }, { "input": "80 80", "output": "81" }, { "input": "95 16", "output": "101" }, { "input": "75 16", "output": "79" }, { "input": "99 74", "output": "100" }, { "input": "20 21", "output": "20" }, { "input": "52 96", "output": "52" }, { "input": "24 5", "output": "29" } ]
1,681,804,288
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
12
46
0
import math n, m = map(int, input().split()) original_n = n arr1 = [] count = 0 temp = 0 flag = True if n == m: print(n + 1) elif n < m: print(n) else: if m == 2: print((original_n*2)-1) flag = False while flag: if n > 0: n = math.floor(n/m) original_n+=n else: break if flag: print(original_n)
Title: Vasya and Socks Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks? Input Specification: The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space. Output Specification: Print a single integer — the answer to the problem. Demo Input: ['2 2\n', '9 3\n'] Demo Output: ['3\n', '13\n'] Note: In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two. In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day.
```python import math n, m = map(int, input().split()) original_n = n arr1 = [] count = 0 temp = 0 flag = True if n == m: print(n + 1) elif n < m: print(n) else: if m == 2: print((original_n*2)-1) flag = False while flag: if n > 0: n = math.floor(n/m) original_n+=n else: break if flag: print(original_n) ```
0
19
A
World Football Cup
PROGRAMMING
1,400
[ "implementation" ]
A. World Football Cup
2
64
Everyone knows that 2010 FIFA World Cup is being held in South Africa now. By the decision of BFA (Berland's Football Association) next World Cup will be held in Berland. BFA took the decision to change some World Cup regulations: - the final tournament features *n* teams (*n* is always even) - the first *n*<=/<=2 teams (according to the standings) come through to the knockout stage - the standings are made on the following principle: for a victory a team gets 3 points, for a draw — 1 point, for a defeat — 0 points. In the first place, teams are ordered in the standings in decreasing order of their points; in the second place — in decreasing order of the difference between scored and missed goals; in the third place — in the decreasing order of scored goals - it's written in Berland's Constitution that the previous regulation helps to order the teams without ambiguity. You are asked to write a program that, by the given list of the competing teams and the results of all the matches, will find the list of teams that managed to get through to the knockout stage.
The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=50) — amount of the teams, taking part in the final tournament of World Cup. The following *n* lines contain the names of these teams, a name is a string of lower-case and upper-case Latin letters, its length doesn't exceed 30 characters. The following *n*·(*n*<=-<=1)<=/<=2 lines describe the held matches in the format name1-name2 num1:num2, where *name*1, *name*2 — names of the teams; *num*1, *num*2 (0<=≤<=*num*1,<=*num*2<=≤<=100) — amount of the goals, scored by the corresponding teams. Accuracy of the descriptions is guaranteed: there are no two team names coinciding accurate to the letters' case; there is no match, where a team plays with itself; each match is met in the descriptions only once.
Output *n*<=/<=2 lines — names of the teams, which managed to get through to the knockout stage in lexicographical order. Output each name in a separate line. No odd characters (including spaces) are allowed. It's guaranteed that the described regulations help to order the teams without ambiguity.
[ "4\nA\nB\nC\nD\nA-B 1:1\nA-C 2:2\nA-D 1:0\nB-C 1:0\nB-D 0:3\nC-D 0:3\n", "2\na\nA\na-A 2:1\n" ]
[ "A\nD\n", "a\n" ]
none
0
[ { "input": "4\nA\nB\nC\nD\nA-B 1:1\nA-C 2:2\nA-D 1:0\nB-C 1:0\nB-D 0:3\nC-D 0:3", "output": "A\nD" }, { "input": "2\na\nA\na-A 2:1", "output": "a" }, { "input": "2\nEULEUbCmfrmqxtzvg\nuHGRmKUhDcxcfqyruwzen\nuHGRmKUhDcxcfqyruwzen-EULEUbCmfrmqxtzvg 13:92", "output": "EULEUbCmfrmqxtzvg" }, { "input": "4\nTeMnHVvWKpwlpubwyhzqvc\nAWJwc\nbhbxErlydiwtoxy\nEVASMeLpfqwjkke\nAWJwc-TeMnHVvWKpwlpubwyhzqvc 37:34\nbhbxErlydiwtoxy-TeMnHVvWKpwlpubwyhzqvc 38:99\nbhbxErlydiwtoxy-AWJwc 33:84\nEVASMeLpfqwjkke-TeMnHVvWKpwlpubwyhzqvc 79:34\nEVASMeLpfqwjkke-AWJwc 24:37\nEVASMeLpfqwjkke-bhbxErlydiwtoxy 3:6", "output": "AWJwc\nEVASMeLpfqwjkke" }, { "input": "6\nA\nB\nC\nD\nE\nF\nA-B 1:0\nA-C 0:0\nA-D 1:0\nA-E 5:5\nA-F 0:1\nB-C 1:0\nB-D 1:0\nB-E 1:0\nB-F 0:2\nC-D 2:2\nC-E 1:0\nC-F 1:0\nD-E 1:0\nD-F 1:0\nE-F 0:1", "output": "A\nB\nF" }, { "input": "6\nA\nB\nC\nD\nE\nF\nA-B 1:0\nA-C 0:0\nA-D 1:0\nA-E 5:5\nA-F 0:1\nB-C 1:0\nB-D 1:0\nB-E 1:0\nB-F 0:2\nC-D 7:7\nC-E 1:0\nC-F 1:0\nD-E 1:0\nD-F 1:0\nE-F 0:1", "output": "B\nC\nF" } ]
1,587,291,564
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
2
186
307,200
def completeTeamInfo(team,scored,missed): team.scoredGoals += scored team.missedGoals += missed team.differenceScoredAndMissed += scored - missed if scored > missed: team.points += 3 elif scored == missed: team.points += 1 def arrangeTeams(totals): totals.sort(key=lambda team: team.points, reverse=True) for teamIndex in range(len(totals)-1): if totals[teamIndex].points == totals[teamIndex + 1].points: if totals[teamIndex].differenceScoredAndMissed < totals[teamIndex + 1].differenceScoredAndMissed: totals[teamIndex], totals[teamIndex + 1] = totals[teamIndex + 1], totals[teamIndex] elif totals[teamIndex].differenceScoredAndMissed == totals[teamIndex + 1].differenceScoredAndMissed: if totals[teamIndex].scoredGoals < totals[teamIndex + 1].scoredGoals: totals[teamIndex], totals[teamIndex + 1] = totals[teamIndex + 1], totals[teamIndex] def main(): class Team: def __init__(self, name, scoredGoals, missedGoals, differenceScoredAndMissed, points): self.name = name self.scoredGoals = scoredGoals self.missedGoals = missedGoals self.differenceScoredAndMissed = differenceScoredAndMissed self.points = points teamsNr = int(input()) totals = [] for _ in range(teamsNr): name = input() totals.append(Team(name,0,0,0,0)) for _ in range(teamsNr*(teamsNr-1)//2): playingTeams,score = input().split() #we want only 0 and 2 position because the input is in this format #A-B 1:1 and we are not interested in - or : teamOne = playingTeams[0] teamTwo = playingTeams[2] scoreTeamOne = int(score[0]) scoreTeamTwo = int(score[2]) for team in totals: if team.name == teamOne: completeTeamInfo(team,scoreTeamOne,scoreTeamTwo) if team.name == teamTwo: completeTeamInfo(team,scoreTeamTwo,scoreTeamOne) arrangeTeams(totals) #print results i = teamsNr//2 - 1 while i >= 0: print(totals[i].name) i -= 1 main()
Title: World Football Cup Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: Everyone knows that 2010 FIFA World Cup is being held in South Africa now. By the decision of BFA (Berland's Football Association) next World Cup will be held in Berland. BFA took the decision to change some World Cup regulations: - the final tournament features *n* teams (*n* is always even) - the first *n*<=/<=2 teams (according to the standings) come through to the knockout stage - the standings are made on the following principle: for a victory a team gets 3 points, for a draw — 1 point, for a defeat — 0 points. In the first place, teams are ordered in the standings in decreasing order of their points; in the second place — in decreasing order of the difference between scored and missed goals; in the third place — in the decreasing order of scored goals - it's written in Berland's Constitution that the previous regulation helps to order the teams without ambiguity. You are asked to write a program that, by the given list of the competing teams and the results of all the matches, will find the list of teams that managed to get through to the knockout stage. Input Specification: The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=50) — amount of the teams, taking part in the final tournament of World Cup. The following *n* lines contain the names of these teams, a name is a string of lower-case and upper-case Latin letters, its length doesn't exceed 30 characters. The following *n*·(*n*<=-<=1)<=/<=2 lines describe the held matches in the format name1-name2 num1:num2, where *name*1, *name*2 — names of the teams; *num*1, *num*2 (0<=≤<=*num*1,<=*num*2<=≤<=100) — amount of the goals, scored by the corresponding teams. Accuracy of the descriptions is guaranteed: there are no two team names coinciding accurate to the letters' case; there is no match, where a team plays with itself; each match is met in the descriptions only once. Output Specification: Output *n*<=/<=2 lines — names of the teams, which managed to get through to the knockout stage in lexicographical order. Output each name in a separate line. No odd characters (including spaces) are allowed. It's guaranteed that the described regulations help to order the teams without ambiguity. Demo Input: ['4\nA\nB\nC\nD\nA-B 1:1\nA-C 2:2\nA-D 1:0\nB-C 1:0\nB-D 0:3\nC-D 0:3\n', '2\na\nA\na-A 2:1\n'] Demo Output: ['A\nD\n', 'a\n'] Note: none
```python def completeTeamInfo(team,scored,missed): team.scoredGoals += scored team.missedGoals += missed team.differenceScoredAndMissed += scored - missed if scored > missed: team.points += 3 elif scored == missed: team.points += 1 def arrangeTeams(totals): totals.sort(key=lambda team: team.points, reverse=True) for teamIndex in range(len(totals)-1): if totals[teamIndex].points == totals[teamIndex + 1].points: if totals[teamIndex].differenceScoredAndMissed < totals[teamIndex + 1].differenceScoredAndMissed: totals[teamIndex], totals[teamIndex + 1] = totals[teamIndex + 1], totals[teamIndex] elif totals[teamIndex].differenceScoredAndMissed == totals[teamIndex + 1].differenceScoredAndMissed: if totals[teamIndex].scoredGoals < totals[teamIndex + 1].scoredGoals: totals[teamIndex], totals[teamIndex + 1] = totals[teamIndex + 1], totals[teamIndex] def main(): class Team: def __init__(self, name, scoredGoals, missedGoals, differenceScoredAndMissed, points): self.name = name self.scoredGoals = scoredGoals self.missedGoals = missedGoals self.differenceScoredAndMissed = differenceScoredAndMissed self.points = points teamsNr = int(input()) totals = [] for _ in range(teamsNr): name = input() totals.append(Team(name,0,0,0,0)) for _ in range(teamsNr*(teamsNr-1)//2): playingTeams,score = input().split() #we want only 0 and 2 position because the input is in this format #A-B 1:1 and we are not interested in - or : teamOne = playingTeams[0] teamTwo = playingTeams[2] scoreTeamOne = int(score[0]) scoreTeamTwo = int(score[2]) for team in totals: if team.name == teamOne: completeTeamInfo(team,scoreTeamOne,scoreTeamTwo) if team.name == teamTwo: completeTeamInfo(team,scoreTeamTwo,scoreTeamOne) arrangeTeams(totals) #print results i = teamsNr//2 - 1 while i >= 0: print(totals[i].name) i -= 1 main() ```
-1
721
A
One-dimensional Japanese Crossword
PROGRAMMING
800
[ "implementation" ]
null
null
Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)). Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword. Help Adaltik find the numbers encrypting the row he drew.
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew).
The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row. The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right.
[ "3\nBBW\n", "5\nBWBWB\n", "4\nWWWW\n", "4\nBBBB\n", "13\nWBBBBWWBWBBBW\n" ]
[ "1\n2 ", "3\n1 1 1 ", "0\n", "1\n4 ", "3\n4 1 3 " ]
The last sample case correspond to the picture in the statement.
500
[ { "input": "3\nBBW", "output": "1\n2 " }, { "input": "5\nBWBWB", "output": "3\n1 1 1 " }, { "input": "4\nWWWW", "output": "0" }, { "input": "4\nBBBB", "output": "1\n4 " }, { "input": "13\nWBBBBWWBWBBBW", "output": "3\n4 1 3 " }, { "input": "1\nB", "output": "1\n1 " }, { "input": "2\nBB", "output": "1\n2 " }, { "input": "100\nWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWB", "output": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "1\nW", "output": "0" }, { "input": "2\nWW", "output": "0" }, { "input": "2\nWB", "output": "1\n1 " }, { "input": "2\nBW", "output": "1\n1 " }, { "input": "3\nBBB", "output": "1\n3 " }, { "input": "3\nBWB", "output": "2\n1 1 " }, { "input": "3\nWBB", "output": "1\n2 " }, { "input": "3\nWWB", "output": "1\n1 " }, { "input": "3\nWBW", "output": "1\n1 " }, { "input": "3\nBWW", "output": "1\n1 " }, { "input": "3\nWWW", "output": "0" }, { "input": "100\nBBBWWWWWWBBWWBBWWWBBWBBBBBBBBBBBWBBBWBBWWWBBWWBBBWBWWBBBWWBBBWBBBBBWWWBWWBBWWWWWWBWBBWWBWWWBWBWWWWWB", "output": "21\n3 2 2 2 11 3 2 2 3 1 3 3 5 1 2 1 2 1 1 1 1 " }, { "input": "5\nBBBWB", "output": "2\n3 1 " }, { "input": "5\nBWWWB", "output": "2\n1 1 " }, { "input": "5\nWWWWB", "output": "1\n1 " }, { "input": "5\nBWWWW", "output": "1\n1 " }, { "input": "5\nBBBWW", "output": "1\n3 " }, { "input": "5\nWWBBB", "output": "1\n3 " }, { "input": "10\nBBBBBWWBBB", "output": "2\n5 3 " }, { "input": "10\nBBBBWBBWBB", "output": "3\n4 2 2 " }, { "input": "20\nBBBBBWWBWBBWBWWBWBBB", "output": "6\n5 1 2 1 1 3 " }, { "input": "20\nBBBWWWWBBWWWBWBWWBBB", "output": "5\n3 2 1 1 3 " }, { "input": "20\nBBBBBBBBWBBBWBWBWBBB", "output": "5\n8 3 1 1 3 " }, { "input": "20\nBBBWBWBWWWBBWWWWBWBB", "output": "6\n3 1 1 2 1 2 " }, { "input": "40\nBBBBBBWWWWBWBWWWBWWWWWWWWWWWBBBBBBBBBBBB", "output": "5\n6 1 1 1 12 " }, { "input": "40\nBBBBBWBWWWBBWWWBWBWWBBBBWWWWBWBWBBBBBBBB", "output": "9\n5 1 2 1 1 4 1 1 8 " }, { "input": "50\nBBBBBBBBBBBWWWWBWBWWWWBBBBBBBBWWWWWWWBWWWWBWBBBBBB", "output": "7\n11 1 1 8 1 1 6 " }, { "input": "50\nWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW", "output": "0" }, { "input": "50\nBBBBBWWWWWBWWWBWWWWWBWWWBWWWWWWBBWBBWWWWBWWWWWWWBW", "output": "9\n5 1 1 1 1 2 2 1 1 " }, { "input": "50\nWWWWBWWBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWBWWWWWWWBBBBB", "output": "6\n1 1 1 1 1 5 " }, { "input": "50\nBBBBBWBWBWWBWBWWWWWWBWBWBWWWWWWWWWWWWWBWBWWWWBWWWB", "output": "12\n5 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "1\n50 " }, { "input": "100\nBBBBBBBBBBBWBWWWWBWWBBWBBWWWWWWWWWWBWBWWBWWWWWWWWWWWBBBWWBBWWWWWBWBWWWWBWWWWWWWWWWWBWWWWWBBBBBBBBBBB", "output": "15\n11 1 1 2 2 1 1 1 3 2 1 1 1 1 11 " }, { "input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "1\n100 " }, { "input": "100\nBBBBBBBBBBBBBBBBBBBBWBWBWWWWWBWWWWWWWWWWWWWWBBWWWBWWWWBWWBWWWWWWBWWWWWWWWWWWWWBWBBBBBBBBBBBBBBBBBBBB", "output": "11\n20 1 1 1 2 1 1 1 1 1 20 " }, { "input": "100\nBBBBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWWWWWBWBWWWWWWBBWWWWWWWWWWWWBWWWWBWWWWWWWWWWWWBWWWWWWWBWWWWWWWBBBBBB", "output": "11\n4 1 1 1 1 2 1 1 1 1 6 " }, { "input": "5\nBWBWB", "output": "3\n1 1 1 " }, { "input": "10\nWWBWWWBWBB", "output": "3\n1 1 2 " }, { "input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "1\n50 " }, { "input": "50\nBBBBBBBBBBBBBBBBBWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "2\n17 31 " }, { "input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "2\n24 42 " }, { "input": "90\nWWBWWBWBBWBBWWBWBWBBBWBWBBBWBWBWBWBWBWBWBWBBBBBWBBWWWWBWBBWBWWBBBWBWBWWBWBWBWBWWWWWWBWBBBB", "output": "30\n1 1 2 2 1 1 3 1 3 1 1 1 1 1 1 1 5 2 1 2 1 3 1 1 1 1 1 1 1 4 " }, { "input": "100\nBWWWBWBWBBBBBWBWWBWBWWWBWBWBWWBBWWBBBWBBBWWBWBWWBBBBWBWBBBWBWBBWWWWWWBWWBBBBWBWBWWBWBWWWBWBWWBWBWWWB", "output": "31\n1 1 1 5 1 1 1 1 1 1 2 3 3 1 1 4 1 3 1 2 1 4 1 1 1 1 1 1 1 1 1 " }, { "input": "90\nWBWBBBBBBWWWBBWWBWWWBBWWBWWWBWBBWBWBBWWWWBWBWBBWBBWBWWWBBWBBWWWWBWBBWWWBBBWBBWBWBBBBWWBWWB", "output": "25\n1 6 2 1 2 1 1 2 1 2 1 1 2 2 1 2 2 1 2 3 2 1 4 1 1 " }, { "input": "80\nBBWWBBBWBBWWWWBBWBWBBWWWWWBWBBWWBWBWBWBWBWWBWWBWWWBWBBWBBWBBWBBBWWBBBBBBBWBBBWBB", "output": "23\n2 3 2 2 1 2 1 2 1 1 1 1 1 1 1 1 2 2 2 3 7 3 2 " }, { "input": "65\nWWWWBWWWBBBBBWWWWWWBBBWWBBBBWWWWWWWWBBBWWWWBWBWWBBWWWWBWWWBBWBBBB", "output": "11\n1 5 3 4 3 1 1 2 1 2 4 " } ]
1,667,333,460
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
1
30
0
n = int(input()) crossword = input() b = 0 co = [] for i in crossword: if i == 'B': b += 1 if i == 'W': if b != 0: co.append(b) b = 0 print(len(co)) for i in co: print(f"{i} ", end="") print()
Title: One-dimensional Japanese Crossword Time Limit: None seconds Memory Limit: None megabytes Problem Description: Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)). Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword. Help Adaltik find the numbers encrypting the row he drew. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew). Output Specification: The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row. The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right. Demo Input: ['3\nBBW\n', '5\nBWBWB\n', '4\nWWWW\n', '4\nBBBB\n', '13\nWBBBBWWBWBBBW\n'] Demo Output: ['1\n2 ', '3\n1 1 1 ', '0\n', '1\n4 ', '3\n4 1 3 '] Note: The last sample case correspond to the picture in the statement.
```python n = int(input()) crossword = input() b = 0 co = [] for i in crossword: if i == 'B': b += 1 if i == 'W': if b != 0: co.append(b) b = 0 print(len(co)) for i in co: print(f"{i} ", end="") print() ```
0
993
A
Two Squares
PROGRAMMING
1,600
[ "geometry", "implementation" ]
null
null
You are given two squares, one with sides parallel to the coordinate axes, and another one with sides at 45 degrees to the coordinate axes. Find whether the two squares intersect. The interior of the square is considered to be part of the square, i.e. if one square is completely inside another, they intersect. If the two squares only share one common point, they are also considered to intersect.
The input data consists of two lines, one for each square, both containing 4 pairs of integers. Each pair represents coordinates of one vertex of the square. Coordinates within each line are either in clockwise or counterclockwise order. The first line contains the coordinates of the square with sides parallel to the coordinate axes, the second line contains the coordinates of the square at 45 degrees. All the values are integer and between $-100$ and $100$.
Print "Yes" if squares intersect, otherwise print "No". You can print each letter in any case (upper or lower).
[ "0 0 6 0 6 6 0 6\n1 3 3 5 5 3 3 1\n", "0 0 6 0 6 6 0 6\n7 3 9 5 11 3 9 1\n", "6 0 6 6 0 6 0 0\n7 4 4 7 7 10 10 7\n" ]
[ "YES\n", "NO\n", "YES\n" ]
In the first example the second square lies entirely within the first square, so they do intersect. In the second sample squares do not have any points in common. Here are images corresponding to the samples:
500
[ { "input": "0 0 6 0 6 6 0 6\n1 3 3 5 5 3 3 1", "output": "YES" }, { "input": "0 0 6 0 6 6 0 6\n7 3 9 5 11 3 9 1", "output": "NO" }, { "input": "6 0 6 6 0 6 0 0\n7 4 4 7 7 10 10 7", "output": "YES" }, { "input": "0 0 6 0 6 6 0 6\n8 4 4 8 8 12 12 8", "output": "YES" }, { "input": "2 2 4 2 4 4 2 4\n0 3 3 6 6 3 3 0", "output": "YES" }, { "input": "-5 -5 5 -5 5 5 -5 5\n-5 7 0 2 5 7 0 12", "output": "YES" }, { "input": "-5 -5 5 -5 5 5 -5 5\n-5 12 0 7 5 12 0 17", "output": "NO" }, { "input": "-5 -5 5 -5 5 5 -5 5\n6 0 0 6 -6 0 0 -6", "output": "YES" }, { "input": "-100 -100 100 -100 100 100 -100 100\n-100 0 0 -100 100 0 0 100", "output": "YES" }, { "input": "92 1 92 98 -5 98 -5 1\n44 60 56 48 44 36 32 48", "output": "YES" }, { "input": "-12 -54 -12 33 -99 33 -99 -54\n-77 -40 -86 -31 -77 -22 -68 -31", "output": "YES" }, { "input": "3 45 19 45 19 61 3 61\n-29 45 -13 29 3 45 -13 61", "output": "YES" }, { "input": "79 -19 79 15 45 15 45 -19\n-1 24 -29 52 -1 80 27 52", "output": "NO" }, { "input": "75 -57 75 -21 39 -21 39 -57\n10 -42 -32 0 10 42 52 0", "output": "NO" }, { "input": "-11 53 9 53 9 73 -11 73\n-10 9 -43 42 -10 75 23 42", "output": "YES" }, { "input": "-10 -36 -10 27 -73 27 -73 -36\n44 -28 71 -55 44 -82 17 -55", "output": "NO" }, { "input": "-63 -15 6 -15 6 54 -63 54\n15 -13 -8 10 15 33 38 10", "output": "YES" }, { "input": "47 15 51 15 51 19 47 19\n19 0 -27 46 19 92 65 46", "output": "NO" }, { "input": "87 -5 87 79 3 79 3 -5\n36 36 78 -6 36 -48 -6 -6", "output": "YES" }, { "input": "-4 56 10 56 10 70 -4 70\n-11 47 -35 71 -11 95 13 71", "output": "YES" }, { "input": "-41 6 -41 8 -43 8 -43 6\n-7 27 43 -23 -7 -73 -57 -23", "output": "NO" }, { "input": "44 -58 44 7 -21 7 -21 -58\n22 19 47 -6 22 -31 -3 -6", "output": "YES" }, { "input": "-37 -63 49 -63 49 23 -37 23\n-52 68 -21 37 -52 6 -83 37", "output": "YES" }, { "input": "93 20 93 55 58 55 58 20\n61 -17 39 5 61 27 83 5", "output": "YES" }, { "input": "-7 4 -7 58 -61 58 -61 4\n-28 45 -17 34 -28 23 -39 34", "output": "YES" }, { "input": "24 -79 87 -79 87 -16 24 -16\n-59 21 -85 47 -59 73 -33 47", "output": "NO" }, { "input": "-68 -15 6 -15 6 59 -68 59\n48 -18 57 -27 48 -36 39 -27", "output": "NO" }, { "input": "25 1 25 91 -65 91 -65 1\n24 3 15 12 24 21 33 12", "output": "YES" }, { "input": "55 24 73 24 73 42 55 42\n49 17 10 56 49 95 88 56", "output": "YES" }, { "input": "69 -65 69 -28 32 -28 32 -65\n-1 50 43 6 -1 -38 -45 6", "output": "NO" }, { "input": "86 -26 86 18 42 18 42 -26\n3 -22 -40 21 3 64 46 21", "output": "YES" }, { "input": "52 -47 52 -30 35 -30 35 -47\n49 -22 64 -37 49 -52 34 -37", "output": "YES" }, { "input": "27 -59 27 9 -41 9 -41 -59\n-10 -17 2 -29 -10 -41 -22 -29", "output": "YES" }, { "input": "-90 2 0 2 0 92 -90 92\n-66 31 -86 51 -66 71 -46 51", "output": "YES" }, { "input": "-93 -86 -85 -86 -85 -78 -93 -78\n-13 61 0 48 -13 35 -26 48", "output": "NO" }, { "input": "-3 -45 85 -45 85 43 -3 43\n-22 0 -66 44 -22 88 22 44", "output": "YES" }, { "input": "-27 -73 72 -73 72 26 -27 26\n58 11 100 -31 58 -73 16 -31", "output": "YES" }, { "input": "-40 -31 8 -31 8 17 -40 17\n0 18 -35 53 0 88 35 53", "output": "NO" }, { "input": "-15 -63 -15 7 -85 7 -85 -63\n-35 -40 -33 -42 -35 -44 -37 -42", "output": "YES" }, { "input": "-100 -100 -100 100 100 100 100 -100\n-100 0 0 100 100 0 0 -100", "output": "YES" }, { "input": "67 33 67 67 33 67 33 33\n43 11 9 45 43 79 77 45", "output": "YES" }, { "input": "14 8 9 8 9 3 14 3\n-2 -13 14 3 30 -13 14 -29", "output": "YES" }, { "input": "4 3 7 3 7 6 4 6\n7 29 20 16 7 3 -6 16", "output": "YES" }, { "input": "14 30 3 30 3 19 14 19\n19 -13 11 -5 19 3 27 -5", "output": "NO" }, { "input": "-54 3 -50 3 -50 -1 -54 -1\n3 -50 -6 -41 -15 -50 -6 -59", "output": "NO" }, { "input": "3 8 3 -10 21 -10 21 8\n-9 2 -21 -10 -9 -22 3 -10", "output": "YES" }, { "input": "-35 3 -21 3 -21 -11 -35 -11\n-8 -10 3 -21 -8 -32 -19 -21", "output": "NO" }, { "input": "-5 -23 -5 -31 3 -31 3 -23\n-7 -23 -2 -28 3 -23 -2 -18", "output": "YES" }, { "input": "3 20 10 20 10 13 3 13\n3 20 21 38 39 20 21 2", "output": "YES" }, { "input": "25 3 16 3 16 12 25 12\n21 -2 16 -7 11 -2 16 3", "output": "YES" }, { "input": "-1 18 -1 3 14 3 14 18\n14 3 19 8 14 13 9 8", "output": "YES" }, { "input": "-44 -17 -64 -17 -64 3 -44 3\n-56 15 -44 27 -32 15 -44 3", "output": "YES" }, { "input": "17 3 2 3 2 18 17 18\n22 23 2 3 -18 23 2 43", "output": "YES" }, { "input": "3 -22 3 -36 -11 -36 -11 -22\n11 -44 19 -36 11 -28 3 -36", "output": "YES" }, { "input": "3 45 3 48 0 48 0 45\n13 38 4 47 13 56 22 47", "output": "NO" }, { "input": "3 -10 2 -10 2 -9 3 -9\n38 -10 20 -28 2 -10 20 8", "output": "YES" }, { "input": "-66 3 -47 3 -47 22 -66 22\n-52 -2 -45 5 -52 12 -59 5", "output": "YES" }, { "input": "3 37 -1 37 -1 41 3 41\n6 31 9 34 6 37 3 34", "output": "NO" }, { "input": "13 1 15 1 15 3 13 3\n13 19 21 11 13 3 5 11", "output": "YES" }, { "input": "20 8 3 8 3 -9 20 -9\n2 -11 3 -10 2 -9 1 -10", "output": "NO" }, { "input": "3 41 3 21 -17 21 -17 41\n26 12 10 28 26 44 42 28", "output": "NO" }, { "input": "11 11 11 3 3 3 3 11\n-12 26 -27 11 -12 -4 3 11", "output": "YES" }, { "input": "-29 3 -29 12 -38 12 -38 3\n-35 9 -29 15 -23 9 -29 3", "output": "YES" }, { "input": "3 -32 1 -32 1 -30 3 -30\n4 -32 -16 -52 -36 -32 -16 -12", "output": "YES" }, { "input": "-16 -10 -16 9 3 9 3 -10\n-8 -1 2 9 12 -1 2 -11", "output": "YES" }, { "input": "3 -42 -5 -42 -5 -34 3 -34\n-8 -54 -19 -43 -8 -32 3 -43", "output": "YES" }, { "input": "-47 3 -37 3 -37 -7 -47 -7\n-37 3 -33 -1 -37 -5 -41 -1", "output": "YES" }, { "input": "10 3 12 3 12 5 10 5\n12 4 20 12 12 20 4 12", "output": "YES" }, { "input": "3 -41 -9 -41 -9 -53 3 -53\n18 -16 38 -36 18 -56 -2 -36", "output": "YES" }, { "input": "3 40 2 40 2 41 3 41\n22 39 13 48 4 39 13 30", "output": "NO" }, { "input": "21 26 21 44 3 44 3 26\n-20 38 -32 26 -20 14 -8 26", "output": "NO" }, { "input": "0 7 3 7 3 10 0 10\n3 9 -17 29 -37 9 -17 -11", "output": "YES" }, { "input": "3 21 3 18 6 18 6 21\n-27 18 -11 2 5 18 -11 34", "output": "YES" }, { "input": "-29 13 -39 13 -39 3 -29 3\n-36 -4 -50 -18 -36 -32 -22 -18", "output": "NO" }, { "input": "3 -26 -2 -26 -2 -21 3 -21\n-5 -37 -16 -26 -5 -15 6 -26", "output": "YES" }, { "input": "3 9 -1 9 -1 13 3 13\n-9 17 -1 9 -9 1 -17 9", "output": "YES" }, { "input": "48 8 43 8 43 3 48 3\n31 -4 43 8 55 -4 43 -16", "output": "YES" }, { "input": "-3 1 3 1 3 -5 -3 -5\n20 -22 3 -5 20 12 37 -5", "output": "YES" }, { "input": "14 3 14 -16 -5 -16 -5 3\n14 2 15 1 14 0 13 1", "output": "YES" }, { "input": "-10 12 -10 -1 3 -1 3 12\n1 10 -2 7 -5 10 -2 13", "output": "YES" }, { "input": "39 21 21 21 21 3 39 3\n27 3 47 -17 27 -37 7 -17", "output": "YES" }, { "input": "3 1 3 17 -13 17 -13 1\n17 20 10 27 3 20 10 13", "output": "NO" }, { "input": "15 -18 3 -18 3 -6 15 -6\n29 -1 16 -14 3 -1 16 12", "output": "YES" }, { "input": "41 -6 41 3 32 3 32 -6\n33 3 35 5 33 7 31 5", "output": "YES" }, { "input": "7 35 3 35 3 39 7 39\n23 15 3 35 23 55 43 35", "output": "YES" }, { "input": "19 19 35 19 35 3 19 3\n25 -9 16 -18 7 -9 16 0", "output": "NO" }, { "input": "-20 3 -20 9 -26 9 -26 3\n-19 4 -21 2 -19 0 -17 2", "output": "YES" }, { "input": "13 3 22 3 22 -6 13 -6\n26 3 22 -1 18 3 22 7", "output": "YES" }, { "input": "-4 -8 -4 -15 3 -15 3 -8\n-10 5 -27 -12 -10 -29 7 -12", "output": "YES" }, { "input": "3 15 7 15 7 19 3 19\n-12 30 -23 19 -12 8 -1 19", "output": "NO" }, { "input": "-12 3 5 3 5 -14 -12 -14\n-14 22 5 3 24 22 5 41", "output": "YES" }, { "input": "-37 3 -17 3 -17 -17 -37 -17\n-9 -41 9 -23 -9 -5 -27 -23", "output": "YES" }, { "input": "3 57 3 45 -9 45 -9 57\n8 50 21 37 8 24 -5 37", "output": "YES" }, { "input": "42 3 42 -6 33 -6 33 3\n42 4 41 3 40 4 41 5", "output": "YES" }, { "input": "3 59 3 45 -11 45 -11 59\n-2 50 -8 44 -2 38 4 44", "output": "YES" }, { "input": "-51 3 -39 3 -39 15 -51 15\n-39 14 -53 0 -39 -14 -25 0", "output": "YES" }, { "input": "-7 -15 -7 3 11 3 11 -15\n15 -1 22 -8 15 -15 8 -8", "output": "YES" }, { "input": "3 -39 14 -39 14 -50 3 -50\n17 -39 5 -27 -7 -39 5 -51", "output": "YES" }, { "input": "91 -27 91 29 35 29 35 -27\n59 39 95 3 59 -33 23 3", "output": "YES" }, { "input": "-81 -60 -31 -60 -31 -10 -81 -10\n-58 -68 -95 -31 -58 6 -21 -31", "output": "YES" }, { "input": "78 -59 78 -2 21 -2 21 -59\n48 1 86 -37 48 -75 10 -37", "output": "YES" }, { "input": "-38 -26 32 -26 32 44 -38 44\n2 -27 -44 19 2 65 48 19", "output": "YES" }, { "input": "73 -54 73 -4 23 -4 23 -54\n47 1 77 -29 47 -59 17 -29", "output": "YES" }, { "input": "-6 -25 46 -25 46 27 -6 27\n21 -43 -21 -1 21 41 63 -1", "output": "YES" }, { "input": "-17 -91 -17 -27 -81 -27 -81 -91\n-48 -21 -12 -57 -48 -93 -84 -57", "output": "YES" }, { "input": "-7 16 43 16 43 66 -7 66\n18 -7 -27 38 18 83 63 38", "output": "YES" }, { "input": "-46 11 16 11 16 73 -46 73\n-18 -8 -67 41 -18 90 31 41", "output": "YES" }, { "input": "-33 -64 25 -64 25 -6 -33 -6\n-5 -74 -51 -28 -5 18 41 -28", "output": "YES" }, { "input": "99 -100 100 -100 100 -99 99 -99\n99 -99 100 -98 99 -97 98 -98", "output": "YES" }, { "input": "-100 -100 -100 -99 -99 -99 -99 -100\n-10 -10 -9 -9 -10 -8 -11 -9", "output": "NO" }, { "input": "-4 3 -3 3 -3 4 -4 4\n0 -4 4 0 0 4 -4 0", "output": "NO" }, { "input": "0 0 10 0 10 10 0 10\n11 9 13 7 15 9 13 11", "output": "NO" }, { "input": "1 1 1 6 6 6 6 1\n5 8 8 11 11 8 8 5", "output": "NO" }, { "input": "99 99 99 100 100 100 100 99\n-100 0 0 100 100 0 0 -100", "output": "NO" }, { "input": "0 0 0 2 2 2 2 0\n5 1 9 5 5 9 1 5", "output": "NO" }, { "input": "3 2 3 3 4 3 4 2\n0 4 4 0 0 -4 -4 0", "output": "NO" }, { "input": "0 0 2 0 2 2 0 2\n4 1 7 4 4 7 1 4", "output": "NO" }, { "input": "3 6 3 8 5 8 5 6\n2 9 4 11 6 9 4 7", "output": "YES" }, { "input": "0 0 10 0 10 10 0 10\n-1 5 5 -1 11 5 5 11", "output": "YES" }, { "input": "0 0 1 0 1 1 0 1\n3 0 6 3 3 6 0 3", "output": "NO" }, { "input": "3 7 4 7 4 6 3 6\n0 0 10 10 20 0 10 -10", "output": "NO" }, { "input": "0 0 0 1 1 1 1 0\n0 3 3 6 6 3 3 0", "output": "NO" }, { "input": "0 0 0 4 4 4 4 0\n3 6 7 10 11 6 7 2", "output": "NO" }, { "input": "0 0 0 1 1 1 1 0\n0 10 10 0 20 10 10 20", "output": "NO" } ]
1,672,806,969
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
3
46
0
import math ax, ay, bx, by, cx, cy, dx, dy = map(int, input().split(' ')) ls = list(map(int, input().split(' '))) left, right = min(ax, bx, cx, dx), max(ax, bx, cx, dx) down, up = min(ay, by, cy, dy), max(ay, by, cy, dy) yes = False for i in range(0, len(ls), 2): if left <= ls[i] <= right and down <= ls[i + 1] <= up: yes = True break if yes: print('YES') else: centerX, centerY = (ls[2] + ls[6]) / 2, (ls[1] + ls[5]) / 2 length = abs(ls[1] - ls[5]) / (2 * math.sqrt(2)) ls = [ax - centerX, ay - centerY, bx - centerX, by - centerY, cx - centerX, cy - centerY, dx - centerX, dy - centerY] for i in range(0, len(ls), 2): x, y = ls[i], ls[i + 1] r = math.sqrt(x * x + y * y) theta = math.acos(x / r) + math.pi / 4 x, y = r * math.cos(theta), r * math.sin(theta) ls[i], ls[i + 1] = x, y if -length <= ls[i] <= length and -length <= ls[i + 1] <= length: yes = True break print('YES' if yes else 'NO')
Title: Two Squares Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given two squares, one with sides parallel to the coordinate axes, and another one with sides at 45 degrees to the coordinate axes. Find whether the two squares intersect. The interior of the square is considered to be part of the square, i.e. if one square is completely inside another, they intersect. If the two squares only share one common point, they are also considered to intersect. Input Specification: The input data consists of two lines, one for each square, both containing 4 pairs of integers. Each pair represents coordinates of one vertex of the square. Coordinates within each line are either in clockwise or counterclockwise order. The first line contains the coordinates of the square with sides parallel to the coordinate axes, the second line contains the coordinates of the square at 45 degrees. All the values are integer and between $-100$ and $100$. Output Specification: Print "Yes" if squares intersect, otherwise print "No". You can print each letter in any case (upper or lower). Demo Input: ['0 0 6 0 6 6 0 6\n1 3 3 5 5 3 3 1\n', '0 0 6 0 6 6 0 6\n7 3 9 5 11 3 9 1\n', '6 0 6 6 0 6 0 0\n7 4 4 7 7 10 10 7\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: In the first example the second square lies entirely within the first square, so they do intersect. In the second sample squares do not have any points in common. Here are images corresponding to the samples:
```python import math ax, ay, bx, by, cx, cy, dx, dy = map(int, input().split(' ')) ls = list(map(int, input().split(' '))) left, right = min(ax, bx, cx, dx), max(ax, bx, cx, dx) down, up = min(ay, by, cy, dy), max(ay, by, cy, dy) yes = False for i in range(0, len(ls), 2): if left <= ls[i] <= right and down <= ls[i + 1] <= up: yes = True break if yes: print('YES') else: centerX, centerY = (ls[2] + ls[6]) / 2, (ls[1] + ls[5]) / 2 length = abs(ls[1] - ls[5]) / (2 * math.sqrt(2)) ls = [ax - centerX, ay - centerY, bx - centerX, by - centerY, cx - centerX, cy - centerY, dx - centerX, dy - centerY] for i in range(0, len(ls), 2): x, y = ls[i], ls[i + 1] r = math.sqrt(x * x + y * y) theta = math.acos(x / r) + math.pi / 4 x, y = r * math.cos(theta), r * math.sin(theta) ls[i], ls[i + 1] = x, y if -length <= ls[i] <= length and -length <= ls[i + 1] <= length: yes = True break print('YES' if yes else 'NO') ```
0
271
A
Beautiful Year
PROGRAMMING
800
[ "brute force" ]
null
null
It seems like the year of 2013 came only yesterday. Do you know a curious fact? The year of 2013 is the first year after the old 1987 with only distinct digits. Now you are suggested to solve the following problem: given a year number, find the minimum year number which is strictly larger than the given one and has only distinct digits.
The single line contains integer *y* (1000<=≤<=*y*<=≤<=9000) — the year number.
Print a single integer — the minimum year number that is strictly larger than *y* and all it's digits are distinct. It is guaranteed that the answer exists.
[ "1987\n", "2013\n" ]
[ "2013\n", "2014\n" ]
none
500
[ { "input": "1987", "output": "2013" }, { "input": "2013", "output": "2014" }, { "input": "1000", "output": "1023" }, { "input": "1001", "output": "1023" }, { "input": "1234", "output": "1235" }, { "input": "5555", "output": "5601" }, { "input": "9000", "output": "9012" }, { "input": "1111", "output": "1203" }, { "input": "8999", "output": "9012" }, { "input": "4572", "output": "4573" }, { "input": "6666", "output": "6701" }, { "input": "2001", "output": "2013" }, { "input": "3000", "output": "3012" }, { "input": "7712", "output": "7801" }, { "input": "8088", "output": "8091" }, { "input": "1594", "output": "1596" }, { "input": "6016", "output": "6017" }, { "input": "8800", "output": "8901" }, { "input": "3331", "output": "3401" }, { "input": "5090", "output": "5091" }, { "input": "2342", "output": "2345" }, { "input": "2334", "output": "2340" }, { "input": "1123", "output": "1203" }, { "input": "8989", "output": "9012" }, { "input": "8977", "output": "9012" }, { "input": "6869", "output": "6870" }, { "input": "8999", "output": "9012" } ]
1,693,013,628
2,147,483,647
Python 3
OK
TESTS
27
92
0
num = int(input()) num += 1 while True: if (len(set(str(num))) == len(str(num))): break else: num += 1 print(num)
Title: Beautiful Year Time Limit: None seconds Memory Limit: None megabytes Problem Description: It seems like the year of 2013 came only yesterday. Do you know a curious fact? The year of 2013 is the first year after the old 1987 with only distinct digits. Now you are suggested to solve the following problem: given a year number, find the minimum year number which is strictly larger than the given one and has only distinct digits. Input Specification: The single line contains integer *y* (1000<=≤<=*y*<=≤<=9000) — the year number. Output Specification: Print a single integer — the minimum year number that is strictly larger than *y* and all it's digits are distinct. It is guaranteed that the answer exists. Demo Input: ['1987\n', '2013\n'] Demo Output: ['2013\n', '2014\n'] Note: none
```python num = int(input()) num += 1 while True: if (len(set(str(num))) == len(str(num))): break else: num += 1 print(num) ```
3
202
A
LLPS
PROGRAMMING
800
[ "binary search", "bitmasks", "brute force", "greedy", "implementation", "strings" ]
null
null
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline. You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence. We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=&lt;<=*p*2<=&lt;<=...<=&lt;<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba". String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| &gt; |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=&lt;<=|*x*|, *r*<=&lt;<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=&gt;<=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post". String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
Print the lexicographically largest palindromic subsequence of string *s*.
[ "radar\n", "bowwowwow\n", "codeforces\n", "mississipp\n" ]
[ "rr\n", "wwwww\n", "s\n", "ssss\n" ]
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
500
[ { "input": "radar", "output": "rr" }, { "input": "bowwowwow", "output": "wwwww" }, { "input": "codeforces", "output": "s" }, { "input": "mississipp", "output": "ssss" }, { "input": "tourist", "output": "u" }, { "input": "romka", "output": "r" }, { "input": "helloworld", "output": "w" }, { "input": "zzzzzzzazz", "output": "zzzzzzzzz" }, { "input": "testcase", "output": "tt" }, { "input": "hahahahaha", "output": "hhhhh" }, { "input": "abbbbbbbbb", "output": "bbbbbbbbb" }, { "input": "zaz", "output": "zz" }, { "input": "aza", "output": "z" }, { "input": "dcbaedcba", "output": "e" }, { "input": "abcdeabcd", "output": "e" }, { "input": "edcbabcde", "output": "ee" }, { "input": "aaaaaaaaab", "output": "b" }, { "input": "testzzzzzz", "output": "zzzzzz" }, { "input": "zzzzzzwait", "output": "zzzzzz" }, { "input": "rrrrrqponm", "output": "rrrrr" }, { "input": "zzyzyy", "output": "zzz" }, { "input": "aababb", "output": "bbb" }, { "input": "zanzibar", "output": "zz" }, { "input": "hhgfedcbaa", "output": "hh" }, { "input": "aabcdefghh", "output": "hh" }, { "input": "aruaru", "output": "uu" }, { "input": "uraura", "output": "uu" }, { "input": "aru", "output": "u" }, { "input": "aburvabur", "output": "v" }, { "input": "ura", "output": "u" }, { "input": "eurottat", "output": "u" }, { "input": "referee", "output": "rr" }, { "input": "joking", "output": "o" }, { "input": "seriously", "output": "y" }, { "input": "sets", "output": "t" }, { "input": "test", "output": "tt" }, { "input": "klmgameklm", "output": "mmm" }, { "input": "dfkjafdkdd", "output": "kk" }, { "input": "zzzzzzzzzz", "output": "zzzzzzzzzz" }, { "input": "aaaaaaaaaa", "output": "aaaaaaaaaa" }, { "input": "buzz", "output": "zz" }, { "input": "b", "output": "b" }, { "input": "y", "output": "y" }, { "input": "yy", "output": "yy" }, { "input": "zz", "output": "zz" }, { "input": "bb", "output": "bb" }, { "input": "aa", "output": "aa" }, { "input": "a", "output": "a" }, { "input": "z", "output": "z" }, { "input": "zz", "output": "zz" }, { "input": "zzazazzzaz", "output": "zzzzzzz" }, { "input": "hellhellhe", "output": "llll" }, { "input": "hellohello", "output": "oo" }, { "input": "refer", "output": "rr" } ]
1,592,124,870
2,147,483,647
Python 3
OK
TESTS
54
216
0
a=input() m="" ma=max(a) for i in range(len(a)): if a[i]==ma: m+=a[i] print(m)
Title: LLPS Time Limit: None seconds Memory Limit: None megabytes Problem Description: This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline. You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence. We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=&lt;<=*p*2<=&lt;<=...<=&lt;<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba". String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| &gt; |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=&lt;<=|*x*|, *r*<=&lt;<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=&gt;<=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post". String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z". Input Specification: The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10. Output Specification: Print the lexicographically largest palindromic subsequence of string *s*. Demo Input: ['radar\n', 'bowwowwow\n', 'codeforces\n', 'mississipp\n'] Demo Output: ['rr\n', 'wwwww\n', 's\n', 'ssss\n'] Note: Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
```python a=input() m="" ma=max(a) for i in range(len(a)): if a[i]==ma: m+=a[i] print(m) ```
3
588
B
Duff in Love
PROGRAMMING
1,300
[ "math" ]
null
null
Duff is in love with lovely numbers! A positive integer *x* is called lovely if and only if there is no such positive integer *a*<=&gt;<=1 such that *a*2 is a divisor of *x*. Malek has a number store! In his store, he has only divisors of positive integer *n* (and he has all of them). As a birthday present, Malek wants to give her a lovely number from his store. He wants this number to be as big as possible. Malek always had issues in math, so he asked for your help. Please tell him what is the biggest lovely number in his store.
The first and only line of input contains one integer, *n* (1<=≤<=*n*<=≤<=1012).
Print the answer in one line.
[ "10\n", "12\n" ]
[ "10\n", "6\n" ]
In first sample case, there are numbers 1, 2, 5 and 10 in the shop. 10 isn't divisible by any perfect square, so 10 is lovely. In second sample case, there are numbers 1, 2, 3, 4, 6 and 12 in the shop. 12 is divisible by 4 = 2<sup class="upper-index">2</sup>, so 12 is not lovely, while 6 is indeed lovely.
1,000
[ { "input": "10", "output": "10" }, { "input": "12", "output": "6" }, { "input": "1", "output": "1" }, { "input": "2", "output": "2" }, { "input": "4", "output": "2" }, { "input": "8", "output": "2" }, { "input": "3", "output": "3" }, { "input": "31", "output": "31" }, { "input": "97", "output": "97" }, { "input": "1000000000000", "output": "10" }, { "input": "15", "output": "15" }, { "input": "894", "output": "894" }, { "input": "271", "output": "271" }, { "input": "2457", "output": "273" }, { "input": "2829", "output": "2829" }, { "input": "5000", "output": "10" }, { "input": "20", "output": "10" }, { "input": "68", "output": "34" }, { "input": "3096", "output": "258" }, { "input": "1024", "output": "2" }, { "input": "1048576", "output": "2" }, { "input": "413933789280", "output": "25870861830" }, { "input": "817634153013", "output": "817634153013" }, { "input": "56517269141", "output": "56517269141" }, { "input": "30707328551", "output": "30707328551" }, { "input": "279564127218", "output": "10354226934" }, { "input": "491159577042", "output": "18191095446" }, { "input": "734337660466", "output": "734337660466" }, { "input": "808453785117", "output": "808453785117" }, { "input": "55926835837", "output": "55926835837" }, { "input": "294809951965", "output": "294809951965" }, { "input": "537988035389", "output": "76855433627" }, { "input": "822722434952", "output": "205680608738" }, { "input": "699511759613", "output": "699511759613" }, { "input": "942689843037", "output": "104743315893" }, { "input": "663634158717", "output": "663634158717" }, { "input": "213612977250", "output": "11730" }, { "input": "999999999989", "output": "999999999989" }, { "input": "999999999988", "output": "499999999994" }, { "input": "87178291200", "output": "30030" }, { "input": "927668721948", "output": "463834360974" }, { "input": "562436815639", "output": "37927" }, { "input": "302981118597", "output": "35853" }, { "input": "5", "output": "5" }, { "input": "9", "output": "3" }, { "input": "36", "output": "6" }, { "input": "2231", "output": "2231" }, { "input": "27648", "output": "6" }, { "input": "40320", "output": "210" }, { "input": "648000", "output": "30" }, { "input": "999966000289", "output": "999983" }, { "input": "999985999949", "output": "999985999949" }, { "input": "991921850317", "output": "9973" } ]
1,694,935,551
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
5
46
0
n=int(input()) sq=int(n**0.5) i=1 maxx=0 while(i<=sq): if n%i==0: l=n//i s=i if maxx>=l and maxx>=s: print(maxx) break flag1=False flag2=False j=2 k=2 while(j<=l**0.5): # print(j<=l**0.5) if l%(j**2)==0: flag1=True break else: j+=1 if flag1: # print('flag1 not worked') while(k<=s**0.5): if s%(k**2)==0: flag=True break else: k+=1 if flag1 and flag2: continue elif flag1== False: print(l) break elif flag2==False: maxx=max(maxx,s) i+=1
Title: Duff in Love Time Limit: None seconds Memory Limit: None megabytes Problem Description: Duff is in love with lovely numbers! A positive integer *x* is called lovely if and only if there is no such positive integer *a*<=&gt;<=1 such that *a*2 is a divisor of *x*. Malek has a number store! In his store, he has only divisors of positive integer *n* (and he has all of them). As a birthday present, Malek wants to give her a lovely number from his store. He wants this number to be as big as possible. Malek always had issues in math, so he asked for your help. Please tell him what is the biggest lovely number in his store. Input Specification: The first and only line of input contains one integer, *n* (1<=≤<=*n*<=≤<=1012). Output Specification: Print the answer in one line. Demo Input: ['10\n', '12\n'] Demo Output: ['10\n', '6\n'] Note: In first sample case, there are numbers 1, 2, 5 and 10 in the shop. 10 isn't divisible by any perfect square, so 10 is lovely. In second sample case, there are numbers 1, 2, 3, 4, 6 and 12 in the shop. 12 is divisible by 4 = 2<sup class="upper-index">2</sup>, so 12 is not lovely, while 6 is indeed lovely.
```python n=int(input()) sq=int(n**0.5) i=1 maxx=0 while(i<=sq): if n%i==0: l=n//i s=i if maxx>=l and maxx>=s: print(maxx) break flag1=False flag2=False j=2 k=2 while(j<=l**0.5): # print(j<=l**0.5) if l%(j**2)==0: flag1=True break else: j+=1 if flag1: # print('flag1 not worked') while(k<=s**0.5): if s%(k**2)==0: flag=True break else: k+=1 if flag1 and flag2: continue elif flag1== False: print(l) break elif flag2==False: maxx=max(maxx,s) i+=1 ```
0
45
A
Codecraft III
PROGRAMMING
900
[ "implementation" ]
A. Codecraft III
2
256
Today Vasya visited a widely known site and learned that the continuation of his favourite game Codecraft II will appear after exactly *k* months. He looked at the calendar and learned that at the moment is the month number *s*. Vasya immediately got interested in what month Codecraft III will appear. Help him understand that. All the twelve months in Vasya's calendar are named using their usual English names: January, February, March, April, May, June, July, August, September, October, November, December.
The first input line contains the name of the current month. It is guaranteed that it is a proper English name of one of twelve months. The first letter is uppercase, the rest are lowercase. The second line contains integer *k* (0<=≤<=*k*<=≤<=100) — the number of months left till the appearance of Codecraft III.
Print starting from an uppercase letter the name of the month in which the continuation of Codeforces II will appear. The printed name must be contained in the list January, February, March, April, May, June, July, August, September, October, November, December.
[ "November\n3\n", "May\n24\n" ]
[ "February\n", "May\n" ]
none
0
[ { "input": "November\n3", "output": "February" }, { "input": "May\n24", "output": "May" }, { "input": "April\n0", "output": "April" }, { "input": "September\n0", "output": "September" }, { "input": "August\n0", "output": "August" }, { "input": "June\n1", "output": "July" }, { "input": "July\n2", "output": "September" }, { "input": "September\n3", "output": "December" }, { "input": "July\n4", "output": "November" }, { "input": "August\n24", "output": "August" }, { "input": "May\n48", "output": "May" }, { "input": "November\n47", "output": "October" }, { "input": "December\n49", "output": "January" }, { "input": "June\n99", "output": "September" }, { "input": "March\n100", "output": "July" }, { "input": "December\n1", "output": "January" }, { "input": "January\n11", "output": "December" }, { "input": "December\n0", "output": "December" }, { "input": "January\n0", "output": "January" }, { "input": "July\n77", "output": "December" }, { "input": "February\n11", "output": "January" }, { "input": "February\n22", "output": "December" }, { "input": "July\n33", "output": "April" }, { "input": "May\n44", "output": "January" }, { "input": "June\n97", "output": "July" } ]
1,628,904,439
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
124
6,656,000
#loser707 month=['January','February','March','April','May','June','July','August','September','October','November','December'] current_month=input() months_left=int(input()) a=month.index(current_month)+1+months_left%12-1 print(month[a])
Title: Codecraft III Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Today Vasya visited a widely known site and learned that the continuation of his favourite game Codecraft II will appear after exactly *k* months. He looked at the calendar and learned that at the moment is the month number *s*. Vasya immediately got interested in what month Codecraft III will appear. Help him understand that. All the twelve months in Vasya's calendar are named using their usual English names: January, February, March, April, May, June, July, August, September, October, November, December. Input Specification: The first input line contains the name of the current month. It is guaranteed that it is a proper English name of one of twelve months. The first letter is uppercase, the rest are lowercase. The second line contains integer *k* (0<=≤<=*k*<=≤<=100) — the number of months left till the appearance of Codecraft III. Output Specification: Print starting from an uppercase letter the name of the month in which the continuation of Codeforces II will appear. The printed name must be contained in the list January, February, March, April, May, June, July, August, September, October, November, December. Demo Input: ['November\n3\n', 'May\n24\n'] Demo Output: ['February\n', 'May\n'] Note: none
```python #loser707 month=['January','February','March','April','May','June','July','August','September','October','November','December'] current_month=input() months_left=int(input()) a=month.index(current_month)+1+months_left%12-1 print(month[a]) ```
-1
862
A
Mahmoud and Ehab and the MEX
PROGRAMMING
1,000
[ "greedy", "implementation" ]
null
null
Dr. Evil kidnapped Mahmoud and Ehab in the evil land because of their performance in the Evil Olympiad in Informatics (EOI). He decided to give them some problems to let them go. Dr. Evil is interested in sets, He has a set of *n* integers. Dr. Evil calls a set of integers evil if the MEX of it is exactly *x*. the MEX of a set of integers is the minimum non-negative integer that doesn't exist in it. For example, the MEX of the set {0,<=2,<=4} is 1 and the MEX of the set {1,<=2,<=3} is 0 . Dr. Evil is going to make his set evil. To do this he can perform some operations. During each operation he can add some non-negative integer to his set or erase some element from it. What is the minimal number of operations Dr. Evil has to perform to make his set evil?
The first line contains two integers *n* and *x* (1<=≤<=*n*<=≤<=100, 0<=≤<=*x*<=≤<=100) — the size of the set Dr. Evil owns, and the desired MEX. The second line contains *n* distinct non-negative integers not exceeding 100 that represent the set.
The only line should contain one integer — the minimal number of operations Dr. Evil should perform.
[ "5 3\n0 4 5 6 7\n", "1 0\n0\n", "5 0\n1 2 3 4 5\n" ]
[ "2\n", "1\n", "0\n" ]
For the first test case Dr. Evil should add 1 and 2 to the set performing 2 operations. For the second test case Dr. Evil should erase 0 from the set. After that, the set becomes empty, so the MEX of it is 0. In the third test case the set is already evil.
500
[ { "input": "5 3\n0 4 5 6 7", "output": "2" }, { "input": "1 0\n0", "output": "1" }, { "input": "5 0\n1 2 3 4 5", "output": "0" }, { "input": "10 5\n57 1 47 9 93 37 76 70 78 15", "output": "4" }, { "input": "10 5\n99 98 93 97 95 100 92 94 91 96", "output": "5" }, { "input": "10 5\n1 2 3 4 59 45 0 58 51 91", "output": "0" }, { "input": "100 100\n79 13 21 11 3 87 28 40 29 4 96 34 8 78 61 46 33 45 99 30 92 67 22 97 39 86 73 31 74 44 62 55 57 2 54 63 80 69 25 48 77 98 17 93 15 16 89 12 43 23 37 95 14 38 83 90 49 56 72 10 20 0 50 71 70 88 19 1 76 81 52 41 82 68 85 47 6 7 35 60 18 64 75 84 27 9 65 91 94 42 53 24 66 26 59 36 51 32 5 58", "output": "0" }, { "input": "100 50\n95 78 46 92 80 18 79 58 30 72 19 89 39 29 44 65 15 100 59 8 96 9 62 67 41 42 82 14 57 32 71 77 40 5 7 51 28 53 85 23 16 35 3 91 6 11 75 61 17 66 13 47 36 56 10 22 83 60 48 24 26 97 4 33 76 86 70 0 34 64 52 43 21 49 55 74 1 73 81 25 54 63 94 84 20 68 87 12 31 88 38 93 37 90 98 69 99 45 27 2", "output": "0" }, { "input": "100 33\n28 11 79 92 88 62 77 72 7 41 96 97 67 84 44 8 81 35 38 1 64 68 46 17 98 83 31 12 74 21 2 22 47 6 36 75 65 61 37 26 25 45 59 48 100 51 93 76 78 49 3 57 16 4 87 29 55 82 70 39 53 0 60 15 24 71 58 20 66 89 95 42 13 43 63 90 85 52 50 30 54 40 56 23 27 34 32 18 10 19 69 9 99 73 91 14 5 80 94 86", "output": "0" }, { "input": "99 33\n25 76 41 95 55 20 47 59 58 84 87 92 16 27 35 65 72 63 93 54 36 96 15 86 5 69 24 46 67 73 48 60 40 6 61 74 97 10 100 8 52 26 77 18 7 62 37 2 14 66 11 56 68 91 0 64 75 99 30 21 53 1 89 81 3 98 12 88 39 38 29 83 22 90 9 28 45 43 78 44 32 57 4 50 70 17 13 51 80 85 71 94 82 19 34 42 23 79 49", "output": "1" }, { "input": "100 100\n65 56 84 46 44 33 99 74 62 72 93 67 43 92 75 88 38 34 66 12 55 76 58 90 78 8 14 45 97 59 48 32 64 18 39 89 31 51 54 81 29 36 70 77 40 22 49 27 3 1 73 13 98 42 87 37 2 57 4 6 50 25 23 79 28 86 68 61 80 17 19 10 15 63 52 11 35 60 21 16 24 85 30 91 7 5 69 20 71 82 53 94 41 95 96 9 26 83 0 47", "output": "0" }, { "input": "100 100\n58 88 12 71 22 1 40 19 73 20 67 48 57 17 69 36 100 35 33 37 72 55 52 8 89 85 47 42 78 70 81 86 11 9 68 99 6 16 21 61 53 98 23 62 32 59 51 0 87 24 50 30 65 10 80 95 7 92 25 74 60 79 91 5 13 31 75 38 90 94 46 66 93 34 14 41 28 2 76 84 43 96 3 56 49 82 27 77 64 63 4 45 18 29 54 39 15 26 83 44", "output": "2" }, { "input": "89 100\n58 96 17 41 86 34 28 84 18 40 8 77 87 89 68 79 33 35 53 49 0 6 22 12 72 90 48 55 21 50 56 62 75 2 37 95 69 74 14 20 44 46 27 32 31 59 63 60 10 85 71 70 38 52 94 30 61 51 80 26 36 23 39 47 76 45 100 57 15 78 97 66 54 13 99 16 93 73 24 4 83 5 98 81 92 25 29 88 65", "output": "13" }, { "input": "100 50\n7 95 24 76 81 78 60 69 83 84 100 1 65 31 48 92 73 39 18 89 38 97 10 42 8 55 98 51 21 90 62 77 16 91 0 94 4 37 19 17 67 35 45 41 56 20 15 85 75 28 59 27 12 54 61 68 36 5 79 93 66 11 70 49 50 34 30 25 96 46 64 14 32 22 47 40 58 23 43 9 87 82 26 53 80 52 3 86 13 99 33 71 6 88 57 74 2 44 72 63", "output": "2" }, { "input": "77 0\n27 8 20 92 21 41 53 98 17 65 67 35 81 11 55 49 61 44 2 66 51 89 40 28 52 62 86 91 64 24 18 5 94 82 96 99 71 6 39 83 26 29 16 30 45 97 80 90 69 12 13 33 76 73 46 19 78 56 88 38 42 34 57 77 47 4 59 58 7 100 95 72 9 74 15 43 54", "output": "0" }, { "input": "100 50\n55 36 0 32 81 6 17 43 24 13 30 19 8 59 71 45 15 74 3 41 99 42 86 47 2 94 35 1 66 95 38 49 4 27 96 89 34 44 92 25 51 39 54 28 80 77 20 14 48 40 68 56 31 63 33 78 69 37 18 26 83 70 23 82 91 65 67 52 61 53 7 22 60 21 12 73 72 87 75 100 90 29 64 79 98 85 5 62 93 84 50 46 97 58 57 16 9 10 76 11", "output": "1" }, { "input": "77 0\n12 8 19 87 9 54 55 86 97 7 27 85 25 48 94 73 26 1 13 57 72 69 76 39 38 91 75 40 42 28 93 21 70 84 65 11 60 90 20 95 66 89 59 47 34 99 6 61 52 100 50 3 77 81 82 53 15 24 0 45 44 14 68 96 58 5 18 35 10 98 29 74 92 49 83 71 17", "output": "1" }, { "input": "100 70\n25 94 66 65 10 99 89 6 70 31 7 40 20 92 64 27 21 72 77 98 17 43 47 44 48 81 38 56 100 39 90 22 88 76 3 83 86 29 33 55 82 79 49 11 2 16 12 78 85 69 32 97 26 15 53 24 23 91 51 67 34 35 52 5 62 50 95 18 71 13 75 8 30 42 93 36 45 60 63 46 57 41 87 0 84 54 74 37 4 58 28 19 96 61 80 9 1 14 73 68", "output": "2" }, { "input": "89 19\n14 77 85 81 79 38 91 45 55 51 50 11 62 67 73 76 2 27 16 23 3 29 65 98 78 17 4 58 22 20 34 66 64 31 72 5 32 44 12 75 80 47 18 25 99 0 61 56 71 84 48 88 10 7 86 8 49 24 43 21 37 28 33 54 46 57 40 89 36 97 6 96 39 95 26 74 1 69 9 100 52 30 83 87 68 60 92 90 35", "output": "2" }, { "input": "89 100\n69 61 56 45 11 41 42 32 28 29 0 76 7 65 13 35 36 82 10 39 26 34 38 40 92 12 17 54 24 46 88 70 66 27 100 52 85 62 22 48 86 68 21 49 53 94 67 20 1 90 77 84 31 87 58 47 95 33 4 72 93 83 8 51 91 80 99 43 71 19 44 59 98 97 64 9 81 16 79 63 25 37 3 75 2 55 50 6 18", "output": "13" }, { "input": "77 0\n38 76 24 74 42 88 29 75 96 46 90 32 59 97 98 60 41 57 80 37 100 49 25 63 95 31 61 68 53 78 27 66 84 48 94 83 30 26 36 99 71 62 45 47 70 28 35 54 34 85 79 43 91 72 86 33 67 92 77 65 69 52 82 55 87 64 56 40 50 44 51 73 89 81 58 93 39", "output": "0" }, { "input": "89 100\n38 90 80 64 35 44 56 11 15 89 23 12 49 70 72 60 63 85 92 10 45 83 8 88 41 33 16 6 61 76 62 71 87 13 25 77 74 0 1 37 96 93 7 94 21 82 34 78 4 73 65 20 81 95 50 32 48 17 69 55 68 5 51 27 53 43 91 67 59 46 86 84 99 24 22 3 97 98 40 36 26 58 57 9 42 30 52 2 47", "output": "11" }, { "input": "77 0\n55 71 78 86 68 35 53 10 59 32 81 19 74 97 62 61 93 87 96 44 25 18 43 82 84 16 34 48 92 39 64 36 49 91 45 76 95 31 57 29 75 79 13 2 14 24 52 23 33 20 47 99 63 15 5 80 58 67 12 3 85 6 1 27 73 90 4 42 37 70 8 11 89 77 9 22 94", "output": "0" }, { "input": "77 0\n12 75 31 71 44 8 3 82 21 77 50 29 57 74 40 10 15 42 84 2 100 9 28 72 92 0 49 11 90 55 17 36 19 54 68 52 4 69 97 91 5 39 59 45 89 62 53 83 16 94 76 60 95 47 30 51 7 48 20 70 67 32 58 78 63 34 56 93 99 88 24 1 66 22 25 14 13", "output": "1" }, { "input": "100 70\n91 82 8 85 26 25 95 97 40 87 81 93 7 73 38 94 64 96 74 18 90 19 65 68 72 61 23 43 36 41 60 88 30 33 71 24 52 39 15 3 16 89 86 79 55 4 9 58 67 44 46 29 6 48 84 69 27 21 78 54 51 57 80 53 76 50 47 77 45 12 34 10 100 0 17 31 56 99 98 11 92 5 2 42 32 59 66 62 37 63 28 75 35 1 22 13 83 49 20 14", "output": "0" }, { "input": "77 0\n51 5 81 62 30 22 11 0 83 16 79 85 52 70 69 10 8 47 58 3 24 34 44 14 82 66 99 17 28 31 64 67 23 49 94 45 4 12 27 15 21 6 43 72 87 2 63 92 35 39 59 9 90 78 93 20 65 36 60 89 50 41 61 84 77 86 76 100 38 68 53 97 96 95 7 19 88", "output": "1" }, { "input": "1 100\n0", "output": "99" }, { "input": "1 0\n100", "output": "0" }, { "input": "1 100\n100", "output": "101" }, { "input": "2 100\n0 100", "output": "100" }, { "input": "5 5\n1 2 3 4 5", "output": "2" }, { "input": "5 3\n0 3 4 5 6", "output": "3" }, { "input": "7 10\n0 1 2 3 4 5 10", "output": "5" }, { "input": "2 2\n0 2", "output": "2" }, { "input": "2 1\n1 2", "output": "2" }, { "input": "5 1\n1 2 3 4 5", "output": "2" }, { "input": "5 2\n1 2 3 4 5", "output": "2" }, { "input": "5 6\n0 1 2 3 4", "output": "1" }, { "input": "3 2\n3 4 5", "output": "2" } ]
1,517,735,466
2,147,483,647
Python 3
OK
TESTS
39
62
5,632,000
def u_b(li,x,low,high): while low<=high: mid=(high+low)//2 if li[mid]<x: low=mid+1 else: high=mid-1 return low n,x=map(int,input().split()) l=list(map(int,input().split())) l.sort() index=u_b(l,x,0,n-1) print(x-index if x not in l else x-index+1)
Title: Mahmoud and Ehab and the MEX Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dr. Evil kidnapped Mahmoud and Ehab in the evil land because of their performance in the Evil Olympiad in Informatics (EOI). He decided to give them some problems to let them go. Dr. Evil is interested in sets, He has a set of *n* integers. Dr. Evil calls a set of integers evil if the MEX of it is exactly *x*. the MEX of a set of integers is the minimum non-negative integer that doesn't exist in it. For example, the MEX of the set {0,<=2,<=4} is 1 and the MEX of the set {1,<=2,<=3} is 0 . Dr. Evil is going to make his set evil. To do this he can perform some operations. During each operation he can add some non-negative integer to his set or erase some element from it. What is the minimal number of operations Dr. Evil has to perform to make his set evil? Input Specification: The first line contains two integers *n* and *x* (1<=≤<=*n*<=≤<=100, 0<=≤<=*x*<=≤<=100) — the size of the set Dr. Evil owns, and the desired MEX. The second line contains *n* distinct non-negative integers not exceeding 100 that represent the set. Output Specification: The only line should contain one integer — the minimal number of operations Dr. Evil should perform. Demo Input: ['5 3\n0 4 5 6 7\n', '1 0\n0\n', '5 0\n1 2 3 4 5\n'] Demo Output: ['2\n', '1\n', '0\n'] Note: For the first test case Dr. Evil should add 1 and 2 to the set performing 2 operations. For the second test case Dr. Evil should erase 0 from the set. After that, the set becomes empty, so the MEX of it is 0. In the third test case the set is already evil.
```python def u_b(li,x,low,high): while low<=high: mid=(high+low)//2 if li[mid]<x: low=mid+1 else: high=mid-1 return low n,x=map(int,input().split()) l=list(map(int,input().split())) l.sort() index=u_b(l,x,0,n-1) print(x-index if x not in l else x-index+1) ```
3
1,008
A
Romaji
PROGRAMMING
900
[ "implementation", "strings" ]
null
null
Vitya has just started learning Berlanese language. It is known that Berlanese uses the Latin alphabet. Vowel letters are "a", "o", "u", "i", and "e". Other letters are consonant. In Berlanese, there has to be a vowel after every consonant, but there can be any letter after any vowel. The only exception is a consonant "n"; after this letter, there can be any letter (not only a vowel) or there can be no letter at all. For example, the words "harakiri", "yupie", "man", and "nbo" are Berlanese while the words "horse", "king", "my", and "nz" are not. Help Vitya find out if a word $s$ is Berlanese.
The first line of the input contains the string $s$ consisting of $|s|$ ($1\leq |s|\leq 100$) lowercase Latin letters.
Print "YES" (without quotes) if there is a vowel after every consonant except "n", otherwise print "NO". You can print each letter in any case (upper or lower).
[ "sumimasen\n", "ninja\n", "codeforces\n" ]
[ "YES\n", "YES\n", "NO\n" ]
In the first and second samples, a vowel goes after each consonant except "n", so the word is Berlanese. In the third sample, the consonant "c" goes after the consonant "r", and the consonant "s" stands on the end, so the word is not Berlanese.
500
[ { "input": "sumimasen", "output": "YES" }, { "input": "ninja", "output": "YES" }, { "input": "codeforces", "output": "NO" }, { "input": "auuaoonntanonnuewannnnpuuinniwoonennyolonnnvienonpoujinndinunnenannmuveoiuuhikucuziuhunnnmunzancenen", "output": "YES" }, { "input": "n", "output": "YES" }, { "input": "necnei", "output": "NO" }, { "input": "nternn", "output": "NO" }, { "input": "aucunuohja", "output": "NO" }, { "input": "a", "output": "YES" }, { "input": "b", "output": "NO" }, { "input": "nn", "output": "YES" }, { "input": "nnnzaaa", "output": "YES" }, { "input": "zn", "output": "NO" }, { "input": "ab", "output": "NO" }, { "input": "aaaaaaaaaa", "output": "YES" }, { "input": "aaaaaaaaab", "output": "NO" }, { "input": "aaaaaaaaan", "output": "YES" }, { "input": "baaaaaaaaa", "output": "YES" }, { "input": "naaaaaaaaa", "output": "YES" }, { "input": "nbaaaaaaaa", "output": "YES" }, { "input": "bbaaaaaaaa", "output": "NO" }, { "input": "bnaaaaaaaa", "output": "NO" }, { "input": "eonwonojannonnufimiiniewuqaienokacevecinfuqihatenhunliquuyebayiaenifuexuanenuaounnboancaeowonu", "output": "YES" }, { "input": "uixinnepnlinqaingieianndeakuniooudidonnnqeaituioeneiroionxuowudiooonayenfeonuino", "output": "NO" }, { "input": "nnnnnyigaveteononnnnxaalenxuiiwannntoxonyoqonlejuoxuoconnnentoinnul", "output": "NO" }, { "input": "ndonneasoiunhomuunnhuitonnntunntoanerekonoupunanuauenu", "output": "YES" }, { "input": "anujemogawautiedoneobninnibonuunaoennnyoorufonxionntinimiboonununnnnnleenqunminzayoutanlalo", "output": "NO" }, { "input": "y", "output": "NO" }, { "input": "by", "output": "NO" }, { "input": "yy", "output": "NO" }, { "input": "nbn", "output": "NO" }, { "input": "nz", "output": "NO" }, { "input": "king", "output": "NO" }, { "input": "g", "output": "NO" }, { "input": "az", "output": "NO" }, { "input": "x", "output": "NO" }, { "input": "z", "output": "NO" }, { "input": "yn", "output": "NO" }, { "input": "aeo", "output": "YES" }, { "input": "nb", "output": "NO" }, { "input": "npn", "output": "NO" }, { "input": "kini", "output": "YES" }, { "input": "pya", "output": "NO" }, { "input": "m", "output": "NO" }, { "input": "p", "output": "NO" }, { "input": "aaaaaaaak", "output": "NO" }, { "input": "aab", "output": "NO" }, { "input": "d", "output": "NO" }, { "input": "at", "output": "NO" }, { "input": "aaaaaak", "output": "NO" }, { "input": "aaz", "output": "NO" }, { "input": "aaab", "output": "NO" }, { "input": "s", "output": "NO" }, { "input": "nzzen", "output": "NO" }, { "input": "aeionnhhhn", "output": "NO" }, { "input": "h", "output": "NO" }, { "input": "ny", "output": "NO" } ]
1,637,168,323
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
31
0
s=input() l=len(S) v=['a','e','i','o','u'] result="YES" for i in range(1-l): if s[i]!='n' and s[i] not in v: if s[i+1] not in v: result="NO" if s[-1] not in v and s[-1]!='n': result="NO" print(result)
Title: Romaji Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vitya has just started learning Berlanese language. It is known that Berlanese uses the Latin alphabet. Vowel letters are "a", "o", "u", "i", and "e". Other letters are consonant. In Berlanese, there has to be a vowel after every consonant, but there can be any letter after any vowel. The only exception is a consonant "n"; after this letter, there can be any letter (not only a vowel) or there can be no letter at all. For example, the words "harakiri", "yupie", "man", and "nbo" are Berlanese while the words "horse", "king", "my", and "nz" are not. Help Vitya find out if a word $s$ is Berlanese. Input Specification: The first line of the input contains the string $s$ consisting of $|s|$ ($1\leq |s|\leq 100$) lowercase Latin letters. Output Specification: Print "YES" (without quotes) if there is a vowel after every consonant except "n", otherwise print "NO". You can print each letter in any case (upper or lower). Demo Input: ['sumimasen\n', 'ninja\n', 'codeforces\n'] Demo Output: ['YES\n', 'YES\n', 'NO\n'] Note: In the first and second samples, a vowel goes after each consonant except "n", so the word is Berlanese. In the third sample, the consonant "c" goes after the consonant "r", and the consonant "s" stands on the end, so the word is not Berlanese.
```python s=input() l=len(S) v=['a','e','i','o','u'] result="YES" for i in range(1-l): if s[i]!='n' and s[i] not in v: if s[i+1] not in v: result="NO" if s[-1] not in v and s[-1]!='n': result="NO" print(result) ```
-1
525
B
Pasha and String
PROGRAMMING
1,400
[ "constructive algorithms", "greedy", "math", "strings" ]
null
null
Pasha got a very beautiful string *s* for his birthday, the string consists of lowercase Latin letters. The letters in the string are numbered from 1 to |*s*| from left to right, where |*s*| is the length of the given string. Pasha didn't like his present very much so he decided to change it. After his birthday Pasha spent *m* days performing the following transformations on his string — each day he chose integer *a**i* and reversed a piece of string (a segment) from position *a**i* to position |*s*|<=-<=*a**i*<=+<=1. It is guaranteed that 2·*a**i*<=≤<=|*s*|. You face the following task: determine what Pasha's string will look like after *m* days.
The first line of the input contains Pasha's string *s* of length from 2 to 2·105 characters, consisting of lowercase Latin letters. The second line contains a single integer *m* (1<=≤<=*m*<=≤<=105) —  the number of days when Pasha changed his string. The third line contains *m* space-separated elements *a**i* (1<=≤<=*a**i*; 2·*a**i*<=≤<=|*s*|) — the position from which Pasha started transforming the string on the *i*-th day.
In the first line of the output print what Pasha's string *s* will look like after *m* days.
[ "abcdef\n1\n2\n", "vwxyz\n2\n2 2\n", "abcdef\n3\n1 2 3\n" ]
[ "aedcbf\n", "vwxyz\n", "fbdcea\n" ]
none
750
[ { "input": "abcdef\n1\n2", "output": "aedcbf" }, { "input": "vwxyz\n2\n2 2", "output": "vwxyz" }, { "input": "abcdef\n3\n1 2 3", "output": "fbdcea" }, { "input": "jc\n5\n1 1 1 1 1", "output": "cj" }, { "input": "wljqgdlxyc\n13\n3 4 3 3 5 4 4 2 4 4 5 3 3", "output": "wyjldgqxlc" }, { "input": "keicnqmuqinhsmtudqcilocxkbqgzhbkitmqwttdyoyvcbxincwjryzknubpacsngorexaldfurondbednowemnnlphhboycfavs\n2\n5 12", "output": "keiccyobhhphsmtudqcilocxkbqgzhbkitmqwttdyoyvcbxincwjryzknubpacsngorexaldfurondbednowemnnlniqumqnfavs" }, { "input": "xwcxggxvfqbdklewbxkjzibmufnaywuxsqvwakefxbbkfandvigasbhbatsxyqxicrosatfsfybedklsaztyyiuurfbrzmwumujy\n100\n14 43 30 13 8 19 33 7 8 14 15 35 5 18 44 1 35 1 18 7 50 47 9 49 28 29 39 37 27 17 19 12 5 24 37 42 37 23 35 31 10 26 5 38 40 34 42 47 2 40 43 34 16 25 14 45 35 38 46 48 49 27 49 38 10 49 5 7 3 3 41 25 24 34 37 33 17 50 48 11 40 43 48 10 9 50 18 39 32 13 26 40 37 16 45 50 27 3 7 31", "output": "xjcxggxvfbbruliyyxkjzikdebnfyftxsorcaxqyxbtkfhbdvigasnababsxfekiwvqsauwsayfumblsaztbweukdfqrzmwumuwy" } ]
1,485,206,357
2,147,483,647
Python 3
OK
TESTS
43
233
12,697,600
a =list(input()) n = int(input()) t = [int(i) for i in input().split()] t = sorted(t) s = len(a) k=0 for i in range(s//2): while k<n and t[k]-1 <= i: k+=1 if k%2==1: a[i],a[s-i-1] = a[s-i-1],a[i] print(''.join(a))
Title: Pasha and String Time Limit: None seconds Memory Limit: None megabytes Problem Description: Pasha got a very beautiful string *s* for his birthday, the string consists of lowercase Latin letters. The letters in the string are numbered from 1 to |*s*| from left to right, where |*s*| is the length of the given string. Pasha didn't like his present very much so he decided to change it. After his birthday Pasha spent *m* days performing the following transformations on his string — each day he chose integer *a**i* and reversed a piece of string (a segment) from position *a**i* to position |*s*|<=-<=*a**i*<=+<=1. It is guaranteed that 2·*a**i*<=≤<=|*s*|. You face the following task: determine what Pasha's string will look like after *m* days. Input Specification: The first line of the input contains Pasha's string *s* of length from 2 to 2·105 characters, consisting of lowercase Latin letters. The second line contains a single integer *m* (1<=≤<=*m*<=≤<=105) —  the number of days when Pasha changed his string. The third line contains *m* space-separated elements *a**i* (1<=≤<=*a**i*; 2·*a**i*<=≤<=|*s*|) — the position from which Pasha started transforming the string on the *i*-th day. Output Specification: In the first line of the output print what Pasha's string *s* will look like after *m* days. Demo Input: ['abcdef\n1\n2\n', 'vwxyz\n2\n2 2\n', 'abcdef\n3\n1 2 3\n'] Demo Output: ['aedcbf\n', 'vwxyz\n', 'fbdcea\n'] Note: none
```python a =list(input()) n = int(input()) t = [int(i) for i in input().split()] t = sorted(t) s = len(a) k=0 for i in range(s//2): while k<n and t[k]-1 <= i: k+=1 if k%2==1: a[i],a[s-i-1] = a[s-i-1],a[i] print(''.join(a)) ```
3
248
A
Cupboards
PROGRAMMING
800
[ "implementation" ]
null
null
One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house. Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find. And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open. Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position. Your task is to write a program that will determine the required number of seconds *t*.
The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero. The numbers in the lines are separated by single spaces.
In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs.
[ "5\n0 1\n1 0\n0 1\n1 1\n0 1\n" ]
[ "3\n" ]
none
500
[ { "input": "5\n0 1\n1 0\n0 1\n1 1\n0 1", "output": "3" }, { "input": "2\n0 0\n0 0", "output": "0" }, { "input": "3\n0 1\n1 1\n1 1", "output": "1" }, { "input": "8\n0 1\n1 0\n0 1\n1 1\n0 1\n1 0\n0 1\n1 0", "output": "7" }, { "input": "8\n1 0\n1 0\n1 0\n0 1\n0 1\n1 1\n1 1\n0 1", "output": "6" }, { "input": "15\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "5\n1 0\n1 0\n1 0\n0 1\n0 1", "output": "4" } ]
1,620,111,409
2,147,483,647
PyPy 3
OK
TESTS
57
404
2,969,600
# cases = int(input()) cases = 1 def solve(): n = int(input()) ones_in_left = 0 ones_in_right = 0 for i in range(n): left, right = map(int, input().split()) if left == 1: ones_in_left += 1 if right == 1: ones_in_right += 1 ans = min(ones_in_left, n - ones_in_left) + min(ones_in_right, n - ones_in_right) return ans for case in range(1, cases+1): ans = solve() print(ans) # print(f"Case #{case}: {ans}")
Title: Cupboards Time Limit: None seconds Memory Limit: None megabytes Problem Description: One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house. Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find. And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open. Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position. Your task is to write a program that will determine the required number of seconds *t*. Input Specification: The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero. The numbers in the lines are separated by single spaces. Output Specification: In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs. Demo Input: ['5\n0 1\n1 0\n0 1\n1 1\n0 1\n'] Demo Output: ['3\n'] Note: none
```python # cases = int(input()) cases = 1 def solve(): n = int(input()) ones_in_left = 0 ones_in_right = 0 for i in range(n): left, right = map(int, input().split()) if left == 1: ones_in_left += 1 if right == 1: ones_in_right += 1 ans = min(ones_in_left, n - ones_in_left) + min(ones_in_right, n - ones_in_right) return ans for case in range(1, cases+1): ans = solve() print(ans) # print(f"Case #{case}: {ans}") ```
3
16
B
Burglar and Matches
PROGRAMMING
900
[ "greedy", "implementation", "sortings" ]
B. Burglar and Matches
0
64
A burglar got into a matches warehouse and wants to steal as many matches as possible. In the warehouse there are *m* containers, in the *i*-th container there are *a**i* matchboxes, and each matchbox contains *b**i* matches. All the matchboxes are of the same size. The burglar's rucksack can hold *n* matchboxes exactly. Your task is to find out the maximum amount of matches that a burglar can carry away. He has no time to rearrange matches in the matchboxes, that's why he just chooses not more than *n* matchboxes so that the total amount of matches in them is maximal.
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=2·108) and integer *m* (1<=≤<=*m*<=≤<=20). The *i*<=+<=1-th line contains a pair of numbers *a**i* and *b**i* (1<=≤<=*a**i*<=≤<=108,<=1<=≤<=*b**i*<=≤<=10). All the input numbers are integer.
Output the only number — answer to the problem.
[ "7 3\n5 10\n2 5\n3 6\n", "3 3\n1 3\n2 2\n3 1\n" ]
[ "62\n", "7\n" ]
none
0
[ { "input": "7 3\n5 10\n2 5\n3 6", "output": "62" }, { "input": "3 3\n1 3\n2 2\n3 1", "output": "7" }, { "input": "1 1\n1 2", "output": "2" }, { "input": "1 2\n1 9\n1 6", "output": "9" }, { "input": "1 10\n1 1\n1 9\n1 3\n1 9\n1 7\n1 10\n1 4\n1 7\n1 3\n1 1", "output": "10" }, { "input": "2 1\n2 1", "output": "2" }, { "input": "2 2\n2 4\n1 4", "output": "8" }, { "input": "2 3\n1 7\n1 2\n1 5", "output": "12" }, { "input": "4 1\n2 2", "output": "4" }, { "input": "4 2\n1 10\n4 4", "output": "22" }, { "input": "4 3\n1 4\n6 4\n1 7", "output": "19" }, { "input": "5 1\n10 5", "output": "25" }, { "input": "5 2\n3 9\n2 2", "output": "31" }, { "input": "5 5\n2 9\n3 1\n2 1\n1 8\n2 8", "output": "42" }, { "input": "5 10\n1 3\n1 2\n1 9\n1 10\n1 1\n1 5\n1 10\n1 2\n1 3\n1 7", "output": "41" }, { "input": "10 1\n9 4", "output": "36" }, { "input": "10 2\n14 3\n1 3", "output": "30" }, { "input": "10 7\n4 8\n1 10\n1 10\n1 2\n3 3\n1 3\n1 10", "output": "71" }, { "input": "10 10\n1 8\n2 10\n1 9\n1 1\n1 9\n1 6\n1 4\n2 5\n1 2\n1 4", "output": "70" }, { "input": "10 4\n1 5\n5 2\n1 9\n3 3", "output": "33" }, { "input": "100 5\n78 6\n29 10\n3 6\n7 3\n2 4", "output": "716" }, { "input": "1000 7\n102 10\n23 6\n79 4\n48 1\n34 10\n839 8\n38 4", "output": "8218" }, { "input": "10000 10\n336 2\n2782 5\n430 10\n1893 7\n3989 10\n2593 8\n165 6\n1029 2\n2097 4\n178 10", "output": "84715" }, { "input": "100000 3\n2975 2\n35046 4\n61979 9", "output": "703945" }, { "input": "1000000 4\n314183 9\n304213 4\n16864 5\n641358 9", "output": "8794569" }, { "input": "10000000 10\n360313 10\n416076 1\n435445 9\n940322 7\n1647581 7\n4356968 10\n3589256 2\n2967933 5\n2747504 7\n1151633 3", "output": "85022733" }, { "input": "100000000 7\n32844337 7\n11210848 7\n47655987 1\n33900472 4\n9174763 2\n32228738 10\n29947408 5", "output": "749254060" }, { "input": "200000000 10\n27953106 7\n43325979 4\n4709522 1\n10975786 4\n67786538 8\n48901838 7\n15606185 6\n2747583 1\n100000000 1\n633331 3", "output": "1332923354" }, { "input": "200000000 9\n17463897 9\n79520463 1\n162407 4\n41017993 8\n71054118 4\n9447587 2\n5298038 9\n3674560 7\n20539314 5", "output": "996523209" }, { "input": "200000000 8\n6312706 6\n2920548 2\n16843192 3\n1501141 2\n13394704 6\n10047725 10\n4547663 6\n54268518 6", "output": "630991750" }, { "input": "200000000 7\n25621043 2\n21865270 1\n28833034 1\n22185073 5\n100000000 2\n13891017 9\n61298710 8", "output": "931584598" }, { "input": "200000000 6\n7465600 6\n8453505 10\n4572014 8\n8899499 3\n86805622 10\n64439238 6", "output": "1447294907" }, { "input": "200000000 5\n44608415 6\n100000000 9\n51483223 9\n44136047 1\n52718517 1", "output": "1634907859" }, { "input": "200000000 4\n37758556 10\n100000000 6\n48268521 3\n20148178 10", "output": "1305347138" }, { "input": "200000000 3\n65170000 7\n20790088 1\n74616133 4", "output": "775444620" }, { "input": "200000000 2\n11823018 6\n100000000 9", "output": "970938108" }, { "input": "200000000 1\n100000000 6", "output": "600000000" }, { "input": "200000000 10\n12097724 9\n41745972 5\n26982098 9\n14916995 7\n21549986 7\n3786630 9\n8050858 7\n27994924 4\n18345001 5\n8435339 5", "output": "1152034197" }, { "input": "200000000 10\n55649 8\n10980981 9\n3192542 8\n94994808 4\n3626106 1\n100000000 6\n5260110 9\n4121453 2\n15125061 4\n669569 6", "output": "1095537357" }, { "input": "10 20\n1 7\n1 7\n1 8\n1 3\n1 10\n1 7\n1 7\n1 9\n1 3\n1 1\n1 2\n1 1\n1 3\n1 10\n1 9\n1 8\n1 8\n1 6\n1 7\n1 5", "output": "83" }, { "input": "10000000 20\n4594 7\n520836 8\n294766 6\n298672 4\n142253 6\n450626 1\n1920034 9\n58282 4\n1043204 1\n683045 1\n1491746 5\n58420 4\n451217 2\n129423 4\n246113 5\n190612 8\n912923 6\n473153 6\n783733 6\n282411 10", "output": "54980855" }, { "input": "200000000 20\n15450824 5\n839717 10\n260084 8\n1140850 8\n28744 6\n675318 3\n25161 2\n5487 3\n6537698 9\n100000000 5\n7646970 9\n16489 6\n24627 3\n1009409 5\n22455 1\n25488456 4\n484528 9\n32663641 3\n750968 4\n5152 6", "output": "939368573" }, { "input": "200000000 20\n16896 2\n113 3\n277 2\n299 7\n69383562 2\n3929 8\n499366 4\n771846 5\n9 4\n1278173 7\n90 2\n54 7\n72199858 10\n17214 5\n3 10\n1981618 3\n3728 2\n141 8\n2013578 9\n51829246 5", "output": "1158946383" }, { "input": "200000000 20\n983125 2\n7453215 9\n9193588 2\n11558049 7\n28666199 1\n34362244 1\n5241493 5\n15451270 4\n19945845 8\n6208681 3\n38300385 7\n6441209 8\n21046742 7\n577198 10\n3826434 8\n9764276 8\n6264675 7\n8567063 3\n3610303 4\n2908232 3", "output": "1131379312" }, { "input": "10 15\n1 6\n2 6\n3 4\n1 3\n1 2\n1 5\n1 6\n1 2\n2 9\n1 10\n1 3\n1 7\n1 8\n1 2\n2 9", "output": "79" }, { "input": "10000000 15\n111 5\n914124 3\n3 9\n177790 1\n2352 3\n32138 9\n104477 1\n1223 4\n18 6\n6655580 4\n57643 10\n94309 2\n37 1\n227002 10\n1733193 7", "output": "45116295" }, { "input": "200000000 15\n7069868 1\n5567826 8\n2310059 10\n13539782 7\n38420939 4\n29911411 8\n52256316 1\n12265839 9\n2074265 1\n24896428 9\n72470695 5\n3236301 1\n3890243 2\n65168965 8\n65724 6", "output": "1489289257" }, { "input": "200000000 15\n12044094 7\n2475138 10\n944451 7\n4854766 2\n3809145 10\n7727571 2\n43908937 6\n2745883 1\n427511 2\n100000000 5\n190914 6\n554889 3\n288798 4\n1848572 5\n893874 3", "output": "961871671" }, { "input": "200000000 15\n6334191 7\n1927941 4\n5175933 10\n468389 1\n433043 10\n6863198 5\n7480646 4\n14774279 10\n2921129 8\n18325627 7\n6973152 9\n8277324 9\n21522856 2\n2058070 1\n2444742 4", "output": "664376069" } ]
1,634,126,598
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
8
92
6,963,200
n, m = map(int, input().split()) v = 0 l = sorted((list(map(int, input().split()))[::-1] for i in range(m)), reverse=True) i = 0 while n > 0: x = min(l[i][1], n) v += l[i][0] * x n -= x i += 1 print(v)
Title: Burglar and Matches Time Limit: 0 seconds Memory Limit: 64 megabytes Problem Description: A burglar got into a matches warehouse and wants to steal as many matches as possible. In the warehouse there are *m* containers, in the *i*-th container there are *a**i* matchboxes, and each matchbox contains *b**i* matches. All the matchboxes are of the same size. The burglar's rucksack can hold *n* matchboxes exactly. Your task is to find out the maximum amount of matches that a burglar can carry away. He has no time to rearrange matches in the matchboxes, that's why he just chooses not more than *n* matchboxes so that the total amount of matches in them is maximal. Input Specification: The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=2·108) and integer *m* (1<=≤<=*m*<=≤<=20). The *i*<=+<=1-th line contains a pair of numbers *a**i* and *b**i* (1<=≤<=*a**i*<=≤<=108,<=1<=≤<=*b**i*<=≤<=10). All the input numbers are integer. Output Specification: Output the only number — answer to the problem. Demo Input: ['7 3\n5 10\n2 5\n3 6\n', '3 3\n1 3\n2 2\n3 1\n'] Demo Output: ['62\n', '7\n'] Note: none
```python n, m = map(int, input().split()) v = 0 l = sorted((list(map(int, input().split()))[::-1] for i in range(m)), reverse=True) i = 0 while n > 0: x = min(l[i][1], n) v += l[i][0] * x n -= x i += 1 print(v) ```
-1
262
A
Roma and Lucky Numbers
PROGRAMMING
800
[ "implementation" ]
null
null
Roma (a popular Russian name that means 'Roman') loves the Little Lvov Elephant's lucky numbers. Let us remind you that lucky numbers are positive integers whose decimal representation only contains lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. Roma's got *n* positive integers. He wonders, how many of those integers have not more than *k* lucky digits? Help him, write the program that solves the problem.
The first line contains two integers *n*, *k* (1<=≤<=*n*,<=*k*<=≤<=100). The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the numbers that Roma has. The numbers in the lines are separated by single spaces.
In a single line print a single integer — the answer to the problem.
[ "3 4\n1 2 4\n", "3 2\n447 44 77\n" ]
[ "3\n", "2\n" ]
In the first sample all numbers contain at most four lucky digits, so the answer is 3. In the second sample number 447 doesn't fit in, as it contains more than two lucky digits. All other numbers are fine, so the answer is 2.
500
[ { "input": "3 4\n1 2 4", "output": "3" }, { "input": "3 2\n447 44 77", "output": "2" }, { "input": "2 2\n507978501 180480073", "output": "2" }, { "input": "9 6\n655243746 167613748 1470546 57644035 176077477 56984809 44677 215706823 369042089", "output": "9" }, { "input": "6 100\n170427799 37215529 675016434 168544291 683447134 950090227", "output": "6" }, { "input": "4 2\n194041605 706221269 69909135 257655784", "output": "3" }, { "input": "4 2\n9581849 67346651 530497 272158241", "output": "4" }, { "input": "3 47\n378261451 163985731 230342101", "output": "3" }, { "input": "2 3\n247776868 480572137", "output": "1" }, { "input": "7 77\n366496749 549646417 278840199 119255907 33557677 379268590 150378796", "output": "7" }, { "input": "40 31\n32230963 709031779 144328646 513494529 36547831 416998222 84161665 318773941 170724397 553666286 368402971 48581613 31452501 368026285 47903381 939151438 204145360 189920160 288159400 133145006 314295423 450219949 160203213 358403181 478734385 29331901 31051111 110710191 567314089 139695685 111511396 87708701 317333277 103301481 110400517 634446253 481551313 39202255 105948 738066085", "output": "40" }, { "input": "1 8\n55521105", "output": "1" }, { "input": "49 3\n34644511 150953622 136135827 144208961 359490601 86708232 719413689 188605873 64330753 488776302 104482891 63360106 437791390 46521319 70778345 339141601 136198441 292941209 299339510 582531183 555958105 437904637 74219097 439816011 236010407 122674666 438442529 186501223 63932449 407678041 596993853 92223251 849265278 480265849 30983497 330283357 186901672 20271344 794252593 123774176 27851201 52717531 479907210 196833889 149331196 82147847 255966471 278600081 899317843", "output": "44" }, { "input": "26 2\n330381357 185218042 850474297 483015466 296129476 1205865 538807493 103205601 160403321 694220263 416255901 7245756 507755361 88187633 91426751 1917161 58276681 59540376 576539745 595950717 390256887 105690055 607818885 28976353 488947089 50643601", "output": "22" }, { "input": "38 1\n194481717 126247087 815196361 106258801 381703249 283859137 15290101 40086151 213688513 577996947 513899717 371428417 107799271 11136651 5615081 323386401 381128815 34217126 17709913 520702093 201694245 570931849 169037023 417019726 282437316 7417126 271667553 11375851 185087449 410130883 383045677 5764771 905017051 328584026 215330671 299553233 15838255 234532105", "output": "20" }, { "input": "44 9\n683216389 250581469 130029957 467020047 188395565 206237982 63257361 68314981 732878407 563579660 199133851 53045209 665723851 16273169 10806790 556633156 350593410 474645249 478790761 708234243 71841230 18090541 19836685 146373571 17947452 534010506 46933264 377035021 311636557 75193963 54321761 12759959 71120181 548816939 23608621 31876417 107672995 72575155 369667956 20574379 210596751 532163173 75726739 853719629", "output": "44" }, { "input": "8 6\n204157376 10514197 65483881 347219841 263304577 296402721 11739011 229776191", "output": "8" }, { "input": "38 29\n333702889 680931737 61137217 203030505 68728281 11414209 642645708 590904616 3042901 607198177 189041074 700764043 813035201 198341461 126403544 401436841 420826465 45046581 20249976 46978855 46397957 706610773 24701041 57954481 51603266 593109701 385569073 178982291 582152863 287317968 1474090 34825141 432421977 130257781 151516903 540852403 548392 117246529", "output": "38" }, { "input": "19 3\n562569697 549131571 50676718 84501863 74567295 702372009 365895280 451459937 40378543 167666701 158635641 53639293 442332661 825055617 100109161 326616021 862332843 533271196 4791547", "output": "18" }, { "input": "1 1\n44", "output": "0" }, { "input": "1 1\n4", "output": "1" }, { "input": "10 3\n444 447 774 777 7777 4447 4 7 7 4", "output": "8" } ]
1,679,244,748
2,147,483,647
Python 3
OK
TESTS
34
62
0
x=input().split(" ") n,k=x count=0 y=input().split(" ") for i in y: counter=0 for j in i: if "4"==j: counter+=1 elif "7"==j: counter+=1 if counter<=int(k): count+=1 print(count)
Title: Roma and Lucky Numbers Time Limit: None seconds Memory Limit: None megabytes Problem Description: Roma (a popular Russian name that means 'Roman') loves the Little Lvov Elephant's lucky numbers. Let us remind you that lucky numbers are positive integers whose decimal representation only contains lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. Roma's got *n* positive integers. He wonders, how many of those integers have not more than *k* lucky digits? Help him, write the program that solves the problem. Input Specification: The first line contains two integers *n*, *k* (1<=≤<=*n*,<=*k*<=≤<=100). The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the numbers that Roma has. The numbers in the lines are separated by single spaces. Output Specification: In a single line print a single integer — the answer to the problem. Demo Input: ['3 4\n1 2 4\n', '3 2\n447 44 77\n'] Demo Output: ['3\n', '2\n'] Note: In the first sample all numbers contain at most four lucky digits, so the answer is 3. In the second sample number 447 doesn't fit in, as it contains more than two lucky digits. All other numbers are fine, so the answer is 2.
```python x=input().split(" ") n,k=x count=0 y=input().split(" ") for i in y: counter=0 for j in i: if "4"==j: counter+=1 elif "7"==j: counter+=1 if counter<=int(k): count+=1 print(count) ```
3
682
B
Alyona and Mex
PROGRAMMING
1,200
[ "sortings" ]
null
null
Someone gave Alyona an array containing *n* positive integers *a*1,<=*a*2,<=...,<=*a**n*. In one operation, Alyona can choose any element of the array and decrease it, i.e. replace with any positive integer that is smaller than the current one. Alyona can repeat this operation as many times as she wants. In particular, she may not apply any operation to the array at all. Formally, after applying some operations Alyona will get an array of *n* positive integers *b*1,<=*b*2,<=...,<=*b**n* such that 1<=≤<=*b**i*<=≤<=*a**i* for every 1<=≤<=*i*<=≤<=*n*. Your task is to determine the maximum possible value of mex of this array. Mex of an array in this problem is the minimum positive integer that doesn't appear in this array. For example, mex of the array containing 1, 3 and 4 is equal to 2, while mex of the array containing 2, 3 and 2 is equal to 1.
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of elements in the Alyona's array. The second line of the input contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array.
Print one positive integer — the maximum possible value of mex of the array after Alyona applies some (possibly none) operations.
[ "5\n1 3 3 3 6\n", "2\n2 1\n" ]
[ "5\n", "3\n" ]
In the first sample case if one will decrease the second element value to 2 and the fifth element value to 4 then the mex value of resulting array 1 2 3 3 4 will be equal to 5. To reach the answer to the second sample case one must not decrease any of the array elements.
1,000
[ { "input": "5\n1 3 3 3 6", "output": "5" }, { "input": "2\n2 1", "output": "3" }, { "input": "1\n1", "output": "2" }, { "input": "1\n1000000000", "output": "2" }, { "input": "1\n2", "output": "2" }, { "input": "2\n1 1", "output": "2" }, { "input": "2\n1 3", "output": "3" }, { "input": "2\n2 2", "output": "3" }, { "input": "2\n2 3", "output": "3" }, { "input": "2\n3 3", "output": "3" }, { "input": "3\n1 1 1", "output": "2" }, { "input": "3\n2 1 1", "output": "3" }, { "input": "3\n3 1 1", "output": "3" }, { "input": "3\n1 1 4", "output": "3" }, { "input": "3\n2 1 2", "output": "3" }, { "input": "3\n3 2 1", "output": "4" }, { "input": "3\n2 4 1", "output": "4" }, { "input": "3\n3 3 1", "output": "4" }, { "input": "3\n1 3 4", "output": "4" }, { "input": "3\n4 1 4", "output": "4" }, { "input": "3\n2 2 2", "output": "3" }, { "input": "3\n3 2 2", "output": "4" }, { "input": "3\n4 2 2", "output": "4" }, { "input": "3\n2 3 3", "output": "4" }, { "input": "3\n4 2 3", "output": "4" }, { "input": "3\n4 4 2", "output": "4" }, { "input": "3\n3 3 3", "output": "4" }, { "input": "3\n4 3 3", "output": "4" }, { "input": "3\n4 3 4", "output": "4" }, { "input": "3\n4 4 4", "output": "4" }, { "input": "4\n1 1 1 1", "output": "2" }, { "input": "4\n1 1 2 1", "output": "3" }, { "input": "4\n1 1 3 1", "output": "3" }, { "input": "4\n1 4 1 1", "output": "3" }, { "input": "4\n1 2 1 2", "output": "3" }, { "input": "4\n1 3 2 1", "output": "4" }, { "input": "4\n2 1 4 1", "output": "4" }, { "input": "4\n3 3 1 1", "output": "4" }, { "input": "4\n1 3 4 1", "output": "4" }, { "input": "4\n1 1 4 4", "output": "4" }, { "input": "4\n2 2 2 1", "output": "3" }, { "input": "4\n1 2 2 3", "output": "4" }, { "input": "4\n2 4 1 2", "output": "4" }, { "input": "4\n3 3 1 2", "output": "4" }, { "input": "4\n2 3 4 1", "output": "5" }, { "input": "4\n1 4 2 4", "output": "5" }, { "input": "4\n3 1 3 3", "output": "4" }, { "input": "4\n3 4 3 1", "output": "5" }, { "input": "4\n1 4 4 3", "output": "5" }, { "input": "4\n4 1 4 4", "output": "5" }, { "input": "4\n2 2 2 2", "output": "3" }, { "input": "4\n2 2 3 2", "output": "4" }, { "input": "4\n2 2 2 4", "output": "4" }, { "input": "4\n2 2 3 3", "output": "4" }, { "input": "4\n2 2 3 4", "output": "5" }, { "input": "4\n2 4 4 2", "output": "5" }, { "input": "4\n2 3 3 3", "output": "4" }, { "input": "4\n2 4 3 3", "output": "5" }, { "input": "4\n4 4 2 3", "output": "5" }, { "input": "4\n4 4 4 2", "output": "5" }, { "input": "4\n3 3 3 3", "output": "4" }, { "input": "4\n3 3 3 4", "output": "5" }, { "input": "4\n4 3 3 4", "output": "5" }, { "input": "4\n4 4 3 4", "output": "5" }, { "input": "4\n4 4 4 4", "output": "5" }, { "input": "11\n1 1 1 1 1 1 1 1 1 3 3", "output": "4" }, { "input": "20\n1 1 1 1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8", "output": "9" }, { "input": "4\n2 2 2 3", "output": "4" }, { "input": "3\n1 1 2", "output": "3" }, { "input": "15\n1 2 2 20 23 25 28 60 66 71 76 77 79 99 100", "output": "15" }, { "input": "7\n1 2 2 2 5 5 1", "output": "5" }, { "input": "4\n1 1 1 2", "output": "3" }, { "input": "5\n1 1 1 1 10000", "output": "3" }, { "input": "5\n1 1 1 1 2", "output": "3" }, { "input": "7\n1 3 3 3 3 3 6", "output": "5" }, { "input": "4\n1 1 1 3", "output": "3" }, { "input": "10\n1 1 1 1 1 1 1 1 1 100", "output": "3" }, { "input": "4\n1 1 2 2", "output": "3" }, { "input": "5\n1 1 1 3 4", "output": "4" }, { "input": "8\n1 1 1 1 2 2 3 40", "output": "5" }, { "input": "5\n1 1 1 1 1", "output": "2" }, { "input": "7\n1 2 2 2 2 2 4", "output": "4" }, { "input": "10\n1 1 1 10000000 10000000 10000000 10000000 10000000 10000000 10000000", "output": "9" }, { "input": "10\n1 1 1 1 1 1 1 1 2 3", "output": "4" }, { "input": "4\n8 8 8 8", "output": "5" }, { "input": "5\n5 6 6 6 7", "output": "6" } ]
1,617,203,616
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
5
62
0
n = int(input()) l = list(map(int, input().rstrip().split())) l.sort() ans = [0] * (n + 1) cu = n ex = 0 j = 1 for i in range(n): if l[i] >= j: j += 1 else: print(j+1) exit() if i != 0 and l[i] > j: l[i] = j print(n + 1)
Title: Alyona and Mex Time Limit: None seconds Memory Limit: None megabytes Problem Description: Someone gave Alyona an array containing *n* positive integers *a*1,<=*a*2,<=...,<=*a**n*. In one operation, Alyona can choose any element of the array and decrease it, i.e. replace with any positive integer that is smaller than the current one. Alyona can repeat this operation as many times as she wants. In particular, she may not apply any operation to the array at all. Formally, after applying some operations Alyona will get an array of *n* positive integers *b*1,<=*b*2,<=...,<=*b**n* such that 1<=≤<=*b**i*<=≤<=*a**i* for every 1<=≤<=*i*<=≤<=*n*. Your task is to determine the maximum possible value of mex of this array. Mex of an array in this problem is the minimum positive integer that doesn't appear in this array. For example, mex of the array containing 1, 3 and 4 is equal to 2, while mex of the array containing 2, 3 and 2 is equal to 1. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of elements in the Alyona's array. The second line of the input contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array. Output Specification: Print one positive integer — the maximum possible value of mex of the array after Alyona applies some (possibly none) operations. Demo Input: ['5\n1 3 3 3 6\n', '2\n2 1\n'] Demo Output: ['5\n', '3\n'] Note: In the first sample case if one will decrease the second element value to 2 and the fifth element value to 4 then the mex value of resulting array 1 2 3 3 4 will be equal to 5. To reach the answer to the second sample case one must not decrease any of the array elements.
```python n = int(input()) l = list(map(int, input().rstrip().split())) l.sort() ans = [0] * (n + 1) cu = n ex = 0 j = 1 for i in range(n): if l[i] >= j: j += 1 else: print(j+1) exit() if i != 0 and l[i] > j: l[i] = j print(n + 1) ```
0
231
A
Team
PROGRAMMING
800
[ "brute force", "greedy" ]
null
null
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution. This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Print a single integer — the number of problems the friends will implement on the contest.
[ "3\n1 1 0\n1 1 1\n1 0 0\n", "2\n1 0 0\n0 1 1\n" ]
[ "2\n", "1\n" ]
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it. In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
500
[ { "input": "3\n1 1 0\n1 1 1\n1 0 0", "output": "2" }, { "input": "2\n1 0 0\n0 1 1", "output": "1" }, { "input": "1\n1 0 0", "output": "0" }, { "input": "2\n1 0 0\n1 1 1", "output": "1" }, { "input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0", "output": "1" }, { "input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0", "output": "4" }, { "input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1", "output": "10" }, { "input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1", "output": "29" }, { "input": "1\n1 1 1", "output": "1" }, { "input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1", "output": "4" }, { "input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1", "output": "16" } ]
1,696,265,499
2,147,483,647
PyPy 3
COMPILATION_ERROR
TESTS
0
0
0
n=int(input()) def conter(ch): n1=0 n=0 for i in range (len(ch)): if ch[i]!=" ": if ch[i]=='1': n1+=1 else: n0+=1 return str(n0)+'.'+str(n1) x=0 for i in range (n): ch=input() c=conter(ch) n0=int(c[:c.find('.')]) n1=int(c[c.find('.')+1:]) if n1>n0: x+=1 print(x)
Title: Team Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution. This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution. Input Specification: The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces. Output Specification: Print a single integer — the number of problems the friends will implement on the contest. Demo Input: ['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n'] Demo Output: ['2\n', '1\n'] Note: In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it. In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
```python n=int(input()) def conter(ch): n1=0 n=0 for i in range (len(ch)): if ch[i]!=" ": if ch[i]=='1': n1+=1 else: n0+=1 return str(n0)+'.'+str(n1) x=0 for i in range (n): ch=input() c=conter(ch) n0=int(c[:c.find('.')]) n1=int(c[c.find('.')+1:]) if n1>n0: x+=1 print(x) ```
-1
2
B
The least round way
PROGRAMMING
2,000
[ "dp", "math" ]
B. The least round way
2
64
There is a square matrix *n*<=×<=*n*, consisting of non-negative integer numbers. You should find such a way on it that - starts in the upper left cell of the matrix; - each following cell is to the right or down from the current cell; - the way ends in the bottom right cell. Moreover, if we multiply together all the numbers along the way, the result should be the least "round". In other words, it should end in the least possible number of zeros.
The first line contains an integer number *n* (2<=≤<=*n*<=≤<=1000), *n* is the size of the matrix. Then follow *n* lines containing the matrix elements (non-negative integer numbers not exceeding 109).
In the first line print the least number of trailing zeros. In the second line print the correspondent way itself.
[ "3\n1 2 3\n4 5 6\n7 8 9\n" ]
[ "0\nDDRR\n" ]
none
0
[ { "input": "3\n1 2 3\n4 5 6\n7 8 9", "output": "0\nDDRR" }, { "input": "2\n7 6\n3 8", "output": "0\nDR" }, { "input": "3\n4 10 5\n10 9 4\n6 5 3", "output": "1\nDRRD" }, { "input": "4\n1 1 9 9\n3 4 7 3\n7 9 1 7\n1 7 1 5", "output": "0\nDDDRRR" }, { "input": "5\n8 3 2 1 4\n3 7 2 4 8\n9 2 8 9 10\n2 3 6 10 1\n8 2 2 8 4", "output": "0\nDDDDRRRR" }, { "input": "6\n5 5 4 10 5 5\n7 10 8 7 6 6\n7 1 7 9 7 8\n5 5 3 3 10 9\n5 8 10 6 3 8\n3 10 5 4 3 4", "output": "1\nDDRRDRDDRR" }, { "input": "7\n2 9 8 2 7 4 8\n9 5 4 4 8 5 3\n5 7 2 10 8 1 8\n2 7 10 7 5 7 7\n9 2 7 6 4 8 4\n7 2 4 7 4 1 8\n9 5 3 10 1 6 2", "output": "0\nRRDRRDRDDDDR" }, { "input": "8\n1 1 10 1 8 4 8 7\n9 3 3 2 2 6 2 4\n7 4 3 5 10 3 5 1\n8 4 4 10 4 5 9 4\n5 5 5 2 6 7 1 8\n4 10 1 3 2 4 8 3\n8 1 10 2 8 2 2 4\n2 10 6 8 10 2 8 4", "output": "0\nDRRRRRRRDDDDDD" }, { "input": "9\n8 3 3 3 10 3 10 5 6\n2 1 6 1 8 1 9 1 6\n6 1 5 4 2 2 10 4 9\n1 9 1 3 10 6 10 5 5\n1 10 5 4 7 2 5 9 10\n6 6 1 3 1 9 4 9 9\n5 3 7 6 4 6 2 10 2\n9 3 3 10 5 6 7 6 4\n4 9 6 7 4 3 7 6 5", "output": "1\nDDDDDRDDDRRRRRRR" }, { "input": "10\n10 8 6 5 9 8 2 5 3 2\n3 1 8 6 8 10 5 5 7 8\n5 9 7 7 4 9 7 2 5 2\n5 9 9 5 4 2 6 6 8 1\n10 6 9 9 10 5 6 3 5 9\n6 7 10 3 1 4 3 6 7 6\n10 10 4 7 4 4 8 6 7 4\n10 5 8 2 2 7 4 4 1 4\n8 4 6 10 10 6 1 3 3 1\n9 9 7 2 9 5 1 8 6 3", "output": "1\nDRDDDRRDDDRRDRDRRR" } ]
1,439,996,322
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
122
0
def circle(x, i, j): x = str(x) point = -1 answer = 0 while x[point] == '0': answer += 1 point -= 1 return [answer if i >= 0 and j >= 0 else 10 ** 18, int(x), [i, j]] n = int(input()) matrix = [list(map(int, input().split())) for i in range(n)] dp = [[0 for i in range(n)] for j in range(n)] prev = [[0 for i in range(n)] for j in range(n)] for i in range(n): for j in range(n): dp[i][j], matrix[i][j], prev[i][j] = min(circle(matrix[i][j - 1] * matrix[i][j], i, j - 1), circle(matrix[i - 1][j] * matrix[i][j], i - 1, j)) if i > 0 or j > 0 else circle(matrix[i][j], i, j) print(dp[-1][-1]) i, j = n - 1, n - 1 ans = list() while (i != 0 or j != 0): li, lj = i, j i, j = prev[i][j] ans += ['D' if j < lj else 'R'] print(''.join(reversed(ans)))
Title: The least round way Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: There is a square matrix *n*<=×<=*n*, consisting of non-negative integer numbers. You should find such a way on it that - starts in the upper left cell of the matrix; - each following cell is to the right or down from the current cell; - the way ends in the bottom right cell. Moreover, if we multiply together all the numbers along the way, the result should be the least "round". In other words, it should end in the least possible number of zeros. Input Specification: The first line contains an integer number *n* (2<=≤<=*n*<=≤<=1000), *n* is the size of the matrix. Then follow *n* lines containing the matrix elements (non-negative integer numbers not exceeding 109). Output Specification: In the first line print the least number of trailing zeros. In the second line print the correspondent way itself. Demo Input: ['3\n1 2 3\n4 5 6\n7 8 9\n'] Demo Output: ['0\nDDRR\n'] Note: none
```python def circle(x, i, j): x = str(x) point = -1 answer = 0 while x[point] == '0': answer += 1 point -= 1 return [answer if i >= 0 and j >= 0 else 10 ** 18, int(x), [i, j]] n = int(input()) matrix = [list(map(int, input().split())) for i in range(n)] dp = [[0 for i in range(n)] for j in range(n)] prev = [[0 for i in range(n)] for j in range(n)] for i in range(n): for j in range(n): dp[i][j], matrix[i][j], prev[i][j] = min(circle(matrix[i][j - 1] * matrix[i][j], i, j - 1), circle(matrix[i - 1][j] * matrix[i][j], i - 1, j)) if i > 0 or j > 0 else circle(matrix[i][j], i, j) print(dp[-1][-1]) i, j = n - 1, n - 1 ans = list() while (i != 0 or j != 0): li, lj = i, j i, j = prev[i][j] ans += ['D' if j < lj else 'R'] print(''.join(reversed(ans))) ```
0
447
A
DZY Loves Hash
PROGRAMMING
800
[ "implementation" ]
null
null
DZY has a hash table with *p* buckets, numbered from 0 to *p*<=-<=1. He wants to insert *n* numbers, in the order they are given, into the hash table. For the *i*-th number *x**i*, DZY will put it into the bucket numbered *h*(*x**i*), where *h*(*x*) is the hash function. In this problem we will assume, that *h*(*x*)<==<=*x* *mod* *p*. Operation *a* *mod* *b* denotes taking a remainder after division *a* by *b*. However, each bucket can contain no more than one element. If DZY wants to insert an number into a bucket which is already filled, we say a "conflict" happens. Suppose the first conflict happens right after the *i*-th insertion, you should output *i*. If no conflict happens, just output -1.
The first line contains two integers, *p* and *n* (2<=≤<=*p*,<=*n*<=≤<=300). Then *n* lines follow. The *i*-th of them contains an integer *x**i* (0<=≤<=*x**i*<=≤<=109).
Output a single integer — the answer to the problem.
[ "10 5\n0\n21\n53\n41\n53\n", "5 5\n0\n1\n2\n3\n4\n" ]
[ "4\n", "-1\n" ]
none
500
[ { "input": "10 5\n0\n21\n53\n41\n53", "output": "4" }, { "input": "5 5\n0\n1\n2\n3\n4", "output": "-1" }, { "input": "10 6\n811966798\n734823552\n790326404\n929189974\n414343256\n560346537", "output": "4" }, { "input": "2 2\n788371161\n801743052", "output": "-1" }, { "input": "10 6\n812796223\n122860157\n199259103\n597650585\n447742024\n521549402", "output": "3" }, { "input": "300 2\n822454942\n119374431", "output": "-1" }, { "input": "300 2\n823284367\n507345500", "output": "-1" }, { "input": "2 5\n791579811\n35613889\n997079893\n878677665\n693717467", "output": "2" }, { "input": "20 5\n793926268\n28931770\n842870287\n974950617\n859404206", "output": "-1" }, { "input": "100 15\n805069249\n778178198\n633897389\n844316223\n146759898\n870527016\n82668754\n42060733\n943602929\n979451110\n746979598\n47406033\n607284062\n850870259\n229415316", "output": "5" }, { "input": "100 15\n806204335\n189490323\n718805086\n716787474\n262315718\n822030596\n894644222\n724054623\n141384399\n579354205\n192622443\n672556242\n97417563\n243354557\n208957882", "output": "8" }, { "input": "100 15\n807033760\n577461392\n275221433\n532633429\n295714486\n783298996\n255799943\n99107143\n729119412\n59302896\n37640015\n313610861\n630550567\n534283052\n681062462", "output": "8" }, { "input": "100 15\n808103310\n136224397\n360129131\n405104681\n263786657\n734802577\n67808179\n928584682\n926900882\n511722343\n483348395\n938695534\n120684068\n74152694\n808088675", "output": "9" }, { "input": "2 2\n2\n2", "output": "2" }, { "input": "300 2\n0\n300", "output": "2" }, { "input": "2 2\n0\n0", "output": "2" } ]
1,406,888,526
2,147,483,647
Python 3
OK
TESTS
29
77
0
l=[] a=-1 p,n=map(int,input().split()) for i in range(n): temp=int(input()) t=temp%p if (t in l) and a==-1: a=i+1 l.append(t) print(a)
Title: DZY Loves Hash Time Limit: None seconds Memory Limit: None megabytes Problem Description: DZY has a hash table with *p* buckets, numbered from 0 to *p*<=-<=1. He wants to insert *n* numbers, in the order they are given, into the hash table. For the *i*-th number *x**i*, DZY will put it into the bucket numbered *h*(*x**i*), where *h*(*x*) is the hash function. In this problem we will assume, that *h*(*x*)<==<=*x* *mod* *p*. Operation *a* *mod* *b* denotes taking a remainder after division *a* by *b*. However, each bucket can contain no more than one element. If DZY wants to insert an number into a bucket which is already filled, we say a "conflict" happens. Suppose the first conflict happens right after the *i*-th insertion, you should output *i*. If no conflict happens, just output -1. Input Specification: The first line contains two integers, *p* and *n* (2<=≤<=*p*,<=*n*<=≤<=300). Then *n* lines follow. The *i*-th of them contains an integer *x**i* (0<=≤<=*x**i*<=≤<=109). Output Specification: Output a single integer — the answer to the problem. Demo Input: ['10 5\n0\n21\n53\n41\n53\n', '5 5\n0\n1\n2\n3\n4\n'] Demo Output: ['4\n', '-1\n'] Note: none
```python l=[] a=-1 p,n=map(int,input().split()) for i in range(n): temp=int(input()) t=temp%p if (t in l) and a==-1: a=i+1 l.append(t) print(a) ```
3
929
B
Места в самолёте
PROGRAMMING
1,300
[ "*special", "implementation" ]
null
null
В самолёте есть *n* рядов мест. Если смотреть на ряды сверху, то в каждом ряду есть 3 места слева, затем проход между рядами, затем 4 центральных места, затем ещё один проход между рядами, а затем ещё 3 места справа. Известно, что некоторые места уже заняты пассажирами. Всего есть два вида пассажиров — статусные (те, которые часто летают) и обычные. Перед вами стоит задача рассадить ещё *k* обычных пассажиров так, чтобы суммарное число соседей у статусных пассажиров было минимально возможным. Два пассажира считаются соседями, если они сидят в одном ряду и между ними нет других мест и прохода между рядами. Если пассажир является соседним пассажиром для двух статусных пассажиров, то его следует учитывать в сумме соседей дважды.
В первой строке следуют два целых числа *n* и *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=10·*n*) — количество рядов мест в самолёте и количество пассажиров, которых нужно рассадить. Далее следует описание рядов мест самолёта по одному ряду в строке. Если очередной символ равен '-', то это проход между рядами. Если очередной символ равен '.', то это свободное место. Если очередной символ равен 'S', то на текущем месте будет сидеть статусный пассажир. Если очередной символ равен 'P', то на текущем месте будет сидеть обычный пассажир. Гарантируется, что количество свободных мест не меньше *k*. Гарантируется, что все ряды удовлетворяют описанному в условии формату.
В первую строку выведите минимальное суммарное число соседей у статусных пассажиров. Далее выведите план рассадки пассажиров, который минимизирует суммарное количество соседей у статусных пассажиров, в том же формате, что и во входных данных. Если в свободное место нужно посадить одного из *k* пассажиров, выведите строчную букву 'x' вместо символа '.'.
[ "1 2\nSP.-SS.S-S.S\n", "4 9\nPP.-PPPS-S.S\nPSP-PPSP-.S.\n.S.-S..P-SS.\nP.S-P.PP-PSP\n" ]
[ "5\nSPx-SSxS-S.S\n", "15\nPPx-PPPS-S.S\nPSP-PPSP-xSx\nxSx-SxxP-SSx\nP.S-PxPP-PSP\n" ]
В первом примере нужно посадить ещё двух обычных пассажиров. Для минимизации соседей у статусных пассажиров, нужно посадить первого из них на третье слева место, а второго на любое из оставшихся двух мест, так как независимо от выбора места он станет соседом двух статусных пассажиров. Изначально, у статусного пассажира, который сидит на самом левом месте уже есть сосед. Также на четвёртом и пятом местах слева сидят статусные пассажиры, являющиеся соседями друг для друга (что добавляет к сумме 2). Таким образом, после посадки ещё двух обычных пассажиров, итоговое суммарное количество соседей у статусных пассажиров станет равно пяти.
1,000
[ { "input": "1 2\nSP.-SS.S-S.S", "output": "5\nSPx-SSxS-S.S" }, { "input": "4 9\nPP.-PPPS-S.S\nPSP-PPSP-.S.\n.S.-S..P-SS.\nP.S-P.PP-PSP", "output": "15\nPPx-PPPS-S.S\nPSP-PPSP-xSx\nxSx-SxxP-SSx\nP.S-PxPP-PSP" }, { "input": "3 7\n.S.-SSSP-..S\nS..-.SPP-S.P\n.S.-PPPP-PSP", "output": "13\nxSx-SSSP-xxS\nSxx-xSPP-S.P\n.S.-PPPP-PSP" }, { "input": "5 6\nPP.-PS.P-P..\nPPS-SP..-P.P\nP.P-....-S..\nSPP-.P.S-.S.\nSP.-S.PS-PPP", "output": "6\nPPx-PS.P-Pxx\nPPS-SPxx-PxP\nP.P-....-S..\nSPP-.P.S-.S.\nSP.-S.PS-PPP" }, { "input": "1 1\n..S-PS..-.PP", "output": "1\nx.S-PS..-.PP" }, { "input": "2 2\nPP.-S.SS-.S.\nSSP-SSSS-S.S", "output": "12\nPPx-S.SS-xS.\nSSP-SSSS-S.S" }, { "input": "30 1\nPPP-PPP.-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP", "output": "0\nPPP-PPPx-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP" }, { "input": "1 1\nSPS-....-P.P", "output": "2\nSPS-x...-P.P" }, { "input": "2 1\nSSS-S.S.-SSS\nSSP-.PP.-S.S", "output": "11\nSSS-S.S.-SSS\nSSP-xPP.-S.S" }, { "input": "30 1\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPP.-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP", "output": "0\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPx-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP\nPPP-PPPP-PPP" } ]
1,520,089,747
84,847
Python 3
OK
TESTS
47
77
6,348,800
n, k = map(int, input().split()) a = b = sits = "" for _ in range(n): sits += "+"+input()+"+" sits = list(sits) length = len(sits) perfect = [] ok = [] bad = [] neighbors = 0 for i in range(length): if sits[i] == "S": a, b = sits[i - 1], sits[i + 1] a, b = sits[i - 1], sits[i + 1] st = "".join([a, b]) neighbors += st.count("S") neighbors += st.count("P") continue if sits[i] != ".": continue a, b = sits[i - 1], sits[i + 1] s = "".join([a, b]).count("S") if s == 0: perfect.append(i) elif s == 1: ok.append(i) else: bad.append(i) for index in perfect: if k <= 0: break sits[index] = "x" k -= 1 for index in ok: if k <= 0: break sits[index] = "x" k -= 1 neighbors += 1 for index in bad: if k <= 0: break sits[index] = "x" k -= 1 neighbors += 2 answer = "".join(sits).split("+") print(neighbors) for item in answer: if item != "": print(item)
Title: Места в самолёте Time Limit: None seconds Memory Limit: None megabytes Problem Description: В самолёте есть *n* рядов мест. Если смотреть на ряды сверху, то в каждом ряду есть 3 места слева, затем проход между рядами, затем 4 центральных места, затем ещё один проход между рядами, а затем ещё 3 места справа. Известно, что некоторые места уже заняты пассажирами. Всего есть два вида пассажиров — статусные (те, которые часто летают) и обычные. Перед вами стоит задача рассадить ещё *k* обычных пассажиров так, чтобы суммарное число соседей у статусных пассажиров было минимально возможным. Два пассажира считаются соседями, если они сидят в одном ряду и между ними нет других мест и прохода между рядами. Если пассажир является соседним пассажиром для двух статусных пассажиров, то его следует учитывать в сумме соседей дважды. Input Specification: В первой строке следуют два целых числа *n* и *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=10·*n*) — количество рядов мест в самолёте и количество пассажиров, которых нужно рассадить. Далее следует описание рядов мест самолёта по одному ряду в строке. Если очередной символ равен '-', то это проход между рядами. Если очередной символ равен '.', то это свободное место. Если очередной символ равен 'S', то на текущем месте будет сидеть статусный пассажир. Если очередной символ равен 'P', то на текущем месте будет сидеть обычный пассажир. Гарантируется, что количество свободных мест не меньше *k*. Гарантируется, что все ряды удовлетворяют описанному в условии формату. Output Specification: В первую строку выведите минимальное суммарное число соседей у статусных пассажиров. Далее выведите план рассадки пассажиров, который минимизирует суммарное количество соседей у статусных пассажиров, в том же формате, что и во входных данных. Если в свободное место нужно посадить одного из *k* пассажиров, выведите строчную букву 'x' вместо символа '.'. Demo Input: ['1 2\nSP.-SS.S-S.S\n', '4 9\nPP.-PPPS-S.S\nPSP-PPSP-.S.\n.S.-S..P-SS.\nP.S-P.PP-PSP\n'] Demo Output: ['5\nSPx-SSxS-S.S\n', '15\nPPx-PPPS-S.S\nPSP-PPSP-xSx\nxSx-SxxP-SSx\nP.S-PxPP-PSP\n'] Note: В первом примере нужно посадить ещё двух обычных пассажиров. Для минимизации соседей у статусных пассажиров, нужно посадить первого из них на третье слева место, а второго на любое из оставшихся двух мест, так как независимо от выбора места он станет соседом двух статусных пассажиров. Изначально, у статусного пассажира, который сидит на самом левом месте уже есть сосед. Также на четвёртом и пятом местах слева сидят статусные пассажиры, являющиеся соседями друг для друга (что добавляет к сумме 2). Таким образом, после посадки ещё двух обычных пассажиров, итоговое суммарное количество соседей у статусных пассажиров станет равно пяти.
```python n, k = map(int, input().split()) a = b = sits = "" for _ in range(n): sits += "+"+input()+"+" sits = list(sits) length = len(sits) perfect = [] ok = [] bad = [] neighbors = 0 for i in range(length): if sits[i] == "S": a, b = sits[i - 1], sits[i + 1] a, b = sits[i - 1], sits[i + 1] st = "".join([a, b]) neighbors += st.count("S") neighbors += st.count("P") continue if sits[i] != ".": continue a, b = sits[i - 1], sits[i + 1] s = "".join([a, b]).count("S") if s == 0: perfect.append(i) elif s == 1: ok.append(i) else: bad.append(i) for index in perfect: if k <= 0: break sits[index] = "x" k -= 1 for index in ok: if k <= 0: break sits[index] = "x" k -= 1 neighbors += 1 for index in bad: if k <= 0: break sits[index] = "x" k -= 1 neighbors += 2 answer = "".join(sits).split("+") print(neighbors) for item in answer: if item != "": print(item) ```
3
242
C
King's Path
PROGRAMMING
1,800
[ "dfs and similar", "graphs", "hashing", "shortest paths" ]
null
null
The black king is standing on a chess field consisting of 109 rows and 109 columns. We will consider the rows of the field numbered with integers from 1 to 109 from top to bottom. The columns are similarly numbered with integers from 1 to 109 from left to right. We will denote a cell of the field that is located in the *i*-th row and *j*-th column as (*i*,<=*j*). You know that some squares of the given chess field are allowed. All allowed cells of the chess field are given as *n* segments. Each segment is described by three integers *r**i*,<=*a**i*,<=*b**i* (*a**i*<=≤<=*b**i*), denoting that cells in columns from number *a**i* to number *b**i* inclusive in the *r**i*-th row are allowed. Your task is to find the minimum number of moves the king needs to get from square (*x*0,<=*y*0) to square (*x*1,<=*y*1), provided that he only moves along the allowed cells. In other words, the king can be located only on allowed cells on his way. Let us remind you that a chess king can move to any of the neighboring cells in one move. Two cells of a chess field are considered neighboring if they share at least one point.
The first line contains four space-separated integers *x*0,<=*y*0,<=*x*1,<=*y*1 (1<=≤<=*x*0,<=*y*0,<=*x*1,<=*y*1<=≤<=109), denoting the initial and the final positions of the king. The second line contains a single integer *n* (1<=≤<=*n*<=≤<=105), denoting the number of segments of allowed cells. Next *n* lines contain the descriptions of these segments. The *i*-th line contains three space-separated integers *r**i*,<=*a**i*,<=*b**i* (1<=≤<=*r**i*,<=*a**i*,<=*b**i*<=≤<=109,<=*a**i*<=≤<=*b**i*), denoting that cells in columns from number *a**i* to number *b**i* inclusive in the *r**i*-th row are allowed. Note that the segments of the allowed cells can intersect and embed arbitrarily. It is guaranteed that the king's initial and final position are allowed cells. It is guaranteed that the king's initial and the final positions do not coincide. It is guaranteed that the total length of all given segments doesn't exceed 105.
If there is no path between the initial and final position along allowed cells, print -1. Otherwise print a single integer — the minimum number of moves the king needs to get from the initial position to the final one.
[ "5 7 6 11\n3\n5 3 8\n6 7 11\n5 2 5\n", "3 4 3 10\n3\n3 1 4\n4 5 9\n3 10 10\n", "1 1 2 10\n2\n1 1 3\n2 6 10\n" ]
[ "4\n", "6\n", "-1\n" ]
none
1,500
[ { "input": "5 7 6 11\n3\n5 3 8\n6 7 11\n5 2 5", "output": "4" }, { "input": "3 4 3 10\n3\n3 1 4\n4 5 9\n3 10 10", "output": "6" }, { "input": "1 1 2 10\n2\n1 1 3\n2 6 10", "output": "-1" }, { "input": "9 8 7 8\n9\n10 6 6\n10 6 6\n7 7 8\n9 5 6\n8 9 9\n9 5 5\n9 8 8\n8 5 6\n9 10 10", "output": "2" }, { "input": "6 15 7 15\n9\n6 15 15\n7 14 14\n6 15 15\n9 14 14\n7 14 16\n6 15 15\n6 15 15\n7 14 14\n8 15 15", "output": "1" }, { "input": "13 16 20 10\n18\n13 16 16\n20 10 10\n19 10 10\n12 15 15\n20 10 10\n18 11 11\n19 10 10\n19 10 10\n20 10 10\n19 10 10\n20 10 10\n20 10 10\n19 10 10\n18 11 11\n13 16 16\n12 15 15\n19 10 10\n19 10 10", "output": "-1" }, { "input": "89 29 88 30\n16\n87 31 31\n14 95 95\n98 88 89\n96 88 88\n14 97 97\n13 97 98\n100 88 88\n88 32 32\n99 88 89\n90 29 29\n87 31 31\n15 94 96\n89 29 29\n88 32 32\n97 89 89\n88 29 30", "output": "1" }, { "input": "30 14 39 19\n31\n35 7 11\n37 11 12\n32 13 13\n37 5 6\n46 13 13\n37 14 14\n31 13 13\n43 13 19\n45 15 19\n46 13 13\n32 17 17\n41 14 19\n30 14 14\n43 13 17\n34 16 18\n44 11 19\n38 13 13\n40 12 20\n37 16 18\n46 16 18\n34 10 14\n36 9 10\n36 15 19\n38 15 19\n42 13 19\n33 14 15\n35 15 19\n33 17 18\n39 12 20\n36 5 7\n45 12 12", "output": "9" }, { "input": "2 1 1 1\n2\n1 1 2\n2 1 2", "output": "1" }, { "input": "1 1 1 2\n5\n1000000000 1 10000\n19920401 1188 5566\n1000000000 1 10000\n1 1 10000\n5 100 200", "output": "1" }, { "input": "1 1 1000000000 2\n5\n1000000000 1 10000\n19920401 1188 5566\n1000000000 1 10000\n1 1 10000\n5 100 200", "output": "-1" } ]
1,658,395,390
2,147,483,647
PyPy 3-64
OK
TESTS
43
1,902
32,358,400
import sys import math import collections import heapq input=sys.stdin.readline x0,y0,x1,y1=(int(i) for i in input().split()) n=int(input()) d1={} for i in range(n): r,a,b=(int(i) for i in input().split()) for i in range(a,b+1): d1[(r,i)]=1 vis={} c=0 c1=-1 queue=[[x0,y0,0]] vis[(x0,y0)]=1 while(queue!=[]): s=queue.pop(0) if(s[0]==x1 and s[1]==y1): c1=1 c=s[2] break else: if(s[0]-1>0 and (s[0]-1,s[1]) not in vis and (s[0]-1,s[1]) in d1): vis[(s[0]-1,s[1])]=1 queue.append([s[0]-1,s[1],s[2]+1]) if(s[1]-1>0 and (s[0],s[1]-1) not in vis and (s[0],s[1]-1) in d1): vis[(s[0],s[1]-1)]=1 queue.append([s[0],s[1]-1,s[2]+1]) if(s[0]+1<1000000001 and (s[0]+1,s[1]) not in vis and (s[0]+1,s[1]) in d1): vis[(s[0]+1,s[1])]=1 queue.append([s[0]+1,s[1],s[2]+1]) if(s[1]+1<1000000001 and (s[0],s[1]+1) not in vis and (s[0],s[1]+1) in d1): vis[(s[0],s[1]+1)]=1 queue.append([s[0],s[1]+1,s[2]+1]) if(s[0]-1>0 and s[1]-1>0 and (s[0]-1,s[1]-1) not in vis and (s[0]-1,s[1]-1) in d1): vis[(s[0]-1,s[1]-1)]=1 queue.append([s[0]-1,s[1]-1,s[2]+1]) if(s[0]-1>0 and s[1]+1<1000000001 and (s[0]-1,s[1]+1) not in vis and (s[0]-1,s[1]+1) in d1): vis[(s[0]-1,s[1]+1)]=1 queue.append([s[0]-1,s[1]+1,s[2]+1]) if(s[0]+1<1000000001 and s[1]-1>0 and (s[0]+1,s[1]-1) not in vis and (s[0]+1,s[1]-1) in d1): vis[(s[0]+1,s[1]-1)]=1 queue.append([s[0]+1,s[1]-1,s[2]+1]) if(s[0]+1<1000000001 and s[1]+1<1000000001 and (s[0]+1,s[1]+1) not in vis and (s[0]+1,s[1]+1) in d1): vis[(s[0]+1,s[1]+1)]=1 queue.append([s[0]+1,s[1]+1,s[2]+1]) if(c1==-1): print(c1) else: print(c)
Title: King's Path Time Limit: None seconds Memory Limit: None megabytes Problem Description: The black king is standing on a chess field consisting of 109 rows and 109 columns. We will consider the rows of the field numbered with integers from 1 to 109 from top to bottom. The columns are similarly numbered with integers from 1 to 109 from left to right. We will denote a cell of the field that is located in the *i*-th row and *j*-th column as (*i*,<=*j*). You know that some squares of the given chess field are allowed. All allowed cells of the chess field are given as *n* segments. Each segment is described by three integers *r**i*,<=*a**i*,<=*b**i* (*a**i*<=≤<=*b**i*), denoting that cells in columns from number *a**i* to number *b**i* inclusive in the *r**i*-th row are allowed. Your task is to find the minimum number of moves the king needs to get from square (*x*0,<=*y*0) to square (*x*1,<=*y*1), provided that he only moves along the allowed cells. In other words, the king can be located only on allowed cells on his way. Let us remind you that a chess king can move to any of the neighboring cells in one move. Two cells of a chess field are considered neighboring if they share at least one point. Input Specification: The first line contains four space-separated integers *x*0,<=*y*0,<=*x*1,<=*y*1 (1<=≤<=*x*0,<=*y*0,<=*x*1,<=*y*1<=≤<=109), denoting the initial and the final positions of the king. The second line contains a single integer *n* (1<=≤<=*n*<=≤<=105), denoting the number of segments of allowed cells. Next *n* lines contain the descriptions of these segments. The *i*-th line contains three space-separated integers *r**i*,<=*a**i*,<=*b**i* (1<=≤<=*r**i*,<=*a**i*,<=*b**i*<=≤<=109,<=*a**i*<=≤<=*b**i*), denoting that cells in columns from number *a**i* to number *b**i* inclusive in the *r**i*-th row are allowed. Note that the segments of the allowed cells can intersect and embed arbitrarily. It is guaranteed that the king's initial and final position are allowed cells. It is guaranteed that the king's initial and the final positions do not coincide. It is guaranteed that the total length of all given segments doesn't exceed 105. Output Specification: If there is no path between the initial and final position along allowed cells, print -1. Otherwise print a single integer — the minimum number of moves the king needs to get from the initial position to the final one. Demo Input: ['5 7 6 11\n3\n5 3 8\n6 7 11\n5 2 5\n', '3 4 3 10\n3\n3 1 4\n4 5 9\n3 10 10\n', '1 1 2 10\n2\n1 1 3\n2 6 10\n'] Demo Output: ['4\n', '6\n', '-1\n'] Note: none
```python import sys import math import collections import heapq input=sys.stdin.readline x0,y0,x1,y1=(int(i) for i in input().split()) n=int(input()) d1={} for i in range(n): r,a,b=(int(i) for i in input().split()) for i in range(a,b+1): d1[(r,i)]=1 vis={} c=0 c1=-1 queue=[[x0,y0,0]] vis[(x0,y0)]=1 while(queue!=[]): s=queue.pop(0) if(s[0]==x1 and s[1]==y1): c1=1 c=s[2] break else: if(s[0]-1>0 and (s[0]-1,s[1]) not in vis and (s[0]-1,s[1]) in d1): vis[(s[0]-1,s[1])]=1 queue.append([s[0]-1,s[1],s[2]+1]) if(s[1]-1>0 and (s[0],s[1]-1) not in vis and (s[0],s[1]-1) in d1): vis[(s[0],s[1]-1)]=1 queue.append([s[0],s[1]-1,s[2]+1]) if(s[0]+1<1000000001 and (s[0]+1,s[1]) not in vis and (s[0]+1,s[1]) in d1): vis[(s[0]+1,s[1])]=1 queue.append([s[0]+1,s[1],s[2]+1]) if(s[1]+1<1000000001 and (s[0],s[1]+1) not in vis and (s[0],s[1]+1) in d1): vis[(s[0],s[1]+1)]=1 queue.append([s[0],s[1]+1,s[2]+1]) if(s[0]-1>0 and s[1]-1>0 and (s[0]-1,s[1]-1) not in vis and (s[0]-1,s[1]-1) in d1): vis[(s[0]-1,s[1]-1)]=1 queue.append([s[0]-1,s[1]-1,s[2]+1]) if(s[0]-1>0 and s[1]+1<1000000001 and (s[0]-1,s[1]+1) not in vis and (s[0]-1,s[1]+1) in d1): vis[(s[0]-1,s[1]+1)]=1 queue.append([s[0]-1,s[1]+1,s[2]+1]) if(s[0]+1<1000000001 and s[1]-1>0 and (s[0]+1,s[1]-1) not in vis and (s[0]+1,s[1]-1) in d1): vis[(s[0]+1,s[1]-1)]=1 queue.append([s[0]+1,s[1]-1,s[2]+1]) if(s[0]+1<1000000001 and s[1]+1<1000000001 and (s[0]+1,s[1]+1) not in vis and (s[0]+1,s[1]+1) in d1): vis[(s[0]+1,s[1]+1)]=1 queue.append([s[0]+1,s[1]+1,s[2]+1]) if(c1==-1): print(c1) else: print(c) ```
3
691
B
s-palindrome
PROGRAMMING
1,600
[ "implementation", "strings" ]
null
null
Let's call a string "s-palindrome" if it is symmetric about the middle of the string. For example, the string "oHo" is "s-palindrome", but the string "aa" is not. The string "aa" is not "s-palindrome", because the second half of it is not a mirror reflection of the first half. You are given a string *s*. Check if the string is "s-palindrome".
The only line contains the string *s* (1<=≤<=|*s*|<=≤<=1000) which consists of only English letters.
Print "TAK" if the string *s* is "s-palindrome" and "NIE" otherwise.
[ "oXoxoXo\n", "bod\n", "ER\n" ]
[ "TAK\n", "TAK\n", "NIE\n" ]
none
0
[ { "input": "oXoxoXo", "output": "TAK" }, { "input": "bod", "output": "TAK" }, { "input": "ER", "output": "NIE" }, { "input": "o", "output": "TAK" }, { "input": "a", "output": "NIE" }, { "input": "opo", "output": "NIE" }, { "input": "HCMoxkgbNb", "output": "NIE" }, { "input": "vMhhXCMWDe", "output": "NIE" }, { "input": "iIcamjTRFH", "output": "NIE" }, { "input": "WvoWvvWovW", "output": "TAK" }, { "input": "WXxAdbAxXW", "output": "TAK" }, { "input": "vqMTUUTMpv", "output": "TAK" }, { "input": "iii", "output": "NIE" }, { "input": "AAWW", "output": "NIE" }, { "input": "ss", "output": "NIE" }, { "input": "i", "output": "NIE" }, { "input": "ii", "output": "NIE" }, { "input": "mm", "output": "NIE" }, { "input": "LJ", "output": "NIE" }, { "input": "m", "output": "NIE" }, { "input": "ioi", "output": "NIE" }, { "input": "OA", "output": "NIE" }, { "input": "aaaiaaa", "output": "NIE" }, { "input": "SS", "output": "NIE" }, { "input": "iiii", "output": "NIE" }, { "input": "ssops", "output": "NIE" }, { "input": "ssss", "output": "NIE" }, { "input": "ll", "output": "NIE" }, { "input": "s", "output": "NIE" }, { "input": "bb", "output": "NIE" }, { "input": "uu", "output": "NIE" }, { "input": "ZoZ", "output": "NIE" }, { "input": "mom", "output": "NIE" }, { "input": "uou", "output": "NIE" }, { "input": "u", "output": "NIE" }, { "input": "JL", "output": "NIE" }, { "input": "mOm", "output": "NIE" }, { "input": "llll", "output": "NIE" }, { "input": "ouo", "output": "NIE" }, { "input": "aa", "output": "NIE" }, { "input": "olo", "output": "NIE" }, { "input": "S", "output": "NIE" }, { "input": "lAl", "output": "NIE" }, { "input": "nnnn", "output": "NIE" }, { "input": "ZzZ", "output": "NIE" }, { "input": "bNd", "output": "NIE" }, { "input": "ZZ", "output": "NIE" }, { "input": "oNoNo", "output": "NIE" }, { "input": "l", "output": "NIE" }, { "input": "zz", "output": "NIE" }, { "input": "NON", "output": "NIE" }, { "input": "nn", "output": "NIE" }, { "input": "NoN", "output": "NIE" }, { "input": "sos", "output": "NIE" }, { "input": "lol", "output": "NIE" }, { "input": "mmm", "output": "NIE" }, { "input": "YAiAY", "output": "NIE" }, { "input": "ipIqi", "output": "NIE" }, { "input": "AAA", "output": "TAK" }, { "input": "uoOou", "output": "NIE" }, { "input": "SOS", "output": "NIE" }, { "input": "NN", "output": "NIE" }, { "input": "n", "output": "NIE" }, { "input": "h", "output": "NIE" }, { "input": "blld", "output": "NIE" }, { "input": "ipOqi", "output": "NIE" }, { "input": "pop", "output": "NIE" }, { "input": "BB", "output": "NIE" }, { "input": "OuO", "output": "NIE" }, { "input": "lxl", "output": "NIE" }, { "input": "Z", "output": "NIE" }, { "input": "vvivv", "output": "NIE" }, { "input": "nnnnnnnnnnnnn", "output": "NIE" }, { "input": "AA", "output": "TAK" }, { "input": "t", "output": "NIE" }, { "input": "z", "output": "NIE" }, { "input": "mmmAmmm", "output": "NIE" }, { "input": "qlililp", "output": "NIE" }, { "input": "mpOqm", "output": "NIE" }, { "input": "iiiiiiiiii", "output": "NIE" }, { "input": "BAAAB", "output": "NIE" }, { "input": "UA", "output": "NIE" }, { "input": "mmmmmmm", "output": "NIE" }, { "input": "NpOqN", "output": "NIE" }, { "input": "uOu", "output": "NIE" }, { "input": "uuu", "output": "NIE" }, { "input": "NAMAN", "output": "NIE" }, { "input": "lllll", "output": "NIE" }, { "input": "T", "output": "TAK" }, { "input": "mmmmmmmmmmmmmmmm", "output": "NIE" }, { "input": "AiiA", "output": "NIE" }, { "input": "iOi", "output": "NIE" }, { "input": "lll", "output": "NIE" }, { "input": "N", "output": "NIE" }, { "input": "viv", "output": "NIE" }, { "input": "oiio", "output": "NIE" }, { "input": "AiiiA", "output": "NIE" }, { "input": "NNNN", "output": "NIE" }, { "input": "ixi", "output": "NIE" }, { "input": "AuuA", "output": "NIE" }, { "input": "AAAANANAAAA", "output": "NIE" }, { "input": "mmmmm", "output": "NIE" }, { "input": "oYo", "output": "TAK" }, { "input": "dd", "output": "NIE" }, { "input": "A", "output": "TAK" }, { "input": "ioh", "output": "NIE" }, { "input": "mmmm", "output": "NIE" }, { "input": "uuuu", "output": "NIE" }, { "input": "puq", "output": "NIE" }, { "input": "rrrrrr", "output": "NIE" }, { "input": "c", "output": "NIE" }, { "input": "AbpA", "output": "NIE" }, { "input": "qAq", "output": "NIE" }, { "input": "tt", "output": "NIE" }, { "input": "mnmnm", "output": "NIE" }, { "input": "sss", "output": "NIE" }, { "input": "yy", "output": "NIE" }, { "input": "bob", "output": "NIE" }, { "input": "NAN", "output": "NIE" }, { "input": "mAm", "output": "NIE" }, { "input": "tAt", "output": "NIE" }, { "input": "yAy", "output": "NIE" }, { "input": "zAz", "output": "NIE" }, { "input": "aZ", "output": "NIE" }, { "input": "hh", "output": "NIE" }, { "input": "bbbb", "output": "NIE" }, { "input": "ZAZ", "output": "NIE" }, { "input": "Y", "output": "TAK" }, { "input": "AAMM", "output": "NIE" }, { "input": "lml", "output": "NIE" }, { "input": "AZA", "output": "NIE" }, { "input": "mXm", "output": "NIE" }, { "input": "bd", "output": "TAK" }, { "input": "H", "output": "TAK" }, { "input": "uvu", "output": "NIE" }, { "input": "dxxd", "output": "NIE" }, { "input": "dp", "output": "NIE" }, { "input": "vV", "output": "NIE" }, { "input": "vMo", "output": "NIE" }, { "input": "O", "output": "TAK" }, { "input": "vYv", "output": "TAK" }, { "input": "fv", "output": "NIE" }, { "input": "U", "output": "TAK" }, { "input": "iAi", "output": "NIE" }, { "input": "I", "output": "TAK" }, { "input": "VxrV", "output": "NIE" }, { "input": "POP", "output": "NIE" }, { "input": "bid", "output": "NIE" }, { "input": "bmd", "output": "NIE" }, { "input": "AiA", "output": "NIE" }, { "input": "mmmmmm", "output": "NIE" }, { "input": "XHX", "output": "TAK" }, { "input": "llllll", "output": "NIE" }, { "input": "aAa", "output": "NIE" }, { "input": "Db", "output": "NIE" }, { "input": "lOl", "output": "NIE" }, { "input": "bzd", "output": "NIE" } ]
1,551,448,788
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
93
0
s=input().split();s=s[0];k=[] if len(s)==1 or len(s)==2: print('NIE') elif len(s)==3: print('TAK') else: for i in range(1,len(s)-2): k.append(s[i]) if k==list(reversed(k)): print('TAK') else: print('NIE')
Title: s-palindrome Time Limit: None seconds Memory Limit: None megabytes Problem Description: Let's call a string "s-palindrome" if it is symmetric about the middle of the string. For example, the string "oHo" is "s-palindrome", but the string "aa" is not. The string "aa" is not "s-palindrome", because the second half of it is not a mirror reflection of the first half. You are given a string *s*. Check if the string is "s-palindrome". Input Specification: The only line contains the string *s* (1<=≤<=|*s*|<=≤<=1000) which consists of only English letters. Output Specification: Print "TAK" if the string *s* is "s-palindrome" and "NIE" otherwise. Demo Input: ['oXoxoXo\n', 'bod\n', 'ER\n'] Demo Output: ['TAK\n', 'TAK\n', 'NIE\n'] Note: none
```python s=input().split();s=s[0];k=[] if len(s)==1 or len(s)==2: print('NIE') elif len(s)==3: print('TAK') else: for i in range(1,len(s)-2): k.append(s[i]) if k==list(reversed(k)): print('TAK') else: print('NIE') ```
0
9
A
Die Roll
PROGRAMMING
800
[ "math", "probabilities" ]
A. Die Roll
1
64
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
[ "4 2\n" ]
[ "1/2\n" ]
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
0
[ { "input": "4 2", "output": "1/2" }, { "input": "1 1", "output": "1/1" }, { "input": "1 2", "output": "5/6" }, { "input": "1 3", "output": "2/3" }, { "input": "1 4", "output": "1/2" }, { "input": "1 5", "output": "1/3" }, { "input": "1 6", "output": "1/6" }, { "input": "2 1", "output": "5/6" }, { "input": "2 2", "output": "5/6" }, { "input": "2 3", "output": "2/3" }, { "input": "2 4", "output": "1/2" }, { "input": "2 5", "output": "1/3" }, { "input": "2 6", "output": "1/6" }, { "input": "3 1", "output": "2/3" }, { "input": "3 2", "output": "2/3" }, { "input": "3 3", "output": "2/3" }, { "input": "3 4", "output": "1/2" }, { "input": "3 5", "output": "1/3" }, { "input": "3 6", "output": "1/6" }, { "input": "4 1", "output": "1/2" }, { "input": "4 3", "output": "1/2" }, { "input": "4 4", "output": "1/2" }, { "input": "4 5", "output": "1/3" }, { "input": "4 6", "output": "1/6" }, { "input": "5 1", "output": "1/3" }, { "input": "5 2", "output": "1/3" }, { "input": "5 3", "output": "1/3" }, { "input": "5 4", "output": "1/3" }, { "input": "5 5", "output": "1/3" }, { "input": "5 6", "output": "1/6" }, { "input": "6 1", "output": "1/6" }, { "input": "6 2", "output": "1/6" }, { "input": "6 3", "output": "1/6" }, { "input": "6 4", "output": "1/6" }, { "input": "6 5", "output": "1/6" }, { "input": "6 6", "output": "1/6" } ]
1,644,249,388
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
92
512,000
import fractions as fr a = input() b = a.split(' ') y = int(b[0]) w = int(b[1]) c = 7 asa = 0 if y > w: for i in range(y,7): asa += 1 else: for aga in range(w,7): asa +=1 probabi = fr.Fraction(asa / 6) print (probabi)
Title: Die Roll Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win. Input Specification: The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls. Output Specification: Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1». Demo Input: ['4 2\n'] Demo Output: ['1/2\n'] Note: Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
```python import fractions as fr a = input() b = a.split(' ') y = int(b[0]) w = int(b[1]) c = 7 asa = 0 if y > w: for i in range(y,7): asa += 1 else: for aga in range(w,7): asa +=1 probabi = fr.Fraction(asa / 6) print (probabi) ```
0
584
A
Olesya and Rodion
PROGRAMMING
1,000
[ "math" ]
null
null
Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them. Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1.
The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by.
Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them.
[ "3 2\n" ]
[ "712" ]
none
500
[ { "input": "3 2", "output": "222" }, { "input": "2 2", "output": "22" }, { "input": "4 3", "output": "3333" }, { "input": "5 3", "output": "33333" }, { "input": "10 7", "output": "7777777777" }, { "input": "2 9", "output": "99" }, { "input": "18 8", "output": "888888888888888888" }, { "input": "1 5", "output": "5" }, { "input": "1 10", "output": "-1" }, { "input": "100 5", "output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "10 2", "output": "2222222222" }, { "input": "18 10", "output": "111111111111111110" }, { "input": "1 9", "output": "9" }, { "input": "7 6", "output": "6666666" }, { "input": "4 4", "output": "4444" }, { "input": "14 7", "output": "77777777777777" }, { "input": "3 8", "output": "888" }, { "input": "1 3", "output": "3" }, { "input": "2 8", "output": "88" }, { "input": "3 8", "output": "888" }, { "input": "4 3", "output": "3333" }, { "input": "5 9", "output": "99999" }, { "input": "4 8", "output": "8888" }, { "input": "3 4", "output": "444" }, { "input": "9 4", "output": "444444444" }, { "input": "8 10", "output": "11111110" }, { "input": "1 6", "output": "6" }, { "input": "20 3", "output": "33333333333333333333" }, { "input": "15 10", "output": "111111111111110" }, { "input": "31 4", "output": "4444444444444444444444444444444" }, { "input": "18 9", "output": "999999999999999999" }, { "input": "72 4", "output": "444444444444444444444444444444444444444444444444444444444444444444444444" }, { "input": "76 8", "output": "8888888888888888888888888888888888888888888888888888888888888888888888888888" }, { "input": "12 5", "output": "555555555555" }, { "input": "54 5", "output": "555555555555555555555555555555555555555555555555555555" }, { "input": "96 10", "output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "15 9", "output": "999999999999999" }, { "input": "100 2", "output": "2222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222" }, { "input": "99 3", "output": "333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333" }, { "input": "98 4", "output": "44444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444" }, { "input": "97 5", "output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "100 6", "output": "6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666" }, { "input": "99 7", "output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "98 8", "output": "88888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888" }, { "input": "97 9", "output": "9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999" }, { "input": "100 10", "output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "3 10", "output": "110" }, { "input": "2 4", "output": "44" }, { "input": "2 10", "output": "10" }, { "input": "10 10", "output": "1111111110" }, { "input": "4 10", "output": "1110" }, { "input": "25 10", "output": "1111111111111111111111110" }, { "input": "50 10", "output": "11111111111111111111111111111111111111111111111110" }, { "input": "5 10", "output": "11110" }, { "input": "99 10", "output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "100 10", "output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "1 2", "output": "2" }, { "input": "20 10", "output": "11111111111111111110" }, { "input": "99 7", "output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "89 5", "output": "55555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "6 10", "output": "111110" }, { "input": "3 8", "output": "888" }, { "input": "1 9", "output": "9" }, { "input": "1 4", "output": "4" }, { "input": "100 7", "output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" } ]
1,699,095,037
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
8
31
0
from random import randint n,m = map(int,input().split()) print(int(str(m) *n))
Title: Olesya and Rodion Time Limit: None seconds Memory Limit: None megabytes Problem Description: Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them. Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1. Input Specification: The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by. Output Specification: Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them. Demo Input: ['3 2\n'] Demo Output: ['712'] Note: none
```python from random import randint n,m = map(int,input().split()) print(int(str(m) *n)) ```
0
416
A
Guess a number!
PROGRAMMING
1,400
[ "greedy", "implementation", "two pointers" ]
null
null
A TV show called "Guess a number!" is gathering popularity. The whole Berland, the old and the young, are watching the show. The rules are simple. The host thinks of an integer *y* and the participants guess it by asking questions to the host. There are four types of acceptable questions: - Is it true that *y* is strictly larger than number *x*? - Is it true that *y* is strictly smaller than number *x*? - Is it true that *y* is larger than or equal to number *x*? - Is it true that *y* is smaller than or equal to number *x*? On each question the host answers truthfully, "yes" or "no". Given the sequence of questions and answers, find any integer value of *y* that meets the criteria of all answers. If there isn't such value, print "Impossible".
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=10000) — the number of questions (and answers). Next *n* lines each contain one question and one answer to it. The format of each line is like that: "sign x answer", where the sign is: - "&gt;" (for the first type queries), - "&lt;" (for the second type queries), - "&gt;=" (for the third type queries), - "&lt;=" (for the fourth type queries). All values of *x* are integer and meet the inequation <=-<=109<=≤<=*x*<=≤<=109. The answer is an English letter "Y" (for "yes") or "N" (for "no"). Consequtive elements in lines are separated by a single space.
Print any of such integers *y*, that the answers to all the queries are correct. The printed number *y* must meet the inequation <=-<=2·109<=≤<=*y*<=≤<=2·109. If there are many answers, print any of them. If such value doesn't exist, print word "Impossible" (without the quotes).
[ "4\n&gt;= 1 Y\n&lt; 3 N\n&lt;= -3 N\n&gt; 55 N\n", "2\n&gt; 100 Y\n&lt; -100 Y\n" ]
[ "17\n", "Impossible\n" ]
none
500
[ { "input": "4\n>= 1 Y\n< 3 N\n<= -3 N\n> 55 N", "output": "17" }, { "input": "2\n> 100 Y\n< -100 Y", "output": "Impossible" }, { "input": "4\n< 1 N\n> 1 N\n> 1 N\n> 1 N", "output": "1" }, { "input": "4\n<= 1 Y\n>= 1 Y\n>= 1 Y\n<= 1 Y", "output": "1" }, { "input": "4\n< 10 Y\n> -6 Y\n< 10 Y\n< -10 N", "output": "-5" }, { "input": "1\n< 1 N", "output": "1361956" }, { "input": "1\n<= 1 Y", "output": "-1998638045" }, { "input": "1\n> 1 N", "output": "-1998638045" }, { "input": "1\n>= 1 Y", "output": "1361956" }, { "input": "4\n< 1 N\n< 1 N\n< 1 N\n<= 1 Y", "output": "1" }, { "input": "4\n< 1 N\n>= 1 Y\n< 1 N\n< 1 N", "output": "1361956" }, { "input": "4\n> 1 N\n<= 1 Y\n<= 1 Y\n> 1 N", "output": "-1998638045" }, { "input": "4\n>= 1 Y\n> 1 N\n>= 1 Y\n>= 1 Y", "output": "1" }, { "input": "4\n<= 9 Y\n< 3 Y\n< 2 Y\n< 2 Y", "output": "-1998638045" }, { "input": "4\n< 0 N\n< -7 N\n>= 8 N\n>= -5 Y", "output": "3" }, { "input": "4\n<= -6 N\n<= -8 N\n<= 3 Y\n<= 7 Y", "output": "-2" }, { "input": "4\n>= 7 N\n<= -1 N\n>= 5 N\n<= -10 N", "output": "0" }, { "input": "4\n> 5 N\n>= -5 Y\n> -9 Y\n> -9 Y", "output": "-4" }, { "input": "10\n<= -60 N\n>= -59 Y\n> 22 Y\n> 95 N\n<= 91 Y\n> 77 Y\n>= -59 Y\n> -25 Y\n> -22 Y\n>= 52 Y", "output": "85" }, { "input": "10\n>= -18 Y\n>= -35 Y\n> -94 Y\n< -23 N\n< -69 N\n< -68 N\n< 82 Y\n> 92 N\n< 29 Y\n>= -25 Y", "output": "18" }, { "input": "10\n>= 18 Y\n<= -32 N\n>= 85 N\n<= 98 Y\n<= -43 N\n<= -79 N\n>= 97 N\n< -38 N\n< -55 N\n<= -93 N", "output": "64" }, { "input": "10\n<= 2 Y\n< -33 Y\n> 6 N\n> -6 N\n< -28 Y\n> -62 Y\n< 57 Y\n<= 24 Y\n> 23 N\n> -25 N", "output": "-54" }, { "input": "10\n<= -31 N\n>= 66 N\n<= 0 Y\n> -95 Y\n< 27 Y\n< -42 N\n> 3 N\n< 6 Y\n>= -42 Y\n> -70 Y", "output": "-29" }, { "input": "10\n>= 54 N\n<= -52 N\n>= 64 N\n> 65 N\n< 37 Y\n> -84 Y\n>= -94 Y\n>= -95 Y\n> -72 Y\n<= 18 N", "output": "22" }, { "input": "10\n> -24 N\n<= -5 Y\n<= -33 Y\n> 45 N\n> -59 Y\n> -21 N\n<= -48 N\n> 40 N\n< 12 Y\n>= 14 N", "output": "-47" }, { "input": "10\n>= 91 Y\n>= -68 Y\n< 92 N\n>= -15 Y\n> 51 Y\n<= 14 N\n> 17 Y\n< 94 Y\n>= 49 Y\n> -36 Y", "output": "93" }, { "input": "1\n< -1000000000 Y", "output": "-1998638045" }, { "input": "1\n< 1 Y", "output": "-1998638045" }, { "input": "1\n>= -999999999 Y", "output": "-998638044" }, { "input": "1\n> 100000 Y", "output": "1461956" }, { "input": "1\n<= 999999999 Y", "output": "-1998638045" }, { "input": "1\n<= 1000000000 N", "output": "1001361956" }, { "input": "4\n< -1000000000 Y\n< -1000000000 Y\n< -1000000000 Y\n< -1000000000 Y", "output": "-1998638045" }, { "input": "1\n>= 1000000000 Y", "output": "1001361955" }, { "input": "1\n<= 999999999 N", "output": "1001361955" }, { "input": "1\n<= 100 Y", "output": "-1998638045" }, { "input": "1\n> 1000000000 Y", "output": "1001361956" }, { "input": "1\n<= 1 Y", "output": "-1998638045" }, { "input": "1\n<= 1000000000 Y", "output": "-1998638045" }, { "input": "1\n<= -1000000000 Y", "output": "-1998638045" }, { "input": "1\n<= -999999999 Y", "output": "-1998638045" }, { "input": "1\n> 100 Y", "output": "1362056" }, { "input": "2\n< -1000000000 Y\n< 3 Y", "output": "-1998638045" }, { "input": "1\n<= -1000000 Y", "output": "-1998638045" }, { "input": "8\n< -1000000000 Y\n< -1000000000 Y\n< -1000000000 Y\n< -1000000000 Y\n< -1000000000 Y\n< -1000000000 Y\n< -1000000000 Y\n< -1000000000 Y", "output": "-1998638045" }, { "input": "1\n<= 15 Y", "output": "-1998638045" }, { "input": "1\n< 1000000000 Y", "output": "-1998638045" }, { "input": "1\n> 10000000 Y", "output": "11361956" }, { "input": "1\n< 0 Y", "output": "-1998638045" }, { "input": "1\n< 100 Y", "output": "-1998638045" }, { "input": "1\n<= 5 Y", "output": "-1998638045" }, { "input": "3\n> 5 Y\n> 0 Y\n< 4 Y", "output": "Impossible" }, { "input": "1\n>= -1000000000 N", "output": "-1998638045" }, { "input": "3\n>= 1 Y\n<= 1 Y\n> 10 Y", "output": "Impossible" }, { "input": "2\n> 1 Y\n< 2 Y", "output": "Impossible" }, { "input": "3\n>= 5 Y\n<= 5 Y\n< 5 Y", "output": "Impossible" }, { "input": "2\n>= 5 N\n> 5 Y", "output": "Impossible" }, { "input": "3\n>= 4 Y\n> 4 Y\n<= 4 Y", "output": "Impossible" }, { "input": "2\n>= 4 Y\n> 4 Y", "output": "1361960" } ]
1,669,989,146
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
4
46
0
def ExtractNum(A): a=A.find(' ') B=A[::-1] b=len(A)-1-B.find(' ') #print(a,b) return int(A[a+1:b]) n=int(input()) l1=[] l2=[] for i in range(n): a=input() if(a[0]== '>' and a[1]=='='): if(a[-1]=='Y'): l1.append(ExtractNum(a)) else: l2.append(ExtractNum(a)-1) elif(a[0]=='>'): if(a[-1]=='Y'): l1.append(ExtractNum(a)-1) else: l2.append(ExtractNum(a)) elif(a[0]== '<' and a[1]=='='): if(a[-1]=='Y'): l2.append(ExtractNum(a)) else: l1.append(ExtractNum(a)-1) elif(a[0]=='<'): if(a[-1]=='Y'): l2.append(ExtractNum(a)-1) else: l1.append(ExtractNum(a)) #print(l1) #print(l2) if(max(l1)<=min(l2)): print(max(l1)) else: print("Impossible")
Title: Guess a number! Time Limit: None seconds Memory Limit: None megabytes Problem Description: A TV show called "Guess a number!" is gathering popularity. The whole Berland, the old and the young, are watching the show. The rules are simple. The host thinks of an integer *y* and the participants guess it by asking questions to the host. There are four types of acceptable questions: - Is it true that *y* is strictly larger than number *x*? - Is it true that *y* is strictly smaller than number *x*? - Is it true that *y* is larger than or equal to number *x*? - Is it true that *y* is smaller than or equal to number *x*? On each question the host answers truthfully, "yes" or "no". Given the sequence of questions and answers, find any integer value of *y* that meets the criteria of all answers. If there isn't such value, print "Impossible". Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=10000) — the number of questions (and answers). Next *n* lines each contain one question and one answer to it. The format of each line is like that: "sign x answer", where the sign is: - "&gt;" (for the first type queries), - "&lt;" (for the second type queries), - "&gt;=" (for the third type queries), - "&lt;=" (for the fourth type queries). All values of *x* are integer and meet the inequation <=-<=109<=≤<=*x*<=≤<=109. The answer is an English letter "Y" (for "yes") or "N" (for "no"). Consequtive elements in lines are separated by a single space. Output Specification: Print any of such integers *y*, that the answers to all the queries are correct. The printed number *y* must meet the inequation <=-<=2·109<=≤<=*y*<=≤<=2·109. If there are many answers, print any of them. If such value doesn't exist, print word "Impossible" (without the quotes). Demo Input: ['4\n&gt;= 1 Y\n&lt; 3 N\n&lt;= -3 N\n&gt; 55 N\n', '2\n&gt; 100 Y\n&lt; -100 Y\n'] Demo Output: ['17\n', 'Impossible\n'] Note: none
```python def ExtractNum(A): a=A.find(' ') B=A[::-1] b=len(A)-1-B.find(' ') #print(a,b) return int(A[a+1:b]) n=int(input()) l1=[] l2=[] for i in range(n): a=input() if(a[0]== '>' and a[1]=='='): if(a[-1]=='Y'): l1.append(ExtractNum(a)) else: l2.append(ExtractNum(a)-1) elif(a[0]=='>'): if(a[-1]=='Y'): l1.append(ExtractNum(a)-1) else: l2.append(ExtractNum(a)) elif(a[0]== '<' and a[1]=='='): if(a[-1]=='Y'): l2.append(ExtractNum(a)) else: l1.append(ExtractNum(a)-1) elif(a[0]=='<'): if(a[-1]=='Y'): l2.append(ExtractNum(a)-1) else: l1.append(ExtractNum(a)) #print(l1) #print(l2) if(max(l1)<=min(l2)): print(max(l1)) else: print("Impossible") ```
0
377
A
Maze
PROGRAMMING
1,600
[ "dfs and similar" ]
null
null
Pavel loves grid mazes. A grid maze is an *n*<=×<=*m* rectangle maze where each cell is either empty, or is a wall. You can go from one cell to another only if both cells are empty and have a common side. Pavel drew a grid maze with all empty cells forming a connected area. That is, you can go from any empty cell to any other one. Pavel doesn't like it when his maze has too little walls. He wants to turn exactly *k* empty cells into walls so that all the remaining cells still formed a connected area. Help him.
The first line contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*<=≤<=500, 0<=≤<=*k*<=&lt;<=*s*), where *n* and *m* are the maze's height and width, correspondingly, *k* is the number of walls Pavel wants to add and letter *s* represents the number of empty cells in the original maze. Each of the next *n* lines contains *m* characters. They describe the original maze. If a character on a line equals ".", then the corresponding cell is empty and if the character equals "#", then the cell is a wall.
Print *n* lines containing *m* characters each: the new maze that fits Pavel's requirements. Mark the empty cells that you transformed into walls as "X", the other cells must be left without changes (that is, "." and "#"). It is guaranteed that a solution exists. If there are multiple solutions you can output any of them.
[ "3 4 2\n#..#\n..#.\n#...\n", "5 4 5\n#...\n#.#.\n.#..\n...#\n.#.#\n" ]
[ "#.X#\nX.#.\n#...\n", "#XXX\n#X#.\nX#..\n...#\n.#.#\n" ]
none
500
[ { "input": "5 4 5\n#...\n#.#.\n.#..\n...#\n.#.#", "output": "#XXX\n#X#.\nX#..\n...#\n.#.#" }, { "input": "3 3 2\n#.#\n...\n#.#", "output": "#X#\nX..\n#.#" }, { "input": "7 7 18\n#.....#\n..#.#..\n.#...#.\n...#...\n.#...#.\n..#.#..\n#.....#", "output": "#XXXXX#\nXX#X#X.\nX#XXX#.\nXXX#...\nX#...#.\nX.#.#..\n#.....#" }, { "input": "1 1 0\n.", "output": "." }, { "input": "2 3 1\n..#\n#..", "output": "X.#\n#.." }, { "input": "2 3 1\n#..\n..#", "output": "#.X\n..#" }, { "input": "3 3 1\n...\n.#.\n..#", "output": "...\n.#X\n..#" }, { "input": "3 3 1\n...\n.#.\n#..", "output": "...\nX#.\n#.." }, { "input": "5 4 4\n#..#\n....\n.##.\n....\n#..#", "output": "#XX#\nXX..\n.##.\n....\n#..#" }, { "input": "5 5 2\n.#..#\n..#.#\n#....\n##.#.\n###..", "output": "X#..#\nX.#.#\n#....\n##.#.\n###.." }, { "input": "4 6 3\n#.....\n#.#.#.\n.#...#\n...#.#", "output": "#.....\n#X#.#X\nX#...#\n...#.#" }, { "input": "7 5 4\n.....\n.#.#.\n#...#\n.#.#.\n.#...\n..#..\n....#", "output": "X...X\nX#.#X\n#...#\n.#.#.\n.#...\n..#..\n....#" }, { "input": "16 14 19\n##############\n..############\n#.############\n#..###########\n....##########\n..############\n.#############\n.#.###########\n....##########\n###..#########\n##...#########\n###....#######\n###.##.......#\n###..###.#..#.\n###....#......\n#...#...##.###", "output": "##############\nXX############\n#X############\n#XX###########\nXXXX##########\nXX############\nX#############\nX#.###########\nX...##########\n###..#########\n##...#########\n###....#######\n###.##.......#\n###..###.#..#.\n###...X#......\n#X..#XXX##.###" }, { "input": "10 17 32\n######.##########\n####.#.##########\n...#....#########\n.........########\n##.......########\n........#########\n#.....###########\n#################\n#################\n#################", "output": "######X##########\n####X#X##########\nXXX#XXXX#########\nXXXXXXXXX########\n##XXX.XXX########\nXXXX...X#########\n#XX...###########\n#################\n#################\n#################" }, { "input": "16 10 38\n##########\n##########\n##########\n..########\n...#######\n...#######\n...#######\n....######\n.....####.\n......###.\n......##..\n.......#..\n.........#\n.........#\n.........#\n.........#", "output": "##########\n##########\n##########\nXX########\nXXX#######\nXXX#######\nXXX#######\nXXXX######\nXXXXX####.\nXXXXX.###.\nXXXX..##..\nXXX....#..\nXXX......#\nXX.......#\nX........#\n.........#" }, { "input": "15 16 19\n########.....###\n########.....###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n.....#####.#..##\n................\n.#...........###\n###.########.###\n###.########.###", "output": "########XXXXX###\n########XXXXX###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\nXXXX.#####.#..##\nXXX.............\nX#...........###\n###.########.###\n###X########.###" }, { "input": "12 19 42\n.........##########\n...................\n.##.##############.\n..################.\n..#################\n..#################\n..#################\n..#################\n..#################\n..#################\n..##########.######\n.............######", "output": "XXXXXXXXX##########\nXXXXXXXXXXXXXXXXXXX\nX##X##############X\nXX################X\nXX#################\nXX#################\nXX#################\nX.#################\nX.#################\n..#################\n..##########.######\n.............######" }, { "input": "3 5 1\n#...#\n..#..\n..#..", "output": "#...#\n..#..\nX.#.." }, { "input": "4 5 10\n.....\n.....\n..#..\n..#..", "output": "XXX..\nXXX..\nXX#..\nXX#.." }, { "input": "3 5 3\n.....\n..#..\n..#..", "output": ".....\nX.#..\nXX#.." }, { "input": "3 5 1\n#....\n..#..\n..###", "output": "#....\n..#.X\n..###" }, { "input": "4 5 1\n.....\n.##..\n..#..\n..###", "output": ".....\n.##..\n..#.X\n..###" }, { "input": "3 5 2\n..#..\n..#..\n....#", "output": "X.#..\nX.#..\n....#" }, { "input": "10 10 1\n##########\n##......##\n#..#..#..#\n#..####..#\n#######.##\n#######.##\n#..####..#\n#..#..#..#\n##......##\n##########", "output": "##########\n##......##\n#..#..#..#\n#X.####..#\n#######.##\n#######.##\n#..####..#\n#..#..#..#\n##......##\n##########" }, { "input": "10 10 3\n..........\n.########.\n.########.\n.########.\n.########.\n.########.\n.#######..\n.#######..\n.####..###\n.......###", "output": "..........\n.########.\n.########.\n.########.\n.########.\n.########.\n.#######X.\n.#######XX\n.####..###\n.......###" }, { "input": "5 7 10\n..#....\n..#.#..\n.##.#..\n..#.#..\n....#..", "output": "XX#....\nXX#.#..\nX##.#..\nXX#.#..\nXXX.#.." }, { "input": "5 7 10\n..#....\n..#.##.\n.##.##.\n..#.#..\n....#..", "output": "XX#....\nXX#.##.\nX##.##.\nXX#.#..\nXXX.#.." }, { "input": "10 10 1\n##########\n##..##..##\n#...##...#\n#.######.#\n#..####..#\n#..####..#\n#.######.#\n#........#\n##..##..##\n##########", "output": "##########\n##.X##..##\n#...##...#\n#.######.#\n#..####..#\n#..####..#\n#.######.#\n#........#\n##..##..##\n##########" }, { "input": "4 5 1\n.....\n.###.\n..#..\n..#..", "output": ".....\n.###.\n..#..\n.X#.." }, { "input": "2 5 2\n###..\n###..", "output": "###X.\n###X." }, { "input": "2 5 3\n.....\n..#..", "output": "X....\nXX#.." }, { "input": "12 12 3\n############\n#..........#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.#######..#\n#.#######..#\n#.####..####\n#.......####\n############", "output": "############\n#..........#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.#######X.#\n#.#######XX#\n#.####..####\n#.......####\n############" }, { "input": "5 5 1\n.....\n.##..\n..###\n..###\n#####", "output": ".....\n.##.X\n..###\n..###\n#####" }, { "input": "4 4 1\n....\n.#..\n..##\n..##", "output": "....\n.#.X\n..##\n..##" }, { "input": "5 5 1\n....#\n.##..\n.##..\n...##\n...##", "output": "....#\n.##..\n.##.X\n...##\n...##" }, { "input": "5 5 1\n.....\n.##..\n..###\n..###\n..###", "output": ".....\n.##.X\n..###\n..###\n..###" }, { "input": "4 5 1\n#....\n#.#..\n..###\n..###", "output": "#....\n#.#.X\n..###\n..###" }, { "input": "4 4 3\n....\n.#..\n..##\n..##", "output": "...X\n.#XX\n..##\n..##" }, { "input": "4 7 6\n.......\n....#..\n.##.#..\n....#..", "output": "X......\nX...#..\nX##.#..\nXXX.#.." }, { "input": "8 8 7\n........\n.##.....\n.#######\n..######\n..######\n..######\n..######\n..######", "output": ".....XXX\n.##.XXXX\n.#######\n..######\n..######\n..######\n..######\n..######" } ]
1,638,632,638
2,147,483,647
PyPy 3-64
RUNTIME_ERROR
TESTS
7
311
19,763,200
n, m, k = map(int, input().split()) grid = [list(input()) for _ in range(n)] visited = {} def is_valid(i, j): return 0 <= i < n and 0 <= j < m def dfs(i, j): global k if k <= 0: return False visited[(i, j)] = True children_blocked = True for ni, nj in [(i - 1, j), (i, j - 1), (i, j + 1), (i + 1, j)]: if not is_valid(ni, nj): continue if grid[ni][nj] == '.' and (ni, nj) not in visited: cb = dfs(ni, nj) children_blocked = cb and children_blocked if children_blocked and k > 0: grid[i][j] = 'X' k -= 1 return children_blocked return False for i in range(n): f = False for j in range(m): if grid[i][j] == '.': dfs(i, j) break if f: break for i in range(n): print(''.join(grid[i]))
Title: Maze Time Limit: None seconds Memory Limit: None megabytes Problem Description: Pavel loves grid mazes. A grid maze is an *n*<=×<=*m* rectangle maze where each cell is either empty, or is a wall. You can go from one cell to another only if both cells are empty and have a common side. Pavel drew a grid maze with all empty cells forming a connected area. That is, you can go from any empty cell to any other one. Pavel doesn't like it when his maze has too little walls. He wants to turn exactly *k* empty cells into walls so that all the remaining cells still formed a connected area. Help him. Input Specification: The first line contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*<=≤<=500, 0<=≤<=*k*<=&lt;<=*s*), where *n* and *m* are the maze's height and width, correspondingly, *k* is the number of walls Pavel wants to add and letter *s* represents the number of empty cells in the original maze. Each of the next *n* lines contains *m* characters. They describe the original maze. If a character on a line equals ".", then the corresponding cell is empty and if the character equals "#", then the cell is a wall. Output Specification: Print *n* lines containing *m* characters each: the new maze that fits Pavel's requirements. Mark the empty cells that you transformed into walls as "X", the other cells must be left without changes (that is, "." and "#"). It is guaranteed that a solution exists. If there are multiple solutions you can output any of them. Demo Input: ['3 4 2\n#..#\n..#.\n#...\n', '5 4 5\n#...\n#.#.\n.#..\n...#\n.#.#\n'] Demo Output: ['#.X#\nX.#.\n#...\n', '#XXX\n#X#.\nX#..\n...#\n.#.#\n'] Note: none
```python n, m, k = map(int, input().split()) grid = [list(input()) for _ in range(n)] visited = {} def is_valid(i, j): return 0 <= i < n and 0 <= j < m def dfs(i, j): global k if k <= 0: return False visited[(i, j)] = True children_blocked = True for ni, nj in [(i - 1, j), (i, j - 1), (i, j + 1), (i + 1, j)]: if not is_valid(ni, nj): continue if grid[ni][nj] == '.' and (ni, nj) not in visited: cb = dfs(ni, nj) children_blocked = cb and children_blocked if children_blocked and k > 0: grid[i][j] = 'X' k -= 1 return children_blocked return False for i in range(n): f = False for j in range(m): if grid[i][j] == '.': dfs(i, j) break if f: break for i in range(n): print(''.join(grid[i])) ```
-1