id stringlengths 3 8 | content stringlengths 100 981k |
|---|---|
11510350 | import argparse
import json
import datetime
from args import get_parser, str2bool
from utils import *
from mtad_gat import MTAD_GAT
from prediction import Predictor
if __name__ == "__main__":
parser = get_parser()
parser.add_argument("--model_id", type=str, default=None,
help="ID (datetime) of pretrained model to use, '-1' for latest, '-2' for second latest, etc")
parser.add_argument("--load_scores", type=str2bool, default=False, help="To use already computed anomaly scores")
parser.add_argument("--save_output", type=str2bool, default=False)
args = parser.parse_args()
print(args)
dataset = args.dataset
if args.model_id is None:
if dataset == 'SMD':
dir_path = f"./output/{dataset}/{args.group}"
else:
dir_path = f"./output/{dataset}"
dir_content = os.listdir(dir_path)
subfolders = [subf for subf in dir_content if os.path.isdir(f"{dir_path}/{subf}") and subf != "logs"]
date_times = [datetime.datetime.strptime(subf, '%d%m%Y_%H%M%S') for subf in subfolders]
date_times.sort()
model_datetime = date_times[-1]
model_id = model_datetime.strftime('%d%m%Y_%H%M%S')
else:
model_id = args.model_id
if dataset == "SMD":
model_path = f"./output/{dataset}/{args.group}/{model_id}"
elif dataset in ['MSL', 'SMAP']:
model_path = f"./output/{dataset}/{model_id}"
else:
raise Exception(f'Dataset "{dataset}" not available.')
# Check that model exist
if not os.path.isfile(f"{model_path}/model.pt"):
raise Exception(f"<{model_path}/model.pt> does not exist.")
# Get configs of model
print(f'Using model from {model_path}')
model_parser = argparse.ArgumentParser()
model_args, unknown = model_parser.parse_known_args()
model_args_path = f"{model_path}/config.txt"
with open(model_args_path, "r") as f:
model_args.__dict__ = json.load(f)
window_size = model_args.lookback
# Check that model is trained on specified dataset
if args.dataset.lower() != model_args.dataset.lower():
raise Exception(f"Model trained on {model_args.dataset}, but asked to predict {args.dataset}.")
elif args.dataset == "SMD" and args.group != model_args.group:
print(f"Model trained on SMD group {model_args.group}, but asked to predict SMD group {args.group}.")
window_size = model_args.lookback
normalize = model_args.normalize
n_epochs = model_args.epochs
batch_size = model_args.bs
init_lr = model_args.init_lr
val_split = model_args.val_split
shuffle_dataset = model_args.shuffle_dataset
use_cuda = model_args.use_cuda
print_every = model_args.print_every
group_index = model_args.group[0]
index = model_args.group[2:]
args_summary = str(model_args.__dict__)
if dataset == "SMD":
(x_train, _), (x_test, y_test) = get_data(f"machine-{group_index}-{index}", normalize=normalize)
else:
(x_train, _), (x_test, y_test) = get_data(args.dataset, normalize=normalize)
x_train = torch.from_numpy(x_train).float()
x_test = torch.from_numpy(x_test).float()
n_features = x_train.shape[1]
target_dims = get_target_dims(args.dataset)
if target_dims is None:
out_dim = n_features
elif type(target_dims) == int:
out_dim = 1
else:
out_dim = len(target_dims)
train_dataset = SlidingWindowDataset(x_train, window_size, target_dims)
test_dataset = SlidingWindowDataset(x_test, window_size, target_dims)
train_loader, val_loader, test_loader = create_data_loaders(
train_dataset, batch_size, val_split, shuffle_dataset, test_dataset=test_dataset
)
train_dataset = SlidingWindowDataset(x_train, window_size, target_dims)
test_dataset = SlidingWindowDataset(x_test, window_size, target_dims)
model = MTAD_GAT(
n_features,
window_size,
out_dim,
kernel_size=args.kernel_size,
use_gatv2=args.use_gatv2,
feat_gat_embed_dim=args.feat_gat_embed_dim,
time_gat_embed_dim=args.time_gat_embed_dim,
gru_n_layers=args.gru_n_layers,
gru_hid_dim=args.gru_hid_dim,
forecast_n_layers=args.fc_n_layers,
forecast_hid_dim=args.fc_hid_dim,
recon_n_layers=args.recon_n_layers,
recon_hid_dim=args.recon_hid_dim,
dropout=args.dropout,
alpha=args.alpha
)
device = "cuda" if args.use_cuda and torch.cuda.is_available() else "cpu"
load(model, f"{model_path}/model.pt", device=device)
model.to(device)
# Some suggestions for POT args
level_q_dict = {
"SMAP": (0.90, 0.005),
"MSL": (0.90, 0.001),
"SMD-1": (0.9950, 0.001),
"SMD-2": (0.9925, 0.001),
"SMD-3": (0.9999, 0.001)
}
key = "SMD-" + args.group[0] if args.dataset == "SMD" else args.dataset
level, q = level_q_dict[key]
if args.level is not None:
level = args.level
if args.q is not None:
q = args.q
# Some suggestions for Epsilon args
reg_level_dict = {"SMAP": 0, "MSL": 0, "SMD-1": 1, "SMD-2": 1, "SMD-3": 1}
key = "SMD-" + args.group[0] if dataset == "SMD" else dataset
reg_level = reg_level_dict[key]
prediction_args = {
'dataset': dataset,
"target_dims": target_dims,
'scale_scores': args.scale_scores,
"level": level,
"q": q,
'dynamic_pot': args.dynamic_pot,
"use_mov_av": args.use_mov_av,
"gamma": args.gamma,
"reg_level": reg_level,
"save_path": f"{model_path}",
}
# Creating a new summary-file each time when new prediction are made with a pre-trained model
count = 0
for filename in os.listdir(model_path):
if filename.startswith("summary"):
count += 1
if count == 0:
summary_file_name = "summary.txt"
else:
summary_file_name = f"summary_{count}.txt"
label = y_test[window_size:] if y_test is not None else None
predictor = Predictor(model, window_size, n_features, prediction_args, summary_file_name=summary_file_name)
predictor.predict_anomalies(x_train, x_test, label,
load_scores=args.load_scores,
save_output=args.save_output)
|
11510352 | from rest_framework import viewsets
from rest_framework.response import Response
from .models import Idc, Cabinet
from .serializers import IdcSerializer, CabinetNodepthSerializer
class IdcViewset(viewsets.ModelViewSet):
"""
retrieve:
返回指定Idc信息
list:
返回Idc列表
update:
更新Idc信息
partial_update:
更新部分Idc字段
destory:
删除Idc信息
create:
创建Idc记录
"""
serializer_class = IdcSerializer
def get_queryset(self):
return Idc.objects.all()
def list(self, request, *args, **kwargs):
# 当传回nopage参数为1时,不分页
queryset = self.filter_queryset(self.get_queryset())
nopage = request.query_params.get("nopage")
idc = self.get_queryset()
if nopage == '1':
self.paginator.page_size = idc.count()
page = self.paginate_queryset(queryset)
if page is not None:
serializer = self.get_serializer(page, many=True)
return self.get_paginated_response(serializer.data)
serializer = self.get_serializer(queryset, many=True)
return Response(serializer.data)
class CabinetViewset(viewsets.ModelViewSet):
"""
retrieve:
返回指定机柜信息
list:
返回机柜列表
update:
更新机柜信息
partial_update:
更新部分机柜字段
destory:
删除机柜信息
create:
创建机柜记录
"""
serializer_class = CabinetNodepthSerializer
def get_queryset(self):
return Cabinet.objects.all()
def list(self, request, *args, **kwargs):
# 当传回nopage参数为1时,不分页
queryset = self.filter_queryset(self.get_queryset())
nopage = request.query_params.get("nopage")
cabinet = self.get_queryset()
if nopage == '1':
self.paginator.page_size = cabinet.count()
page = self.paginate_queryset(queryset)
if page is not None:
serializer = self.get_serializer(page, many=True)
return self.get_paginated_response(serializer.data)
serializer = self.get_serializer(queryset, many=True)
return Response(serializer.data) |
11510359 | from pyradioconfig.parts.lynx.calculators.calc_radio import CALC_Radio_lynx
class calc_radio_leopard(CALC_Radio_lynx):
pass |
11510371 | def percent_encode(str):
if str is None:
return ""
result_str = ""
for char in str.encode():
if char >= 33 and char <= 0x7E and char != 34 and char != 37 and char != 39 and char != 44 and char != 92:
result_str += chr(char)
else:
result_str += "%"
result_str += format(char, "x").upper()
return result_str
def sum_char_codes(str):
sum = 0
for char in str.encode():
if char < 0x80:
sum += char
return sum
def feistel_cipher(upper_32_bits, lower_32_bits, key):
def to_signed_32(n):
n = n & 0xFFFFFFFF
return n | (-(n & 0x80000000))
def iterate(arg1, arg2, arg3):
return arg1 ^ (arg2 >> (32 - arg3) | to_signed_32(arg2 << arg3))
upper = to_signed_32(upper_32_bits)
lower = to_signed_32(lower_32_bits)
data = (lower & 0xFFFFFFFF) | (upper << 32)
lower2 = to_signed_32(data & 0xFFFFFFFF)
upper2 = to_signed_32((data >> 32) & 0xFFFFFFFF)
for i in range(16):
v2_1 = upper2 ^ iterate(lower2, key, i)
v8 = lower2
lower2 = v2_1
upper2 = v8
return (upper2 << 32) | (lower2 & 0xFFFFFFFF)
def timestamp_to_millis(timestamp):
return int(timestamp.timestamp() * 1000) |
11510378 | def findMinSum(num):
sum = 0
# Find factors of number
# and add to the sum
i = 2
while(i * i <= num):
while(num % i == 0):
sum += i
num /= i
i += 1
sum += num
# Return sum of numbers
# having minimum product
return sum
# Driver Code
num = int(input("Enter number to find the minimum sum of factors of it\n"))
print(findMinSum(num))
|
11510382 | from telegram.ext import Updater
from telegram.ext.dispatcher import Dispatcher
from bot.handler import *
from bot.handler.abstractHandler import AbstractHandler
from config.envs import BOT_TOKEN, PORT, WEBHOOK_URL
from logger import Logger
class App:
updater: Updater
dispatcher: Dispatcher
def __init__(self):
self.updater = Updater(BOT_TOKEN)
def run(self) -> None:
Logger.register()
self.register_handlers()
self.register_webhook()
self.updater.idle()
def register_handlers(self) -> None:
for handler in AbstractHandler.__subclasses__():
self.updater.dispatcher.add_handler(handler().bot_handler)
def register_webhook(self) -> None:
self.updater.start_webhook(
listen="0.0.0.0",
port=int(PORT),
url_path=BOT_TOKEN,
webhook_url="/".join([WEBHOOK_URL, BOT_TOKEN])
)
Logger.info(f'Webhook configured, listening on {WEBHOOK_URL}/<bot-token>')
if __name__ == "__main__":
app = App()
app.run()
|
11510393 | from tods.sk_interface.data_ensemble import *
from tods.sk_interface.feature_analysis import *
from tods.sk_interface.detection_algorithm import *
|
11510396 | def load_to_exgdb():
cmds = [cmd for cmd in dir(ExgdbMethods) if callable(getattr(ExgdbMethods, cmd)) and not cmd.startswith("_")]
for cmd in cmds:
setattr(Exgdb, cmd, getattr(ExgdbMethods, cmd))
def load_to_exgdbcmd():
cmds = [cmd for cmd in dir(ExgdbCmdMethods) if callable(getattr(ExgdbCmdMethods, cmd)) and not cmd.startswith("_")]
for cmd in cmds:
setattr(ExgdbCmd, cmd, getattr(ExgdbCmdMethods, cmd))
return cmds
def register_gdbcmd():
for cmd in c.cmds:
if not cmd in ["next", "step", "nexti", "stepi", "n", "s", "ni", "si", "start"]:
ExgdbAlias(cmd,"exgdb %s" % cmd)
ExgdbCmdWrapper()
def register_repeat_gdbcmd():
for cmd in c.repeat_cmds:
RepeatExgdbAlias(cmd,"rexgdb %s" % cmd)
RepeatExgdbCmdWrapper()
load_to_exgdb()
cmds = load_to_exgdbcmd()
e = Exgdb()
c = ExgdbCmd()
c.cmds = cmds
c.repeat_cmds = ["radvance", "rad"]
register_gdbcmd()
register_repeat_gdbcmd()
|
11510417 | def _cc_injected_toolchain_header_library_impl(ctx):
hdrs = ctx.files.hdrs
transitive_cc_infos = [dep[CcInfo] for dep in ctx.attr.deps]
compilation_ctx = \
cc_common.create_compilation_context(headers = depset(hdrs))
info = cc_common.merge_cc_infos(
cc_infos = transitive_cc_infos +
[CcInfo(compilation_context = compilation_ctx)],
)
return [info, DefaultInfo(files = depset(hdrs))]
cc_injected_toolchain_header_library = rule(
_cc_injected_toolchain_header_library_impl,
attrs = {
"hdrs": attr.label_list(
doc = "A list of headers to be included into a toolchain implicitly\
using -include",
allow_files = True,
),
"deps": attr.label_list(
doc = "list of injected header libraries that this target depends on",
providers = [CcInfo],
),
},
provides = [CcInfo],
)
def _normalise_include(ctx, inc):
root_str = ""
if ctx.label.workspace_root:
root_str = ctx.label.workspace_root + "/"
return root_str + ctx.label.package + "/" + inc
def _cc_toolchain_header_polyfill_library_impl(ctx):
hdrs = ctx.files.hdrs
system_includes = \
[_normalise_include(ctx, inc) for inc in ctx.attr.system_includes] + \
[ctx.label.workspace_root]
transitive_cc_infos = [dep[CcInfo] for dep in ctx.attr.deps]
compilation_ctx = cc_common.create_compilation_context(
headers = depset(hdrs),
system_includes = depset(system_includes),
)
info = cc_common.merge_cc_infos(
cc_infos = transitive_cc_infos +
[CcInfo(compilation_context = compilation_ctx)],
)
return [
info,
DefaultInfo(files =
depset(hdrs, transitive = [info.compilation_context.headers])),
]
cc_polyfill_toolchain_library = rule(
_cc_toolchain_header_polyfill_library_impl,
attrs = {
"hdrs": attr.label_list(
doc = "A list of headers to be included into the toolchains system \
libraries",
allow_files = True,
),
"system_includes": attr.string_list(
doc = "A list of directories to be included when the toolchain \
searches for headers",
),
"deps": attr.label_list(
doc = "list of injected header libraries that this target depends\
on",
providers = [CcInfo],
),
},
)
|
11510420 | import sys;
sys.path.append('C:\\Users\\Aaron\\workspace\\DigsbyTrunk\\digsby');
#import os
#os.chdir('C:\\Users\\Aaron\\workspace\\DigsbyTrunk\\digsby')
from ctypes import windll
windll.comctl32.InitCommonControls()
import wx
from tests.testapp import testapp
from win32events import bindwin32
from gui.uberwidgets.formattedinput2.FormattedExpandoTextCtrl import FormattedExpandoTextCtrl
FormattedExpandoTextCtrl.BindWin32 = bindwin32
#wx.Window.BindWin32 = bindwin32
#import gui.native.win.winhelpers
from gui.uberwidgets.formattedinput2.fontutil import FontFromFacename
from cgui import EVT_ETC_LAYOUT_NEEDED
def _(text):
return text
__builtins__._ = _
from gui.uberwidgets.formattedinput2.formattedinput import FormattedInput
def NewInput():
f = wx.Frame(None)
f.Sizer = wx.BoxSizer(wx.VERTICAL)
font = FontFromFacename('Arial')
font.SetPointSize(10)
# fo = {'default': False,
# 'italic': True}
textattr = wx.TextAttr(wx.BLACK, wx.WHITE, font) #@UndefinedVariable
i = FormattedInput(f, multiFormat = True)#, formatOptions = fo)
def OnExpandEvent(event):
height = (i.fbar.Size.height if i.FormattingBarIsShown() else 0) + i.tc.MinSize.height
i.MinSize = wx.Size(-1, height)
f.Fit()
i.Bind(EVT_ETC_LAYOUT_NEEDED, OnExpandEvent)
f.Sizer.Add(i, 0, wx.EXPAND)
f.Show()
f.Fit()
if __name__ == '__main__':
app = testapp(plugins = False)
NewInput()
app.MainLoop()
|
11510444 | import sys
import argparse
import time
import logging
import subprocess
from watchdog.observers import Observer
from watchdog.events import LoggingEventHandler, FileSystemEventHandler
class RsyncEventHandler(FileSystemEventHandler):
def __init__(self, host, src_dir, dst_dir, flags, exclude):
self.host = host
self.src = src_dir
self.dst = dst_dir
self.flags = flags
self.exclude = exclude
self.sync()
def on_any_event(self, event):
if not event.is_directory:
self.sync()
def sync(self):
cmd = ['rsync', self.flags, self.src, '--exclude-from', self.exclude, '{}:{}'.format(self.host, self.dst)]
print(' '.join(cmd))
subprocess.call(cmd)
def main(args):
logging.basicConfig(level=logging.INFO,
format='%(asctime)s - %(message)s',
datefmt='%Y-%m-%d %H:%M:%S')
event_handler = LoggingEventHandler()
rsync_handler = RsyncEventHandler(args.host, args.source, args.destination, args.rsync, args.exclude_file)
observer = Observer()
observer.schedule(event_handler, args.source, recursive=True)
observer.schedule(rsync_handler, args.source, recursive=True)
observer.start()
try:
while True:
time.sleep(1)
except KeyboardInterrupt:
observer.stop()
observer.join()
if __name__ == "__main__":
parser = argparse.ArgumentParser()
parser.add_argument('host', type=str, help='Host')
parser.add_argument('destination', type=str, help='Destination directory')
parser.add_argument('-s', '--source', type=str, default='.', help='Source directory (default current directory)')
parser.add_argument('-rs', '--rsync', type=str, default='-azvq', help='rsync flags (default -avzq')
parser.add_argument('-ef', '--exclude-file', type=str, default='.rsync-exclude', help='File containing exclusion rules (default .gitignore)')
args = parser.parse_args()
main(args)
|
11510449 | from __future__ import print_function
from orphics import maps,io,cosmology,lensing,stats
from enlib import enmap,bench,lensing as enlensing,resample
import numpy as np
import os,sys
from szar import counts
import argparse
from scipy.linalg import pinv2
# Parse command line
parser = argparse.ArgumentParser(description='Do a thing.')
parser.add_argument("-N", "--Nclusters", type=int, default=100,help="Num clusters.")
parser.add_argument("-a", "--arc", type=float, default=10.,help="Stamp width (arcmin).")
parser.add_argument("-p", "--pix", type=float, default=0.5,help="Pix width (arcmin).")
parser.add_argument("-b", "--beam", type=float, default=1.0,help="Beam (arcmin).")
parser.add_argument("-n", "--noise", type=float, default=1.0,help="Noise (uK-arcmin).")
parser.add_argument("-f", "--buffer-factor", type=int, default=2,help="Buffer factor for stamp.")
#parser.add_argument("-f", "--flag", action='store_true',help='A flag.')
args = parser.parse_args()
# Theory
theory_file_root = "../alhazen/data/Aug6_highAcc_CDM"
cc = counts.ClusterCosmology(skipCls=True)
theory = cosmology.loadTheorySpectraFromCAMB(theory_file_root,unlensedEqualsLensed=False,
useTotal=False,TCMB = 2.7255e6,lpad=9000,get_dimensionless=False)
# Geometry
shape, wcs = maps.rect_geometry(width_arcmin=args.arc,px_res_arcmin=args.pix,pol=False)
modlmap = enmap.modlmap(shape,wcs)
modrmap = enmap.modrmap(shape,wcs)
bshape, bwcs = maps.rect_geometry(width_arcmin=args.arc*args.buffer_factor,px_res_arcmin=args.pix,pol=False)
bmodlmap = enmap.modlmap(bshape,bwcs)
bmodrmap = enmap.modrmap(bshape,bwcs)
#gshape, gwcs = maps.rect_geometry(width_arcmin=args.arc,px_res_arcmin=0.1953125,pol=False)
gshape, gwcs = maps.rect_geometry(width_arcmin=100.,px_res_arcmin=args.pix,pol=False)
gshape,gwcs = bshape,bwcs
gmodlmap = enmap.modlmap(gshape,gwcs)
gmodrmap = enmap.modrmap(gshape,gwcs)
print(shape,bshape)
# Noise model
noise_uK_rad = args.noise*np.pi/180./60.
normfact = np.sqrt(np.prod(enmap.pixsize(shape,wcs)))
noise_uK_pixel = noise_uK_rad/normfact
Ncov = np.diag([(noise_uK_pixel)**2.]*np.prod(shape))
# Unlensed signal
power2d = theory.uCl('TT',bmodlmap)
bfcov = maps.diagonal_cov(power2d)
sny,snx = shape
ny,nx = bshape
Ucov = maps.pixcov(bshape,bwcs,bfcov)
Ucov = Ucov.reshape(np.prod(bshape),np.prod(bshape))
# Noise model
kbeam = maps.gauss_beam(args.beam,bmodlmap)
# Lens template
lens_order = 5
posmap = enmap.posmap(bshape,bwcs)
# Lens grid
amin = 0.18
amax = 0.22
num_amps = 10
kamps = np.linspace(amin,amax,num_amps)
cinvs = []
logdets = []
for k,kamp in enumerate(kamps):
kappa_template = lensing.nfw_kappa(kamp*1e15,bmodrmap,cc,overdensity=200.,critical=True,atClusterZ=True)
phi,_ = lensing.kappa_to_phi(kappa_template,bmodlmap,return_fphi=True)
grad_phi = enmap.grad(phi)
pos = posmap + grad_phi
alpha_pix = enmap.sky2pix(bshape,bwcs,pos, safe=False)
#if k==0: io.plot_img(kappa_template)
with bench.show("lensing cov"):
Scov = lensing.lens_cov(Ucov,alpha_pix,lens_order=lens_order,kbeam=kbeam,bshape=shape)
Tcov = Scov + Ncov + 5000 # !!!
with bench.show("covwork"):
s,logdet = np.linalg.slogdet(Tcov)
assert s>0
cinv = pinv2(Tcov).astype(np.float64)
cinvs.append(cinv)
logdets.append(logdet)
print(kamp,logdet)
# import cPickle as pickle
# pickle.dump((kamp,logdet,cinv),open("cdump_"+str(k)+".pkl",'wb'))
# Simulate
lmax = int(gmodlmap.max()+1)
ells = np.arange(0,lmax,1)
ps = theory.uCl('TT',ells).reshape((1,1,lmax))
ps_noise = np.array([(noise_uK_rad)**2.]*ells.size).reshape((1,1,ells.size))
mg = maps.MapGen(gshape,gwcs,ps)
ng = maps.MapGen(bshape,bwcs,ps_noise)
kamp_true = 0.2
kappa = lensing.nfw_kappa(kamp_true*1e15,gmodrmap,cc,overdensity=200.,critical=True,atClusterZ=True)
phi,_ = lensing.kappa_to_phi(kappa,gmodlmap,return_fphi=True)
grad_phi = enmap.grad(phi)
posmap = enmap.posmap(gshape,gwcs)
pos = posmap + grad_phi
alpha_pix = enmap.sky2pix(gshape,gwcs,pos, safe=False)
kbeam = maps.gauss_beam(args.beam,gmodlmap)
mstats = stats.Stats()
for i in range(args.Nclusters):
if (i+1)%100==0: print(i+1)
unlensed = mg.get_map()
noise_map = ng.get_map()
lensed = maps.filter_map(enlensing.displace_map(unlensed.copy(), alpha_pix, order=lens_order),kbeam)
fdownsampled = enmap.enmap(resample.resample_fft(lensed,bshape),bwcs)
stamp = fdownsampled + noise_map
#cutout = lensed + noise_map
cutout = stamp[int(bshape[0]/2.-shape[0]/2.):int(bshape[0]/2.+shape[0]/2.),int(bshape[0]/2.-shape[0]/2.):int(bshape[0]/2.+shape[0]/2.)]
# print(cinvs[k].shape,cutout.shape)
totlnlikes = []
for k,kamp in enumerate(kamps):
lnlike = maps.get_lnlike(cinvs[k],cutout) + logdets[k]
totlnlike = lnlike #+ lnprior[k]
totlnlikes.append(totlnlike)
nlnlikes = -0.5*np.array(totlnlikes)
mstats.add_to_stats("totlikes",nlnlikes)
mstats.get_stats()
lnlikes = mstats.vectors["totlikes"].sum(axis=0)
lnlikes -= lnlikes.max()
pl = io.Plotter(xlabel="$A$",ylabel="$\\mathrm{ln}\\mathcal{L}$")
for j in range(mstats.vectors["totlikes"].shape[0]):
pl.add(kamps,mstats.vectors["totlikes"][j,:]/mstats.vectors["totlikes"][j,:].max())
pl.done(io.dout_dir+"lensed_lnlikes_each_max.png")
pl = io.Plotter(xlabel="$A$",ylabel="$\\mathrm{ln}\\mathcal{L}$")
for j in range(mstats.vectors["totlikes"].shape[0]):
pl.add(kamps,mstats.vectors["totlikes"][j,:])
pl.done(io.dout_dir+"lensed_lnlikes_each.png")
pl1 = io.Plotter(xlabel="$A$",ylabel="$\\mathrm{ln}\\mathcal{L}$")
pl1.add(kamps,lnlikes,label="bayesian chisquare")
amaxes = kamps[np.isclose(lnlikes,lnlikes.max())]
p = np.polyfit(kamps,lnlikes,2)
pl1.add(kamps,p[0]*kamps**2.+p[1]*kamps+p[2],ls="--",label="bayesian chisquare fit")
for amax in amaxes:
pl1.vline(x=amax,ls="-")
pl1.vline(x=kamp_true,ls="--")
pl1.legend(loc='upper left')
pl1.done(io.dout_dir+"lensed_lnlikes_all.png")
pl2 = io.Plotter(xlabel="$A$",ylabel="$\\mathcal{L}$")
# Bayesian
c,b,a = p
mean = -b/2./c
sigma = np.sqrt(-1./2./c)
print(mean,sigma)
sn = (kamp_true/sigma)
pbias = (mean-kamp_true)*100./kamp_true
print ("BE Bias : ",pbias, " %")
print ("BE Bias : ",(mean-kamp_true)/sigma, " sigma")
print ("S/N for 1000 : ",sn*np.sqrt(1000./args.Nclusters))
like = np.exp(lnlikes)
like /= like.max()
nkamps = np.linspace(kamps.min(),kamps.max(),1000)
pl2.add(nkamps,np.exp(-(nkamps-mean)**2./2./sigma**2.),label="BE likelihood from chisquare fit")
#pl2.add(bkamps,like,label="BE likelihood")
pl2.vline(x=kamp_true,ls="--")
pl2.legend(loc='upper left')
pl2.done(io.dout_dir+"lensed_likes.png")
|
11510472 | from typing import List, Tuple
import random
from interfaces.TaggingOperation import TaggingOperation
from tasks.TaskTypes import TaskType
"""
A tagging implementation of NER systems.
I am travelling to London. --> I am travelling to South/Central London.
"""
def pick_random_word(seed):
"""
pick random "pre" or "post" perturb type with respective word
"""
pre_word_list = ["East", "West", "South", "North", "Eastern", "Western", "Central", "Southern",
"Northern", "Northeast", "Southwest", "Southeast", "Northwest", "NE", "SW", "SE", "NW",
"ESE", "SSE", "SSW", "WSW", "WNW", "NNW", "NNE", "North East", "ENE", "South West",
"South East", "North West", "Eastern South East", "Southern South East",
"Southern South West", "Western South West", "Western North West", "Northern North West",
"Northern North East", "Eastern North East"]
post_word_list = ["City", "Republic", "University", "Airport", "Palace"]
random.seed(seed)
if bool(random.getrandbits(1)):
perturb_type = "pre"
selected_word = random.choice(pre_word_list)
else:
perturb_type = "post"
selected_word = random.choice(post_word_list)
return selected_word, perturb_type
def create_token_and_tag_seq(token_seq, tag_seq, b_tag_index, i_tag_index, b_tag, i_tag, seed):
"""
Select perturb_type and respected phrase associated with it randomly.
"""
phrase, perturb_type = pick_random_word(seed)
if perturb_type == "pre":
token_seq, tag_seq = add_location_prefix(token_seq, tag_seq, phrase, b_tag_index, b_tag, i_tag)
if perturb_type == "post":
token_seq, tag_seq = add_location_postfix(token_seq, tag_seq, phrase, i_tag_index, i_tag)
return token_seq, tag_seq
def add_location_prefix(token_seq, tag_seq, phrase, b_tag_index, b_tag, i_tag):
"""
Create token sequence and tag sequence for prefix perturbation
"""
word_list = phrase.strip().split(" ")
if len(word_list) == 1: # if selected phrase contains single word
token_seq.insert(b_tag_index, phrase) # put phrase in token_seq at index b_tag_index
tag_seq[b_tag_index] = i_tag # replace B-LOC with I-LOC
tag_seq.insert(b_tag_index, b_tag) # put B-LOC in tag_seq at index b_tag_index
return token_seq, tag_seq
else: # if selected phrase is multi-word
for i, word in enumerate(word_list):
if i == 0:
tag_seq[b_tag_index] = i_tag # change B-LOC to I-LOC
token_seq.insert(b_tag_index, word)
tag_seq.insert(b_tag_index, b_tag)
else:
token_seq.insert(b_tag_index + i, word)
tag_seq.insert(b_tag_index + i, i_tag)
return token_seq, tag_seq
def add_location_postfix(token_seq, tag_seq, phrase, i_tag_index, i_tag):
"""
Create token sequence and tag sequence for postfix perturbation
"""
word_list = phrase.strip().split(" ")
if len(word_list) == 1:
token_seq.insert(i_tag_index + 1, phrase)
tag_seq.insert(i_tag_index + 1, i_tag)
return token_seq, tag_seq
else:
for i, word in enumerate(word_list):
i += 1
token_seq.insert(i_tag_index + i, word)
tag_seq.insert(i_tag_index + i, i_tag)
return token_seq, tag_seq
def extract_tag_indexes(tag_seq, b_tag, i_tag):
"""
Returns index of B-LOC and I-LOC, I-LOC = -1 if no I-LOC exist
"""
i_tag_index = -1 # default value
b_tag_index = tag_seq.index(b_tag)
if b_tag_index == len(tag_seq) - 1:
i_tag_index = b_tag_index
return b_tag_index, i_tag_index # case when B-LOC at the end of tag_sequence", no I-LOC
if tag_seq[b_tag_index + 1] == "O":
i_tag_index = b_tag_index # case when B-LOC in the middle but no "I-LOC"
return b_tag_index, i_tag_index
else:
for i in range(b_tag_index + 1, len(tag_seq)):
if tag_seq[i] == i_tag:
i_tag_index = i # return index of last I-LOC
return b_tag_index, i_tag_index
class LongerLocationNer(TaggingOperation):
tasks = [TaskType.TEXT_TAGGING]
languages = "en"
def __init__(self, max_outputs=1, seed=0):
super().__init__(seed, max_outputs=max_outputs)
def generate(
self, token_sequence: List[str], tag_sequence: List[str]
) -> List[Tuple[List[str], List[str]]]:
token_seq = token_sequence.copy()
tag_seq = tag_sequence.copy()
perturbed_sentences = []
tag = "LOCATION" if "B-LOCATION" in tag_seq else "LOC"
b_tag = "B-" + tag
i_tag = "I-" + tag
assert len(token_seq) == len(tag_seq), \
"Lengths of `token_sequence` and `tag_sequence` should be the same"
if b_tag in tag_seq:
b_tag_index, i_tag_index = extract_tag_indexes(tag_seq, b_tag, i_tag)
for _ in range(self.max_outputs):
token_seq, tag_seq = create_token_and_tag_seq(token_seq, tag_seq, b_tag_index, i_tag_index,
b_tag, i_tag, self.seed)
#assert len(token_seq) == len(tag_seq)
perturbed_sentences.append((token_seq, tag_seq))
token_seq = token_sequence.copy()
tag_seq = tag_sequence.copy()
return perturbed_sentences
# if __name__ == '__main__':
# import json
# from TestRunner import convert_to_snake_case
#
# tf = LongerLocationNer(max_outputs=1)
# test_cases = []
# src = ["I am going to New Zealand via Costa Rica .",
# "I am travelling to London .",
# "Edison was born in Ohio .",
# "<NAME> is a professor at Berkeley .",
# "Google head office is located in California ."
# ]
# tgt = ["O O O O B-LOC I-LOC O B-LOC I-LOC O",
# "O O O O B-LOC O",
# "B-PER O O O B-LOC O",
# "B-PER I-PER O O O O B-LOC O",
# "B-ORG O O O O O B-LOC O"
# ]
#
# for i, (token_sequence, tag_sequence) in enumerate(zip(src, tgt)):
# sentences = tf.generate(token_sequence.split(" "), tag_sequence.split(" "))
# test_cases.append({
# "class": tf.name(),
# "inputs": {"token_sequence": token_sequence, "tag_sequence":tag_sequence},
# "outputs": []}
# )
# for sentence, target in sentences:
# test_cases[i]["outputs"].append({"token_sequence": " ".join(sentence)
# , "tag_sequence":" ".join(target)})
# json_file = {"type": convert_to_snake_case(tf.name()), "test_cases":test_cases}
# print(json.dumps(json_file))
# for i, (token_seq, tag_seq) in enumerate(zip(src, tgt)):
# tf = LongerLocationNer(max_outputs=1)
# print(token_seq, tag_seq)
# res = tf.generate(token_seq.split(" "), tag_seq.split(" "))
# print(res)
|
11510484 | import sys
from math import sqrt
def itertxt(filename):
with open(filename, "r") as f:
for line in f:
yield line.rstrip()
def loadtxt(filename):
return list(itertxt(filename))
def savetxt(filename, txt):
with open(filename, "w") as f:
for line in txt:
print(line, file=f)
def stats(x):
N = len(x)
x = sorted(x)
mean = sum(x) / N
std = sqrt(sum([(x_i - mean) ** 2 for x_i in x]) / max(N - 1, .1))
percentile_5 = x[int(N * 0.05)]
percentile_95 = x[int(N * 0.95)]
return mean, std, percentile_5, percentile_95
def relative_decrease(y, x):
if y > 0:
return max(0, y - x) / y
else:
return 0
def check_tokenization(sents):
"""Check whether an input text is tokenized (borrowed from sacreBLEU)"""
too_much = 100
tokenized_count = 0
for sent in sents:
if sent.endswith(' .'):
tokenized_count += 1
# Too much is too much
if tokenized_count == too_much:
print(
f"That's {too_much} lines that end in a "
"tokenized period ('.')",
file=sys.stderr,
)
print(
"It looks like you forgot to detokenize your data, "
"which may hurt your score and make your results "
"difficult to replicate.",
file=sys.stderr,
)
return too_much
return tokenized_count
|
11510537 | import torch.nn as nn
import torch
class ParameterRegressor(nn.Module):
def __init__(self, num_features, num_parts):
super(ParameterRegressor, self).__init__()
"""
convolutional encoder + linear layer at the end
Args:
num_features: list of ints containing number of features per layer
num_parts: number of body parts for which we regress affine parameters
Returns:
torch.tensor (batch, num_parts, 2, 3), (2, 3) affine matrix for each body part
"""
self.num_features = num_features
self.num_parts = num_parts
self.layers = self.define_network(num_features)
def _add_conv_layer(self, in_ch, nf):
return nn.Sequential(
nn.Conv2d(in_ch, nf, 3, 1, 1),
nn.BatchNorm2d(nf),
nn.LeakyReLU(inplace=True)
)
def _add_down_layer(self, in_ch, nf):
return nn.Sequential(
nn.Conv2d(in_ch, nf, 3, 2, 1),
nn.BatchNorm2d(nf),
nn.LeakyReLU(inplace=True)
)
def define_network(self, num_features):
layers = [self._add_conv_layer(in_ch=3, nf=num_features[0])]
for i in range(1, len(num_features)):
layers.append(self._add_conv_layer(num_features[i-1], num_features[i-1]))
layers.append(self._add_down_layer(num_features[i-1], num_features[i]))
layers.append(nn.Sequential(
nn.Conv2d(num_features[-1], 256, 1, 1, 1),
nn.BatchNorm2d(256),
nn.LeakyReLU(inplace=True),
nn.Flatten(),
nn.LazyLinear(512),
nn.BatchNorm1d(512),
nn.LeakyReLU(inplace=True),
nn.LazyLinear(self.num_parts*6)
))
return nn.Sequential(*layers)
def forward(self, input):
return self.layers(input).view(-1, self.num_parts, 2, 3)
class ImageTranslator(nn.Module):
def __init__(self, num_features, num_parts):
super(ImageTranslator, self).__init__()
"""
convolutional enncoder, decoder
"""
self.num_features = num_features
self.num_parts = num_parts
self.layers = self.define_network(self.num_features)
def _add_conv_layer(self, in_ch, nf):
return nn.Sequential(
nn.Conv2d(in_ch, nf, 3, 1, 1),
nn.BatchNorm2d(nf),
nn.LeakyReLU(inplace=True)
)
def _add_down_layer(self, in_ch, nf):
return nn.Sequential(
nn.Conv2d(in_ch, nf, 3, 2, 1),
nn.BatchNorm2d(nf),
nn.LeakyReLU(inplace=True)
)
def _add_up_layer(self, in_ch, nf):
return nn.Sequential(
nn.Upsample(scale_factor=2, mode='bilinear'),
nn.Conv2d(in_ch, nf, 3, 1, 1),
nn.BatchNorm2d(nf),
nn.LeakyReLU(inplace=True)
)
def define_network(self, num_features):
# encoder
layers = [self._add_conv_layer(in_ch=3+self.num_parts, nf=num_features[0])]
for i in range(1, len(num_features)):
layers.append(self._add_conv_layer(num_features[i - 1], num_features[i - 1]))
layers.append(self._add_down_layer(num_features[i - 1], num_features[i]))
# decoder mirrors the encoder
for i in range(len(num_features)-1, 0, -1):
layers.append(self._add_conv_layer(num_features[i], num_features[i]))
layers.append(self._add_up_layer(num_features[i], num_features[i-1]))
layers.append(nn.Conv2d(num_features[i-1], 3, 3, 1, 1))
return nn.Sequential(*layers)
def forward(self, input, template):
return self.layers(torch.cat([input, template], dim=1))
|
11510583 | def f():
if True:
if False:
x =3
y = 4
return
return 19
|
11510688 | import numpy as np
import pytest
from sklearn.svm import SVC
from m2cgen import ast
from m2cgen.assemblers import SklearnSVMModelAssembler
from tests.assemblers import utils
from tests.utils import cmp_exprs
def test_rbf_kernel():
estimator = SVC(kernel="rbf", random_state=1, gamma=2.0)
estimator.fit([[1], [2]], [1, 2])
assembler = SklearnSVMModelAssembler(estimator)
actual = assembler.assemble()
kernels = [utils._svm_rbf_kernel_ast(estimator, 1.), utils._svm_rbf_kernel_ast(estimator, 2.)]
expected = utils._create_expected_svm_single_output_ast(
estimator.dual_coef_, estimator.intercept_, kernels)
assert cmp_exprs(actual, expected)
def test_linear_kernel():
estimator = SVC(kernel="linear", random_state=1)
estimator.fit([[1], [2]], [1, 2])
assembler = SklearnSVMModelAssembler(estimator)
actual = assembler.assemble()
def kernel_ast(sup_vec_value):
return ast.BinNumExpr(
ast.NumVal(sup_vec_value),
ast.FeatureRef(0),
ast.BinNumOpType.MUL)
expected = utils._create_expected_svm_single_output_ast(
estimator.dual_coef_, estimator.intercept_,
[kernel_ast(1.0), kernel_ast(2.0)])
assert cmp_exprs(actual, expected)
def test_sigmoid_kernel():
estimator = SVC(kernel="sigmoid", random_state=1, gamma=2.0)
estimator.fit([[1], [2]], [1, 2])
assembler = SklearnSVMModelAssembler(estimator)
actual = assembler.assemble()
def kernel_ast(sup_vec_value):
return ast.TanhExpr(
ast.BinNumExpr(
ast.BinNumExpr(
ast.NumVal(estimator.gamma),
ast.BinNumExpr(
ast.NumVal(sup_vec_value),
ast.FeatureRef(0),
ast.BinNumOpType.MUL),
ast.BinNumOpType.MUL),
ast.NumVal(0.0),
ast.BinNumOpType.ADD))
expected = utils._create_expected_svm_single_output_ast(
estimator.dual_coef_, estimator.intercept_,
[kernel_ast(1.0), kernel_ast(2.0)])
assert cmp_exprs(actual, expected)
def test_poly_kernel():
estimator = SVC(kernel="poly", random_state=1, gamma=2.0, degree=2)
estimator.fit([[1], [2]], [1, 2])
assembler = SklearnSVMModelAssembler(estimator)
actual = assembler.assemble()
def kernel_ast(sup_vec_value):
return ast.PowExpr(
ast.BinNumExpr(
ast.BinNumExpr(
ast.NumVal(estimator.gamma),
ast.BinNumExpr(
ast.NumVal(sup_vec_value),
ast.FeatureRef(0),
ast.BinNumOpType.MUL),
ast.BinNumOpType.MUL),
ast.NumVal(0.0),
ast.BinNumOpType.ADD),
ast.NumVal(estimator.degree))
expected = utils._create_expected_svm_single_output_ast(
estimator.dual_coef_, estimator.intercept_,
[kernel_ast(1.0), kernel_ast(2.0)])
assert cmp_exprs(actual, expected)
def test_unknown_kernel():
estimator = SVC(kernel=lambda x, y: np.transpose(x) * y)
estimator.fit([[1], [2]], [1, 2])
with pytest.raises(ValueError,
match="Unsupported kernel type '<function test_unknown_kernel.<locals>.<lambda> at .*"):
SklearnSVMModelAssembler(estimator)
def test_multi_class_rbf_kernel():
estimator = SVC(kernel="rbf", random_state=1, gamma=2.0)
estimator.fit([[1], [2], [3]], [1, 2, 3])
assembler = SklearnSVMModelAssembler(estimator)
actual = assembler.assemble()
kernels = [
utils._svm_rbf_kernel_ast(estimator, float(i), to_reuse=True)
for i in range(1, 4)
]
expected = ast.VectorVal([
ast.BinNumExpr(
ast.BinNumExpr(
ast.NumVal(0.0),
ast.BinNumExpr(
kernels[1],
ast.NumVal(-1.0),
ast.BinNumOpType.MUL),
ast.BinNumOpType.ADD),
ast.BinNumExpr(
kernels[0],
ast.NumVal(1.0),
ast.BinNumOpType.MUL),
ast.BinNumOpType.ADD),
ast.BinNumExpr(
ast.BinNumExpr(
ast.NumVal(0.0),
ast.BinNumExpr(
kernels[2],
ast.NumVal(-1.0),
ast.BinNumOpType.MUL),
ast.BinNumOpType.ADD),
ast.BinNumExpr(
kernels[0],
ast.NumVal(1.0),
ast.BinNumOpType.MUL),
ast.BinNumOpType.ADD),
ast.BinNumExpr(
ast.BinNumExpr(
ast.NumVal(0.0),
ast.BinNumExpr(
kernels[2],
ast.NumVal(-1.0),
ast.BinNumOpType.MUL),
ast.BinNumOpType.ADD),
ast.BinNumExpr(
kernels[1],
ast.NumVal(1.0),
ast.BinNumOpType.MUL),
ast.BinNumOpType.ADD)])
assert cmp_exprs(actual, expected)
|
11510740 | from __future__ import print_function
import argparse
from datetime import datetime, timedelta
import os
import pytsk3
import pyewf
import struct
import sys
import unicodecsv as csv
from utility.pytskutil import TSKUtil
"""
MIT License
Copyright (c) 2017 <NAME>, <NAME>
Please share comments and questions at:
https://github.com/PythonForensics/PythonForensicsCookbook
or email <EMAIL>
Permission is hereby granted, free of charge, to any person obtaining a copy
of this software and associated documentation files (the "Software"), to deal
in the Software without restriction, including without limitation the rights
to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
copies of the Software, and to permit persons to whom the Software is
furnished to do so, subject to the following conditions:
The above copyright notice and this permission notice shall be included in all
copies or substantial portions of the Software.
THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
SOFTWARE.
"""
__authors__ = ["<NAME>", "<NAME>"]
__date__ = 20170815
__description__ = " Read information from prefetch files"
def main(evidence, image_type, output_csv, path):
# Create TSK object and query path for prefetch files
tsk_util = TSKUtil(evidence, image_type)
prefetch_dir = tsk_util.query_directory(path)
prefetch_files = None
if prefetch_dir is not None:
prefetch_files = tsk_util.recurse_files(
".pf", path=path, logic="endswith")
if prefetch_files is None:
print("[-] No .pf files found")
sys.exit(2)
print("[+] Identified {} potential prefetch files".format(
len(prefetch_files)))
prefetch_data = []
for hit in prefetch_files:
prefetch_file = hit[2]
pf_version = check_signature(prefetch_file)
if pf_version is None:
continue
pf_name = hit[0]
if pf_version == 17:
parsed_data = parse_pf_17(prefetch_file, pf_name)
parsed_data.append(os.path.join(path, hit[1].lstrip("//")))
prefetch_data.append(parsed_data)
elif pf_version == 23:
print("[-] Windows Vista / 7 PF file {} -- unsupported".format(
pf_name))
continue
elif pf_version == 26:
print("[-] Windows 8 PF file {} -- unsupported".format(
pf_name))
continue
elif pf_version == 30:
print("[-] Windows 10 PF file {} -- unsupported".format(
pf_name))
continue
else:
print("[-] Signature mismatch - Name: {}\nPath: {}".format(
hit[0], hit[1]))
continue
write_output(prefetch_data, output_csv)
def parse_pf_17(prefetch_file, pf_name):
# Parse Windows XP, 2003 Prefetch File
create = convert_unix(prefetch_file.info.meta.crtime)
modify = convert_unix(prefetch_file.info.meta.mtime)
pf_size, name, vol_info, vol_entries, vol_size, filetime, \
count = struct.unpack("<i60s32x3iq16xi",
prefetch_file.read_random(12, 136))
name = name.decode("utf-16", "ignore").strip("/x00").split("/x00")[0]
vol_name_offset, vol_name_length, vol_create, \
vol_serial = struct.unpack("<2iqi",
prefetch_file.read_random(vol_info, 20))
vol_serial = hex(vol_serial).lstrip("0x")
vol_serial = vol_serial[:4] + "-" + vol_serial[4:]
vol_name = struct.unpack(
"<{}s".format(2 * vol_name_length),
prefetch_file.read_random(vol_info + vol_name_offset,
vol_name_length * 2)
)[0]
vol_name = vol_name.decode("utf-16", "ignore").strip("/x00").split(
"/x00")[0]
return [
pf_name, name, pf_size, create,
modify, convert_filetime(filetime), count, vol_name,
convert_filetime(vol_create), vol_serial
]
def convert_unix(ts):
if int(ts) == 0:
return ""
return datetime.utcfromtimestamp(ts)
def convert_filetime(ts):
if int(ts) == 0:
return ""
return datetime(1601, 1, 1) + timedelta(microseconds=ts / 10)
def check_signature(prefetch_file):
version, signature = struct.unpack(
"<2i", prefetch_file.read_random(0, 8))
if signature == 1094927187:
return version
else:
return None
def write_output(data, output_csv):
print("[+] Writing csv report")
with open(output_csv, "wb") as outfile:
writer = csv.writer(outfile)
writer.writerow([
"File Name", "Prefetch Name", "File Size (bytes)",
"File Create Date (UTC)", "File Modify Date (UTC)",
"Prefetch Last Execution Date (UTC)",
"Prefetch Execution Count", "Volume", "Volume Create Date",
"Volume Serial", "File Path"
])
writer.writerows(data)
if __name__ == "__main__":
parser = argparse.ArgumentParser(
description=__description__,
epilog="Developed by {} on {}".format(
", ".join(__authors__), __date__)
)
parser.add_argument("EVIDENCE_FILE", help="Evidence file path")
parser.add_argument("TYPE", help="Type of Evidence",
choices=("raw", "ewf"))
parser.add_argument("OUTPUT_CSV", help="Path to write output csv")
parser.add_argument("-d", help="Prefetch directory to scan",
default="/WINDOWS/PREFETCH")
args = parser.parse_args()
if os.path.exists(args.EVIDENCE_FILE) and \
os.path.isfile(args.EVIDENCE_FILE):
main(args.EVIDENCE_FILE, args.TYPE, args.OUTPUT_CSV, args.d)
else:
print("[-] Supplied input file {} does not exist or is not a "
"file".format(args.EVIDENCE_FILE))
sys.exit(1)
|
11510791 | from __future__ import annotations
import random
from typing import Dict, Generic, Optional, Sequence, TypeVar
from pydantic import BaseModel, Field, PrivateAttr
from pydantic.generics import GenericModel
from tarkov.bots.bots import BotInventory
from tarkov.exceptions import NotFoundError
from tarkov.inventory.implementations import MultiGridContainer
T = TypeVar("T") # pylint: disable=invalid-name
class MinMax(GenericModel, Generic[T]):
max: T
min: T
class LootGenerationConfig(BaseModel):
healing: MinMax[int]
loose_loot: MinMax[int] = Field(alias="looseLoot")
magazines: MinMax[int]
grenades: MinMax[int]
class BotInventoryContainers(BaseModel):
"""
Class to hold containers for backpack, rig and pockets
"""
class Config:
arbitrary_types_allowed = True
__bot_inventory__: BotInventory = PrivateAttr()
TacticalVest: Optional[MultiGridContainer]
Pockets: MultiGridContainer
Backpack: Optional[MultiGridContainer]
def containers(self, include: Sequence[str] = None) -> Sequence[MultiGridContainer]:
"""
:param include: List of slot ids to include, includes everything by default
:return: Sequence of containers with slot_id that are present in include parameter
"""
if not include:
include = tuple(self.__fields__.keys())
for slot_id in include:
if slot_id not in self.__fields__:
raise ValueError(
f"{slot_id} element of include argument is not present in fields of {self.__class__.__name__}"
)
containers = []
for slot_id in self.__fields__:
if slot_id not in include:
continue
container: Optional[MultiGridContainer] = self.__getattribute__(slot_id)
if container is None:
continue
containers.append(container)
return containers
@classmethod
def from_inventory(cls, bot_inventory: BotInventory) -> BotInventoryContainers:
containers: Dict[str, MultiGridContainer] = {}
for slot_id in cls.__fields__:
try:
containers[slot_id] = MultiGridContainer.from_item(
bot_inventory.get_equipment(slot_id), slot_id
)
except NotFoundError:
pass
obj = cls.parse_obj(
containers,
)
obj.__bot_inventory__ = bot_inventory
return obj
def flush(self) -> None:
"""
Flushes inventories items into bot inventory
"""
for container in self.containers():
for sub_inventory in container.inventories:
self.__bot_inventory__.items.update(sub_inventory.items)
def random_container(self, include: Sequence[str] = None) -> MultiGridContainer:
"""
:param include: slot id's to include, will include all containers if none
:return: Randomly chosen container, weighted by it's size
"""
containers = self.containers(include=include)
weights = [container.size for container in containers]
return random.choices(containers, weights=weights, k=1)[0]
|
11510796 | import requests
# Vuln Base Info
def info():
return {
"author": "cckuailong",
"name": '''Yuzo Related Posts plugin XSS''',
"description": '''The Yuzo Related Posts plugin before 5.12.94 for WordPress has XSS
because it mistakenly expects that is_admin() verifies that the
request comes from an admin user (it actually only verifies that the
request is for an admin page). An unauthenticated attacker can inject
a payload into the plugin settings, such as the
yuzo_related_post_css_and_style setting.''',
"severity": "medium",
"references": [
"https://www.wordfence.com/blog/2019/04/yuzo-related-posts-zero-day-vulnerability-exploited-in-the-wild",
"https://wpscan.com/vulnerability/9254"
],
"classification": {
"cvss-metrics": "CVSS:3.0/AV:N/AC:L/PR:N/UI:R/S:C/C:L/I:L/A:N",
"cvss-score": "",
"cve-id": "CVE-2019-11869",
"cwe-id": "CWE-79"
},
"metadata":{
"vuln-target": "",
},
"tags": ["cve", "cve2019", "wordpress", "wp-plugin", "xss"],
}
# Vender Fingerprint
def fingerprint(url):
return True
# Proof of Concept
def poc(url):
result = {}
try:
url = format_url(url)
path = """/wp-admin/options-general.php?page=yuzo-related-post"""
method = "POST"
data = """yuzo_related_post_css_and_style=</style><script>alert(0);</script>"""
headers = {'Content-Type': 'application/x-www-form-urlencoded'}
resp0 = requests.request(method=method,url=url+path,data=data,headers=headers,timeout=10,verify=False,allow_redirects=False)
path = """/"""
method = "GET"
data = """"""
headers = {}
resp1 = requests.request(method=method,url=url+path,data=data,headers=headers,timeout=10,verify=False,allow_redirects=False)
if "<script>alert(0);</script>" in resp1.text and "text/html" in str(resp1.headers).lower():
result["success"] = True
result["info"] = info()
result["payload"] = url+path
except:
result["success"] = False
return result
# Exploit, can be same with poc()
def exp(url):
return poc(url)
# Utils
def format_url(url):
url = url.strip()
if not ( url.startswith('http://') or url.startswith('https://') ):
url = 'http://' + url
url = url.rstrip('/')
return url |
11510861 | from fpakman.core import resource
from fpakman.core.flatpak.constants import FLATPAK_CACHE_PATH
from fpakman.core.model import Application, ApplicationData
class FlatpakApplication(Application):
def __init__(self, base_data: ApplicationData, branch: str, arch: str, origin: str, runtime: bool, ref: str, commit: str):
super(FlatpakApplication, self).__init__(base_data=base_data)
self.ref = ref
self.branch = branch
self.arch = arch
self.origin = origin
self.runtime = runtime
self.commit = commit
def is_incomplete(self):
return self.base_data.description is None and self.base_data.icon_url
def has_history(self):
return self.installed
def has_info(self):
return self.installed
def can_be_downgraded(self):
return self.installed
def can_be_uninstalled(self):
return self.installed
def can_be_installed(self):
return not self.installed
def get_type(self):
return 'flatpak'
def can_be_refreshed(self):
return False
def get_default_icon_path(self):
return resource.get_path('img/flathub.svg')
def is_library(self):
return self.runtime
def get_disk_cache_path(self):
return '{}/{}'.format(FLATPAK_CACHE_PATH, self.base_data.id)
def get_data_to_cache(self):
return {
'description': self.base_data.description,
'icon_url': self.base_data.icon_url,
'latest_version': self.base_data.latest_version,
'version': self.base_data.version,
'name': self.base_data.name
}
def fill_cached_data(self, data: dict):
for attr in self.get_data_to_cache().keys():
if not getattr(self.base_data, attr):
setattr(self.base_data, attr, data[attr])
|
11510874 | import discord
from discord.ext import commands
class Latency(commands.Cog):
def __init__(self, bot):
self.bot = bot
@commands.command(name="ping", aliases=['pong, latency'])
async def ping(self, ctx):
pong = round(self.bot.latency * 1000)
await ctx.send(f":ping_pong: Pong in {pong}ms")
def setup(bot):
bot.add_cog(Latency(bot))
bot.logging.info('Loaded ping command') |
11510885 | from array import array
import math
from numpy.lib.arraysetops import isin
from sympy.utilities.iterables import multiset_permutations
from sympy.utilities.iterables import multiset_combinations
import itertools
from math import factorial
import hashlib
import numpy as np
import gc
"""
A class to store the packing scheme.
Each row represents a tensor and each column represnts a page
0 means that the blcok is not in the corresponding page. 1 just the opposite.
Also includes the number of pages needed
"""
class BinPackingScheme(object):
# initialization
def __init__(self, item_ids, l):
# Each row is a tensor
# Each col is the bin/page
self.p_i_j = [[0 for _ in range(math.ceil(len(item_ids) / l))] for _ in range(len(item_ids))]
self.item_ids = list(item_ids)
self.l = l
self.numBins = math.ceil(len(item_ids) / l)
# Determine whether it has been marked.
# 0 means that the blcok is not in the corresponding page. 1 just the opposite.
def is_marked(self, item_id):
return any([x == 1 for x in self.p_i_j[self.item_ids.index(item_id)]])
def __eq__(self, other):
my_array_hash = "".join([str(j) for sub in self.p_i_j for j in sub])
other_array_hash = "".join([str(j) for sub in other.p_i_j for j in sub])
if my_array_hash != other_array_hash:
return False
if len(self.item_ids) != len(other.item_ids):
return False
if self.numBins != other.numBins:
return False
# Order of items is also important
for i in range(len(self.item_ids)):
if self.item_ids[i] != other.item_ids[i]:
return False
return True
def __ne__(self, other):
my_array_hash = "".join([str(j) for sub in self.p_i_j for j in sub])
other_array_hash = "".join([str(j) for sub in other.p_i_j for j in sub])
if my_array_hash != other_array_hash:
return True
if len(self.item_ids) != len(other.item_ids):
return True
if self.numBins != other.numBins:
return True
# Order of items is also important
for i in range(len(self.item_ids)):
if self.item_ids[i] != other.item_ids[i]:
return True
return False
def __hash__(self):
"""
This is important. If this does not work, we cannot tell the difference between two bin packing schemes.
What identifies a bin packing scheme is:
1. The items being packed, i.e. the items must be uniquely identifiable
2. The sequAmount of space savedence of packing pages into bins
"""
array_hash = "".join([str(j) for sub in self.p_i_j for j in sub])
items_hash = "".join([str(hash(i)) for i in self.item_ids])
full_hash = (array_hash + items_hash).encode("utf-8")
return int(hashlib.md5(full_hash).hexdigest(), 16)
# The marked function replaces the original 0 with 1
def mark(self, i, j):
if j - 1 > len(self.p_i_j[0]) - 1:
diff = (j - 1) - (len(self.p_i_j[0]) - 1)
# Add new bucket
for row in self.p_i_j:
row.extend([0 for _ in range(diff)])
# Convert 1-index to 0-index
self.p_i_j[i - 1][j - 1] = 1
def merge(self, otherBinPackingScheme):
assert self.l == otherBinPackingScheme.l
for i in range(len(self.item_ids)):
self.p_i_j[i] = self.p_i_j[i] + [0 for _ in range(otherBinPackingScheme.numBins)]
# Take care of common item ids
common_items = set(self.item_ids).intersection(set(otherBinPackingScheme.item_ids))
for item in common_items:
our_index = self.item_ids.index(item)
their_index = otherBinPackingScheme.item_ids.index(item)
self.p_i_j[our_index] += otherBinPackingScheme.p_i_j[their_index]
# Take care of new item ids
our_index = len(self.item_ids) - 1
new_items = []
for other_index, item in enumerate(otherBinPackingScheme.item_ids):
if item in common_items:
continue
our_index += 1
new_items.append(item)
new_row = [0 for _ in range(self.numBins)] + otherBinPackingScheme.p_i_j[other_index]
self.p_i_j.append(new_row)
self.numBins += otherBinPackingScheme.numBins
self.item_ids.extend(new_items)
return self
def blocks_in_bin_id(self, bin_id):
return [self.item_ids[k] for k in range(len(self.item_ids)) if self.p_i_j[k][bin_id] == 1]
"""
INPUT1: all_bins (a set of bins, each bin representing a page of tensor blocks)
INPUT2: t (a set of tensor blocks)
OUTPUT: bin_set (a minimum set of bins that maximally cover t)
"""
def findMinBinsMaxCover(self, t, l):
# A set of item ids
T = set(t)
# will contain groups of item ids
bin_set = set()
used_bins = set()
while T:
cover = l
bin = None
bin_id = None
for j in range(self.numBins):
if j in used_bins:
continue
# Intersect tensor items in T with the items present in bin j
bin_items = frozenset(self.blocks_in_bin_id(j))
new_cover = len(T.intersection(bin_items))
if new_cover == cover:
cover = new_cover
bin = bin_items
bin_id = j
# If we have bins but their contents dont cover t at all i.e. different items
if not bin:
break
used_bins.add(bin_id)
bin_set = bin_set.union(T.intersection(bin))
T = T - bin
# All bins used
if len(used_bins) == self.numBins:
break
return bin_set, used_bins
# Ordering sizes for Greedy-2 algorithm
# Sort the tensors from large to small according to the size
def order_tensors_by_size(T):
return sorted(T, key=lambda x: len(x), reverse=True)
# Ordering frequency for Greedy-2 algorithm
# Sort from high to low according to the frequency of occurrence in all tensors
def order_tensor_blocks_by_freq(T, t_i):
freq_map = {}
for block in t_i:
if not block in freq_map:
freq_map[block] = 1
else:
freq_map[block] += 1
for t_k in T:
if not isinstance(t_i, list) and t_k == t_i:
continue
for block in t_k:
if block in freq_map:
freq_map[block] += 1
ordered_items = sorted(freq_map.items(), key=lambda x: x[1], reverse=True)
return [x[0] for x in ordered_items]
"""
1:INPUT1: T (a set of tensors, each tensor is a set of item ids i.e. tensor blocks ids)
2:INPUT2: l (the maximum number of blocks for each page)
3:OUTPUT: {𝑃𝑖𝑗} (an approximate optimal bin-packing scheme) including number of pages needed and mapping of tensor IDs and page IDs
Used in the Greedy-2 algorithm in all 4 test cases:
1. word2vec (100 * 10000, 64MB)
2. text classification (100 * 10000, 64MB)
3. text classification (300 * 300, 64MB)
4. text classification (300 * 300, 32MB)
These testing examples can be found in runGreedy-2.py in the corresponding 4 folders
"""
def bin_pack_greedy(T, l):
I = set()
for t_i in T:
I = I.union(t_i)
I = list(I)
tensor_page_mapping = dict()
tensor_page_set = set()
tensors = order_tensors_by_size(T)
items = order_tensor_blocks_by_freq(T, tensors[0])
i, j = 0, 0
p_i_j = BinPackingScheme(I, l)
# Process at all items in t0
for i in range(1, len(items) + 1):
# Use 1-index according to logic
j = I.index(items[i - 1]) + 1
s = math.ceil(i / l)
tensor_page_set.add(s-1)
p_i_j.mark(j, s)
numBins = math.ceil(len(items) / l)
p_i_j.numBins = numBins
tensor_page_mapping[0] = tensor_page_set
# Already added tensor t1
for i in range(2, len(T) + 1):
bin_set, used_bins = p_i_j.findMinBinsMaxCover(tensors[i - 1],l)
tensor_page_set = used_bins
I_delta = set(tensors[i - 1]) - bin_set
I_delta = list(I_delta)
if not I_delta:
continue
else:
remaining_items = order_tensor_blocks_by_freq(T, I_delta)
for j in range(1, len(remaining_items) + 1):
# Important to index using I because we built BinPackingScheme using ordering of blocks in I
s = I.index(remaining_items[j - 1]) + 1
u = numBins + math.ceil(j / l)
tensor_page_set.add(u-1)
p_i_j.mark(s, u)
numBins = numBins + math.ceil(len(remaining_items) / l)
p_i_j.numBins = numBins
tensor_page_mapping[i-1] = tensor_page_set
return set([p_i_j]), tensor_page_mapping
"""
1:INPUT1: tensor_list (a set of tensors, each tensor is a set of item ids i.e. tensor blocks ids)
2:INPUT2: blocks_in_page (the maximum number of blocks for each page)
3:OUTPUT: {𝑃𝑖𝑗} (an approximate optimal bin-packing scheme) including number of pages needed
Used in the Greedy-1 algorithm in the floowing test cases:
1. text classification (100 * 10000, 64MB)
2. text classification (300 * 300, 64MB)
3. text classification (300 * 300, 32MB)
These testing examples can be found in runGreedy-1.py in the corresponding 3 folders
"""
def text_classification_greedy1(tensor_list, blocks_in_page):
I = set()
for t_i in tensor_list:
I = I.union(t_i)
I = list(I)
p_i_j = BinPackingScheme(I, blocks_in_page)
# set the required number of pages as 0
numBins = 0
# create a list of equivalent class tensors
equivalent_class_tensors = []
# divide blocks into multiple equivalent classes
l01234=tensor_list[0].intersection(tensor_list[1], tensor_list[2], tensor_list[3], tensor_list[4])
ll01234 = list(l01234)
equivalent_class_tensors.append(ll01234)
l0123=tensor_list[0].intersection(tensor_list[1], tensor_list[2], tensor_list[3])-l01234
ll0123 = list(l0123)
equivalent_class_tensors.append(ll0123)
l0124=tensor_list[0].intersection(tensor_list[1], tensor_list[2], tensor_list[4])-l01234
ll0124 = list(l0124)
equivalent_class_tensors.append(ll0124)
l0134=tensor_list[0].intersection(tensor_list[1], tensor_list[3], tensor_list[4])-l01234
ll0134 = list(l0134)
equivalent_class_tensors.append(ll0134)
l0234=tensor_list[0].intersection(tensor_list[2], tensor_list[3], tensor_list[4])-l01234
ll0234 = list(l0234)
equivalent_class_tensors.append(ll0234)
l1234=tensor_list[1].intersection(tensor_list[2], tensor_list[3], tensor_list[4])-l01234
ll1234 = list(l1234)
equivalent_class_tensors.append(ll1234)
l012=tensor_list[0].intersection(tensor_list[1], tensor_list[2])-l0123-l0124-l01234
ll012 = list(l012)
equivalent_class_tensors.append(ll012)
l013=tensor_list[0].intersection(tensor_list[1], tensor_list[3])-l0123-l0134-l01234
ll013 = list(l013)
equivalent_class_tensors.append(ll013)
l014=tensor_list[0].intersection(tensor_list[1], tensor_list[4])-l0124-l0134-l01234
ll014 = list(l014)
equivalent_class_tensors.append(ll014)
l023=tensor_list[0].intersection(tensor_list[2], tensor_list[3])-l0123-l0234-l01234
ll023 = list(l023)
equivalent_class_tensors.append(ll023)
l024=tensor_list[0].intersection(tensor_list[2], tensor_list[4])-l0124-l0234-l01234
ll024 = list(l024)
equivalent_class_tensors.append(ll024)
l034=tensor_list[0].intersection(tensor_list[3], tensor_list[4])-l0134-l0234-l01234
ll034 = list(l034)
equivalent_class_tensors.append(ll034)
l123=tensor_list[1].intersection(tensor_list[2], tensor_list[3])-l0123-l1234-l01234
ll123 = list(l123)
equivalent_class_tensors.append(ll123)
l124=tensor_list[1].intersection(tensor_list[2], tensor_list[4])-l0124-l1234-l01234
ll124 = list(l124)
equivalent_class_tensors.append(ll124)
l134=tensor_list[1].intersection(tensor_list[3], tensor_list[4])-l0134-l1234-l01234
ll134 = list(l134)
equivalent_class_tensors.append(ll134)
l234=tensor_list[2].intersection(tensor_list[3], tensor_list[4])-l0234-l1234-l01234
ll234 = list(l234)
equivalent_class_tensors.append(ll234)
l01=tensor_list[0].intersection(tensor_list[1])-l012-l013-l014-l0123-l0124-l0134-l01234
ll01 = list(l01)
equivalent_class_tensors.append(ll01)
l02=tensor_list[0].intersection(tensor_list[2])-l012-l023-l024-l0123-l0124-l0234-l01234
ll02 = list(l02)
equivalent_class_tensors.append(ll02)
l03=tensor_list[0].intersection(tensor_list[3])-l013-l023-l034-l0123-l0234-l0234-l01234
ll03 = list(l03)
equivalent_class_tensors.append(ll03)
l04=tensor_list[0].intersection(tensor_list[4])-l014-l024-l034-l0124-l0134-l0234-l01234
ll04 = list(l04)
equivalent_class_tensors.append(ll04)
l12=tensor_list[1].intersection(tensor_list[2])-l012-l123-l124-l0123-l0124-l1234-l01234
ll12 = list(l12)
equivalent_class_tensors.append(ll12)
l13=tensor_list[1].intersection(tensor_list[3])-l013-l034-l134-l0123-l0134-l1234-l01234
ll13 = list(l13)
equivalent_class_tensors.append(ll13)
l14=tensor_list[1].intersection(tensor_list[4])-l014-l124-l134-l0124-l0134-l1234-l01234
ll14 = list(l14)
equivalent_class_tensors.append(ll14)
l23=tensor_list[2].intersection(tensor_list[3])-l023-l123-l234-l0123-l0234-l1234-l01234
ll23 = list(l23)
equivalent_class_tensors.append(ll23)
l24=tensor_list[2].intersection(tensor_list[4])-l024-l124-l234-l0124-l0234-l1234-l01234
ll24 = list(l24)
equivalent_class_tensors.append(ll24)
l34=tensor_list[3].intersection(tensor_list[4])-l034-l134-l234-l0134-l0234-l1234-l01234
ll34 = list(l34)
equivalent_class_tensors.append(ll34)
l0=tensor_list[0]-l01-l02-l03-l04-l012-l013-l014-l023-l024-l034-l0123-l0124-l0134-l0234-l01234
ll0 = list(l0)
equivalent_class_tensors.append(ll0)
l1=tensor_list[1]-l01-l12-l13-l14-l012-l013-l014-l123-l124-l134-l0123-l0124-l0134-l1234-l01234
ll1 = list(l1)
equivalent_class_tensors.append(ll1)
l2=tensor_list[2]-l02-l12-l23-l24-l012-l023-l024-l123-l124-l234-l0123-l0124-l0234-l1234-l01234
ll2 = list(l2)
equivalent_class_tensors.append(ll2)
l3=tensor_list[3]-l03-l13-l23-l34-l013-l023-l034-l123-l134-l234-l0123-l0134-l0234-l1234-l01234
ll3 = list(l3)
equivalent_class_tensors.append(ll3)
l4=tensor_list[4]-l04-l14-l24-l34-l014-l024-l034-l124-l134-l234-l0124-l0134-l0234-l1234-l01234
ll4 = list(l4)
equivalent_class_tensors.append(ll4)
# pack the blocks based on the equivalent classes
for k in range(len(equivalent_class_tensors)):
this_len = len(equivalent_class_tensors[k])
this_ten = equivalent_class_tensors[k]
for i in range(this_len):
j = I.index(this_ten[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
numBins = numBins + math.ceil(this_len / blocks_in_page)
p_i_j.numBins = numBins
# return the bin-packing scheme
return set([p_i_j])
"""
1:INPUT1: tensor_list (a set of tensors, each tensor is a set of item ids i.e. tensor blocks ids)
2:INPUT2: blocks_in_page (the maximum number of blocks for each page)
3:OUTPUT: {𝑃𝑖𝑗} (an approximate optimal bin-packing scheme) including number of pages needed
Used in the Two-Stage algorithm in the floowing test cases:
1. text classification (100 * 10000, 64MB)
2. text classification (300 * 300, 64MB)
3. text classification (300 * 300, 32MB)
These testing examples can be found in runTwo-Stage.py in the corresponding 3 folders
"""
def text_classification_twostage(tensor_list, blocks_in_page):
I = set()
for t_i in tensor_list:
I = I.union(t_i)
I = list(I)
p_i_j = BinPackingScheme(I, blocks_in_page)
# set the required number of pages as 0
numBins = 0
# create a new tensor for stage-2
new_tensor_list = [[], [], [], [], []]
block_id = 0
# start the first stage
l01234=tensor_list[0].intersection(tensor_list[1], tensor_list[2], tensor_list[3], tensor_list[4])
newBins01234 = int(len(l01234) / blocks_in_page)
numBins = numBins + newBins01234
ll01234 = list(l01234)
for i in range(len(l01234)):
j = I.index(ll01234[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l01234) - blocks_in_page*newBins01234
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
new_tensor_list[1].append(i)
new_tensor_list[2].append(i)
new_tensor_list[3].append(i)
new_tensor_list[4].append(i)
block_id = block_id + this_remain
l0123=tensor_list[0].intersection(tensor_list[1], tensor_list[2], tensor_list[3])-l01234
newBins0123 = int(len(l0123) / blocks_in_page)
numBins = numBins + newBins0123
ll0123 = list(l0123)
for i in range(len(l0123)):
j = I.index(ll0123[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l0123) - blocks_in_page*newBins0123
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
new_tensor_list[1].append(i)
new_tensor_list[2].append(i)
new_tensor_list[3].append(i)
block_id = block_id + this_remain
l0124=tensor_list[0].intersection(tensor_list[1], tensor_list[2], tensor_list[4])-l01234
newBins0124 = int(len(l0124) / blocks_in_page)
numBins = numBins + newBins0124
ll0124 = list(l0124)
for i in range(len(l0124)):
j = I.index(ll0124[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l0124) - blocks_in_page*newBins0124
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
new_tensor_list[1].append(i)
new_tensor_list[2].append(i)
new_tensor_list[4].append(i)
block_id = block_id + this_remain
l0134=tensor_list[0].intersection(tensor_list[1], tensor_list[3], tensor_list[4])-l01234
newBins0134 = int(len(l0134) / blocks_in_page)
numBins = numBins + newBins0134
ll0134 = list(l0134)
for i in range(len(l0134)):
j = I.index(ll0134[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l0134) - blocks_in_page*newBins0134
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
new_tensor_list[1].append(i)
new_tensor_list[3].append(i)
new_tensor_list[4].append(i)
block_id = block_id + this_remain
l0234=tensor_list[0].intersection(tensor_list[2], tensor_list[3], tensor_list[4])-l01234
newBins0234 = int(len(l0234) / blocks_in_page)
numBins = numBins + newBins0234
ll0234 = list(l0234)
for i in range(len(l0234)):
j = I.index(ll0234[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l0234) - blocks_in_page*newBins0234
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
new_tensor_list[2].append(i)
new_tensor_list[3].append(i)
new_tensor_list[4].append(i)
block_id = block_id + this_remain
l1234=tensor_list[1].intersection(tensor_list[2], tensor_list[3], tensor_list[4])-l01234
newBins1234 = int(len(l1234) / blocks_in_page)
numBins = numBins + newBins1234
ll1234 = list(l1234)
for i in range(len(l1234)):
j = I.index(ll1234[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l1234) - blocks_in_page*newBins1234
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[1].append(i)
new_tensor_list[2].append(i)
new_tensor_list[3].append(i)
new_tensor_list[4].append(i)
block_id = block_id + this_remain
l012=tensor_list[0].intersection(tensor_list[1], tensor_list[2])-l0123-l0124-l01234
newBins012 = int(len(l012) / blocks_in_page)
numBins = numBins + newBins012
ll012 = list(l012)
for i in range(len(l012)):
j = I.index(ll012[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l012) - blocks_in_page*newBins012
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
new_tensor_list[1].append(i)
new_tensor_list[2].append(i)
block_id = block_id + this_remain
l013=tensor_list[0].intersection(tensor_list[1], tensor_list[3])-l0123-l0134-l01234
newBins013 = int(len(l013) / blocks_in_page)
numBins = numBins + newBins013
ll013 = list(l013)
for i in range(len(l013)):
j = I.index(ll013[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l013) - blocks_in_page*newBins013
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
new_tensor_list[1].append(i)
new_tensor_list[3].append(i)
block_id = block_id + this_remain
l014=tensor_list[0].intersection(tensor_list[1], tensor_list[4])-l0124-l0134-l01234
newBins014 = int(len(l014) / blocks_in_page)
numBins = numBins + newBins014
ll014 = list(l014)
for i in range(len(l014)):
j = I.index(ll014[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l014) - blocks_in_page*newBins014
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
new_tensor_list[1].append(i)
new_tensor_list[4].append(i)
block_id = block_id + this_remain
l023=tensor_list[0].intersection(tensor_list[2], tensor_list[3])-l0123-l0234-l01234
newBins023 = int(len(l023) / blocks_in_page)
numBins = numBins + newBins023
ll023 = list(l023)
for i in range(len(l023)):
j = I.index(ll023[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l023) - blocks_in_page*newBins023
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
new_tensor_list[2].append(i)
new_tensor_list[3].append(i)
block_id = block_id + this_remain
l024=tensor_list[0].intersection(tensor_list[2], tensor_list[4])-l0124-l0234-l01234
newBins024 = int(len(l024) / blocks_in_page)
numBins = numBins + newBins024
ll024 = list(l024)
for i in range(len(l024)):
j = I.index(ll024[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l024) - blocks_in_page*newBins024
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
new_tensor_list[2].append(i)
new_tensor_list[4].append(i)
block_id = block_id + this_remain
l034=tensor_list[0].intersection(tensor_list[3], tensor_list[4])-l0134-l0234-l01234
newBins034 = int(len(l034) / blocks_in_page)
numBins = numBins + newBins034
ll034 = list(l034)
for i in range(len(l034)):
j = I.index(ll034[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l034) - blocks_in_page*newBins034
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
new_tensor_list[3].append(i)
new_tensor_list[4].append(i)
block_id = block_id + this_remain
l123=tensor_list[1].intersection(tensor_list[2], tensor_list[3])-l0123-l1234-l01234
newBins123 = int(len(l123) / blocks_in_page)
numBins = numBins + newBins123
ll123 = list(l123)
for i in range(len(l123)):
j = I.index(ll123[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l123) - blocks_in_page*newBins123
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[1].append(i)
new_tensor_list[2].append(i)
new_tensor_list[3].append(i)
block_id = block_id + this_remain
l124=tensor_list[1].intersection(tensor_list[2], tensor_list[4])-l0124-l1234-l01234
newBins124 = int(len(l124) / blocks_in_page)
numBins = numBins + newBins124
ll124 = list(l124)
for i in range(len(l124)):
j = I.index(ll124[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l124) - blocks_in_page*newBins124
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[1].append(i)
new_tensor_list[2].append(i)
new_tensor_list[4].append(i)
block_id = block_id + this_remain
l134=tensor_list[1].intersection(tensor_list[3], tensor_list[4])-l0134-l1234-l01234
newBins134 = int(len(l134) / blocks_in_page)
numBins = numBins + newBins134
ll134 = list(l134)
for i in range(len(l134)):
j = I.index(ll134[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l134) - blocks_in_page*newBins134
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[1].append(i)
new_tensor_list[3].append(i)
new_tensor_list[4].append(i)
block_id = block_id + this_remain
l234=tensor_list[2].intersection(tensor_list[3], tensor_list[4])-l0234-l1234-l01234
newBins234 = int(len(l234) / blocks_in_page)
numBins = numBins + newBins234
ll234 = list(l234)
for i in range(len(l234)):
j = I.index(ll234[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l234) - blocks_in_page*newBins234
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[2].append(i)
new_tensor_list[3].append(i)
new_tensor_list[4].append(i)
block_id = block_id + this_remain
l01=tensor_list[0].intersection(tensor_list[1])-l012-l013-l014-l0123-l0124-l0134-l01234
newBins01 = int(len(l01) / blocks_in_page)
numBins = numBins + newBins01
ll01 = list(l01)
for i in range(len(l01)):
j = I.index(ll01[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l01) - blocks_in_page*newBins01
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
new_tensor_list[1].append(i)
block_id = block_id + this_remain
l02=tensor_list[0].intersection(tensor_list[2])-l012-l023-l024-l0123-l0124-l0234-l01234
newBins02 = int(len(l02) / blocks_in_page)
numBins = numBins + newBins02
ll02 = list(l02)
for i in range(len(l02)):
j = I.index(ll02[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l02) - blocks_in_page*newBins02
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
new_tensor_list[2].append(i)
block_id = block_id + this_remain
l03=tensor_list[0].intersection(tensor_list[3])-l013-l023-l034-l0123-l0234-l0234-l01234
newBins03 = int(len(l03) / blocks_in_page)
numBins = numBins + newBins03
ll03 = list(l03)
for i in range(len(l03)):
j = I.index(ll03[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l03) - blocks_in_page*newBins03
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
new_tensor_list[3].append(i)
block_id = block_id + this_remain
l04=tensor_list[0].intersection(tensor_list[4])-l014-l024-l034-l0124-l0134-l0234-l01234
newBins04 = int(len(l04) / blocks_in_page)
numBins = numBins + newBins04
ll04 = list(l04)
for i in range(len(l04)):
j = I.index(ll04[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l04) - blocks_in_page*newBins04
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
new_tensor_list[4].append(i)
block_id = block_id + this_remain
l12=tensor_list[1].intersection(tensor_list[2])-l012-l123-l124-l0123-l0124-l1234-l01234
newBins12 = int(len(l12) / blocks_in_page)
numBins = numBins + newBins12
ll12 = list(l12)
for i in range(len(l12)):
j = I.index(ll12[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l12) - blocks_in_page*newBins12
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[1].append(i)
new_tensor_list[2].append(i)
block_id = block_id + this_remain
l13=tensor_list[1].intersection(tensor_list[3])-l013-l034-l134-l0123-l0134-l1234-l01234
newBins13 = int(len(l13) / blocks_in_page)
numBins = numBins + newBins13
ll13 = list(l13)
for i in range(len(l13)):
j = I.index(ll13[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l13) - blocks_in_page*newBins13
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[1].append(i)
new_tensor_list[3].append(i)
block_id = block_id + this_remain
l14=tensor_list[1].intersection(tensor_list[4])-l014-l124-l134-l0124-l0134-l1234-l01234
newBins14 = int(len(l14) / blocks_in_page)
numBins = numBins + newBins14
ll14 = list(l14)
for i in range(len(l14)):
j = I.index(ll14[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l14) - blocks_in_page*newBins14
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[1].append(i)
new_tensor_list[4].append(i)
block_id = block_id + this_remain
l23=tensor_list[2].intersection(tensor_list[3])-l023-l123-l234-l0123-l0234-l1234-l01234
newBins23 = int(len(l23) / blocks_in_page)
numBins = numBins + newBins23
ll23 = list(l23)
for i in range(len(l23)):
j = I.index(ll23[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l23) - blocks_in_page*newBins23
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[2].append(i)
new_tensor_list[3].append(i)
block_id = block_id + this_remain
l24=tensor_list[2].intersection(tensor_list[4])-l024-l124-l234-l0124-l0234-l1234-l01234
newBins24 = int(len(l24) / blocks_in_page)
numBins = numBins + newBins01
ll24 = list(l24)
for i in range(len(l24)):
j = I.index(ll24[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l24) - blocks_in_page*newBins24
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[2].append(i)
new_tensor_list[4].append(i)
block_id = block_id + this_remain
l34=tensor_list[3].intersection(tensor_list[4])-l034-l134-l234-l0134-l0234-l1234-l01234
newBins34 = int(len(l34) / blocks_in_page)
numBins = numBins + newBins34
ll34 = list(l34)
for i in range(len(l34)):
j = I.index(ll34[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l34) - blocks_in_page*newBins34
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[3].append(i)
new_tensor_list[4].append(i)
block_id = block_id + this_remain
l0=tensor_list[0]-l01-l02-l03-l04-l012-l013-l014-l023-l024-l034-l0123-l0124-l0134-l0234-l01234
newBins0 = int(len(l0) / blocks_in_page)
numBins = numBins + newBins0
ll0 = list(l0)
for i in range(len(l0)):
j = I.index(ll0[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l0) - blocks_in_page*newBins0
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[0].append(i)
block_id = block_id + this_remain
l1=tensor_list[1]-l01-l12-l13-l14-l012-l013-l014-l123-l124-l134-l0123-l0124-l0134-l1234-l01234
newBins1 = int(len(l1) / blocks_in_page)
numBins = numBins + newBins1
ll1 = list(l1)
for i in range(len(l1)):
j = I.index(ll1[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l1) - blocks_in_page*newBins1
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[1].append(i)
block_id = block_id + this_remain
l2=tensor_list[2]-l02-l12-l23-l24-l012-l023-l024-l123-l124-l234-l0123-l0124-l0234-l1234-l01234
newBins2 = int(len(l2) / blocks_in_page)
numBins = numBins + newBins2
ll2 = list(l2)
for i in range(len(l2)):
j = I.index(ll2[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l2) - blocks_in_page*newBins2
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[2].append(i)
block_id = block_id + this_remain
l3=tensor_list[3]-l03-l13-l23-l34-l013-l023-l034-l123-l134-l234-l0123-l0134-l0234-l1234-l01234
newBins3 = int(len(l3) / blocks_in_page)
numBins = numBins + newBins3
ll3 = list(l3)
for i in range(len(l3)):
j = I.index(ll3[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l3) - blocks_in_page*newBins3
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[3].append(i)
block_id = block_id + this_remain
l4=tensor_list[4]-l04-l14-l24-l34-l014-l024-l034-l124-l134-l234-l0124-l0134-l0234-l1234-l01234
newBins4 = int(len(l4) / blocks_in_page)
numBins = numBins + newBins4
ll4 = list(l4)
for i in range(len(l4)):
j = I.index(ll4[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
this_remain = len(l4) - blocks_in_page*newBins4
if (this_remain!=0):
for i in range(block_id, block_id + this_remain):
new_tensor_list[4].append(i)
block_id = block_id + this_remain
# start the second stage
P = set()
P, tensor_page_mapping = bin_pack_greedy(new_tensor_list, blocks_in_page)
L = list(P)
L[0].numBins = numBins + L[0].numBins
P = set(L)
P.union(set([p_i_j]))
return P
"""
1:INPUT1: T (a set of tensors, each tensor is a set of item ids i.e. tensor blocks ids)
2:INPUT2: l (the maximum number of blocks for each page)
3:OUTPUT: {𝑃𝑖𝑗} (an approximate optimal bin-packing scheme) including number of pages needed
Used in the Greedy-1 algorithm in the following test:
1. word2vec (100 * 10000, 64MB)
This testing example can be found in runGreedy-1.py in the corresponding folder
"""
def w2v_greedy1(tensor_list, blocks_in_page):
# use set to union and change the set to list
I = set()
for t_i in tensor_list:
I = I.union(t_i)
I = list(I)
# initialize the packing scheme
p_i_j = BinPackingScheme(I, blocks_in_page)
# set the required number of pages as 0
numBins = 0
# create a list of equivalent class tensors
equivalent_class_tensors = []
# divide blocks into multiple equivalent classes
l=tensor_list[0].intersection(tensor_list[1],tensor_list[2],tensor_list[3],tensor_list[4],tensor_list[5])
ll = list(l)
equivalent_class_tensors.append(ll)
l0=tensor_list[0]-l
ll0 = list(l0)
equivalent_class_tensors.append(ll0)
l1=tensor_list[1]-l
ll1 = list(l1)
equivalent_class_tensors.append(ll1)
l2=tensor_list[2]-l
ll2 = list(l2)
equivalent_class_tensors.append(ll2)
l3=tensor_list[3]-l
ll3 = list(l3)
equivalent_class_tensors.append(ll3)
l4=tensor_list[4]-l
ll4 = list(l4)
equivalent_class_tensors.append(ll4)
l5=tensor_list[5]-l
ll5 = list(l5)
equivalent_class_tensors.append(ll5)
# pack the blocks based on the equivalent classes
for k in range(len(equivalent_class_tensors)):
this_len = len(equivalent_class_tensors[k])
this_ten = equivalent_class_tensors[k]
for i in range(this_len):
j = I.index(this_ten[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
numBins = numBins + math.ceil(this_len / blocks_in_page)
p_i_j.numBins = numBins
# return the bin-packing scheme
return set([p_i_j])
"""
1:INPUT1: T (a set of tensors, each tensor is a set of item ids i.e. tensor blocks ids)
2:INPUT2: l (the maximum number of blocks for each page)
3:OUTPUT: {𝑃𝑖𝑗} (an approximate optimal bin-packing scheme) including number of pages needed
Used in the Two-Stage algorithm in the following test:
1. word2vec (100 * 10000, 64MB)
This testing example can be found in runTwo-Stage.py in the corresponding folder
"""
def w2v_twostage(tensor_list, blocks_in_page):
# use set to union and change the set to list
I = set()
for t_i in tensor_list:
I = I.union(t_i)
I = list(I)
# initialize the packing scheme
p_i_j = BinPackingScheme(I, blocks_in_page)
# set the required number of pages as 0
numBins = 0
# create a list of equivalent class tensors
equivalent_class_tensors = []
# divide blocks into multiple equivalent classes
l=tensor_list[0].intersection(tensor_list[1],tensor_list[2],tensor_list[3],tensor_list[4],tensor_list[5])
ll = list(l)
equivalent_class_tensors.append(ll)
l0=tensor_list[0]-l
ll0 = list(l0)
equivalent_class_tensors.append(ll0)
l1=tensor_list[1]-l
ll1 = list(l1)
equivalent_class_tensors.append(ll1)
l2=tensor_list[2]-l
ll2 = list(l2)
equivalent_class_tensors.append(ll2)
l3=tensor_list[3]-l
ll3 = list(l3)
equivalent_class_tensors.append(ll3)
l4=tensor_list[4]-l
ll4 = list(l4)
equivalent_class_tensors.append(ll4)
l5=tensor_list[5]-l
ll5 = list(l5)
equivalent_class_tensors.append(ll5)
# set the number of bins owned by all and owned by one tensor
allBins = 0
oneBins = 0
# pack the blocks based on the equivalent classes
for k in range(len(equivalent_class_tensors)):
this_len = len(equivalent_class_tensors[k])
this_ten = equivalent_class_tensors[k]
newBins = int(this_len / blocks_in_page)
numBins = numBins + newBins
if(k == 0):
allBins = newBins
elif(k == 1):
oneBins = newBins
for i in range(blocks_in_page*newBins):
j = I.index(this_ten[i]) + 1
s = numBins + math.ceil(i / blocks_in_page)
p_i_j.mark(j, s)
p_i_j.numBins = numBins
# deal with the blocks which can not be packed into a full page
new_tensor_list = [[], [], [], [], [], []]
for i in range(len(l)-blocks_in_page*allBins):
for j in range(6):
new_tensor_list[j].append(i)
block_id = len(l)-blocks_in_page*allBins
block_increase = len(l0)-blocks_in_page*oneBins
for k in range(6):
for i in range(block_id+k*block_increase, block_id+(k+1)*block_increase):
new_tensor_list[k].append(i)
# apply the remaining blocks into Greedy-2 algorithm
P = set()
P, tensor_page_mapping = bin_pack_greedy(new_tensor_list, blocks_in_page)
L = list(P)
L[0].numBins = numBins + L[0].numBins
P = set(L)
P.union(set([p_i_j]))
return P
"""
1:INPUT1: T (a set of tensors, each tensor is a set of item ids i.e. tensor blocks ids)
2:INPUT2: l (the maximum number of blocks for each page)
3:OUTPUT: {𝑃𝑖𝑗} (an approximate optimal bin-packing scheme) including number of pages needed
Used in the Baseline algorithm in all 4 test cases:
1. word2vec (100 * 10000, 64MB)
2. text classification (100 * 10000, 64MB)
3. text classification (300 * 300, 64MB)
4. text classification (300 * 300, 32MB)
These testing examples can be found in runBaseline.py in the corresponding 4 folders
"""
def bin_pack_base(T, l):
I = set()
for t_i in T:
I = I.union(t_i)
I = list(I)
items = T[0]
i, j = 0, 0
p_i_j = BinPackingScheme(I, l)
# Process at all items in t0
for i in range(1, len(items) + 1):
# Use 1-index according to logic
j = I.index(items[i - 1]) + 1
s = math.ceil(i / l)
p_i_j.mark(j, s)
numBins = math.ceil(len(items) / l)
# Already added tensor t1
for i in range(2, len(T) + 1):
bin_set, used_bin = p_i_j.findMinBinsMaxCover(T[i - 1],l)
I_delta = set(T[i - 1]) - bin_set
I_delta = list(I_delta)
if not I_delta:
continue
else:
remaining_items = order_tensor_blocks_by_freq(T, I_delta)
for j in range(1, len(remaining_items) + 1):
# Important to index using I because we built BinPackingScheme using ordering of blocks in I
s = I.index(remaining_items[j - 1]) + 1
u = numBins + math.ceil(j / l)
p_i_j.mark(s, u)
numBins = numBins + math.ceil(len(remaining_items) / l)
p_i_j.numBins = numBins
return set([p_i_j]) |
11510967 | from bson import ObjectId
from datetime import datetime, timedelta, timezone
from flask import Response, abort, redirect, render_template, request
import json
import os
import pymongo
from .app import app, mongo
from .utils import json_error, json_response, new_transcription, require_auth
@app.route('/')
def slash():
feeds = list(mongo.db.feeds.find())
# TODO: aggregate, or store this on the feed when you insert a call, or something instead of doing N extra queries
now = datetime.now(timezone.utc)
for feed in feeds:
newest_call = mongo.db.calls.find_one(
{'feed_id': feed['_id']},
projection=['ts'],
sort=[('ts', pymongo.DESCENDING)])
if newest_call:
ts = feed['last_ts'] = newest_call['ts']
feed['active'] = now - ts <= timedelta(days=0.5)
feed['hours_ago'] = int((now - ts).total_seconds() / 60 / 60)
feeds.sort(key=lambda x: x['name'])
return render_template('index.html',
feeds=feeds,
time_now=now)
def _get_feed(feed_id, since=None, limit=200):
query = {'feed_id': feed_id}
if since is not None:
query.update({
'$or': [
{'update_ts': {'$gte': since}},
{'update_ts': {'$exists': False}, 'ts': {'$gte': since}},
],
})
query['update_ts'] = {'$gte': since}
return mongo.db.calls.find(
query,
projection=['ts', 'audio_url', 'transcriptions._id', 'transcriptions.ts', 'transcriptions.text',
'transcriptions.upvotes', 'transcriptions.downvotes', 'transcriptions.source'],
limit=limit,
sort=[('ts', pymongo.DESCENDING)]
)
@app.route('/feeds/<ObjectId:feed_id>')
def get_feed(feed_id):
feed = mongo.db.feeds.find_one_or_404({'_id': feed_id})
calls = list(_get_feed(feed_id, limit=2000))
for call in calls:
call['transcriptions'].sort(key=lambda x: (x['upvotes'] - x['downvotes']), reverse=True)
return render_template(
'feed.html',
feed=feed,
feed_id=str(feed_id),
last_timestamp=0,
calls=calls,
time_now=datetime.now(timezone.utc),
)
@app.route('/api/feeds/<ObjectId:feed_id>')
def get_feed_text(feed_id):
since = None
if 'since' in request.args:
since = datetime.utcfromtimestamp(float(request.args['since'])).replace(tzinfo=timezone.utc)
limit = min(2000, int(request.args.get('limit', 2000)))
calls = _get_feed(feed_id, since=since, limit=limit)
return json_response(calls)
@app.route('/api/calls', methods=['POST'])
def add_call():
require_auth()
j = request.json
if 'feed_id' in j:
feed = mongo.db.feeds.find_one_or_404({'_id': ObjectId(j['feed_id'])})
elif 'feed_num' in j:
feed = mongo.db.feeds.find_one_or_404({'numeric_id': j['feed_num']})
else:
abort(500)
transcription = new_transcription(j['text'],
ts=datetime.fromisoformat(j['text_ts']),
source=j['text_source'])
mongo.db.calls.insert_one({
'feed_id': feed['_id'],
'ts': datetime.fromisoformat(j['ts']),
'update_ts': datetime.fromisoformat(j['ts']),
'audio_url': j['audio_url'],
'audio_length': j['audio_length'],
'from': j.get('from', None),
'to': j.get('to', None),
'transcriptions': [transcription]
})
return 'ok'
@app.route('/api/calls/<ObjectId:call_id>/transcribe', methods=['POST'])
def suggest(call_id):
text = request.form.get('text', '')
if len(text) < 3 or len(text) > 1000:
return json_error('Invalid Text')
ts = datetime.now(timezone.utc)
call = mongo.db.calls.find_one_and_update(
{ '_id': call_id, 'transcriptions.text': {'$nin': [text]} },
{
'$push': { 'transcriptions': new_transcription(text, ts=ts, source='user') },
'$set': { 'update_ts': ts },
},
return_document=pymongo.ReturnDocument.AFTER)
if call is None:
# TODO: this could also be call id not found, but we'll assume it's a dup for now
return json_error("Duplicate transcription")
else:
return json_response(call)
@app.route('/api/transcriptions/<ObjectId:transcription_id>/vote', methods=['POST'])
def upvote(transcription_id):
vote = int(request.form.get('vote', 0))
if vote == 1:
result = mongo.db.calls.find_one_and_update(
{ 'transcriptions._id': transcription_id },
{
'$inc': { 'transcriptions.$.upvotes': 1 },
'$set': { 'update_ts': datetime.now(timezone.utc) },
},
return_document=pymongo.ReturnDocument.AFTER)
elif vote == -1:
result = mongo.db.calls.find_one_and_update(
{ 'transcriptions._id': transcription_id },
{
'$inc': { 'transcriptions.$.downvotes': 1 },
'$set': { 'update_ts': datetime.now(timezone.utc) },
},
return_document=pymongo.ReturnDocument.AFTER)
else:
return json_error("Invalid Vote", status=400)
if result is None:
return json_error("Call not found", status=404)
return json_response(result)
|
11511027 | import django_tables2 as tables
from django.conf import settings
from django.db.models import Case, When
from django_tables2.utils import A
from apis_core.apis_labels.models import Label
from apis_core.apis_metainfo.models import Uri
from apis_core.apis_metainfo.tables import (
generic_order_start_date_written,
generic_order_end_date_written,
generic_render_start_date_written,
generic_render_end_date_written
)
from apis_core.apis_relations.models import AbstractRelation
empty_text_default = 'There are currently no relations'
def get_generic_relation_listview_table(relation_name):
"""
Creates a table class according to the relation class given by the relation_name parameter.
Instantiates corresponding columns which also provide linking to the respectively related entities.
:param relation_name: str : The name of the relation class to be loaded
:return: a django-tables2 Table Class tailored for the respective relation class
"""
# create all variables which save the foreign key fields which are different for each relation class
relation_class = AbstractRelation.get_relation_class_of_name(relation_name)
related_entity_class_name_a = relation_class.get_related_entity_classA().__name__.lower()
related_entity_class_name_b = relation_class.get_related_entity_classB().__name__.lower()
related_entity_field_name_a = relation_class.get_related_entity_field_nameA()
related_entity_field_name_b = relation_class.get_related_entity_field_nameB()
class GenericRelationListViewTable(tables.Table):
# reuse the logic for ordering and rendering *_date_written
# Important: The names of these class variables must correspond to the column field name,
# e.g. for start_date_written, the methods must be named order_start_date_written and render_start_date_written
order_start_date_written = generic_order_start_date_written
order_end_date_written = generic_order_end_date_written
render_start_date_written = generic_render_start_date_written
render_end_date_written = generic_render_end_date_written
class Meta:
model = relation_class
# the fields list also serves as the defining order of them, as to avoid duplicated definitions
fields = [
related_entity_field_name_a,
related_entity_field_name_b,
'relation_type',
'start_date_written',
'end_date_written',
]
# reuse the list for ordering
sequence = tuple(fields)
# This attrs dictionary I took over from the tables implementation before. No idea if and where it would be needed.
attrs = {"class": "table table-hover table-striped table-condensed"}
def __init__(self, *args, **kwargs):
# LinkColumn objects provied hyperlinking to the related entities
self.base_columns[related_entity_field_name_a] = tables.LinkColumn(
# which url to use:
'apis:apis_entities:generic_entities_detail_view',
args=[
# which entity sub-url to load from:
related_entity_class_name_a,
# which instance identifier to use:
A(related_entity_field_name_a + ".pk")
]
)
# same as above
self.base_columns[related_entity_field_name_b] = tables.LinkColumn(
'apis:apis_entities:generic_entities_detail_view',
args=[
related_entity_class_name_b,
A(related_entity_field_name_b + ".pk")
]
)
super().__init__(*args, **kwargs)
return GenericRelationListViewTable
def get_generic_relations_table(relation_class, entity_instance, detail=None):
"""
Creates a table class according to the relation and entity class given by the parameters.
:param relation_class: the class where the entity_instance can have instantiated relations to
:param entity_instance: the entity instance of which related relations and entities are to be displayed
:param detail: boolean : if this Table is to be displayed in an detail or edit UI
:return: a django-tables2 Table Class tailored for the respective relation class and entity instance
"""
# create all variables which save the foreign key fields which are different for each relation class
entity_class_name = entity_instance.__class__.__name__.lower()
related_entity_class_name_a = relation_class.get_related_entity_classA().__name__.lower()
related_entity_class_name_b = relation_class.get_related_entity_classB().__name__.lower()
related_entity_field_name_a = relation_class.get_related_entity_field_nameA()
related_entity_field_name_b = relation_class.get_related_entity_field_nameB()
# find out what other entity class the current entity instance in a given relation class is related to
# (needed for linkg towards instances of related entities)
if entity_class_name == related_entity_class_name_a == related_entity_class_name_b:
other_related_entity_class_name = entity_class_name
elif entity_class_name == related_entity_class_name_a:
other_related_entity_class_name = related_entity_class_name_b
elif entity_class_name == related_entity_class_name_b:
other_related_entity_class_name = related_entity_class_name_a
else:
raise Exception(
"Did not find the entity instance in the given relation class fields!" +
"Either a wrong entity instance or wrong relation class was passed to this function."
)
class RelationTableBase(tables.Table):
"""
The base table from which detail or edit tables will inherit from in order to avoid redundant definitions
"""
# reuse the logic for ordering and rendering *_date_written
# Important: The names of these class variables must correspond to the column field name,
# e.g. for start_date_written, the methods must be named order_start_date_written and render_start_date_written
order_start_date_written = generic_order_start_date_written
order_end_date_written = generic_order_end_date_written
render_start_date_written = generic_render_start_date_written
render_end_date_written = generic_render_end_date_written
class Meta:
"""
Meta class needed for django-tables2 plugin.
"""
empty_text = empty_text_default
model = relation_class
# the fields list also serves as the defining order of them, as to avoid duplicated definitions
fields = [
'start_date_written',
'end_date_written',
'other_relation_type',
"other_related_entity"
]
# reuse the list for ordering
sequence = tuple(fields)
# This attrs dictionary I took over from the tables implementation before. No idea if and where it would be needed.
attrs = {
"class": "table table-hover table-striped table-condensed",
"id": related_entity_class_name_a.title()[:2] + related_entity_class_name_b.title()[:2] + "_conn"
}
def render_other_related_entity(self, record, value):
"""
Custom render_FOO method for related entity linking. Since the 'other_related_entity' is a generated annotation
on the queryset, it does not return the related instance but only the foreign key as the integer it is.
Thus fetching the related instance is necessary.
:param record: The 'row' of a queryset, i.e. an entity instance
:param value: The current column of the row, i.e. the 'other_related_entity' annotation
:return: related instance
"""
if value == record.get_related_entity_instanceA().pk :
return record.get_related_entity_instanceA()
elif value == record.get_related_entity_instanceB().pk :
return record.get_related_entity_instanceB()
else:
raise Exception(
"Did not find the entity this relation is supposed to come from!" +
"Something must have went wrong when annotating for the related instance."
)
def __init__(self, data, *args, **kwargs):
# annotations for displaying data about the 'other side' of the relation.
# Both of them ('other_related_entity' and 'other_relation_type') are necessary for displaying relations
# in context to what entity we are calling this from.
data = data.annotate(
# In order to provide the 'other instance' for each instance of a table where this whole logic is called from,
# the queryset must be annotated accordingly. The following Case searches which of the two related instances
# of a relation queryset entry is the one corresponding to the current entity instance. When found, take the
# other related entity (since this is the one we are interested in displaying).
#
# The approach of using queryset's annotate method allows for per-instance case decision and thus
# guarantees that the other related entity is always correctly picked,
# even in case two entities are of the same class.
other_related_entity=Case(
# **kwargs pattern is needed here as the key-value pairs change with each relation class and entity instance.
When(**{
related_entity_field_name_a + "__pk": entity_instance.pk,
"then": related_entity_field_name_b
}),
When(**{
related_entity_field_name_b + "__pk": entity_instance.pk,
"then": related_entity_field_name_a
}),
)
).annotate(
# Get the correct side of the relation type given the current entity instance.
#
# The approach of using queryset's annotate method allows for per-instance case decision and thus
# guarantees that the other related entity is always correctly picked,
# even in case two entities are of the same class.
other_relation_type=Case(
When(**{
# A->B relation and current entity instance is A, hence take forward name
related_entity_field_name_a + "__pk": entity_instance.pk,
"then": "relation_type__name"
}),
When(**{
# A->B relation and current entity instance is B, hence take reverse name.
related_entity_field_name_b + "__pk": entity_instance.pk,
"then": "relation_type__name_reverse"
}),
)
)
for an in data:
if getattr(an, f"{related_entity_field_name_a}_id") == entity_instance.pk:
an.other_relation_type = getattr(an.relation_type, "label")
else:
an.other_relation_type = getattr(an.relation_type, "label_reverse")
super().__init__(data, *args, **kwargs)
if detail:
class RelationTableDetail(RelationTableBase):
"""
Sublcass inheriting the bulk of logic from parent. This table is used for the 'detail' views.
"""
def __init__(self, data, *args, **kwargs):
# Only addition with respect to parent class is which main url is to be used when clicking on a
# related entity column.
self.base_columns["other_related_entity"] = tables.LinkColumn(
'apis:apis_entities:generic_entities_detail_view',
args=[
other_related_entity_class_name,
A("other_related_entity")
],
verbose_name="Related " + other_related_entity_class_name.title()
)
super().__init__(data=data, *args, **kwargs)
return RelationTableDetail
else:
class RelationTableEdit(RelationTableBase):
"""
Sublcass inheriting the bulk of logic from parent. This table is used for the 'edit' view.
"""
class Meta(RelationTableBase.Meta):
"""
Additional Meta fields are necessary for editing functionalities
"""
# This fields list also defines the order of the elements.
fields = ["delete"] + RelationTableBase.Meta.fields + ["edit"]
if 'apis_bibsonomy' in settings.INSTALLED_APPS:
fields = ["ref"] + fields
# again reuse the fields list for ordering
sequence = tuple(fields)
def __init__(self, *args, **kwargs):
# Clicking on a related entity will lead also the edit view of the related entity instance
self.base_columns["other_related_entity"] = tables.LinkColumn(
'apis:apis_entities:generic_entities_edit_view',
args=[
other_related_entity_class_name, A("other_related_entity")
],
verbose_name="Related " + other_related_entity_class_name.title()
)
# delete button
self.base_columns['delete'] = tables.TemplateColumn(
template_name='apis_relations/delete_button_generic_ajax_form.html'
)
# edit button
self.base_columns['edit'] = tables.TemplateColumn(
template_name='apis_relations/edit_button_generic_ajax_form.html'
)
# bibsonomy button
if 'apis_bibsonomy' in settings.INSTALLED_APPS:
self.base_columns['ref'] = tables.TemplateColumn(
template_name='apis_relations/references_button_generic_ajax_form.html'
)
super().__init__(*args, **kwargs)
return RelationTableEdit
class EntityUriTable(tables.Table):
delete = tables.TemplateColumn(template_name='apis_relations/delete_button_Uri_ajax_form.html')
class Meta:
empty_text = empty_text_default
model = Uri
fields = ['uri']
sequence = ('delete', 'uri')
# add class="paleblue" to <table> tag
attrs = {"class": "table table-hover table-striped table-condensed",
"id": "PURI_conn"}
class LabelTableBase(tables.Table):
label2 = tables.TemplateColumn(template_name="apis_relations/labels_label.html")
# reuse the logic for ordering and rendering *_date_written
# Important: The names of these class variables must correspond to the column field name,
# e.g. for start_date_written, the methods must be named order_start_date_written and render_start_date_written
order_start_date_written = generic_order_start_date_written
order_end_date_written = generic_order_end_date_written
render_start_date_written = generic_render_start_date_written
render_end_date_written = generic_render_end_date_written
class Meta:
empty_text = empty_text_default
model = Label
# Note that as the next attribute 'sequence' builds on this list 'fields', the order defined within this list
# will be reused for the tuple 'sequence'. So if the order needs to be changed, better do it here in the list 'fields'.
fields = ['start_date_written', 'end_date_written', 'label_type', 'isoCode_639_3']
sequence = ('label2',) + tuple(fields)
# add class="paleblue" to <table> tag
attrs = {
"class": "table table-hover table-striped table-condensed",
"id": "PL_conn"
}
class LabelTableEdit(LabelTableBase):
"""
Reuse most of the base table class for labels. Only addition is editing functionality.
"""
edit = tables.TemplateColumn(template_name='apis_relations/edit_button_persLabel_ajax_form.html')
class Meta(LabelTableBase.Meta):
sequence = LabelTableBase.Meta.sequence + ("edit",)
|
11511053 | from setuptools import setup
setup(name='fdfault',
version='1.0',
description='Tools made to go with fdfault rupture code',
url='https://github.com/egdaub/fdfault',
author='<NAME>',
author_email='<EMAIL>',
packages=['fdfault', 'fdfault.analysis'],
install_requires=['numpy'])
|
11511061 | from typing import Optional
from copy import copy
import numpy as np
import torch
import torch.nn as nn
from torch.utils.data import DataLoader, TensorDataset
from scipy import stats
from scipy.special import inv_boxcox, boxcox
from statsmodels.tsa.api import STLForecast
from statsmodels.tsa.ar_model import AutoReg
from statsmodels.tsa.arima.model import ARIMA
from fedot.core.data.data import InputData
from fedot.core.log import Log
from fedot.core.operations.evaluation.operation_implementations.data_operations.ts_transformations import \
ts_to_table, prepare_target
from fedot.core.operations.evaluation. \
operation_implementations.implementation_interfaces import ModelImplementation
from fedot.core.pipelines.ts_wrappers import _update_input, exception_if_not_ts_task
from fedot.core.repository.dataset_types import DataTypesEnum
from fedot.utilities.ts_gapfilling import SimpleGapFiller
from sklearn.preprocessing import StandardScaler
class ARIMAImplementation(ModelImplementation):
def __init__(self, log: Log = None, **params):
super().__init__(log)
self.params = params
self.arima = None
self.lambda_value = None
self.scope = None
self.actual_ts_len = None
self.sts = None
def fit(self, input_data):
""" Class fit arima model on data
:param input_data: data with features, target and ids to process
"""
source_ts = np.array(input_data.features)
# Save actual time series length
self.actual_ts_len = len(source_ts)
self.sts = source_ts
# Apply box-cox transformation for positive values
min_value = np.min(source_ts)
if min_value > 0:
pass
else:
# Making a shift to positive values
self.scope = abs(min_value) + 1
source_ts = source_ts + self.scope
_, self.lambda_value = stats.boxcox(source_ts)
transformed_ts = boxcox(source_ts, self.lambda_value)
# Set parameters
p = int(self.params.get('p'))
d = int(self.params.get('d'))
q = int(self.params.get('q'))
params = {'order': (p, d, q)}
self.arima = ARIMA(transformed_ts, **params).fit()
return self.arima
def predict(self, input_data, is_fit_pipeline_stage: bool):
""" Method for time series prediction on forecast length
:param input_data: data with features, target and ids to process
:param is_fit_pipeline_stage: is this fit or predict stage for pipeline
:return output_data: output data with smoothed time series
"""
input_data = copy(input_data)
parameters = input_data.task.task_params
forecast_length = parameters.forecast_length
old_idx = input_data.idx
target = input_data.target
# For training pipeline get fitted data
if is_fit_pipeline_stage:
fitted_values = self.arima.fittedvalues
fitted_values = self._inverse_boxcox(predicted=fitted_values,
lambda_param=self.lambda_value)
# Undo shift operation
fitted_values = self._inverse_shift(fitted_values)
diff = int(self.actual_ts_len - len(fitted_values))
# If first elements skipped
if diff != 0:
# Fill nans with first values
first_element = fitted_values[0]
first_elements = [first_element] * diff
first_elements.extend(list(fitted_values))
fitted_values = np.array(first_elements)
_, predict = ts_to_table(idx=old_idx,
time_series=fitted_values,
window_size=forecast_length)
new_idx, target_columns = ts_to_table(idx=old_idx,
time_series=target,
window_size=forecast_length)
# Update idx and target
input_data.idx = new_idx
input_data.target = target_columns
# For predict stage we can make prediction
else:
start_id = old_idx[-1] - forecast_length + 1
end_id = old_idx[-1]
predicted = self.arima.predict(start=start_id,
end=end_id)
predicted = self._inverse_boxcox(predicted=predicted,
lambda_param=self.lambda_value)
# Undo shift operation
predict = self._inverse_shift(predicted)
# Convert one-dim array as column
predict = np.array(predict).reshape(1, -1)
new_idx = np.arange(start_id, end_id + 1)
# Update idx
input_data.idx = new_idx
# Update idx and features
output_data = self._convert_to_output(input_data,
predict=predict,
data_type=DataTypesEnum.table)
return output_data
def get_params(self):
return self.params
def _inverse_boxcox(self, predicted, lambda_param):
""" Method apply inverse Box-Cox transformation """
if lambda_param == 0:
return np.exp(predicted)
else:
res = inv_boxcox(predicted, lambda_param)
res = self._filling_gaps(res)
return res
def _inverse_shift(self, values):
""" Method apply inverse shift operation """
if self.scope is None:
pass
else:
values = values - self.scope
return values
@staticmethod
def _filling_gaps(res):
nan_ind = np.argwhere(np.isnan(res))
res[nan_ind] = -100.0
# Gaps in first and last elements fills with mean value
if 0 in nan_ind:
res[0] = np.mean(res)
if int(len(res) - 1) in nan_ind:
res[int(len(res) - 1)] = np.mean(res)
# Gaps in center of timeseries fills with linear interpolation
if len(np.ravel(np.argwhere(np.isnan(res)))) != 0:
gf = SimpleGapFiller()
res = gf.linear_interpolation(res)
return res
class AutoRegImplementation(ModelImplementation):
def __init__(self, log: Log = None, **params):
super().__init__(log)
self.params = params
self.actual_ts_len = None
self.autoreg = None
def fit(self, input_data):
""" Class fit ar model on data
:param input_data: data with features, target and ids to process
"""
source_ts = np.array(input_data.features)
self.actual_ts_len = len(source_ts)
lag_1 = int(self.params.get('lag_1'))
lag_2 = int(self.params.get('lag_2'))
params = {'lags': [lag_1, lag_2]}
self.autoreg = AutoReg(source_ts, **params).fit()
return self.autoreg
def predict(self, input_data, is_fit_pipeline_stage: bool):
""" Method for time series prediction on forecast length
:param input_data: data with features, target and ids to process
:param is_fit_pipeline_stage: is this fit or predict stage for pipeline
:return output_data: output data with smoothed time series
"""
input_data = copy(input_data)
parameters = input_data.task.task_params
forecast_length = parameters.forecast_length
old_idx = input_data.idx
target = input_data.target
if is_fit_pipeline_stage:
fitted = self.autoreg.predict(start=old_idx[0], end=old_idx[-1])
# First n elements in time series are skipped
diff = self.actual_ts_len - len(fitted)
# Fill nans with first values
first_element = fitted[0]
first_elements = [first_element] * diff
first_elements.extend(list(fitted))
fitted = np.array(first_elements)
_, predict = ts_to_table(idx=old_idx,
time_series=fitted,
window_size=forecast_length)
new_idx, target_columns = ts_to_table(idx=old_idx,
time_series=target,
window_size=forecast_length)
# Update idx and target
input_data.idx = new_idx
input_data.target = target_columns
# For predict stage we can make prediction
else:
start_id = old_idx[-1] - forecast_length + 1
end_id = old_idx[-1]
predicted = self.autoreg.predict(start=start_id,
end=end_id)
# Convert one-dim array as column
predict = np.array(predicted).reshape(1, -1)
new_idx = np.arange(start_id, end_id + 1)
# Update idx
input_data.idx = new_idx
# Update idx and features
output_data = self._convert_to_output(input_data,
predict=predict,
data_type=DataTypesEnum.table)
return output_data
def get_params(self):
return self.params
class STLForecastARIMAImplementation(ModelImplementation):
def __init__(self, log: Log = None, **params: Optional[dict]):
super().__init__(log)
self.params = params
self.model = None
self.lambda_param = None
self.scope = None
self.actual_ts_len = None
self.sts = None
def fit(self, input_data):
""" Class fit STLForecast arima model on data
:param input_data: data with features, target and ids to process
"""
source_ts = np.array(input_data.features)
# Save actual time series length
self.actual_ts_len = len(source_ts)
self.sts = source_ts
if not self.params:
# Default data
self.params = {'p': 2, 'd': 0, 'q': 2, 'period': 365}
p = int(self.params.get('p'))
d = int(self.params.get('d'))
q = int(self.params.get('q'))
period = int(self.params.get('period'))
params = {'period': period, 'model_kwargs': {'order': (p, d, q)}}
self.model = STLForecast(source_ts, ARIMA, **params).fit()
return self.model
def predict(self, input_data, is_fit_pipeline_stage: bool):
""" Method for time series prediction on forecast length
:param input_data: data with features, target and ids to process
:param is_fit_pipeline_stage: is this fit or predict stage for pipeline
:return output_data: output data with smoothed time series
"""
parameters = input_data.task.task_params
forecast_length = parameters.forecast_length
old_idx = input_data.idx
target = input_data.target
# For training pipeline get fitted data
if is_fit_pipeline_stage:
fitted_values = self.model.get_prediction(start=old_idx[0], end=old_idx[-1]).predicted_mean
diff = int(self.actual_ts_len) - len(fitted_values)
# If first elements skipped
if diff != 0:
# Fill nans with first values
first_element = fitted_values[0]
first_elements = [first_element] * diff
first_elements.extend(list(fitted_values))
fitted_values = np.array(first_elements)
_, predict = ts_to_table(idx=old_idx,
time_series=fitted_values,
window_size=forecast_length)
new_idx, target_columns = ts_to_table(idx=old_idx,
time_series=target,
window_size=forecast_length)
# Update idx and target
input_data.idx = new_idx
input_data.target = target_columns
# For predict stage we can make prediction
else:
start_id = old_idx[-1] - forecast_length + 1
end_id = old_idx[-1]
predicted = self.model.get_prediction(start=start_id, end=end_id).predicted_mean
# Convert one-dim array as column
predict = np.array(predicted).reshape(1, -1)
new_idx = np.arange(start_id, end_id + 1)
# Update idx
input_data.idx = new_idx
# Update idx and features
output_data = self._convert_to_output(input_data,
predict=predict,
data_type=DataTypesEnum.table)
return output_data
def get_params(self):
return self.params
class CLSTMImplementation(ModelImplementation):
def __init__(self, log: Log = None, **params):
super().__init__(log)
self.params = params
self.epochs = params.get("num_epochs")
self.batch_size = params.get("batch_size")
self.learning_rate = params.get("learning_rate")
self.window_size = int(params.get("window_size"))
self.teacher_forcing = int(params.get("teacher_forcing"))
self.device = self._get_device()
self.model = LSTMNetwork(
hidden_size=int(params.get("hidden_size")),
cnn1_kernel_size=int(params.get("cnn1_kernel_size")),
cnn1_output_size=int(params.get("cnn1_output_size")),
cnn2_kernel_size=int(params.get("cnn2_kernel_size")),
cnn2_output_size=int(params.get("cnn2_output_size"))
)
self.optim_dict = {
'adam': torch.optim.Adam(self.model.parameters(), lr=self.learning_rate),
'sgd': torch.optim.SGD(self.model.parameters(), lr=self.learning_rate)
}
self.loss_dict = {
'mae': nn.L1Loss,
'mse': nn.MSELoss
}
self.scaler = StandardScaler()
self.optimizer = self.optim_dict[params.get("optimizer")]
self.criterion = self.loss_dict[params.get("loss")]()
def fit(self, train_data: InputData):
""" Class fit ar model on data.
Implementation uses the idea of teacher forcing. That means model learns
to predict data when horizon != 1. It uses real values or previous model output
to predict next value. self.teacher_forcing param is used to control probability
of using real y values.
:param train_data: data with features, target and ids to process
"""
self.model = self.model.to(self.device)
data_loader, forecast_length = self._create_dataloader(train_data)
self.model.train()
for epoch in range(self.epochs):
for x, y in data_loader:
self.optimizer.zero_grad()
x = x.to(self.device)
y = y.to(self.device)
final_output = self._apply_teacher_forcing(x, y, forecast_length)
loss = self.criterion(final_output, y)
loss.backward()
self.optimizer.step()
return self.model
def _apply_teacher_forcing(self, x, y, forecast_length):
final_output = None
for i in range(forecast_length):
self.model.init_hidden(x.shape[0], self.device)
output = self.model(x.unsqueeze(1)).squeeze(0)
if np.random.random_sample() > self.teacher_forcing:
x = torch.hstack((x[:, 1:], output))
else:
x = torch.hstack((x, y[:, i].unsqueeze(1)))
if final_output is not None:
final_output = torch.hstack((final_output, output))
else:
final_output = output
return final_output
def predict(self, input_data: InputData, is_fit_pipeline_stage: Optional[bool]):
""" Method for time series prediction on forecast length
:param input_data: data with features, target and ids to process
:param is_fit_pipeline_stage: is this fit or predict stage for pipeline
:return output_data: output data with smoothed time series
"""
self.model.eval()
input_data_new = copy(input_data)
old_idx = input_data_new.idx
forecast_length = input_data.task.task_params.forecast_length
if is_fit_pipeline_stage:
new_idx, lagged_table = ts_to_table(idx=old_idx,
time_series=input_data_new.features,
window_size=self.window_size)
final_idx, features_columns, final_target = prepare_target(idx=new_idx,
features_columns=lagged_table,
target=input_data_new.target,
forecast_length=forecast_length)
input_data_new.idx = final_idx
input_data_new.features = features_columns
input_data_new.target = final_target
else:
input_data_new.features = input_data_new.features[-self.window_size:].reshape(1, -1)
input_data_new.idx = input_data_new.idx[-forecast_length:]
predict = self._out_of_sample_ts_forecast(input_data_new)
output_data = self._convert_to_output(input_data_new,
predict=predict,
data_type=DataTypesEnum.table)
return output_data
def _predict(self, input_data: InputData):
features_scaled = self._transform_scaler_features(input_data)
x = torch.Tensor(features_scaled).to(self.device)
self.model.init_hidden(x.shape[0], self.device)
predict = self.model(x.unsqueeze(1)).squeeze(0).cpu().detach().numpy()
return self._inverse_transform_scaler(predict)
def _out_of_sample_ts_forecast(self, input_data: InputData) -> np.array:
""" Method for out_of_sample CLSTM forecasting (use previous outputs as next inputs)
:param input_data: data with features, target and ids to process
:return np.array: np.array with predicted values to process it into output_data
"""
input_data_new = copy(input_data)
# Prepare data for time series forecasting
task = input_data_new.task
exception_if_not_ts_task(task)
pre_history_ts = np.array(input_data_new.features)
number_of_iterations = task.task_params.forecast_length
final_forecast = None
for _ in range(0, number_of_iterations):
with torch.no_grad():
iter_predict = self._predict(input_data_new)
if final_forecast is not None:
final_forecast = np.hstack((final_forecast, iter_predict))
else:
final_forecast = iter_predict
# Add prediction to the historical data - update it
pre_history_ts = np.hstack((pre_history_ts[:, 1:], iter_predict))
# Prepare InputData for next iteration
input_data_new = _update_input(pre_history_ts, number_of_iterations, task)
return final_forecast
def _fit_transform_scaler(self, data: InputData):
f_scaled = self.scaler.fit_transform(data.features.reshape(-1, 1)).reshape(-1)
t_scaled = self.scaler.transform(data.target.reshape(-1, 1)).reshape(-1)
return f_scaled, t_scaled
def _inverse_transform_scaler(self, data: np.ndarray):
start_shape = data.shape
return self.scaler.inverse_transform(data.reshape(-1, 1)).reshape(start_shape)
def _transform_scaler_features(self, data: InputData):
start_shape = data.features.shape
return self.scaler.transform(data.features.reshape(-1, 1)).reshape(start_shape)
def _transform_scaler_target(self, data: InputData):
start_shape = data.features.shape
return self.scaler.transform(data.target.reshape(-1, 1)).reshape(start_shape)
def get_params(self):
return self.params
@staticmethod
def _get_device():
if torch.cuda.is_available():
device = 'cuda:0'
else:
device = 'cpu'
return device
def _create_dataloader(self, input_data: InputData):
""" Method for creating torch.utils.data.DataLoader object from input_data
Generate lag tables and process it into DataLoader
:param input_data: data with features, target and ids to process
:return torch.utils.data.DataLoader: DataLoader with train data
"""
forecast_length = input_data.task.task_params.forecast_length
features_scaled, target_scaled = self._fit_transform_scaler(input_data)
new_idx, lagged_table = ts_to_table(idx=input_data.idx,
time_series=features_scaled,
window_size=self.window_size)
final_idx, features_columns, final_target = prepare_target(idx=new_idx,
features_columns=lagged_table,
target=target_scaled,
forecast_length=forecast_length)
x = torch.from_numpy(features_columns.copy()).float()
y = torch.from_numpy(final_target.copy()).float()
return DataLoader(TensorDataset(x, y), batch_size=self.batch_size), forecast_length
class LSTMNetwork(nn.Module):
def __init__(self,
hidden_size=200,
cnn1_kernel_size=5,
cnn1_output_size=16,
cnn2_kernel_size=3,
cnn2_output_size=32,
):
super().__init__()
self.hidden_size = hidden_size
self.conv_block1 = nn.Sequential(
nn.Conv1d(in_channels=1, out_channels=cnn1_output_size, kernel_size=cnn1_kernel_size),
nn.ReLU()
)
self.conv_block2 = nn.Sequential(
nn.Conv1d(in_channels=cnn1_output_size, out_channels=cnn2_output_size, kernel_size=cnn2_kernel_size),
nn.ReLU()
)
self.lstm = nn.LSTM(cnn2_output_size, self.hidden_size, dropout=0.1)
self.hidden_cell = None
self.linear = nn.Linear(self.hidden_size * 2, 1)
def init_hidden(self, batch_size, device):
self.hidden_cell = (torch.zeros(1, batch_size, self.hidden_size).to(device),
torch.zeros(1, batch_size, self.hidden_size).to(device))
def forward(self, x):
if self.hidden_cell is None:
raise Exception
x = self.conv_block1(x)
x = self.conv_block2(x)
x = x.permute(2, 0, 1)
out, self.hidden_cell = self.lstm(x, self.hidden_cell)
hidden_cat = torch.cat([self.hidden_cell[0], self.hidden_cell[1]], dim=2)
predictions = self.linear(hidden_cat)
return predictions
|
11511116 | import pytest
class TestAPreChargeDecision:
@pytest.mark.skip(reason="So the CI build stays green. Remove this to get coding.")
def test_should_record_alternative_offence_advice_against_suspects(self):
pytest.fail()
|
11511133 | import numpy as np
import glob
import sys
import scipy.io as sio
import argparse
sys.path.append('../../')
from util import env, decompose, angular_distance_np, inverse, Reader
parser = argparse.ArgumentParser(
description='measure error of input')
parser.add_argument('--dataset',
type=str, help='redwood or scannet',
default='redwood')
parser.add_argument('--source',
type=str, help='fgr or super4pcs',
default='fgr')
args = parser.parse_args()
data_path = env()
dataset = args.dataset
source = args.source
with open('%s/experiments/%s.test' % (data_path, dataset), 'r') as fin:
lines = [line.strip() for line in fin.readlines()]
print(lines)
with open('%s/experiments/%s.train' % (data_path, dataset), 'r') as fin:
lines2 = [line.strip() for line in fin.readlines()]
lines = lines + lines2
terrs = []
aerrs = []
sigmas = []
for line in lines:
summary_mat = '%s/relative_pose/summary/%s/%s/%s.mat' % (data_path, dataset, source, line)
summary_mat = sio.loadmat(summary_mat)
T = summary_mat['T']
Tstar = summary_mat['Tstar']
aerr = summary_mat['aerr']
terr = summary_mat['terr']
sigma = summary_mat['sigma']
n = Tstar.shape[0]
n = 30
for i in range(n):
for j in range(i+1, n):
Tij = T[i*4:(i+1)*4, j*4:(j+1)*4]
Tij_gt = Tstar[j, :, :].dot(inverse(Tstar[i, :, :]))
terr_ij = np.linalg.norm((Tij_gt - Tij)[:3, 3], 2)
assert abs(terr_ij - terr[i, j]) < 1e-4
terrs.append(terr_ij)
aerr_ij = angular_distance_np(Tij_gt[np.newaxis, :3, :3], Tij[np.newaxis, :3, :3]).sum()
assert abs(aerr_ij - aerr[i, j]) < 1e-4
aerrs.append(aerr_ij)
sigmas.append(sigma[i, j])
aerrs = np.array(aerrs)
terrs = np.array(terrs)
sigmas = np.array(sigmas)
for sigma_threshold in [0.1, 0.2]:
valid_indices = np.where(sigmas < sigma_threshold)[0]
terrs_temp = terrs[valid_indices]
aerrs_temp = aerrs[valid_indices]
for a in [3.0, 5.0, 10.0, 30.0, 45.0]:
p = len(np.where(aerrs_temp < a)[0]) * 1.0 / len(aerrs_temp)
print('Rotation: \tpercentage below %f = %f' % (a, p))
print('Rotation: Mean=%f' % np.mean(aerrs_temp))
for t in [0.05, 0.1, 0.25, 0.5, 0.75]:
p = len(np.where(terrs_temp < t)[0]) * 1.0 / len(terrs_temp)
print('Translation: \tpercentage below %f = %f' % (t, p))
print('Translation: \tMean=%f' % np.mean(terrs_temp))
|
11511159 | import os
from logging.config import fileConfig
fileConfig('examples/logging_config.ini')
DEGIRO_USERNAME = os.getenv('DEGIRO_USERNAME', '<SECRET>')
DEGIRO_PASSWORD = os.getenv('DEGIRO_PASSWORD', '<SECRET>')
|
11511163 | import os
from django.conf import settings
from django.core.files.base import ContentFile
from django.shortcuts import render_to_response
from django.template import RequestContext
from django.http import HttpResponseRedirect
from django.core.urlresolvers import reverse
from django.shortcuts import get_object_or_404
from django.utils.translation import ugettext as _
from django.contrib.auth.decorators import login_required
from django.contrib import messages
try:
from cStringIO import StringIO
except ImportError:
from StringIO import StringIO
try:
from PIL import Image
except ImportError:
import Image
from avatar_crop.forms import AvatarForm, AvatarCropForm
from avatar.models import Avatar
from avatar_crop import AVATAR_CROP_MAX_SIZE
from avatar.settings import AVATAR_STORAGE_DIR, AVATAR_THUMB_QUALITY, AVATAR_THUMB_FORMAT
@login_required
def avatar_crop(request, id=None):
"""
Avatar management, creates a new avatar and makes it default
"""
if id:
avatar = get_object_or_404(Avatar, id=id, user=request.user)
else:
avatar = get_object_or_404(Avatar, user=request.user, primary=True)
if (avatar.avatar.width<=avatar.avatar.height):
result = "width"
else:
result = "height"
if not request.method == "POST":
form = AvatarCropForm()
else:
try:
orig = avatar.avatar.storage.open(avatar.avatar.name, 'rb').read()
image = Image.open(StringIO(orig))
except IOError:
return
form = AvatarCropForm(image, request.POST)
if form.is_valid():
top = int(form.cleaned_data.get('top'))
left = int(form.cleaned_data.get('left'))
right = int(form.cleaned_data.get('right'))
bottom = int(form.cleaned_data.get('bottom'))
box = [ left, top, right, bottom ]
(w, h) = image.size
if result=="width":
box = map(lambda x: x*h/AVATAR_CROP_MAX_SIZE, box)
else:
box = map(lambda x: x*w/AVATAR_CROP_MAX_SIZE, box)
image = image.crop(box)
if image.mode != 'RGB':
image = image.convert('RGB')
thumb = StringIO()
image.save(thumb, AVATAR_THUMB_FORMAT, quality=AVATAR_THUMB_QUALITY)
thumb_file = ContentFile(thumb.getvalue())
base_name, ext = os.path.splitext(avatar.avatar.name)
thumb = avatar.avatar.storage.save("%s_cropped%s" % (base_name, ext), thumb_file)
Avatar.objects.filter(id=avatar.id).update(primary=False)
new_avatar = Avatar(user=request.user, primary=True, avatar=thumb)
new_avatar.save()
messages.add_message(request, messages.INFO, _("Your new avatar has been saved successfully."))
return HttpResponseRedirect(reverse("avatar_change"))
return render_to_response("avatar_crop/crop.html", {
'AVATAR_CROP_MAX_SIZE': AVATAR_CROP_MAX_SIZE,
'dim': result,
'avatar': avatar,
'form': form
}, context_instance=RequestContext(request))
|
11511197 | from common import *
import dask
import dask.array as da
@pytest.fixture
def df():
x = np.arange(10, dtype=np.float64)
y = x**2
df = vaex.from_arrays(x=x, y=y)
df = df[['x', 'y']] # make sure we are in this order
return df
def test_dask_array(df):
X = np.array(df)
Xd = df.to_dask_array(chunks=(5,1)).compute()
assert Xd.tolist() == X.tolist()
Xd = (df.to_dask_array(chunks=(5,1))**2).compute()
assert Xd.tolist() == (X**2).tolist()
# on a column
x = df.x.to_numpy()
xd = df['x'].to_dask_array(chunks=(5,)).compute()
assert xd.tolist() == x.tolist()
xd = (df['x'].to_dask_array(chunks=(5,))**2).compute()
assert xd.tolist() == (x**2).tolist()
def test_dask_sin(df):
X = np.array(df)
Xdv = df.to_dask_array()
sines = np.sin(Xdv).compute()
assert sines[:,0].tolist() == np.sin(df.x).tolist()
assert sines[:,1].tolist() == np.sin(df.y).tolist()
# on a column
x = df.x.to_numpy()
xd = da.sin(df['x'].to_dask_array(chunks=(5,))).compute()
assert xd.tolist() == np.sin(df.x).tolist()
def test_dask_svd(df):
Xd = df.to_dask_array(chunks=(10,2))
values = da.linalg.svd(Xd)
values = dask.compute(*values)
values = [k.tolist() for k in values]
|
11511207 | from unittest import TestCase
from django.core.management import call_command
class RecalculateQueryCountTestCase(TestCase):
def test_run_command(self):
call_command('recalculate_query_count')
|
11511211 | from montepython.likelihood_class import Likelihood_clocks
class cosmic_clocks_BC03_all(Likelihood_clocks):
pass
|
11511218 | import sys
sys.path.append("../")
from helper.utils import *
from config import *
Print(" "*25+" Merge ")
nn_model=pd.read_csv(join(sub_path,"nn_model"))
cat_model=pd.read_csv(join(sub_path,"catboost_sub"))
cat_model.sort_values("fid",inplace=True)
nn_model.sort_values("fid",inplace=True)
columns=cat_model.drop(["fid"],1).columns
sub=cat_model[["fid"]]
nn_weight=0.6
cat_weight=0.4
sub[columns]=nn_model[columns]*nn_weight+cat_model[columns]*cat_weight
target=pd.read_pickle(join(proc_data_path,"target.p"))
target_counts=(target.label.value_counts(True)*len(sub)).round()
ratios={'Crop_ID_1': 1.19,'Crop_ID_2': 1.33,'Crop_ID_4': 1.46,'Crop_ID_5': 2.02,'Crop_ID_6': 1.31,'Crop_ID_3': 2.05,'Crop_ID_7': 2.55}
target_name=['Crop_ID_1', 'Crop_ID_2', 'Crop_ID_3', 'Crop_ID_4', 'Crop_ID_5',
'Crop_ID_6', 'Crop_ID_7']
for label in target_counts.index :
column_name="Crop_ID_{}".format(int(label+1))
other_columns=[ name for name in target_name if name != column_name]
sub=sub.sort_values(column_name,ascending=False)
count=int(target_counts.loc[label]/2.5)
sub_id=sub.fid.tolist()[0:count]
sub.loc[sub.fid.isin(sub_id),column_name]*=ratios[column_name]
Print("save final sub to "+join(sub_path,"final_sub.csv"))
sub.to_csv(join(sub_path,"final_sub.csv"),index=False) |
11511239 | import itertools
import math
import warnings
from copy import deepcopy
from enum import Enum
from typing import TYPE_CHECKING
from typing import Any
from typing import Callable
from typing import Dict
from typing import List
from typing import Optional
from typing import Sequence
from typing import Set
from typing import Tuple
from typing import Type
from typing import Union
import holidays as holidays_lib
import matplotlib.pyplot as plt
import numpy as np
import pandas as pd
import plotly
import plotly.graph_objects as go
import seaborn as sns
from matplotlib.lines import Line2D
from scipy.signal import periodogram
from typing_extensions import Literal
from etna.analysis import RelevanceTable
from etna.analysis.feature_selection import AGGREGATION_FN
from etna.analysis.feature_selection import AggregationMode
from etna.analysis.utils import prepare_axes
from etna.transforms import Transform
if TYPE_CHECKING:
from etna.datasets import TSDataset
from etna.transforms import TimeSeriesImputerTransform
from etna.transforms.decomposition.change_points_trend import ChangePointsTrendTransform
from etna.transforms.decomposition.detrend import LinearTrendTransform
from etna.transforms.decomposition.detrend import TheilSenTrendTransform
from etna.transforms.decomposition.stl import STLTransform
def _get_existing_quantiles(ts: "TSDataset") -> Set[float]:
"""Get quantiles that are present inside the TSDataset."""
cols = [col for col in ts.columns.get_level_values("feature").unique().tolist() if col.startswith("target_0.")]
existing_quantiles = {float(col[len("target_") :]) for col in cols}
return existing_quantiles
def _select_quantiles(forecast_results: Dict[str, "TSDataset"], quantiles: Optional[List[float]]) -> List[float]:
"""Select quantiles from the forecast results.
Selected quantiles exist in each forecast.
"""
intersection_quantiles_set = set.intersection(
*[_get_existing_quantiles(forecast) for forecast in forecast_results.values()]
)
intersection_quantiles = sorted(list(intersection_quantiles_set))
if quantiles is None:
selected_quantiles = intersection_quantiles
else:
selected_quantiles = sorted(list(set(quantiles) & intersection_quantiles_set))
non_existent = set(quantiles) - intersection_quantiles_set
if non_existent:
warnings.warn(f"Quantiles {non_existent} do not exist in each forecast dataset. They will be dropped.")
return selected_quantiles
def _prepare_forecast_results(
forecast_ts: Union["TSDataset", List["TSDataset"], Dict[str, "TSDataset"]]
) -> Dict[str, "TSDataset"]:
"""Prepare dictionary with forecasts results."""
from etna.datasets import TSDataset
if isinstance(forecast_ts, TSDataset):
return {"1": forecast_ts}
elif isinstance(forecast_ts, list) and len(forecast_ts) > 0:
return {str(i + 1): forecast for i, forecast in enumerate(forecast_ts)}
elif isinstance(forecast_ts, dict) and len(forecast_ts) > 0:
return forecast_ts
else:
raise ValueError("Unknown type of `forecast_ts`")
def plot_forecast(
forecast_ts: Union["TSDataset", List["TSDataset"], Dict[str, "TSDataset"]],
test_ts: Optional["TSDataset"] = None,
train_ts: Optional["TSDataset"] = None,
segments: Optional[List[str]] = None,
n_train_samples: Optional[int] = None,
columns_num: int = 2,
figsize: Tuple[int, int] = (10, 5),
prediction_intervals: bool = False,
quantiles: Optional[List[float]] = None,
):
"""
Plot of prediction for forecast pipeline.
Parameters
----------
forecast_ts:
there are several options:
#. Forecasted TSDataset with timeseries data, single-forecast mode
#. List of forecasted TSDatasets, multi-forecast mode
#. Dictionary with forecasted TSDatasets, multi-forecast mode
test_ts:
TSDataset with timeseries data
train_ts:
TSDataset with timeseries data
segments:
segments to plot; if not given plot all the segments from ``forecast_df``
n_train_samples:
length of history of train to plot
columns_num:
number of graphics columns
figsize:
size of the figure per subplot with one segment in inches
prediction_intervals:
if True prediction intervals will be drawn
quantiles:
List of quantiles to draw, if isn't set then quantiles from a given dataset will be used.
In multi-forecast mode, only quantiles present in each forecast will be used.
Raises
------
ValueError:
if the format of ``forecast_ts`` is unknown
"""
forecast_results = _prepare_forecast_results(forecast_ts)
num_forecasts = len(forecast_results.keys())
if segments is None:
unique_segments = set()
for forecast in forecast_results.values():
unique_segments.update(forecast.segments)
segments = list(unique_segments)
ax = prepare_axes(segments=segments, columns_num=columns_num, figsize=figsize)
if prediction_intervals:
quantiles = _select_quantiles(forecast_results, quantiles)
if train_ts is not None:
train_ts.df.sort_values(by="timestamp", inplace=True)
if test_ts is not None:
test_ts.df.sort_values(by="timestamp", inplace=True)
for i, segment in enumerate(segments):
if train_ts is not None:
segment_train_df = train_ts[:, segment, :][segment]
else:
segment_train_df = pd.DataFrame(columns=["timestamp", "target", "segment"])
if test_ts is not None:
segment_test_df = test_ts[:, segment, :][segment]
else:
segment_test_df = pd.DataFrame(columns=["timestamp", "target", "segment"])
if n_train_samples is None:
plot_df = segment_train_df
elif n_train_samples != 0:
plot_df = segment_train_df[-n_train_samples:]
else:
plot_df = pd.DataFrame(columns=["timestamp", "target", "segment"])
if (train_ts is not None) and (n_train_samples != 0):
ax[i].plot(plot_df.index.values, plot_df.target.values, label="train")
if test_ts is not None:
ax[i].plot(segment_test_df.index.values, segment_test_df.target.values, color="purple", label="test")
# plot forecast plot for each of given forecasts
quantile_prefix = "target_"
for j, (forecast_name, forecast) in enumerate(forecast_results.items()):
legend_prefix = f"{forecast_name}: " if num_forecasts > 1 else ""
segment_forecast_df = forecast[:, segment, :][segment].sort_values(by="timestamp")
line = ax[i].plot(
segment_forecast_df.index.values,
segment_forecast_df.target.values,
linewidth=1,
label=f"{legend_prefix}forecast",
)
forecast_color = line[0].get_color()
# draw prediction intervals from outer layers to inner ones
if prediction_intervals and quantiles is not None:
alpha = np.linspace(0, 1 / 2, len(quantiles) // 2 + 2)[1:-1]
for quantile_idx in range(len(quantiles) // 2):
# define upper and lower border for this iteration
low_quantile = quantiles[quantile_idx]
high_quantile = quantiles[-quantile_idx - 1]
values_low = segment_forecast_df[f"{quantile_prefix}{low_quantile}"].values
values_high = segment_forecast_df[f"{quantile_prefix}{high_quantile}"].values
# if (low_quantile, high_quantile) is the smallest interval
if quantile_idx == len(quantiles) // 2 - 1:
ax[i].fill_between(
segment_forecast_df.index.values,
values_low,
values_high,
facecolor=forecast_color,
alpha=alpha[quantile_idx],
label=f"{legend_prefix}{low_quantile}-{high_quantile}",
)
# if there is some interval inside (low_quantile, high_quantile) we should plot around it
else:
low_next_quantile = quantiles[quantile_idx + 1]
high_prev_quantile = quantiles[-quantile_idx - 2]
values_next = segment_forecast_df[f"{quantile_prefix}{low_next_quantile}"].values
ax[i].fill_between(
segment_forecast_df.index.values,
values_low,
values_next,
facecolor=forecast_color,
alpha=alpha[quantile_idx],
label=f"{legend_prefix}{low_quantile}-{high_quantile}",
)
values_prev = segment_forecast_df[f"{quantile_prefix}{high_prev_quantile}"].values
ax[i].fill_between(
segment_forecast_df.index.values,
values_high,
values_prev,
facecolor=forecast_color,
alpha=alpha[quantile_idx],
)
# when we can't find pair quantile, we plot it separately
if len(quantiles) % 2 != 0:
remaining_quantile = quantiles[len(quantiles) // 2]
values = segment_forecast_df[f"{quantile_prefix}{remaining_quantile}"].values
ax[i].plot(
segment_forecast_df.index.values,
values,
"--",
color=forecast_color,
label=f"{legend_prefix}{remaining_quantile}",
)
ax[i].set_title(segment)
ax[i].tick_params("x", rotation=45)
ax[i].legend(loc="upper left")
def plot_backtest(
forecast_df: pd.DataFrame,
ts: "TSDataset",
segments: Optional[List[str]] = None,
folds: Optional[List[int]] = None,
columns_num: int = 2,
history_len: int = 0,
figsize: Tuple[int, int] = (10, 5),
):
"""Plot targets and forecast for backtest pipeline.
Parameters
----------
forecast_df:
forecasted dataframe with timeseries data
ts:
dataframe of timeseries that was used for backtest
segments:
segments to plot
folds:
folds to plot
columns_num:
number of subplots columns
history_len:
length of pre-backtest history to plot
figsize:
size of the figure per subplot with one segment in inches
"""
if segments is None:
segments = sorted(ts.segments)
df = ts.df
ax = prepare_axes(segments=segments, columns_num=columns_num, figsize=figsize)
if not folds:
folds = sorted(set(forecast_df[segments[0]]["fold_number"]))
forecast_start = forecast_df.index.min()
history_df = df[df.index < forecast_start]
backtest_df = df[df.index >= forecast_start]
for i, segment in enumerate(segments):
segment_backtest_df = backtest_df[segment]
segment_history_df = history_df[segment]
if history_len:
plot_df = segment_history_df.tail(history_len)
else:
plot_df = segment_backtest_df
ax[i].plot(plot_df.index, plot_df.target, label="history")
ax[i].plot(segment_backtest_df.index, segment_backtest_df.target, label="test")
segment_forecast_df = forecast_df[segment]
for fold_number in folds:
forecast_df_slice_fold = segment_forecast_df[segment_forecast_df.fold_number == fold_number]
ax[i].axvspan(
forecast_df_slice_fold.index.min(),
forecast_df_slice_fold.index.max(),
alpha=0.15 * (int(forecast_df_slice_fold.fold_number.max() + 1) % 2),
color="skyblue",
)
ax[i].plot(segment_forecast_df.index, segment_forecast_df.target, label="forecast")
ax[i].set_title(segment)
ax[i].legend()
ax[i].tick_params("x", rotation=45)
def plot_backtest_interactive(
forecast_df: pd.DataFrame,
ts: "TSDataset",
segments: Optional[List[str]] = None,
folds: Optional[List[int]] = None,
history_len: int = 0,
figsize: Tuple[int, int] = (900, 600),
) -> go.Figure:
"""Plot targets and forecast for backtest pipeline using plotly.
Parameters
----------
forecast_df:
forecasted dataframe with timeseries data
ts:
dataframe of timeseries that was used for backtest
segments:
segments to plot
folds:
folds to plot
history_len:
length of pre-backtest history to plot
figsize:
size of the figure in pixels
Returns
-------
go.Figure:
result of plotting
"""
if segments is None:
segments = sorted(ts.segments)
df = ts.df
if not folds:
folds = sorted(set(forecast_df[segments[0]]["fold_number"]))
fig = go.Figure()
colors = plotly.colors.qualitative.Dark24
forecast_start = forecast_df.index.min()
history_df = df[df.index < forecast_start]
backtest_df = df[df.index >= forecast_start]
for i, segment in enumerate(segments):
segment_backtest_df = backtest_df[segment]
segment_history_df = history_df[segment]
if history_len:
plot_df = segment_history_df.tail(history_len)
else:
plot_df = segment_backtest_df
# history
fig.add_trace(
go.Scattergl(
x=plot_df.index,
y=plot_df.target,
legendgroup=f"{segment}",
name=f"{segment}",
marker_color=colors[i % len(colors)],
showlegend=True,
line=dict(width=2, dash="solid"),
)
)
# test
fig.add_trace(
go.Scattergl(
x=segment_backtest_df.index,
y=segment_backtest_df.target,
legendgroup=f"{segment}",
name=f"Test: {segment}",
marker_color=colors[i % len(colors)],
showlegend=False,
line=dict(width=2, dash="dot"),
)
)
# folds
segment_forecast_df = forecast_df[segment]
if i == 0:
for fold_number in folds:
forecast_df_slice_fold = segment_forecast_df[segment_forecast_df.fold_number == fold_number]
opacity = 0.15 * (int(forecast_df_slice_fold.fold_number.max() + 1) % 2)
fig.add_vrect(
x0=forecast_df_slice_fold.index.min(),
x1=forecast_df_slice_fold.index.max(),
line_width=0,
fillcolor="blue",
opacity=opacity,
)
# forecast
fig.add_trace(
go.Scattergl(
x=segment_forecast_df.index,
y=segment_forecast_df.target,
legendgroup=f"{segment}",
name=f"Forecast: {segment}",
marker_color=colors[i % len(colors)],
showlegend=False,
line=dict(width=2, dash="dash"),
)
)
fig.update_layout(
height=figsize[1],
width=figsize[0],
title="Backtest for all segments",
xaxis_title="timestamp",
yaxis_title="target",
legend=dict(itemsizing="trace", title="Segments"),
updatemenus=[
dict(
type="buttons",
direction="left",
xanchor="left",
yanchor="top",
showactive=True,
x=1.0,
y=1.1,
buttons=[
dict(method="restyle", args=["visible", "all"], label="show all"),
dict(method="restyle", args=["visible", "legendonly"], label="hide all"),
],
)
],
annotations=[
dict(text="Show segments:", showarrow=False, x=1.0, y=1.08, xref="paper", yref="paper", align="left")
],
)
return fig
def plot_anomalies(
ts: "TSDataset",
anomaly_dict: Dict[str, List[pd.Timestamp]],
in_column: str = "target",
segments: Optional[List[str]] = None,
columns_num: int = 2,
figsize: Tuple[int, int] = (10, 5),
):
"""Plot a time series with indicated anomalies.
Parameters
----------
ts:
TSDataset of timeseries that was used for detect anomalies
anomaly_dict:
dictionary derived from anomaly detection function,
e.g. :py:func:`~etna.analysis.outliers.density_outliers.get_anomalies_density`
in_column:
column to plot
segments:
segments to plot
columns_num:
number of subplots columns
figsize:
size of the figure per subplot with one segment in inches
"""
if segments is None:
segments = sorted(ts.segments)
ax = prepare_axes(segments=segments, columns_num=columns_num, figsize=figsize)
for i, segment in enumerate(segments):
segment_df = ts[:, segment, :][segment]
anomaly = anomaly_dict[segment]
ax[i].set_title(segment)
ax[i].plot(segment_df.index.values, segment_df[in_column].values, c="b")
anomaly = sorted(anomaly) # type: ignore
ax[i].scatter(anomaly, segment_df[segment_df.index.isin(anomaly)][in_column].values, c="r")
ax[i].tick_params("x", rotation=45)
def get_correlation_matrix(
ts: "TSDataset", segments: Optional[List[str]] = None, method: str = "pearson"
) -> np.ndarray:
"""Compute pairwise correlation of timeseries for selected segments.
Parameters
----------
ts:
TSDataset with timeseries data
segments:
Segments to use
method:
Method of correlation:
* pearson: standard correlation coefficient
* kendall: Kendall Tau correlation coefficient
* spearman: Spearman rank correlation
Returns
-------
np.ndarray
Correlation matrix
"""
if method not in ["pearson", "kendall", "spearman"]:
raise ValueError(f"'{method}' is not a valid method of correlation.")
if segments is None:
segments = sorted(ts.segments)
correlation_matrix = ts[:, segments, :].corr(method=method).values
return correlation_matrix
def plot_correlation_matrix(
ts: "TSDataset",
segments: Optional[List[str]] = None,
method: str = "pearson",
figsize: Tuple[int, int] = (10, 10),
**heatmap_kwargs,
):
"""Plot pairwise correlation heatmap for selected segments.
Parameters
----------
ts:
TSDataset with timeseries data
segments:
Segments to use
method:
Method of correlation:
* pearson: standard correlation coefficient
* kendall: Kendall Tau correlation coefficient
* spearman: Spearman rank correlation
figsize:
size of the figure in inches
"""
if segments is None:
segments = sorted(ts.segments)
if "vmin" not in heatmap_kwargs:
heatmap_kwargs["vmin"] = -1
if "vmax" not in heatmap_kwargs:
heatmap_kwargs["vmax"] = 1
correlation_matrix = get_correlation_matrix(ts, segments, method)
fig, ax = plt.subplots(figsize=figsize)
ax = sns.heatmap(correlation_matrix, annot=True, fmt=".1g", square=True, ax=ax, **heatmap_kwargs)
labels = list(ts[:, segments, :].columns.values)
ax.set_xticklabels(labels, rotation=45, horizontalalignment="right")
ax.set_yticklabels(labels, rotation=0, horizontalalignment="right")
ax.set_title("Correlation Heatmap")
def plot_anomalies_interactive(
ts: "TSDataset",
segment: str,
method: Callable[..., Dict[str, List[pd.Timestamp]]],
params_bounds: Dict[str, Tuple[Union[int, float], Union[int, float], Union[int, float]]],
in_column: str = "target",
figsize: Tuple[int, int] = (20, 10),
):
"""Plot a time series with indicated anomalies.
Anomalies are obtained using the specified method. The method parameters values
can be changed using the corresponding sliders.
Parameters
----------
ts:
TSDataset with timeseries data
segment:
Segment to plot
method:
Method for outliers detection, e.g. :py:func:`~etna.analysis.outliers.density_outliers.get_anomalies_density`
params_bounds:
Parameters ranges of the outliers detection method. Bounds for the parameter are (min,max,step)
in_column:
column to plot
figsize:
size of the figure in inches
Notes
-----
Jupyter notebook might display the results incorrectly,
in this case try to use ``!jupyter nbextension enable --py widgetsnbextension``.
Examples
--------
>>> from etna.datasets import TSDataset
>>> from etna.datasets import generate_ar_df
>>> from etna.analysis import plot_anomalies_interactive, get_anomalies_density
>>> classic_df = generate_ar_df(periods=1000, start_time="2021-08-01", n_segments=2)
>>> df = TSDataset.to_dataset(classic_df)
>>> ts = TSDataset(df, "D")
>>> params_bounds = {"window_size": (5, 20, 1), "distance_coef": (0.1, 3, 0.25)}
>>> method = get_anomalies_density
>>> plot_anomalies_interactive(ts=ts, segment="segment_1", method=method, params_bounds=params_bounds, figsize=(20, 10)) # doctest: +SKIP
"""
from ipywidgets import FloatSlider
from ipywidgets import IntSlider
from ipywidgets import interact
from etna.datasets import TSDataset
df = ts[:, segment, in_column]
ts = TSDataset(ts[:, segment, :], ts.freq)
x, y = df.index.values, df.values
cache = {}
sliders = dict()
style = {"description_width": "initial"}
for param, bounds in params_bounds.items():
min_, max_, step = bounds
if isinstance(min_, float) or isinstance(max_, float) or isinstance(step, float):
sliders[param] = FloatSlider(min=min_, max=max_, step=step, continuous_update=False, style=style)
else:
sliders[param] = IntSlider(min=min_, max=max_, step=step, continuous_update=False, style=style)
def update(**kwargs):
key = "_".join([str(val) for val in kwargs.values()])
if key not in cache:
anomalies = method(ts, **kwargs)[segment]
anomalies = sorted(anomalies)
cache[key] = anomalies
else:
anomalies = cache[key]
plt.figure(figsize=figsize)
plt.cla()
plt.plot(x, y)
plt.scatter(anomalies, y[pd.to_datetime(x).isin(anomalies)], c="r")
plt.xticks(rotation=45)
plt.show()
interact(update, **sliders)
def plot_clusters(
ts: "TSDataset",
segment2cluster: Dict[str, int],
centroids_df: Optional[pd.DataFrame] = None,
columns_num: int = 2,
figsize: Tuple[int, int] = (10, 5),
):
"""Plot clusters [with centroids].
Parameters
----------
ts:
TSDataset with timeseries
segment2cluster:
mapping from segment to cluster in format {segment: cluster}
centroids_df:
dataframe with centroids
columns_num:
number of columns in subplots
figsize:
size of the figure per subplot with one segment in inches
"""
unique_clusters = sorted(set(segment2cluster.values()))
rows_num = math.ceil(len(unique_clusters) / columns_num)
figsize = (figsize[0] * columns_num, figsize[1] * rows_num)
fig, axs = plt.subplots(rows_num, columns_num, constrained_layout=True, figsize=figsize)
for i, cluster in enumerate(unique_clusters):
segments = [segment for segment in segment2cluster if segment2cluster[segment] == cluster]
h, w = i // columns_num, i % columns_num
for segment in segments:
segment_slice = ts[:, segment, "target"]
axs[h][w].plot(
segment_slice.index.values,
segment_slice.values,
alpha=1 / math.sqrt(len(segments)),
c="blue",
)
axs[h][w].set_title(f"cluster={cluster}\n{len(segments)} segments in cluster")
if centroids_df is not None:
centroid = centroids_df[cluster, "target"]
axs[h][w].plot(centroid.index.values, centroid.values, c="red", label="centroid")
axs[h][w].legend()
def plot_time_series_with_change_points(
ts: "TSDataset",
change_points: Dict[str, List[pd.Timestamp]],
segments: Optional[List[str]] = None,
columns_num: int = 2,
figsize: Tuple[int, int] = (10, 5),
):
"""Plot segments with their trend change points.
Parameters
----------
ts:
TSDataset with timeseries
change_points:
dictionary with trend change points for each segment,
can be obtained from :py:func:`~etna.analysis.change_points_trend.search.find_change_points`
segments:
segments to use
columns_num:
number of subplots columns
figsize:
size of the figure per subplot with one segment in inches
"""
if segments is None:
segments = sorted(ts.segments)
ax = prepare_axes(segments=segments, columns_num=columns_num, figsize=figsize)
for i, segment in enumerate(segments):
segment_df = ts[:, segment, :][segment]
change_points_segment = change_points[segment]
# plot each part of segment separately
timestamp = segment_df.index.values
target = segment_df["target"].values
all_change_points_segment = [pd.Timestamp(timestamp[0])] + change_points_segment + [pd.Timestamp(timestamp[-1])]
for idx in range(len(all_change_points_segment) - 1):
start_time = all_change_points_segment[idx]
end_time = all_change_points_segment[idx + 1]
selected_indices = (timestamp >= start_time) & (timestamp <= end_time)
cur_timestamp = timestamp[selected_indices]
cur_target = target[selected_indices]
ax[i].plot(cur_timestamp, cur_target)
# plot each trend change point
for change_point in change_points_segment:
ax[i].axvline(change_point, linestyle="dashed", c="grey")
ax[i].set_title(segment)
ax[i].tick_params("x", rotation=45)
def get_residuals(forecast_df: pd.DataFrame, ts: "TSDataset") -> "TSDataset":
"""Get residuals for further analysis.
Parameters
----------
forecast_df:
forecasted dataframe with timeseries data
ts:
dataset of timeseries that has answers to forecast
Returns
-------
new_ts: TSDataset
TSDataset with residuals in forecasts
Raises
------
KeyError:
if segments of ``forecast_df`` and ``ts`` aren't the same
Notes
-----
Transforms are taken as is from ``ts``.
"""
from etna.datasets import TSDataset
# find the residuals
true_df = ts[forecast_df.index, :, :]
if set(ts.segments) != set(forecast_df.columns.get_level_values("segment").unique()):
raise KeyError("Segments of `ts` and `forecast_df` should be the same")
true_df.loc[:, pd.IndexSlice[ts.segments, "target"]] -= forecast_df.loc[:, pd.IndexSlice[ts.segments, "target"]]
# make TSDataset
new_ts = TSDataset(df=true_df, freq=ts.freq)
new_ts.known_future = ts.known_future
new_ts._regressors = ts.regressors
new_ts.transforms = ts.transforms
new_ts.df_exog = ts.df_exog
return new_ts
def plot_residuals(
forecast_df: pd.DataFrame,
ts: "TSDataset",
feature: Union[str, Literal["timestamp"]] = "timestamp",
transforms: Sequence[Transform] = (),
segments: Optional[List[str]] = None,
columns_num: int = 2,
figsize: Tuple[int, int] = (10, 5),
):
"""Plot residuals for predictions from backtest against some feature.
Parameters
----------
forecast_df:
forecasted dataframe with timeseries data
ts:
dataframe of timeseries that was used for backtest
feature:
feature name to draw against residuals, if "timestamp" plot residuals against the timestamp
transforms:
sequence of transforms to get feature column
segments:
segments to use
columns_num:
number of columns in subplots
figsize:
size of the figure per subplot with one segment in inches
Raises
------
ValueError:
if feature isn't present in the dataset after applying transformations
Notes
-----
Parameter ``transforms`` is necessary because some pipelines doesn't save features in their forecasts,
e.g. :py:mod:`etna.ensembles` pipelines.
"""
if segments is None:
segments = sorted(ts.segments)
ax = prepare_axes(segments=segments, columns_num=columns_num, figsize=figsize)
ts_copy = deepcopy(ts)
ts_copy.fit_transform(transforms=transforms)
ts_residuals = get_residuals(forecast_df=forecast_df, ts=ts_copy)
df = ts_residuals.to_pandas()
# check if feature is present in dataset
if feature != "timestamp":
all_features = set(df.columns.get_level_values("feature").unique())
if feature not in all_features:
raise ValueError("Given feature isn't present in the dataset after applying transformations")
for i, segment in enumerate(segments):
segment_forecast_df = forecast_df.loc[:, pd.IndexSlice[segment, :]][segment].reset_index()
segment_residuals_df = df.loc[:, pd.IndexSlice[segment, :]][segment].reset_index()
residuals = segment_residuals_df["target"].values
feature_values = segment_residuals_df[feature].values
# highlight different backtest folds
if feature == "timestamp":
folds = sorted(set(segment_forecast_df["fold_number"]))
for fold_number in folds:
forecast_df_slice_fold = segment_forecast_df[segment_forecast_df["fold_number"] == fold_number]
ax[i].axvspan(
forecast_df_slice_fold["timestamp"].min(),
forecast_df_slice_fold["timestamp"].max(),
alpha=0.15 * (int(forecast_df_slice_fold["fold_number"].max() + 1) % 2),
color="skyblue",
)
ax[i].scatter(feature_values, residuals, c="b")
ax[i].set_title(segment)
ax[i].tick_params("x", rotation=45)
ax[i].set_xlabel(feature)
TrendTransformType = Union[
"ChangePointsTrendTransform", "LinearTrendTransform", "TheilSenTrendTransform", "STLTransform"
]
def _get_labels_names(trend_transform, segments):
"""If only unique transform classes are used then show their short names (without parameters). Otherwise show their full repr as label."""
from etna.transforms.decomposition.detrend import LinearTrendTransform
from etna.transforms.decomposition.detrend import TheilSenTrendTransform
labels = [transform.__repr__() for transform in trend_transform]
labels_short = [i[: i.find("(")] for i in labels]
if len(np.unique(labels_short)) == len(labels_short):
labels = labels_short
linear_coeffs = dict(zip(segments, ["" for i in range(len(segments))]))
if (
len(trend_transform) == 1
and isinstance(trend_transform[0], (LinearTrendTransform, TheilSenTrendTransform))
and trend_transform[0].poly_degree == 1
):
for seg in segments:
linear_coeffs[seg] = (
", k=" + f"{trend_transform[0].segment_transforms[seg]._pipeline.steps[1][1].coef_[0]:g}"
)
return labels, linear_coeffs
def plot_trend(
ts: "TSDataset",
trend_transform: Union["TrendTransformType", List["TrendTransformType"]],
segments: Optional[List[str]] = None,
columns_num: int = 2,
figsize: Tuple[int, int] = (10, 5),
):
"""Plot series and trend from trend transform for this series.
If only unique transform classes are used then show their short names (without parameters).
Otherwise show their full repr as label
Parameters
----------
ts:
dataframe of timeseries that was used for trend plot
trend_transform:
trend transform or list of trend transforms to apply
segments:
segments to use
columns_num:
number of columns in subplots
figsize:
size of the figure per subplot with one segment in inches
"""
if segments is None:
segments = ts.segments
ax = prepare_axes(segments=segments, columns_num=columns_num, figsize=figsize)
df = ts.df
if not isinstance(trend_transform, list):
trend_transform = [trend_transform]
df_detrend = [transform.fit_transform(df.copy()) for transform in trend_transform]
labels, linear_coeffs = _get_labels_names(trend_transform, segments)
for i, segment in enumerate(segments):
ax[i].plot(df[segment]["target"], label="Initial series")
for label, df_now in zip(labels, df_detrend):
ax[i].plot(df[segment, "target"] - df_now[segment, "target"], label=label + linear_coeffs[segment])
ax[i].set_title(segment)
ax[i].tick_params("x", rotation=45)
ax[i].legend()
def plot_feature_relevance(
ts: "TSDataset",
relevance_table: RelevanceTable,
normalized: bool = False,
relevance_aggregation_mode: Union[str, Literal["per-segment"]] = AggregationMode.mean,
relevance_params: Optional[Dict[str, Any]] = None,
top_k: Optional[int] = None,
segments: Optional[List[str]] = None,
columns_num: int = 2,
figsize: Tuple[int, int] = (10, 5),
):
"""
Plot relevance of the features.
The most important features are at the top, the least important are at the bottom.
Parameters
----------
ts:
TSDataset with timeseries data
relevance_table:
method to evaluate the feature relevance
normalized:
whether obtained relevances should be normalized to sum up to 1
relevance_aggregation_mode:
aggregation strategy for obtained feature relevance table;
all the strategies can be examined
at :py:class:`~etna.analysis.feature_selection.mrmr_selection.AggregationMode`
relevance_params:
additional keyword arguments for the ``__call__`` method of
:py:class:`~etna.analysis.feature_relevance.relevance.RelevanceTable`
top_k:
number of best features to plot, if None plot all the features
segments:
segments to use
columns_num:
if ``relevance_aggregation_mode="per-segment"`` number of columns in subplots, otherwise the value is ignored
figsize:
size of the figure per subplot with one segment in inches
"""
if relevance_params is None:
relevance_params = {}
if segments is None:
segments = sorted(ts.segments)
is_ascending = not relevance_table.greater_is_better
features = list(set(ts.columns.get_level_values("feature")) - {"target"})
relevance_df = relevance_table(df=ts[:, :, "target"], df_exog=ts[:, :, features], **relevance_params).loc[segments]
if relevance_aggregation_mode == "per-segment":
ax = prepare_axes(segments=segments, columns_num=columns_num, figsize=figsize)
for i, segment in enumerate(segments):
relevance = relevance_df.loc[segment].sort_values(ascending=is_ascending)
# warning about NaNs
if relevance.isna().any():
na_relevance_features = relevance[relevance.isna()].index.tolist()
warnings.warn(
f"Relevances on segment: {segment} of features: {na_relevance_features} can't be calculated."
)
relevance = relevance.dropna()[:top_k]
if normalized:
relevance = relevance / relevance.sum()
sns.barplot(x=relevance.values, y=relevance.index, orient="h", ax=ax[i])
ax[i].set_title(f"Feature relevance: {segment}")
else:
relevance_aggregation_fn = AGGREGATION_FN[AggregationMode(relevance_aggregation_mode)]
relevance = relevance_df.apply(lambda x: relevance_aggregation_fn(x[~x.isna()])) # type: ignore
relevance = relevance.sort_values(ascending=is_ascending)
# warning about NaNs
if relevance.isna().any():
na_relevance_features = relevance[relevance.isna()].index.tolist()
warnings.warn(f"Relevances of features: {na_relevance_features} can't be calculated.")
# if top_k == None, all the values are selected
relevance = relevance.dropna()[:top_k]
if normalized:
relevance = relevance / relevance.sum()
_, ax = plt.subplots(figsize=figsize, constrained_layout=True)
sns.barplot(x=relevance.values, y=relevance.index, orient="h", ax=ax)
ax.set_title("Feature relevance") # type: ignore
def plot_imputation(
ts: "TSDataset",
imputer: "TimeSeriesImputerTransform",
segments: Optional[List[str]] = None,
columns_num: int = 2,
figsize: Tuple[int, int] = (10, 5),
):
"""Plot the result of imputation by a given imputer.
Parameters
----------
ts:
TSDataset with timeseries data
imputer:
transform to make imputation of NaNs
segments:
segments to use
columns_num:
number of columns in subplots
figsize:
size of the figure per subplot with one segment in inches
"""
if segments is None:
segments = sorted(ts.segments)
ax = prepare_axes(segments=segments, columns_num=columns_num, figsize=figsize)
ts_after = deepcopy(ts)
ts_after.fit_transform(transforms=[imputer])
feature_name = imputer.in_column
for i, segment in enumerate(segments):
# we want to capture nans at the beginning, so don't use `ts[:, segment, :]`
segment_before_df = ts.to_pandas().loc[:, pd.IndexSlice[segment, feature_name]]
segment_after_df = ts_after.to_pandas().loc[:, pd.IndexSlice[segment, feature_name]]
# plot result after imputation
ax[i].plot(segment_after_df.index, segment_after_df)
# highlight imputed points
imputed_index = ~segment_after_df.isna() & segment_before_df.isna()
ax[i].scatter(
segment_after_df.loc[imputed_index].index,
segment_after_df.loc[imputed_index],
c="red",
zorder=2,
)
ax[i].set_title(segment)
ax[i].tick_params("x", rotation=45)
def plot_periodogram(
ts: "TSDataset",
period: float,
amplitude_aggregation_mode: Union[str, Literal["per-segment"]] = AggregationMode.mean,
periodogram_params: Optional[Dict[str, Any]] = None,
segments: Optional[List[str]] = None,
columns_num: int = 2,
figsize: Tuple[int, int] = (10, 5),
):
"""Plot the periodogram using :py:func:`scipy.signal.periodogram`.
It is useful to determine the optimal ``order`` parameter
for :py:class:`~etna.transforms.timestamp.fourier.FourierTransform`.
Parameters
----------
ts:
TSDataset with timeseries data
period:
the period of the seasonality to capture in frequency units of time series, it should be >= 2;
it is translated to the ``fs`` parameter of :py:func:`scipy.signal.periodogram`
amplitude_aggregation_mode:
aggregation strategy for obtained per segment periodograms;
all the strategies can be examined
at :py:class:`~etna.analysis.feature_selection.mrmr_selection.AggregationMode`
periodogram_params:
additional keyword arguments for periodogram, :py:func:`scipy.signal.periodogram` is used
segments:
segments to use
columns_num:
if ``amplitude_aggregation_mode="per-segment"`` number of columns in subplots, otherwise the value is ignored
figsize:
size of the figure per subplot with one segment in inches
Raises
------
ValueError:
if period < 2
ValueError:
if periodogram can't be calculated on segment because of the NaNs inside it
Notes
-----
In non per-segment mode all segments are cut to be the same length, the last values are taken.
"""
if period < 2:
raise ValueError("Period should be at least 2")
if periodogram_params is None:
periodogram_params = {}
if not segments:
segments = sorted(ts.segments)
df = ts.to_pandas()
# plot periodograms
if amplitude_aggregation_mode == "per-segment":
ax = prepare_axes(segments=segments, columns_num=columns_num, figsize=figsize)
for i, segment in enumerate(segments):
segment_df = df.loc[:, pd.IndexSlice[segment, "target"]]
segment_df = segment_df[segment_df.first_valid_index() : segment_df.last_valid_index()]
if segment_df.isna().any():
raise ValueError(f"Periodogram can't be calculated on segment with NaNs inside: {segment}")
frequencies, spectrum = periodogram(x=segment_df, fs=period, **periodogram_params)
ax[i].step(frequencies, spectrum)
ax[i].set_xscale("log")
ax[i].set_xlabel("Frequency")
ax[i].set_ylabel("Power spectral density")
ax[i].set_title(f"Periodogram: {segment}")
else:
# find length of each segment
lengths_segments = []
for segment in segments:
segment_df = df.loc[:, pd.IndexSlice[segment, "target"]]
segment_df = segment_df[segment_df.first_valid_index() : segment_df.last_valid_index()]
if segment_df.isna().any():
raise ValueError(f"Periodogram can't be calculated on segment with NaNs inside: {segment}")
lengths_segments.append(len(segment_df))
cut_length = min(lengths_segments)
# cut each segment to `cut_length` last elements and find periodogram for each segment
frequencies_segments = []
spectrums_segments = []
for segment in segments:
segment_df = df.loc[:, pd.IndexSlice[segment, "target"]]
segment_df = segment_df[segment_df.first_valid_index() : segment_df.last_valid_index()][-cut_length:]
frequencies, spectrum = periodogram(x=segment_df, fs=period, **periodogram_params)
frequencies_segments.append(frequencies)
spectrums_segments.append(spectrum)
frequencies = frequencies_segments[0]
amplitude_aggregation_fn = AGGREGATION_FN[AggregationMode(amplitude_aggregation_mode)]
spectrum = amplitude_aggregation_fn(spectrums_segments, axis=0) # type: ignore
_, ax = plt.subplots(figsize=figsize, constrained_layout=True)
ax.step(frequencies, spectrum) # type: ignore
ax.set_xscale("log") # type: ignore
ax.set_xlabel("Frequency") # type: ignore
ax.set_ylabel("Power spectral density") # type: ignore
ax.set_title("Periodogram") # type: ignore
def _create_holidays_df(country_holidays: Type["holidays_lib.HolidayBase"], timestamp: List[pd.Timestamp]):
holiday_names = {country_holidays.get(timestamp_value) for timestamp_value in timestamp}
holiday_names = holiday_names.difference({None})
holidays_dict = {}
for holiday_name in holiday_names:
cur_holiday_index = pd.Series(timestamp).apply(lambda x: country_holidays.get(x, "") == holiday_name)
holidays_dict[holiday_name] = cur_holiday_index
holidays_df = pd.DataFrame(holidays_dict)
holidays_df.index = timestamp
return holidays_df
def plot_holidays(
ts: "TSDataset",
holidays: Union[str, pd.DataFrame],
segments: Optional[List[str]] = None,
columns_num: int = 2,
figsize: Tuple[int, int] = (10, 5),
):
"""Plot holidays for segments.
Sequence of timestamps with one holiday is drawn as a colored region.
Individual holiday is drawn like a colored point.
It is not possible to distinguish points plotted at one timestamp, but this case is considered rare.
This the problem isn't relevant for region drawing because they are partially transparent.
Parameters
----------
ts:
TSDataset with timeseries data
holidays:
there are several options:
* if str, then this is code of the country in `holidays <https://pypi.org/project/holidays/>`_ library;
* | if DataFrame, then dataframe with holidays is expected to have timestamp index with holiday names columns.
| In a holiday column values 0 represent absence of holiday in that timestamp, 1 represent the presence.
segments:
segments to use
columns_num:
number of columns in subplots
figsize:
size of the figure per subplot with one segment in inches
"""
if segments is None:
segments = sorted(ts.segments)
if isinstance(holidays, str):
holidays_df = _create_holidays_df(
country_holidays=holidays_lib.CountryHoliday(country=holidays), timestamp=ts.index.tolist()
)
elif isinstance(holidays, pd.DataFrame):
holidays_df = holidays
else:
raise ValueError("Parameter holidays is expected as str or pd.DataFrame")
ax = prepare_axes(segments=segments, columns_num=columns_num, figsize=figsize)
df = ts.to_pandas()
for i, segment in enumerate(segments):
segment_df = df.loc[:, pd.IndexSlice[segment, "target"]]
segment_df = segment_df[segment_df.first_valid_index() : segment_df.last_valid_index()]
# plot target on segment
target_plot = ax[i].plot(segment_df.index, segment_df)
target_color = target_plot[0].get_color()
# plot holidays on segment
# remember color of each holiday to reuse it
default_colors = plt.rcParams["axes.prop_cycle"].by_key()["color"]
default_colors.remove(target_color)
color_cycle = itertools.cycle(default_colors)
holidays_colors = {holiday_name: next(color_cycle) for holiday_name in holidays_df.columns}
for holiday_name in holidays_df.columns:
holiday_df = holidays_df.loc[segment_df.index, holiday_name]
for _, holiday_group in itertools.groupby(enumerate(holiday_df.tolist()), key=lambda x: x[1]):
holiday_group_cached = list(holiday_group)
indices = [x[0] for x in holiday_group_cached]
values = [x[1] for x in holiday_group_cached]
# if we have group with zero value, then it is not a holidays, skip it
if values[0] == 0:
continue
color = holidays_colors[holiday_name]
if len(indices) == 1:
# plot individual holiday point
ax[i].scatter(segment_df.index[indices[0]], segment_df.iloc[indices[0]], color=color, zorder=2)
else:
# plot span with holiday borders
x_min = segment_df.index[indices[0]]
x_max = segment_df.index[indices[-1]]
ax[i].axvline(x_min, color=color, linestyle="dashed")
ax[i].axvline(x_max, color=color, linestyle="dashed")
ax[i].axvspan(xmin=x_min, xmax=x_max, alpha=1 / 4, color=color)
ax[i].set_title(segment)
ax[i].tick_params("x", rotation=45)
legend_handles = [
Line2D([0], [0], marker="o", color=color, label=label) for label, color in holidays_colors.items()
]
ax[i].legend(handles=legend_handles)
class PerFoldAggregation(str, Enum):
"""Enum for types of aggregation in a metric per-segment plot."""
mean = "mean"
sum = "median"
@classmethod
def _missing_(cls, value):
raise NotImplementedError(
f"{value} is not a valid {cls.__name__}. Only {', '.join([repr(m.value) for m in cls])} aggregations are allowed"
)
def get_function(self):
"""Get aggregation function."""
if self.value == "mean":
return np.nanmean
elif self.value == "median":
return np.nanmedian
def plot_metric_per_segment(
metrics_df: pd.DataFrame,
metric_name: str,
ascending: bool = False,
per_fold_aggregation_mode: str = PerFoldAggregation.mean,
top_k: Optional[int] = None,
barplot_params: Optional[Dict[str, Any]] = None,
figsize: Tuple[int, int] = (10, 5),
):
"""Plot barplot with per-segment metrics.
Parameters
----------
metrics_df:
dataframe with metrics calculated on the backtest
metric_name:
name of the metric to visualize
ascending:
* If True, small values at the top;
* If False, big values at the top.
per_fold_aggregation_mode:
how to aggregate metrics over the folds if they aren't already aggregated
(see :py:class:`~etna.analysis.plotters.PerFoldAggregation`)
top_k:
number segments to show after ordering according to ``ascending``
barplot_params:
dictionary with parameters for plotting, :py:func:`seaborn.barplot` is used
figsize:
size of the figure per subplot with one segment in inches
Raises
------
ValueError:
if ``metric_name`` isn't present in ``metrics_df``
NotImplementedError:
unknown ``per_fold_aggregation_mode`` is given
"""
if barplot_params is None:
barplot_params = {}
aggregation_mode = PerFoldAggregation(per_fold_aggregation_mode)
plt.figure(figsize=figsize)
if metric_name not in metrics_df.columns:
raise ValueError("Given metric_name isn't present in metrics_df")
if "fold_number" in metrics_df.columns:
metrics_dict = (
metrics_df.groupby("segment").agg({metric_name: aggregation_mode.get_function()}).to_dict()[metric_name]
)
else:
metrics_dict = metrics_df["segment", metric_name].to_dict()[metric_name]
segments = np.array(list(metrics_dict.keys()))
values = np.array(list(metrics_dict.values()))
sort_idx = np.argsort(values)
if not ascending:
sort_idx = sort_idx[::-1]
segments = segments[sort_idx][:top_k]
values = values[sort_idx][:top_k]
sns.barplot(x=values, y=segments, orient="h", **barplot_params)
plt.title("Metric per-segment plot")
plt.xlabel("Segment")
plt.ylabel(metric_name)
class MetricPlotType(str, Enum):
"""Enum for types of plot in :py:func:`~etna.analysis.plotters.metric_per_segment_distribution_plot`.
Attributes
----------
hist:
Histogram plot, :py:func:`seaborn.histplot` is used
box:
Boxplot, :py:func:`seaborn.boxplot` is used
violin:
Violin plot, :py:func:`seaborn.violinplot` is used
"""
hist = "hist"
box = "box"
violin = "violin"
@classmethod
def _missing_(cls, value):
raise NotImplementedError(
f"{value} is not a valid {cls.__name__}. Only {', '.join([repr(m.value) for m in cls])} plots are allowed"
)
def get_function(self):
"""Get aggregation function."""
if self.value == "hist":
return sns.histplot
elif self.value == "box":
return sns.boxplot
elif self.value == "violin":
return sns.violinplot
def metric_per_segment_distribution_plot(
metrics_df: pd.DataFrame,
metric_name: str,
per_fold_aggregation_mode: Optional[str] = None,
plot_type: Union[Literal["hist"], Literal["box"], Literal["violin"]] = "hist",
seaborn_params: Optional[Dict[str, Any]] = None,
figsize: Tuple[int, int] = (10, 5),
):
"""Plot per-segment metrics distribution.
Parameters
----------
metrics_df:
dataframe with metrics calculated on the backtest
metric_name:
name of the metric to visualize
per_fold_aggregation_mode:
* If None, separate distributions for each fold will be drawn
* If str, determines how to aggregate metrics over the folds if they aren't already aggregated
(see :py:class:`~etna.analysis.plotters.PerFoldAggregation`)
plot_type:
type of plot (see :py:class:`~etna.analysis.plotters.MetricPlotType`)
seaborn_params:
dictionary with parameters for plotting
figsize:
size of the figure per subplot with one segment in inches
Raises
------
ValueError:
if ``metric_name`` isn't present in ``metrics_df``
NotImplementedError:
unknown ``per_fold_aggregation_mode`` is given
"""
if seaborn_params is None:
seaborn_params = {}
metrics_df = metrics_df.reset_index(drop=True)
plot_type_enum = MetricPlotType(plot_type)
plot_function = plot_type_enum.get_function()
plt.figure(figsize=figsize)
if metric_name not in metrics_df.columns:
raise ValueError("Given metric_name isn't present in metrics_df")
# draw plot for each fold
if per_fold_aggregation_mode is None and "fold_number" in metrics_df.columns:
if plot_type_enum == MetricPlotType.hist:
plot_function(data=metrics_df, x=metric_name, hue="fold_number", **seaborn_params)
else:
plot_function(data=metrics_df, x="fold_number", y=metric_name, **seaborn_params)
plt.xlabel("Fold")
# draw one plot of aggregated data
else:
if "fold_number" in metrics_df.columns:
agg_func = PerFoldAggregation(per_fold_aggregation_mode).get_function()
metrics_df = metrics_df.groupby("segment").agg({metric_name: agg_func})
if plot_type_enum == MetricPlotType.hist:
plot_function(data=metrics_df, x=metric_name, **seaborn_params)
else:
plot_function(data=metrics_df, y=metric_name, **seaborn_params)
plt.title("Metric per-segment distribution plot")
|
11511266 | from __future__ import print_function, absolute_import
import unittest
import numpy as np
from misc import *
from sklearn import linear_model
from pandas_extensions import base_pandas_extensions_tester
class T(base_pandas_extensions_tester.BasePandasExtensionsTester):
def test_cv(self):
c = linear_model.LinearRegression()
X = np.random.random(size=(100, 3))
y = np.random.random(size=100)
cv = do_cv(c, X, y)
def test_gs(self):
c = linear_model.LinearRegression()
X = np.random.random(size=(100, 3))
y = np.random.random(size=100)
gs = do_gs(c, X, y, {'fit_intercept': [True, False]}, n_jobs=1)
self.assertEqual(gs.best_params_, {'fit_intercept': True})
def test_start_stop(self):
start('msg', 'id')
msg = stop('msg', 'id')
self.assertTrue(msg.startswith('msg, took: 0:00'))
start('msg1', 'id1')
start('msg2', 'id2')
msg1 = stop('msg1', 'id1')
msg2 = stop('msg2', 'id2')
self.assertTrue(msg1.startswith('msg1, took: 0:00'))
self.assertTrue(msg2.startswith('msg2, took: 0:00'))
|
11511305 | import numpy as np
import os
import csv
from PIL import Image
import shutil
att = open('./Celeb/attrs.txt','r')
imgs = os.listdir('./Celeb/data1024')
imgs.sort()
# print(len(attlines))
attlines = []
while True:
attline = att.readline().split()
if not attline:break
attlines.append(attline)
# print(attlines)
att_male = open('./Celeb/male.txt','w')
att_female = open('./Celeb/female.txt','w')
os.mkdir('./Celeb/mult/males')
os.mkdir('./Celeb/mult/females')
for i in range(30000):
nums = int(attlines[i][0])+1
iname = str(nums).zfill(5) +'.jpg'
print(iname)
if attlines[i][21] =='1':
att_male.write(' '.join(attlines[i])+'\n')
shutil.copy(os.path.join('./Celeb/data1024',iname),os.path.join('./Celeb/mult/males',iname))
elif attlines[i][21] =='-1':
att_female.write(' '.join(attlines[i])+'\n')
shutil.copy(os.path.join('./Celeb/data1024',iname),os.path.join('./Celeb/mult/females',iname))
|
11511310 | import praw
import inspect, os, sys # set the BASE_DIR
import simplejson as json
import datetime
import reddit.connection
import reddit.praw_utils as praw_utils
import reddit.queries
import sqlalchemy
import app.event_handler
from utils.common import PageType
from app.models import Base, SubredditPage, Subreddit, Post, ModAction
from sqlalchemy import and_
class ModeratorController:
def __init__(self, subreddit, db_session, r, log):
self.subreddit = subreddit
self.db_session = db_session
self.log = log
self.r = r
self.fetched_mod_actions = []
self.fetched_subreddit_id = None
# returns the last action id, for paging purposes
@app.event_handler.event_handler
def archive_mod_action_page(self, after_id=None):
if(after_id):
self.log.info("Querying moderation log for {subreddit}, after_id = {after_id}".format(
subreddit=self.subreddit, after_id = after_id))
else:
self.log.info("Querying moderation log for {subreddit}".format(subreddit=self.subreddit))
self.fetched_mod_actions = list(self.r.get_mod_log(self.subreddit, limit = 500, params={"after": after_id}))
if self.fetched_mod_actions:
first_ma = self.fetched_mod_actions[0]
src_dict = getattr(first_ma, 'json_dict', first_ma)
self.fetched_subreddit_id = src_dict['sr_id36']
action_dicts = []
for action in self.fetched_mod_actions:
if("json_dict" in dir(action)):
action = action.json_dict # to handle test fixtures
action_dicts.append(dict(
id = action['id'],
created_utc = datetime.datetime.fromtimestamp(action['created_utc']),
subreddit_id = action['sr_id36'],
mod = action['mod'],
target_author = action['target_author'],
action = action['action'],
target_fullname = action['target_fullname'],
action_data = json.dumps(action)
))
if len(action_dicts) == 0:
unique_count = 0
else:
try:
result = self.db_session.insert_retryable(ModAction, action_dicts)
unique_count = result.rowcount
except:
self.log.exception("An error occurred while trying to bulk insert moderation actions for {subreddit}".format(
subreddit = self.subreddit))
raise
self.log.info("Completed archive of {unique_count} unique moderation actions of {returned_count} returned moderation actions for {subreddit}".format(
unique_count=unique_count,
returned_count=len(action_dicts),
subreddit = self.subreddit))
last_id = action_dicts[-1]['id'] if len(action_dicts) > 0 else None
return last_id, unique_count
|
11511311 | import json
from ..compat import compat_urllib_parse
from ..utils import raise_if_invalid_rank_token
class TagsEndpointsMixin(object):
"""For endpoints in ``/tags/``."""
def tag_info(self, tag):
"""
Get tag info
:param tag:
:return:
"""
endpoint = 'tags/{tag!s}/info/'.format(
**{'tag': compat_urllib_parse.quote(tag.encode('utf8'))})
res = self._call_api(endpoint)
return res
def tag_related(self, tag, **kwargs):
"""
Get related tags
:param tag:
:return:
"""
endpoint = 'tags/{tag!s}/related/'.format(
**{'tag': compat_urllib_parse.quote(tag.encode('utf8'))})
query = {
'visited': json.dumps([{'id': tag, 'type': 'hashtag'}], separators=(',', ':')),
'related_types': json.dumps(['hashtag', 'location'], separators=(',', ':'))}
res = self._call_api(endpoint, query=query)
return res
def tag_search(self, text, rank_token, exclude_list=[], **kwargs):
"""
Search tag
:param text: Search term
:param rank_token: Required for paging through a single feed. See examples/pagination.py
:param exclude_list: List of numerical tag IDs to exclude
:param kwargs:
:return:
"""
raise_if_invalid_rank_token(rank_token)
if not exclude_list:
exclude_list = []
query = {
'q': text,
'timezone_offset': self.timezone_offset,
'count': 30,
'exclude_list': json.dumps(exclude_list, separators=(',', ':')),
'rank_token': rank_token,
}
query.update(kwargs)
res = self._call_api('tags/search/', query=query)
return res
def tags_user_following(self, user_id):
"""
Get tags a user is following
:param user_id:
:return:
"""
endpoint = 'users/{user_id!s}/following_tags_info/'.format(user_id=user_id)
return self._call_api(endpoint)
def tag_follow_suggestions(self):
"""Get suggestions for tags to follow"""
return self._call_api('tags/suggested/')
def tag_follow(self, tag):
"""
Follow a tag
:param tag:
:return:
"""
endpoint = 'tags/follow/{hashtag!s}/'.format(
hashtag=compat_urllib_parse.quote(tag.encode('utf-8')))
return self._call_api(endpoint, params=self.authenticated_params)
def tag_unfollow(self, tag):
"""
Unfollow a tag
:param tag:
:return:
"""
endpoint = 'tags/unfollow/{hashtag!s}/'.format(
hashtag=compat_urllib_parse.quote(tag.encode('utf-8')))
return self._call_api(endpoint, params=self.authenticated_params)
|
11511363 | import numpy as np
import torch
def rotate_pc_along_y(pc, rot_angle):
"""
params pc: (N, 3+C), (N, 3) is in the rectified camera coordinate
params rot_angle: rad scalar
Output pc: updated pc with XYZ rotated
"""
cosval = np.cos(rot_angle)
sinval = np.sin(rot_angle)
rotmat = np.array([[cosval, -sinval], [sinval, cosval]])
pc[:, [0, 2]] = np.dot(pc[:, [0, 2]], np.transpose(rotmat))
return pc
def rotate_pc_along_y_torch(pc, rot_angle):
"""
:param pc: (N, 512, 3 + C)
:param rot_angle: (N)
:return:
TODO: merge with rotate_pc_along_y_torch in bbox_transform.py
"""
cosa = torch.cos(rot_angle).view(-1, 1) # (N, 1)
sina = torch.sin(rot_angle).view(-1, 1) # (N, 1)
raw_1 = torch.cat([cosa, -sina], dim=1) # (N, 2)
raw_2 = torch.cat([sina, cosa], dim=1) # (N, 2)
R = torch.cat((raw_1.unsqueeze(dim=1), raw_2.unsqueeze(dim=1)), dim=1) # (N, 2, 2)
pc_temp = pc[:, :, [0, 2]] # (N, 512, 2)
pc[:, :, [0, 2]] = torch.matmul(pc_temp, R.permute(0, 2, 1)) # (N, 512, 2)
return pc
def boxes3d_to_corners3d(boxes3d, rotate=True):
"""
:param boxes3d: (N, 7) [x, y, z, h, w, l, ry]
:param rotate:
:return: corners3d: (N, 8, 3)
"""
boxes_num = boxes3d.shape[0]
h, w, l = boxes3d[:, 3], boxes3d[:, 4], boxes3d[:, 5]
x_corners = np.array([l / 2., l / 2., -l / 2., -l / 2., l / 2., l / 2., -l / 2., -l / 2.],
dtype=np.float32).T # (N, 8)
z_corners = np.array([w / 2., -w / 2., -w / 2., w / 2., w / 2., -w / 2., -w / 2., w / 2.],
dtype=np.float32).T # (N, 8)
y_corners = np.zeros((boxes_num, 8), dtype=np.float32)
y_corners[:, 4:8] = -h.reshape(boxes_num, 1).repeat(4, axis=1) # (N, 8)
if rotate:
ry = boxes3d[:, 6]
zeros, ones = np.zeros(ry.size, dtype=np.float32), np.ones(ry.size, dtype=np.float32)
rot_list = np.array([[np.cos(ry), zeros, -np.sin(ry)],
[zeros, ones, zeros],
[np.sin(ry), zeros, np.cos(ry)]]) # (3, 3, N)
R_list = np.transpose(rot_list, (2, 0, 1)) # (N, 3, 3)
temp_corners = np.concatenate((x_corners.reshape(-1, 8, 1), y_corners.reshape(-1, 8, 1),
z_corners.reshape(-1, 8, 1)), axis=2) # (N, 8, 3)
rotated_corners = np.matmul(temp_corners, R_list) # (N, 8, 3)
x_corners, y_corners, z_corners = rotated_corners[:, :, 0], rotated_corners[:, :, 1], rotated_corners[:, :, 2]
x_loc, y_loc, z_loc = boxes3d[:, 0], boxes3d[:, 1], boxes3d[:, 2]
x = x_loc.reshape(-1, 1) + x_corners.reshape(-1, 8)
y = y_loc.reshape(-1, 1) + y_corners.reshape(-1, 8)
z = z_loc.reshape(-1, 1) + z_corners.reshape(-1, 8)
corners = np.concatenate((x.reshape(-1, 8, 1), y.reshape(-1, 8, 1), z.reshape(-1, 8, 1)), axis=2)
return corners.astype(np.float32)
def boxes3d_to_corners3d_torch(boxes3d, flip=False):
"""
:param boxes3d: (N, 7) [x, y, z, h, w, l, ry]
:return: corners_rotated: (N, 8, 3)
"""
boxes_num = boxes3d.shape[0]
h, w, l, ry = boxes3d[:, 3:4], boxes3d[:, 4:5], boxes3d[:, 5:6], boxes3d[:, 6:7]
if flip:
ry = ry + np.pi
centers = boxes3d[:, 0:3]
zeros = torch.cuda.FloatTensor(boxes_num, 1).fill_(0)
ones = torch.cuda.FloatTensor(boxes_num, 1).fill_(1)
x_corners = torch.cat([l / 2., l / 2., -l / 2., -l / 2., l / 2., l / 2., -l / 2., -l / 2.], dim=1) # (N, 8)
y_corners = torch.cat([zeros, zeros, zeros, zeros, -h, -h, -h, -h], dim=1) # (N, 8)
z_corners = torch.cat([w / 2., -w / 2., -w / 2., w / 2., w / 2., -w / 2., -w / 2., w / 2.], dim=1) # (N, 8)
corners = torch.cat((x_corners.unsqueeze(dim=1), y_corners.unsqueeze(dim=1), z_corners.unsqueeze(dim=1)),
dim=1) # (N, 3, 8)
cosa, sina = torch.cos(ry), torch.sin(ry)
raw_1 = torch.cat([cosa, zeros, sina], dim=1)
raw_2 = torch.cat([zeros, ones, zeros], dim=1)
raw_3 = torch.cat([-sina, zeros, cosa], dim=1)
R = torch.cat((raw_1.unsqueeze(dim=1), raw_2.unsqueeze(dim=1), raw_3.unsqueeze(dim=1)), dim=1) # (N, 3, 3)
corners_rotated = torch.matmul(R, corners) # (N, 3, 8)
corners_rotated = corners_rotated + centers.unsqueeze(dim=2).expand(-1, -1, 8)
corners_rotated = corners_rotated.permute(0, 2, 1)
return corners_rotated
def boxes3d_to_bev_torch(boxes3d):
"""
:param boxes3d: (N, 7) [x, y, z, h, w, l, ry]
:return:
boxes_bev: (N, 5) [x1, y1, x2, y2, ry]
"""
boxes_bev = boxes3d.new(torch.Size((boxes3d.shape[0], 5)))
cu, cv = boxes3d[:, 0], boxes3d[:, 2]
half_l, half_w = boxes3d[:, 5] / 2, boxes3d[:, 4] / 2
boxes_bev[:, 0], boxes_bev[:, 1] = cu - half_l, cv - half_w
boxes_bev[:, 2], boxes_bev[:, 3] = cu + half_l, cv + half_w
boxes_bev[:, 4] = boxes3d[:, 6]
return boxes_bev
def enlarge_box3d(boxes3d, extra_width):
"""
:param boxes3d: (N, 7) [x, y, z, h, w, l, ry]
"""
if isinstance(boxes3d, np.ndarray):
large_boxes3d = boxes3d.copy()
else:
large_boxes3d = boxes3d.clone()
large_boxes3d[:, 3:6] = large_boxes3d[:, 3:6] + extra_width * 2
large_boxes3d[:, 1] = large_boxes3d[:, 1] + extra_width
return large_boxes3d
|
11511379 | import pytz
def check_associations(collection, association):
"""All items in collection should contain a reference to the association's database ID"""
for item in collection:
assert item[association.__class__.__name__.lower() + '_id'] == association['_id']
def check_persistence(target, *target_args, **target_kwargs):
"""Subsequent identical calls to target should return the same objects"""
old_ids = [entity['_id'] for entity in target(*target_args, **target_kwargs)]
new_ids = [entity['_id'] for entity in target(*target_args, **target_kwargs)]
assert old_ids == new_ids
def check_providers(collection, provider):
"""All items in collection should contain a reference to the provider instance from which they were sourced"""
for item in collection:
assert item.provider == provider
def check_timestamps(target):
"""All items in collection should contain timezone aware created/updated at timestamps"""
if isinstance(target, list):
for item in target:
for key in ('created_at', 'updated_at'):
assert item[key].tzinfo == pytz.utc
else:
for key in ('created_at', 'updated_at'):
assert target[key].tzinfo == pytz.utc
def check_types(collection, collection_type, item_type):
"""Assert that the collection and all items within it are of the correct type"""
assert isinstance(collection, collection_type)
for item in collection:
assert isinstance(item, item_type)
def check_updates(target, *target_args, **target_kwargs):
"""Subsequent identical calls to target should return the same objects updated"""
old_items = target(*target_args, **target_kwargs)
new_items = target(*target_args, **target_kwargs)
for new_item in new_items:
found_item = None
for old_item in old_items:
if old_item['_id'] == new_item['_id']:
found_item = old_item
break
assert new_item['updated_at'] > found_item['updated_at']
|
11511472 | from .PBXResolver import *
from .PBXSourcesBuildPhase import *
from .PBXFrameworksBuildPhase import *
from .PBX_Build_Setting import *
from .PBX_Constants import *
class PBX_Base_Target(PBX_Build_Setting):
def __init__(self, lookup_func, dictionary, project, identifier):
super(PBX_Base_Target, self).__init__(lookup_func, dictionary, project, identifier);
self.project_container = project;
if kPBX_TARGET_name in dictionary.keys():
self.name = dictionary[kPBX_TARGET_name];
self.productName = '';
if kPBX_TARGET_productName in dictionary.keys():
self.productName = dictionary[kPBX_TARGET_productName];
if kPBX_TARGET_buildConfigurationList in dictionary.keys():
self.buildConfigurationList = self.parseProperty(kPBX_TARGET_buildConfigurationList, lookup_func, dictionary, project, False);
self.buildPhases = [];
if kPBX_TARGET_buildPhases in dictionary.keys():
self.buildPhases = self.parseProperty(kPBX_TARGET_buildPhases, lookup_func, dictionary, project, True);
self.dependencies = [];
if kPBX_TARGET_dependencies in dictionary.keys():
self.dependencies = self.parseProperty(kPBX_TARGET_dependencies, lookup_func, dictionary, project, True);
if kPBX_TARGET_productReference in dictionary.keys():
self.productReference = self.parseProperty(kPBX_TARGET_productReference, lookup_func, dictionary, project, False);
if kPBX_TARGET_productType in dictionary.keys():
self.productType = dictionary[kPBX_TARGET_productType];
# maybe worth adding a method on here to resolve the dependency graph of a target to find duplicates
def sourceFiles(self):
file_list = [];
source_phase_list = self.resolve(PBXSourcesBuildPhase, self.buildPhases);
for phase in source_phase_list:
file_list.extend(phase.files);
return file_list;
def linkedLibraries(self):
library_list = [];
framework_phase_list = self.resolve(PBXFrameworksBuildPhase, self.buildPhases);
for phase in framework_phase_list:
library_list.extend(phase.files);
return library_list;
def explicitDependencies(self):
explicit_dep_list = [];
library_refs = set(map(lambda ref: ref.fileRef, self.linkedLibraries()));
dependency_refs = set(map(lambda dep: dep.target.productReference, self.dependencies));
explicit_dep_list.extend(library_refs.intersection(dependency_refs));
return explicit_dep_list;
def implicitDependencies(self):
# this needs to be checked to make sure it can resolve these correct, not just built products, but also exported files (headers)
implicit_dep_list = [];
library_refs = set(map(lambda ref: ref.fileRef, self.linkedLibraries()));
dependency_refs = set(map(lambda dep: dep.target.productReference, self.dependencies));
implicit_dep_list.extend(library_refs.difference(dependency_refs));
return implicit_dep_list;
def executeBuildPhases(self, build_system):
# build phases are listed in order, must be executed in that order to be successful.
for phase in self.buildPhases:
phase.performPhase(build_system, self); |
11511489 | import numpy
import csb.test as test
import csb.bio.structure as structure
import csb.core
import csb.bio.sequence as sequence
@test.regression
class ChainRegressions(test.Case):
def setUp(self):
super(ChainRegressions, self).setUp()
self.structure = self.config.getPickle('1nz9.model1.pickle')
self.chain = self.structure['A']
def testClone(self):
"""
@see: [CSB 0000029]
"""
self.assertEqual(self.chain.residues[1].clone()._container, None)
def testApplyTransformation(self):
"""
@see: [CSB 0000030]
"""
r = numpy.eye(3)
t = numpy.array([1, 1, 1])
residue = self.chain.residues[1]
atom1 = structure.Atom(99999, 'Cx', structure.ChemElements.C, numpy.array([2, 2, 2]), alternate=True)
atom1.occupancy = 0.2
atom2 = structure.Atom(99999, 'Cx', structure.ChemElements.C, numpy.array([2, 2, 2]), alternate=True)
atom2.occupancy = 0.8
residue.atoms.append(atom1)
residue.atoms.append(atom2)
self.chain.transform(r, t)
disatom = residue.atoms['Cx']
self.assertTrue(isinstance(disatom, structure.DisorderedAtom))
self.assertEqual(disatom.vector.tolist(), [3, 3, 3])
# now the regression itself
for altatom in disatom:
self.assertEqual(altatom.vector.tolist(), [3, 3, 3])
@test.skip("may fail on slower machines")
def testListCoordinates(self):
"""
Performance tweaks in AbstractEntity.get_coordinates()
"""
def test():
for dummy in range(1000):
self.structure.get_coordinates(what=['CA'])
self.assertFasterThan(0.50, test)
def testAppendAtom(self):
"""
@see: [CSB 0000122]
"""
r = structure.ProteinResidue(1, sequence.ProteinAlphabet.ALA)
a1 = structure.Atom(1, 'CA', structure.ChemElements.C, [1, 1, 1], alternate='A')
a2 = structure.Atom(1, 'CA', structure.ChemElements.C, [1, 1, 1], alternate='B')
r.atoms.append(a1)
r.atoms.append(a2)
self.assertEqual(a1.residue, r)
self.assertEqual(a2.residue, r)
@test.unit
class TestAbstractEntity(test.Case):
def setUp(self):
super(TestAbstractEntity, self).setUp()
self.e = self.config.getPickle('1nz9.full.pickle')
self.s = self.e.models[1]
self.c = self.s.chains['A']
self.r = self.c.residues[1]
self.a = self.r.atoms['CA']
def testItems(self):
self.assertEqual(list(self.e.items), list(self.e.models))
self.assertEqual(list(self.s.items), list(self.s.chains[c] for c in self.s.chains))
self.assertEqual(list(self.c.items), list(self.c.residues))
self.assertEqual(list(self.r.items), list(self.r.atoms[a] for a in self.r.atoms))
self.assertEqual(list(self.a.items), list([]))
def testComponents(self):
# also covers the composite iterators
items = list(structure.CompositeEntityIterator.create(self.e, leaf=structure.Chain))
self.assertEqual(items, [self.e[0], self.e[0]['A'], self.e[1], self.e[1]['A']])
self.assertEqual(list(self.e.components())[:4], [self.s, self.c, self.r, list(self.r.items)[0]])
self.assertEqual(list(self.e.components(structure.Structure)), list(self.e.models))
self.assertEqual(list(self.e.components(structure.Chain)), [self.e[0]['A'], self.e[1]['A']])
self.assertEqual(list(self.r.components()), [self.r[a] for a in self.r.atoms])
self.assertEqual(list(self.r.components(structure.Atom)), [self.r[a] for a in self.r.atoms])
self.assertEqual(list(self.r.components(structure.Residue)), [])
self.assertEqual(list(self.a.components()), [])
self.assertEqual(list(self.a.components(structure.Atom)), [])
def testApplyTransformation(self):
R = numpy.eye(3)
t = numpy.array([1, 2, 3])
original = self.s['A'].get_coordinates(('CA',))
assert len(original) > 0
self.e.transform(R, t)
translated = self.s['A'].get_coordinates(('CA',))
self.e.transform(R, -t)
restored = self.s['A'].get_coordinates(('CA',))
self.assertTrue(len(original) == len(translated) == len(restored))
for i in range(len(original)):
for j in range(3):
self.assertEqual((original[i] + t)[j], translated[i][j])
self.assertAlmostEqual(original[i][j], restored[i][j], places=13)
def testListCoordinates(self):
# all atoms
original, listed = [], []
for s in self.e.items:
for c in s.items:
for r in c.items:
for a in r.items:
original.append(list(a.vector))
for i in self.e.get_coordinates(what=None):
listed.append(list(i))
self.assertEqual(original, listed)
self.assertEqual([list(i) for i in self.r.get_coordinates()], [list(a.vector) for a in self.r.items])
self.assertEqual(list(self.a.get_coordinates()[0]), list(self.a.vector))
# specific atoms
original, listed = [], []
for s in self.e.items:
for c in s.items:
for r in c.items:
original.append(list(r.atoms['CA'].vector))
for i in self.e.get_coordinates(what=['CA']):
listed.append(list(i))
self.assertEqual(original, listed)
self.assertEqual([list(i) for i in self.r.get_coordinates(['CA'])], [list(self.r.atoms['CA'].vector)])
self.assertEqual(list(self.a.get_coordinates(['CA'])[0]), list(self.a.vector))
# other stuff
self.assertRaises(structure.Broken3DStructureError, lambda: self.c.get_coordinates(what=['BUG']))
self.assertRaises(structure.Broken3DStructureError, lambda: self.r.get_coordinates(what=['BUG']))
self.assertRaises(structure.Broken3DStructureError, lambda: self.a.get_coordinates(what=['BUG']))
@test.unit
class TestEnsemble(test.Case):
def setUp(self):
super(TestEnsemble, self).setUp()
self.ensemble = self.config.getPickle('1nz9.full.pickle')
def testItems(self):
models = list(self.ensemble.items)
self.assertEqual(len(models), self.ensemble.models.length)
def testComponents(self):
models = list(self.ensemble.components(klass=structure.Structure))
self.assertEqual(len(models), self.ensemble.models.length)
def testGetitem(self):
self.assertEqual(self.ensemble.models.length, 2)
self.assertEqual(self.ensemble.models[1].model_id, 1)
self.assertEqual(self.ensemble[1].model_id, 2)
def testFirstModel(self):
self.assertEqual(self.ensemble.models[1], self.ensemble.first_model)
self.assertEqual(self.ensemble[0], self.ensemble.first_model)
def testAppend(self):
testModel = structure.Structure('test')
testModel.model_id = 3
rank = self.ensemble.models.append(testModel)
self.assertEqual(rank, 3)
self.assertEqual(self.ensemble.models[3], testModel)
self.assertEqual(self.ensemble.models[3].model_id, 3)
self.assertRaises(Exception, self.ensemble.models.append, 1)
def testToPDB(self):
pdbraw = self.ensemble.to_pdb()
pdb = pdbraw.splitlines()
model = 0
endmdl = 0
for line in pdb:
if line.startswith('MODEL '):
model += 1
if line.startswith('ENDMDL '):
endmdl += 1
self.assertEqual(model, self.ensemble.models.length)
self.assertEqual(endmdl, self.ensemble.models.length)
self.assertTrue(pdb[0].startswith, 'HEADER')
self.assertTrue(pdb[0].endswith('1NZ9 '))
self.assertEqual(pdb[-3].rstrip(), 'TER')
self.assertEqual(pdb[-2].rstrip(), 'ENDMDL')
self.assertEqual(pdb[-1].rstrip(), 'END')
@test.unit
class TestStructure(test.Case):
def setUp(self):
super(TestStructure, self).setUp()
self.structure = self.config.getPickle('1nz9.model1.pickle')
self.structure2 = self.config.getPickle('1nz9.model1.pickle')
def testGetitem(self):
self.assertEqual(self.structure.chains.length, 1)
self.assertTrue('A' in self.structure.chains)
self.assertTrue('A' in self.structure)
self.assertEqual(self.structure.chains['A'], self.structure['A'])
self.assertEqual(self.structure.chains['A'].id, 'A')
def testFirstChain(self):
self.assertEqual(self.structure.chains['A'], self.structure.first_chain)
self.assertEqual(self.structure['A'], self.structure.first_chain)
def testItems(self):
self.assertEqual(self.structure['A'], tuple(self.structure.items)[0])
def testAppend(self):
testChain = structure.Chain('$', accession='____')
self.structure2.chains.append(testChain)
self.assertTrue('$' in self.structure2.chains)
self.assertEqual(self.structure2.chains['$'], testChain)
self.assertEqual(self.structure2.chains['$'].accession, self.structure2.accession)
self.assertRaises(structure.DuplicateChainIDError, self.structure2.chains.append, testChain)
self.assertRaises(structure.InvalidOperation, self.structure2.chains.append, self.structure.first_chain)
def testRemove(self):
self.assertTrue('A' in self.structure2.chains)
self.structure2.chains.remove('A')
self.assertFalse('A' in self.structure2.chains)
for c in ['.', 'A']:
self.assertRaises(structure.ChainNotFoundError, self.structure2.chains.remove, c)
def testAccession(self):
self.assertEqual(self.structure.accession, '1nz9')
self.structure.accession = ' TeST '
self.assertEqual(self.structure.accession, 'test')
for chain in self.structure.items:
self.assertEqual(chain.accession, self.structure.accession)
self.structure.accession = '1nz9'
def testToFASTA(self):
fasta = self.structure.to_fasta().splitlines()
self.assertTrue(fasta[0].startswith('>1nz9_A'))
self.assertEqual(fasta[1], 'AQVAFREGDQVRVVSGPFADFTGTVTEINPERGKVKVMVTIFGRETPVELDFSQVVKA')
def testToPDB(self):
pdbraw = self.structure.to_pdb()
pdb = pdbraw.splitlines()
self.assertTrue(pdb[0].startswith, 'HEADER')
self.assertTrue(pdb[0].endswith('1NZ9 '))
self.assertEqual(pdb[-2].rstrip(), 'TER')
self.assertEqual(pdb[-1].rstrip(), 'END')
for line in pdb:
self.assertTrue(not line.startswith('MODEL '))
self.assertTrue(not line.startswith('ENDMDL '))
has_seqres = False
has_atom = False
# check first SEQRES line
for l in pdb:
if l.startswith('SEQRES') and not has_seqres:
has_seqres = True
self.assertEqual(l, 'SEQRES 1 A 58 ALA GLN VAL ALA PHE ARG GLU GLY ASP GLN VAL ARG VAL ')
if l.startswith('SEQRES 3 A 58'):
self.assertEqual(l, 'SEQRES 3 A 58 GLU ILE ASN PRO GLU ARG GLY LYS VAL LYS VAL MSE VAL ')
break
# check first ATOM line
for l in pdb:
if l.startswith('ATOM') and not has_atom:
has_atom = True
self.assertEqual(l, 'ATOM 1 N ALA A 127 -0.977 -18.702 -7.689 1.00 0.00 N ')
if l.startswith('ATOM 572'):
self.assertEqual(l, 'ATOM 572 SE MSE A 164 8.107 5.802 4.753 1.00 0.00 Se ')
break
self.assertTrue(has_seqres)
self.assertTrue(has_atom)
# test also the content written to a file stream
with self.config.getTempStream() as tmp:
self.structure.to_pdb(tmp)
tmp.flush()
self.assertEqual(pdbraw, open(tmp.name).read())
# and to a file
with self.config.getTempStream() as tmp:
self.structure.to_pdb(tmp.name)
self.assertEqual(pdbraw, open(tmp.name).read())
def testFromChain(self):
new_structure = structure.Structure.from_chain(self.structure.first_chain)
self.assertEqual(new_structure.chains.length,1)
self.assertEqual(new_structure.first_chain.get_coordinates(('CA',)).tolist(),
self.structure.first_chain.get_coordinates(('CA',)).tolist(),)
self.assertEqual(new_structure.first_chain.sequence,
self.structure.first_chain.sequence)
@test.unit
class TestChain(test.Case):
def setUp(self):
super(TestChain, self).setUp()
self.structure = self.config.getPickle('1nz9.model1.pickle')
self.chain = self.structure['A']
def testFromSequence(self):
seq = sequence.Sequence('testA', 'test seq', 'ABCDE', type=sequence.SequenceTypes.Protein)
chain = structure.Chain.from_sequence(seq, 'Z')
self.assertEqual(chain.sequence, 'ABCDE')
self.assertEqual(chain.id, 'Z')
self.assertEqual(chain.residues[2].sequence_number, 2)
self.assertEqual(chain.residues[2].rank, 2)
self.assertEqual(chain.residues[2].type, sequence.ProteinAlphabet.ASX)
def testId(self):
self.assertEqual(self.chain.id, 'A')
self.chain.id = '$'
self.assertEqual(self.chain.id, '$')
self.assertEqual(tuple(self.structure.items)[0].id, '$')
self.assertTrue('$' in self.structure)
self.chain.id = 'A'
def testAccession(self):
def assign(chain, value):
chain.accession = value
self.assertRaises(structure.InvalidOperation, assign, self.chain, 'xxxx')
chain = self.chain.clone()
chain.accession = 'xxxx'
self.assertEqual(chain.accession, 'xxxx')
def testType(self):
self.assertEqual(self.chain.type, structure.SequenceTypes.Protein)
def testEntryID(self):
self.assertEqual(self.chain.entry_id, '1nz9A')
def testSequence(self):
self.assertEqual(self.chain.sequence, 'AQVAFREGDQVRVVSGPFADFTGTVTEINPERGKVKVMVTIFGRETPVELDFSQVVKA')
def testHeader(self):
self.assertTrue(self.chain.header.startswith('1nz9_A'))
def testLength(self):
self.assertEqual(self.chain.length, 58)
self.assertEqual(self.chain.length, len(self.chain))
def testAlphabet(self):
self.assertEqual(self.chain.alphabet, structure.SequenceAlphabets.Protein)
chain = self.chain.clone()
chain.type = structure.SequenceTypes.DNA
self.assertEqual(chain.alphabet, structure.SequenceAlphabets.Nucleic)
def testSecStructure(self):
self.assertEqual(self.chain.secondary_structure.length, 6)
self.assertEqual(self.chain.secondary_structure[1].type, structure.SecStructures.Strand)
self.assertEqual(self.chain.secondary_structure[5].type, structure.SecStructures.Helix)
self.assertEqual(self.chain.secondary_structure.to_string(), '---------EEEE--------EEEEEEEE----EEEEEEE----EEEEEE-HHHEEE')
def testClone(self):
chain = self.chain
clone = chain.clone()
self.assertEqual(chain.id, clone.id)
self.assertEqual(chain.length, clone.length)
self.assertNotEqual(id(chain), id(clone))
# residues
self.assertEqual(chain[0].type, clone[0].type)
self.assertNotEqual(id(chain[0]), id(clone[0]))
# atoms
self.assertEqual(set(chain[0].atoms), set(clone[0].atoms))
self.assertNotEqual(id(chain[0]['CA']), id(clone[0]['CA']))
# detached?
self.assertEqual(chain._structure, self.structure)
self.assertEqual(clone._structure, None)
def testSubregion(self):
sub = self.chain.subregion(1, self.chain.length)
self.assertEqual(list(self.chain.residues), list(sub.residues))
self.assertRaises(IndexError, self.chain.subregion, -1, 5)
self.assertRaises(IndexError, self.chain.subregion, 1, self.chain.length + 1)
def testFind(self):
self.assertEqual(self.chain.find('127'), self.chain[0])
self.chain[0].id = 127, 'X'
self.assertEqual(self.chain.find('127', 'X'), self.chain[0])
self.chain[0].id = 127, None
self.assertRaises(structure.EntityNotFoundError, self.chain.find, 127, 'X')
self.assertRaises(structure.EntityNotFoundError, self.chain.find, 999999)
def testComputeTorsion(self):
self.assertRaises(structure.InvalidOperation, lambda:self.chain.torsion)
self.chain.compute_torsion()
self.assertEqual(self.chain.residues[1].torsion.phi, None)
self.assertNotEqual(self.chain.residues[1].torsion.psi, None)
# http://www.fz-juelich.de/nic/cbb/wang/dssp/dssp/1nz9.dssp
self.assertAlmostEqual(self.chain.residues[2].torsion.phi, -134.597, places=3)
self.assertAlmostEqual(self.chain.residues[2].torsion.psi, 155.738, places=3)
self.assertAlmostEqual(self.chain.residues[2].torsion.omega, 179.916, places=3)
def testListCoordinates(self):
coords = self.chain.get_coordinates(('CA',))
self.assertEqual(coords[0].tolist(), self.chain[0]['CA'].vector.tolist())
self.assertEqual(len(coords), self.chain.length)
self.assertRaises(structure.Broken3DStructureError, self.chain.get_coordinates, ('H',))
def testSuperimpose(self):
clone = self.chain.clone()
si = self.chain.superimpose(clone)
self.assertAlmostEqual(si.rmsd, 0.0, places = 6)
for coord in si.translation:
self.assertAlmostEqual(coord, 0.0)
clone.transform(si.rotation, si.translation)
self.assertAlmostEqual(self.chain.rmsd(clone), 0, 5)
# not testable for now, but ensure at least no exception is raised
si = self.chain.superimpose(clone, what=('C', 'CA',))
si = self.chain.superimpose(clone, how=structure.AlignmentTypes.Local)
# make sure the subject is not moving (as it is the case in .align)
# - grab a different structure
diff = self.chain.clone()
diff[1]['CA'].vector += 2.0
x = diff[1]['CA'].vector[0]
# - superimpose them
si = self.chain.superimpose(diff)
# - assert diff is untouched
assert si.rmsd > 0, 'test with different structures'
self.assertEqual(diff[1]['CA'].vector[0], x)
self.assertRaises(ValueError, clone.superimpose, clone.subregion(1, 1))
def testAlign(self):
clone = self.chain.clone()
si = self.chain.align(clone)
self.assertAlmostEqual(si.rmsd, 0.0, places = 6)
for coord in si.translation:
self.assertAlmostEqual(coord, 0.0)
self.assertAlmostEqual(self.chain.rmsd(clone), 0, 5)
# mutate clone a bit to achieve RMSD != 0
clone[0]['CA'].vector[0] += 2.0
si = self.chain.align(clone)
self.assertNotEqual(si.rmsd, 0.0)
# ensure clone has been transformed; self.chain holds the original coords of clone
self.assertNotEqual(clone[3]['CA'].vector[0], self.chain[3]['CA'].vector[0])
self.assertRaises(ValueError, clone.align, clone.subregion(1, 1))
# not testable for now, but ensure at least no exception is raised
si = self.chain.align(clone, what=('C', 'CA',))
si = self.chain.align(clone, how=structure.AlignmentTypes.Local)
def testRMSD(self):
chain = self.chain
self.assertAlmostEqual(chain.rmsd(chain), 0.0, places=6)
self.assertAlmostEqual(chain.rmsd(chain, what=['N', 'CA', 'C', 'O']), 0.0, places=6)
self.assertRaises(ValueError, chain.rmsd, chain.subregion(1, 1))
def testTMSuperimpose(self):
clone = self.chain.clone()
si = self.chain.tm_superimpose(clone)
self.assertEqual(si.tm_score, 1.0)
for coord in si.translation:
self.assertAlmostEqual(coord, 0.0)
clone.transform(si.rotation, si.translation)
self.assertEqual(self.chain.tm_score(clone), 1.0)
# not testable for now, but ensure at least no exception is raised
si = self.chain.tm_superimpose(clone, what=('C', 'CA',))
si = self.chain.tm_superimpose(clone, how=structure.AlignmentTypes.Local)
# make sure the subject is not moving (as it is the case in .align)
# - grab a different structure
diff = self.chain.clone()
diff[1]['CA'].vector += 2.0
x = diff[1]['CA'].vector[0]
# - superimpose them
si = self.chain.tm_superimpose(diff)
# - assert diff is untouched
assert si.tm_score < 1, 'test with different structures'
self.assertEqual(diff[1]['CA'].vector[0], x)
self.assertRaises(ValueError, clone.tm_superimpose, clone.subregion(1, 1))
def testTMScore(self):
chain = self.chain
self.assertAlmostEqual(chain.tm_score(chain), 1.0, places=6)
self.assertAlmostEqual(chain.tm_score(chain, what=['N', 'CA', 'C', 'O']), 1.0, places=6)
self.assertRaises(ValueError, chain.tm_score, chain.subregion(1, 1))
def testGetitem(self):
self.assertEqual(self.chain.residues[1], self.chain[0])
self.assertRaises(csb.core.CollectionIndexError, lambda:self.chain.residues[0])
self.assertRaises(csb.core.CollectionIndexError, lambda:self.chain.residues[59])
self.assertRaises(IndexError, lambda:self.chain[58])
self.assertEqual(self.chain[0].type, structure.SequenceAlphabets.Protein.ALA)
self.assertEqual(self.chain[0].rank, 1)
self.assertEqual(self.chain[0].sequence_number, 127)
self.assertEqual(self.chain[0].id, '127')
def testAppend(self):
chain = self.chain.clone()
chain.compute_torsion()
assert chain.torsion is not None
residue = structure.ProteinResidue(9999, structure.SequenceAlphabets.Protein.ALA, 9999, 'A')
rank = chain.residues.append(residue)
self.assertTrue(chain.residues._contains('9999A'))
self.assertRaises(structure.InvalidOperation, lambda:chain.torsion)
self.assertEqual(chain[-1], residue)
self.assertEqual(chain.residues[59], residue)
self.assertEqual(rank, 59)
self.assertRaises(structure.DuplicateResidueIDError, chain.residues.append, residue)
# assert NOT raises DuplicateResidueIDError if id is None:
residue = structure.ProteinResidue(99999, structure.SequenceAlphabets.Protein.ALA)
chain.residues.append(residue)
chain.residues.append(residue)
def testContains(self):
self.assertTrue(self.chain.residues._contains('127'))
@test.unit
class TestResidue(test.Case):
def setUp(self):
super(TestResidue, self).setUp()
self.structure = self.config.getPickle('1nz9.model1.pickle')
self.chain = self.structure['A']
self.chain.compute_torsion()
self.residue = self.chain[0]
def testGetitem(self):
self.assertTrue('CA' in self.residue)
self.assertEqual(set(self.residue), set(['C', 'H2', 'CB', 'CA', 'H1', 'O', 'N', 'H3', 'HA', 'HB1', 'HB3', 'HB2']))
self.assertEqual(self.residue['CA'], self.residue.atoms['CA'])
self.assertEqual(self.residue['CA'], tuple(self.residue.items)[1])
self.assertEqual(self.residue['CA'].element, structure.ChemElements.C)
self.assertEqual(self.residue['CA'].serial_number, 2)
def testItems(self):
self.assertEqual(tuple(self.residue.items)[0], self.residue['N'])
self.assertTrue(tuple(self.residue.items)[0] < tuple(self.residue.items)[1])
def testHasStructure(self):
self.assertTrue(self.residue.has_structure)
residue = structure.ProteinResidue(111, 'ALA')
self.assertFalse(residue.has_structure)
def testId(self):
def assign(sn, ins=None):
self.residue.id = sn, ins
# should raise if the residue is part of a chain and SN=128 is already there (true)
self.assertRaises(structure.DuplicateResidueIDError, assign, 128)
self.assertRaises(structure.DuplicateResidueIDError, assign, '128 ')
# should not raise (same residue)
self.residue.id = 127, None
# sequence_number must be defined when an insertion_code is specified
self.assertRaises(structure.InvalidOperation, assign, None, 'X')
self.residue.id = 111127, 'X'
self.assertEqual(self.chain.find(111127, 'X'), self.residue)
self.residue.id = 127, None
def testSequenceNumber(self):
self.assertEqual(self.residue.sequence_number, 127)
def testInsertionCode(self):
self.assertEqual(self.residue.insertion_code, None)
def testType(self):
self.assertEqual(self.residue.type, structure.SequenceAlphabets.Protein.ALA)
def testIsModified(self):
self.assertFalse(self.residue.is_modified)
self.assertTrue(self.chain[37].is_modified)
def testLabel(self):
self.assertEqual(self.residue.label, repr(self.residue.type))
self.assertTrue(self.chain[37].label, 'MSE')
def testTorsion(self):
self.assertEqual(self.residue.torsion.phi, None)
self.assertNotEqual(self.residue.torsion.psi, None)
def testFactory(self):
factory = structure.Residue.create
nucleotide = factory(structure.SequenceTypes.NucleicAcid, 1, structure.SequenceAlphabets.Nucleic.Adenine)
aminoacid = factory(structure.SequenceTypes.Protein, 1, structure.SequenceAlphabets.Protein.ALA)
unknown = factory(structure.SequenceTypes.Unknown, 1, structure.SequenceAlphabets.Unknown.UNK)
self.assertTrue(isinstance(nucleotide, structure.NucleicResidue))
self.assertTrue(isinstance(aminoacid, structure.ProteinResidue))
self.assertTrue(isinstance(unknown, structure.UnknownResidue))
def testAppend(self):
# should raise if appending an atom with atom._residue (already part of another residue)
self.assertRaises(structure.InvalidOperation, self.residue.atoms.append, self.chain[2]['CA'])
# should not raise InvalidOperation (same residue)
self.assertRaises(structure.DuplicateAtomIDError, self.residue.atoms.append, self.residue['CA'])
atom = structure.Atom(999999, 'Cx', structure.ChemElements.C, numpy.array([1, 1, 1]))
self.residue.atoms.append(atom)
self.assertTrue(atom.name in self.residue)
self.assertEqual(atom.residue, self.residue)
# test alternate handling
atom2 = structure.Atom(999999, 'Cx', structure.ChemElements.C, numpy.array([2, 2, 2]), alternate=True)
self.residue.atoms.append(atom2)
self.assertTrue(isinstance(self.residue['Cx'], structure.DisorderedAtom))
self.assertEqual(self.residue['Cx'].length, 2)
atom3 = structure.Atom(999999, 'Cx', structure.ChemElements.C, numpy.array([3, 3, 3]))
self.residue.atoms.append(atom3)
self.assertEqual(self.residue['Cx'].length, 3)
@test.unit
class TestAtom(test.Case):
def setUp(self):
super(TestAtom, self).setUp()
self.structure = self.config.getPickle('1nz9.model1.pickle')
self.chain = self.structure['A']
self.residue = self.chain[0]
self.atom = self.residue['CA']
def testName(self):
self.assertEqual(self.atom.name, 'CA')
def testSerialNumber(self):
"""
@bug: check for overlapping SNs in a Chain
"""
def assign(sn):
self.atom.serial_number = sn
self.assertEqual(self.atom.serial_number, 2)
self.assertRaises(TypeError, assign, -2)
def testElement(self):
self.assertEqual(self.atom.element, structure.ChemElements.C)
def testResidue(self):
"""
@todo: more checks are needed here (e.g. append an atom to different residues)
"""
self.assertEqual(self.atom.residue, self.residue)
def testSorting(self):
self.assertTrue(self.residue['N'] < self.residue['CA'])
def testVector(self):
def assign(v):
self.atom.vector = v
self.assertEqual(self.atom.vector.tolist(), [-0.96399999999999997, -17.864999999999998, -6.46])
self.assertRaises(ValueError, assign, numpy.array([1]))
@test.unit
class TestDisorderedAtom(TestAtom):
def setUp(self):
super(TestDisorderedAtom, self).setUp()
self.structure = self.config.getPickle('1nz9.model1.pickle')
self.chain = self.structure['A']
self.residue = self.chain[0]
self.atom = self.residue['CA']
self.alt = structure.Atom(999, 'CA', structure.ChemElements.C,
self.atom.vector.copy(), alternate='B')
self.atom.occupancy = 0.9
self.alt.occupancy = 0.1
self.residue.atoms.append(self.alt)
self.disatom = self.residue['CA']
def testAppend(self):
self.assertEqual(self.residue.atoms['CA'].serial_number, 2)
alt = structure.Atom(1000, 'CA', structure.ChemElements.C,
self.atom.vector.copy(), alternate='C')
alt.occupancy = 1.0
self.residue.atoms.append(alt)
self.assertEqual(self.residue.atoms['CA'].serial_number, 1000)
self.assertTrue(isinstance(self.residue.atoms['CA'], structure.DisorderedAtom))
def testIteration(self):
atoms = list(self.residue.atoms['CA'])
self.assertEqual(len(atoms), 2)
def testLength(self):
self.assertEqual(self.disatom.length, 2)
def testFind(self):
self.assertTrue(self.disatom.find('B') is self.alt)
self.assertRaises(structure.EntityNotFoundError, self.disatom.find, 'X')
@test.unit
class TestSecondaryStructure(test.Case):
"""
@todo: implement secondary structure tests
"""
def setUp(self):
super(TestSecondaryStructure, self).setUp()
self.structure = self.config.getPickle('1nz9.model1.pickle')
self.chain = self.structure['A']
self.residue = self.chain[0]
@test.unit
class TestTorsionAngles(test.Case):
def setUp(self):
super(TestTorsionAngles, self).setUp()
self.structure = self.config.getPickle('1nz9.model1.pickle')
self.chain = self.structure['A']
self.chain.compute_torsion()
self.angles1 = structure.TorsionAnglesCollection()
self.angles2 = structure.TorsionAnglesCollection()
self.angles3 = structure.TorsionAnglesCollection()
self.angles4 = structure.TorsionAnglesCollection()
for dummy in range(10):
self.angles1.append(structure.TorsionAngles(20, 30, 180))
self.angles2.append(structure.TorsionAngles(20, 30, 180))
self.angles3.append(structure.TorsionAngles(20, 30, 180))
self.angles4.append(structure.TorsionAngles(20, 30, 180))
self.angles2[5].phi = 40
self.angles2[7].psi = 10
self.angles3[4].phi = None
self.angles4[1].phi = None
def testRMSD(self):
self.assertEqual(self.chain.torsion.rmsd(self.chain.torsion), 0.0)
self.assertNotEqual(self.angles1.rmsd(self.angles2), 0.0)
self.assertEqual(self.angles1.rmsd(self.angles4), 0.0)
self.assertAlmostEqual(self.angles1.rmsd(self.angles2), 0.005442, places=5)
self.assertRaises(structure.Broken3DStructureError, self.angles1.rmsd, self.angles3)
self.assertRaises(ValueError, self.angles1.rmsd, structure.TorsionAnglesCollection())
def testConversion(self):
ta = structure.TorsionAngles(0, 90, 180)
ta.to_radians()
self.assertEqual(ta.phi, 0)
self.assertAlmostEqual(ta.psi, 1.57, places=2)
self.assertAlmostEqual(ta.omega, 3.14, places=2)
ta.to_degrees()
self.assertEqual(ta.phi, 0)
self.assertEqual(ta.psi, 90)
self.assertEqual(ta.omega, 180)
def testBool(self):
self.assertTrue(structure.TorsionAngles(20, None, None))
self.assertFalse(structure.TorsionAngles(None, None, None))
if __name__ == '__main__':
test.Console()
|
11511500 | from fastapi import Request, Response
from fastapi.responses import RedirectResponse
from fps.hooks import register_exception_handler
from fps.logging import get_configured_logger
logger = get_configured_logger("helloworld")
class RedirectException(Exception):
def __init__(self, reason, redirect_to):
self.reason = reason
self.redirect_to = redirect_to
async def exception_handler(request: Request, exc: RedirectException) -> Response:
logger.warning(f"'{exc.reason}' caused redirection to '{exc.redirect_to}'")
return RedirectResponse(url=exc.redirect_to)
h = register_exception_handler(RedirectException, exception_handler)
|
11511507 | from spritecss.css import parser
from itertools import izip
def parser_events():
p = iter(parser.CSSParser(data="sel { decl: val; }\n"))
evs = [("selector", {"selector": "sel "}),
("whitespace", {"whitespace": " "}),
("declaration", {"declaration": "decl: val"}),
("whitespace", {"whitespace": " "}),
("block_end", {}),
("whitespace", {"whitespace": "\n"})]
for got, expect in izip(p, evs):
assert got.lexeme == expect[0]
for k, ex_val in expect[1].iteritems():
val = getattr(got, k)
assert ex_val == val
def reprint(css):
reprinted = "".join(parser.CSSParser(data=css).iter_print_css())
assert css == reprinted
return reprinted
def test_reprint_trivial():
reprint(" ")
reprint("@test;\n")
reprint("@test\n{ x: y; }\n")
reprint("@test foo { x: y; }\n")
reprint("hello { world: foo; }\n")
reprint("/* foo */bar{test:xxx;/*ee*/abc;;}\n")
def test_reprint_escapes():
reprint(r's{decl:"\"hel\\lo\"";}')
def test_reprint_test_files():
from os import path
from glob import glob
css_dirn = path.join(path.dirname(__file__), "test_css_files")
for fn in glob(path.join(css_dirn, "*.css")):
with open(fn, "rb") as fp:
reprint(fp.read())
|
11511544 | import numpy as np
import jax.numpy as jnp
from jax.nn import softplus
from utils import softplus_inv
from jax.experimental import optimizers
from jax import value_and_grad
import matplotlib.pyplot as plt
import time
from sde_gp import SDEGP
from approximate_inference import EP, PL, CL, IKS, EKEP
import priors
import likelihoods
pi = 3.141592653589793
np.random.seed(12345)
N = 1000
x = np.sort(np.random.permutation(np.linspace(-25.0, 150.0, num=N) + 0.5*np.random.randn(N))) # unevenly spaced
x_test = np.linspace(np.min(x)-15.0, np.max(x)+15.0, num=100)
dummy_y = x
var_f = 1.0 # GP variance
len_f = 20.0 # GP lengthscale
var_y = 0.1
theta_prior = jnp.array([var_f, len_f])
theta_lik = jnp.array([])
prior_ = priors.Matern52(theta_prior)
lik_ = likelihoods.SumOfGaussians(theta_lik)
approx_inf_ = EP(power=1.)
# approx_inf_ = PL()
# approx_inf_ = CL(power=0.5)
# approx_inf_ = IKS()
# approx_inf_ = EKEP()
sde_gp_model = SDEGP(prior=prior_, likelihood=lik_, t=x, y=dummy_y, t_test=x_test, approx_inf=approx_inf_)
print('generating some data by sampling from the prior ...')
ground_truth = sde_gp_model.prior_sample(1, t=x)
y = sde_gp_model.likelihood.sample(ground_truth)[:, 0, 0]
# plt.figure(1, figsize=(12, 5))
# plt.clf()
# plt.plot(x, ground_truth[:, 0, 0])
# plt.plot(x, y, '.')
# plt.show()
sde_gp_model = SDEGP(prior=prior_, likelihood=lik_, t=x, y=y, t_test=x_test, approx_inf=approx_inf_)
opt_init, opt_update, get_params = optimizers.adam(step_size=5e-1)
# parameters should be a 2-element list [param_prior, param_likelihood]
opt_state = opt_init([sde_gp_model.prior.hyp, sde_gp_model.likelihood.hyp]) # params mapped through inverse softplus
def gradient_step(i, state, model):
params = get_params(state)
model.prior.hyp = params[0]
model.likelihood.hyp = params[1]
# neg_log_marg_lik, gradients = model.run_model()
neg_log_marg_lik, gradients = model.neg_log_marg_lik()
print('iter %2d: var_f=%1.2f len_f=%1.2f, nlml=%2.2f' %
(i, softplus(params[0][0]), softplus(params[0][1]), neg_log_marg_lik))
return opt_update(i, gradients, state)
for j in range(3):
neg_log_marg_lik, gradients = sde_gp_model.run()
print(neg_log_marg_lik)
params = [sde_gp_model.prior.hyp, sde_gp_model.likelihood.hyp]
neg_log_marg_lik, dlZ = value_and_grad(sde_gp_model.kalman_filter, argnums=2)(sde_gp_model.y_train, sde_gp_model.dt_train, params, False,
False, None, sde_gp_model.sites.site_params)
print(neg_log_marg_lik)
print(dlZ)
# print('optimising the hyperparameters ...')
# t0 = time.time()
# for j in range(20):
# opt_state = gradient_step(j, opt_state, sde_gp_model)
# t1 = time.time()
# print('optimisation time: %2.2f secs' % (t1-t0))
# calculate posterior predictive distribution via filtering and smoothing at train & test locations:
print('calculating the posterior predictive distribution ...')
t0 = time.time()
posterior_mean, posterior_var, _ = sde_gp_model.predict()
t1 = time.time()
print('prediction time: %2.2f secs' % (t1-t0))
lb = posterior_mean[:, 0] - 1.96 * posterior_var[:, 0]**0.5
ub = posterior_mean[:, 0] + 1.96 * posterior_var[:, 0]**0.5
x_pred = sde_gp_model.t_all
test_id = sde_gp_model.test_id
print('sampling from the posterior ...')
t0 = time.time()
posterior_samp = sde_gp_model.posterior_sample(20)
t1 = time.time()
print('sampling time: %2.2f secs' % (t1-t0))
print('plotting ...')
plt.figure(1, figsize=(12, 5))
plt.clf()
plt.plot(x, ground_truth[:, 0, 0], 'k--', label='ground truth')
plt.plot(x, y, 'k.', label='observations')
plt.plot(x_pred, posterior_mean, 'b', label='posterior mean')
plt.fill_between(x_pred, lb, ub, color='b', alpha=0.05, label='95% confidence')
plt.plot(sde_gp_model.t_test, posterior_samp[test_id, 0, :], 'b', alpha=0.15)
plt.xlim([sde_gp_model.t_test[0], sde_gp_model.t_test[-1]])
plt.legend()
plt.title('GP regression via Kalman smoothing')
plt.xlabel('time - $t$')
plt.show()
|
11511581 | class Solution:
def replaceElements(self, arr: List[int]) -> List[int]:
n = len(arr)
for i in range(n - 1, -1, -1):
if i == n - 1:
premax = arr[i]
arr[i] = -1
else:
cmax = max(premax, arr[i])
arr[i] = premax
premax = cmax
return arr
|
11511589 | from rest_framework import serializers
from bullet_point.models import BulletPoint, Endorsement, Flag, Vote
from user.serializers import UserSerializer
from utils.http import get_user_from_request
class EndorsementSerializer(serializers.ModelSerializer):
bullet_point = serializers.PrimaryKeyRelatedField(
many=False,
read_only=True
)
created_by = UserSerializer(
read_only=False,
default=serializers.CurrentUserDefault()
)
class Meta:
fields = [
'bullet_point',
'created_by',
'created_date',
]
model = Endorsement
class FlagSerializer(serializers.ModelSerializer):
bullet_point = serializers.PrimaryKeyRelatedField(
many=False,
read_only=True
)
created_by = UserSerializer(
read_only=False,
default=serializers.CurrentUserDefault()
)
class Meta:
fields = [
'bullet_point',
'created_by',
'created_date',
'reason',
]
model = Flag
class BulletPointSerializer(serializers.ModelSerializer):
tail_created_by = serializers.SerializerMethodField()
tail_editors = serializers.SerializerMethodField()
created_by = UserSerializer(
read_only=False,
default=serializers.CurrentUserDefault()
)
editors = serializers.SerializerMethodField()
score = serializers.SerializerMethodField()
user_vote = serializers.SerializerMethodField()
promoted = serializers.SerializerMethodField()
paper_slug = serializers.SerializerMethodField()
endorsements = EndorsementSerializer(read_only=True, many=True)
flags = FlagSerializer(read_only=True, many=True)
class Meta:
model = BulletPoint
exclude = []
read_only_fields = [
'is_head',
'is_tail',
'previous',
'tail',
]
def get_tail_created_by(self, obj):
if obj.is_tail:
tail = obj
else:
tail = obj.tail
return UserSerializer(tail.created_by).data
def get_tail_editors(self, obj):
if obj.is_tail:
tail = obj
else:
tail = obj.tail
return self.get_editors(tail)
def get_editors(self, obj):
return UserSerializer(obj.editors, many=True).data
def get_score(self, obj):
return obj.calculate_score()
def get_user_vote(self, obj):
user = get_user_from_request(self.context)
if user and not user.is_anonymous:
vote = obj.votes.filter(created_by=user)
if vote.exists():
return BulletPointVoteSerializer(vote.last()).data
return False
return False
def get_promoted(self, obj):
if self.context.get('exclude_promoted_score', False):
return None
return obj.get_promoted_score()
def get_paper_slug(self, obj):
if obj.paper:
return obj.paper.slug
class BulletPointTextOnlySerializer(serializers.ModelSerializer):
paper = serializers.PrimaryKeyRelatedField(many=False, read_only=True)
class Meta:
model = BulletPoint
fields = [
'is_head',
'is_public',
'ordinal',
'paper',
'plain_text',
'text',
]
read_only_fields = fields
class BulletPointVoteSerializer(serializers.ModelSerializer):
bullet_point = serializers.SerializerMethodField()
class Meta:
fields = [
'id',
'created_by',
'created_date',
'vote_type',
'bullet_point',
]
model = Vote
def get_bullet_point(self, obj):
if self.context.get('include_bullet_data', False):
serializer = BulletPointSerializer(obj.bulletpoint)
return serializer.data
return None
|
11511599 | def calculate_score(str1: str, str2: str, partial_match=False):
"""
Calculates how close `str1` matches `str2` using fuzzy match.
How matching works:
– first characters of both `str1` and `str2` *must* match
– `str1` length larger than `str2` length is allowed only when `unmatched` is true
– ideal match is when `str1` equals to `str2` (score: 1)
– next best match is `str2` starts with `str1` (score: 1 × percent of matched characters)
– other scores depend on how close characters of `str1` to the beginning of `str2`
:param partial_match Allow length `str1` to be greater than `str2` length
"""
str1 = str1.lower()
str2 = str2.lower()
if str1 == str2:
return 1
# Both strings MUST start with the same character
if not str1 or not str2 or str1[0] != str2[0]:
return 0
str1_len = len(str1)
str2_len = len(str2)
if not partial_match and str1_len > str2_len:
return 0
# Characters from `str1` which are closer to the beginning of a `str2` should
# have higher score.
# For example, if `str2` is `abcde`, it’s max score is:
# 5 + 4 + 3 + 2 + 1 = 15 (sum of character positions in reverse order)
# Matching `abd` against `abcde` should produce:
# 5 + 4 + 2 = 11
# Acronym bonus for match right after `-`. Matching `abd` against `abc-de`
# should produce:
# 6 + 5 + 4 (use `d` position in `abd`, not in abc-de`)
min_length = min(str1_len, str2_len)
max_length = max(str1_len, str2_len)
i = 1
j = 1
score = max_length
found = False
acronym = False
while i < str1_len:
ch1 = str1[i]
found = False
acronym = False
while j < str2_len:
ch2 = str2[j]
if ch1 == ch2:
found = True
score += max_length - (i if acronym else j)
break
# add acronym bonus for exactly next match after unmatched `-`
acronym = ch2 == '-'
j += 1
if not found:
if not partial_match:
return 0
break
i += 1
match_ratio = i / max_length
delta = max_length - min_length
max_score = n_sum(max_length) - n_sum(delta)
return (score * match_ratio) / max_score
def n_sum(n: int):
"Calculates sum of first `n` numbers, e.g. 1+2+3+...n"
return n * (n + 1) / 2
|
11511647 | import datasets
from transformers import (AutoTokenizer, DataCollatorForLanguageModeling, TrainingArguments,
Trainer, AutoModelForMaskedLM, PreTrainedTokenizerFast)
from datasets import load_dataset, concatenate_datasets
from transformers import AutoTokenizer, PreTrainedTokenizerFast
import re
import glob
text_path = "../pretraining_data" # Path to documents to use for pre-training (stored in CSV files)
base_model = "microsoft/deberta-base" # Base pre-trained model
save_to_hub = "organization/model_name" # Directory where the model will be saved in HF hub
report = "wandb" # report to Weights and Biases
run_name = "run_name" # Name of the run for reporting and local storage
other_data_sources = False # False for this project. Set to True if also using other texts (e.g. radiology reports, pathology reports etc.)
# Function to remove discharge summary "bloat" (e.g. long copy-and-paste sections like medication list and pathology results)
def dcsumm_body(text):
if text['TEXT']:
reduced = re.search('PRINCIPAL DIAGNOSIS(.*?)DISCHARGE|PRESCRIBED MEDICATION', text['TEXT'], flags=re.S)
if reduced:
text['TEXT'] = reduced.group(1)
else:
text['TEXT'] = ''
else:
text['TEXT'] = ''
return text
def tokenize_function(examples, tokenizer):
return tokenizer(examples["TEXT"])
def group_texts(examples):
# Concatenate all texts.
concatenated_examples = {k: sum(examples[k], []) for k in examples.keys()}
total_length = len(concatenated_examples[list(examples.keys())[0]])
total_length = (total_length // 512) * 512
result = {
k: [t[i: i + 512] for i in range(0, total_length, 512)]
for k, t in concatenated_examples.items()
}
result["labels"] = result["input_ids"].copy()
return result
datafiles = glob.glob(f"{text_path}/*")
tokenizer = AutoTokenizer.from_pretrained(base_model)
assert isinstance(tokenizer, PreTrainedTokenizerFast)
dcsumm_datafiles=[datafile for datafile in datafiles if 'summaries' in datafile]
other_datafiles=[datafile for datafile in datafiles if 'summaries' not in datafile]
dataset = load_dataset("csv", data_files=dcsumm_datafiles) \
.map(dcsumm_body) \
.filter(lambda example: (example['TEXT'] is not None) & (example['TEXT'] != '')) \
.remove_columns(['EPISODE_ID', 'PATIENT_ID', 'DOC_ID', 'START_DTTM'])
if other_data_sources:
other_dataset = load_dataset("csv", data_files=other_datafiles) \
.filter(lambda example: (example['TEXT'] is not None) & (example['TEXT'] != ''))
dataset = concatenate_datasets([dataset['train'], other_dataset['train']])
tokenised = dataset.map(tokenize_function, fn_kwargs={'tokenizer': tokenizer},
batched=True, batch_size=5000,
remove_columns=["TEXT"])
tokenised = tokenised.map(
group_texts,
batched=True,
num_proc=10
)
tokenised.save_to_disk("tokenized-texts")
model = AutoModelForMaskedLM.from_pretrained(base_model)
tokenizer = AutoTokenizer.from_pretrained(base_model)
data_collator = DataCollatorForLanguageModeling(tokenizer=tokenizer, mlm_probability=0.15)
assert isinstance(tokenizer, PreTrainedTokenizerFast)
train_test = datasets.load_from_disk('tokenized-texts')
train_test = train_test.train_test_split(test_size=0.05)
training_args = TrainingArguments(
run_name,
evaluation_strategy = "steps",
eval_steps = 40_000,
learning_rate=5e-5,
weight_decay=0.01,
per_device_train_batch_size=3,
per_device_eval_batch_size=3,
report_to=report,
run_name=run_name,
num_train_epochs=5,
save_steps=40_000,
hub_model_id=save_to_hub,
push_to_hub=True
)
trainer = Trainer(
model=model,
args=training_args,
train_dataset=train_test["train"],
eval_dataset=train_test["test"],
data_collator=data_collator,
)
trainer.train()
trainer.push_to_hub() |
11511693 | from ..utils import Scraper
from bs4 import BeautifulSoup
from collections import OrderedDict
import json
import os
import requests
class UTSCTimetable:
host = 'http://www.utsc.utoronto.ca/~registrar/scheduling/timetable'
@staticmethod
def scrape(location='.'):
Scraper.logger.info('UTSCTimetable initialized.')
Scraper.logger.info('Not implemented.')
Scraper.logger.info('UTSCTimetable completed.')
|
11511727 | from time import *
import functools
from peewee import *
import logging
# 这个模块主要用来放一些装饰器的函数。
def db_connnect(text):
"""
连接sqlite数据库的装饰器。
:param text: 要连接的数据库名。
:return: None。
"""
def decorator(func):
@functools.wraps(func)
def wrapper(*args, **kwargs):
db = SqliteDatabase(text)
db.connect()
result = func(*args, **kwargs)
db.close()
return result
return wrapper
return decorator
def set_log_cofig(func):
"""
日志基本设置的装饰器。
:param func: 待包装的函数。
:return: None。
"""
def wrapper(*args, **kwargs):
# 日志格式
LOG_FORMAT = "%(asctime)s - %(levelname)s - %(message)s"
DATE_FORMAT = "%m/%d/%Y %H:%M:%S %process"
logging.basicConfig(
level=logging.INFO,
format=LOG_FORMAT,
datefmt=DATE_FORMAT)
return func(*args, **kwargs)
return wrapper
@set_log_cofig
def metric_time(func):
"""
测量函数运行时间的装饰器。
:param func:待包装的函数。
:return: None。
"""
def wrapper(*args, **kwargs):
start_time = time()
result = func(*args, **kwargs)
end_time = time()
logging.info("%s函数运行时间为%fs" % (func.__name__, end_time - start_time))
return result
return wrapper
|
11511760 | import random
import numpy as np
import nltk
import sklearn
import keras
import json
import scipy
from collections import defaultdict
import gen_util
import keras
random.seed(1337)
path="../big_domain_desc/"
maxlen=120
train_per_cls=100 #seen examples
test_per_cls=50 #test examples so 5000 test examples in the end.
mode="test"
with open("../meta_data/clean_big_domain_desc_split.json") as f:
split=json.load(f)
classes=split[mode]
train_corpus, test_corpus={}, {} #let's not change the name of train_corpus, but it's actually seen_corpus
corpus=[]
for cls in classes:
with open(path+cls+".txt") as f:
samples=f.readlines()
random.shuffle(samples)
train_examples=samples[:train_per_cls]
test_examples=samples[-test_per_cls:]
corpus.extend(train_examples )
corpus.extend(test_examples )
train_corpus[cls]=[nltk.tokenize.word_tokenize(doc) for doc in train_examples ]
test_corpus[cls]=[nltk.tokenize.word_tokenize(doc) for doc in test_examples ]
with open("word_idx.json") as f:
word_idx=json.load(f)
model=keras.models.load_model("../../model/encoder_lstm_512.h5")
train_idx, test_idx, train_Y=[], [], []
train_rep, test_rep=[], []
for ix, cls in enumerate(classes):
tmp_idx=[[word_idx[token] if token in word_idx else 1 for token in doc] for doc in train_corpus[cls] ]
tmp_idx=keras.preprocessing.sequence.pad_sequences(tmp_idx, maxlen=maxlen, padding="post")
train_idx.append(tmp_idx)
train_rep.append(model.predict(tmp_idx) )
train_Y.append(np.full((train_per_cls,), ix) )
tmp_idx=[[word_idx[token] if token in word_idx else 1 for token in doc] for doc in test_corpus[cls] ]
tmp_idx=keras.preprocessing.sequence.pad_sequences(tmp_idx, maxlen=maxlen, padding="post")
test_idx.append(tmp_idx)
test_rep.append(model.predict(tmp_idx) )
train_idx=np.vstack(train_idx)
train_Y=np.concatenate(train_Y, 0)
train_rep=np.vstack(train_rep)
test_idx=np.vstack(test_idx)
test_rep=np.vstack(test_rep)
def data2np_DOC_train(class_set, data_idx, data_rep, data_Y, classes, train_per_cls):
train_idx, train_rep, train_Y=[], [], []
for cls in class_set:
ix=classes.index(cls)
cls_offset=ix*train_per_cls
train_idx.append(data_idx[cls_offset:cls_offset+train_per_cls] )
train_rep.append(data_rep[cls_offset:cls_offset+train_per_cls] )
train_Y.append(data_Y[cls_offset:cls_offset+train_per_cls])
train_idx=np.vstack(train_idx)
train_rep=np.vstack(train_rep)
train_Y=np.concatenate(train_Y, 0)
shuffle_idx=np.random.permutation(train_idx.shape[0])
return train_idx[shuffle_idx], train_rep[shuffle_idx], train_Y[shuffle_idx]
def data2np_test(class_set, train_rep, test_idx, test_rep, classes, train_per_cls, test_per_cls):
test_X1, test_Y=[], []
test_X0=test_rep #testing over the full test examples. we only change the dim 1 of test_X1 for range of known classes.
test_idx_X0=test_idx
for cls in class_set: #looping through train classes
ix=classes.index(cls)
cls_offset=ix*train_per_cls
sim=sklearn.metrics.pairwise.cosine_similarity(test_X0, train_rep[cls_offset:cls_offset+train_per_cls ])
sim_idx=sim.argsort(axis=1)[:,1:]+cls_offset #keep all 99 examples
test_X1.append(np.expand_dims(sim_idx, 1) )
test_X1=np.concatenate(test_X1, 1)
#build the rejection class.
test_Y=np.concatenate([np.repeat(np.arange(len(class_set) ), test_per_cls), np.full( test_per_cls*(len(classes)-len(class_set) ) , len(class_set) ) ])
return test_idx_X0, test_X0, test_X1, test_Y
for cut in [25, 50, 75]:
class_set=classes[:cut]
train_set_idx_X, train_set_X, train_set_Y=data2np_DOC_train(class_set, train_idx, train_rep, train_Y, classes, train_per_cls)
test_idx_X0, test_X0, test_X1, test_Y=data2np_test(class_set, train_rep, test_idx, test_rep, classes, train_per_cls, test_per_cls)
np.savez("../data/"+mode+"_"+str(cut)+"_idx.npz",
train_rep=train_rep,
train_set_idx_X=train_set_idx_X, train_set_X=train_set_X, train_set_Y=train_set_Y,
test_idx_X0=test_idx_X0, test_X0=test_X0, test_X1=test_X1, test_Y=test_Y)
|
11511762 | info = [
('nn::spl::detail::IRandomInterface', 0, '', '0 bytes in - 0 bytes out - Buffer<0,6,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 1, '', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 2, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 7, '', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,8>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 8, '', '0x10 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x301>, InRaw<8,8,8>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 9, '', '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 11, '', '4 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x301>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 12, '', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 13, '', '0 bytes in - 0 bytes out', ''),
('nn::fssrv::sf::IFileSystemProxy', 17, '', '0 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x301>', ''),
('nn::fssrv::sf::IFileSystemProxy', 18, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 19, '', '0 bytes in - 0 bytes out', ''),
('nn::fssrv::sf::IFileSystemProxy', 21, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 22, '', '0x90 bytes in - 0 bytes out - InRaw<0x40,8,0>, InRaw<0x40,8,0x40>, InRaw<0x10,4,0x80>', ''),
('nn::fssrv::sf::IFileSystemProxy', 23, '', '0x80 bytes in - 0 bytes out - InRaw<0x40,8,0>, InRaw<0x40,8,0x40>', ''),
('nn::fssrv::sf::IFileSystemProxy', 24, '', '0 bytes in - 0 bytes out - Buffer<0,5,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 25, '', '0x10 bytes in - 0 bytes out - InRaw<1,1,0>, InRaw<8,8,8>', ''),
('nn::fssrv::sf::IFileSystemProxy', 26, '', '0 bytes in - 0 bytes out', ''),
('nn::fssrv::sf::IFileSystemProxy', 27, '', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 30, '', '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::fssrv::sf::IFileSystemProxy', 31, '', '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::fssrv::sf::IFileSystemProxy', 32, '', '0x20 bytes in - 0 bytes out - InRaw<1,1,0>, InRaw<8,8,8>, InRaw<8,8,0x10>, InRaw<8,8,0x18>', ''),
('nn::fssrv::sf::IFileSystemProxy', 51, '', '0x48 bytes in - 0 bytes out - OutObject<0,0>, InRaw<1,1,0>, InRaw<0x40,8,8>', ''),
('nn::fssrv::sf::IFileSystemProxy', 52, '', '0x48 bytes in - 0 bytes out - OutObject<0,0>, InRaw<1,1,0>, InRaw<0x40,8,8>', ''),
('nn::fssrv::sf::IFileSystemProxy', 53, '', '0x48 bytes in - 0 bytes out - OutObject<0,0>, InRaw<1,1,0>, InRaw<0x40,8,8>', ''),
('nn::fssrv::sf::IFileSystemProxy', 57, '', '0x10 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<1,1,0>, InRaw<8,8,8>', ''),
('nn::fssrv::sf::IFileSystemProxy', 58, '', '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 59, '', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>, Buffer<0,5,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 60, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 61, '', '1 bytes in - 0 bytes out - OutObject<0,0>, InRaw<1,1,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 80, '', '0x48 bytes in - 0 bytes out - OutObject<0,0>, InRaw<1,1,0>, InRaw<0x40,8,8>, InRaw<4,4,4>', ''),
('nn::fssrv::sf::IFileSystemProxy', 100, '', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 110, '', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 200, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 201, '', '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 202, '', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,8>, InRaw<1,1,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 203, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 400, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 500, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 501, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 600, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 601, '', '0x10 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>, InRaw<8,8,8>', ''),
('nn::fssrv::sf::IFileSystemProxy', 602, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,6,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 603, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 604, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 605, '', '0 bytes in - 0 bytes out', ''),
('nn::fssrv::sf::IFileSystemProxy', 606, '', '0x10 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<8,8,8>, InRaw<1,1,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 607, '', '0x20 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<0x10,1,0x10>', ''),
('nn::fssrv::sf::IFileSystemProxy', 608, '', '0 bytes in - 0 bytes out', ''),
('nn::fssrv::sf::IFileSystemProxy', 609, '', '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, Buffer<0,0x19,0x301>', ''),
('nn::fssrv::sf::IFileSystemProxy', 610, '', '0 bytes in - 0x18 bytes out - OutRaw<0x10,8,8>, OutRaw<1,1,0>, Buffer<0,0x19,0x301>', ''),
('nn::fssrv::sf::IFileSystemProxy', 620, '', '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 800, '', '0 bytes in - 0x80 bytes out - OutRaw<0x80,4,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 1000, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>, Buffer<0,0x19,0x301>', ''),
('nn::fssrv::sf::IFileSystemProxy', 1001, '', '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>', ''),
('nn::fssrv::sf::IFileSystemProxy', 1002, '', '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>', ''),
('nn::fssrv::sf::IFileSystemProxy', 1003, '', '0 bytes in - 0 bytes out', ''),
('nn::fssrv::sf::IFileSystemProxy', 1004, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 1005, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::fssrv::sf::IFileSystemProxy', 1006, '', '0 bytes in - 0 bytes out - Buffer<0,5,0>', ''),
('nn::fssrv::sf::IFileSystem', 0, '', '0x10 bytes in - 0 bytes out - Buffer<0,0x19,0x301>, InRaw<8,8,8>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IFileSystem', 1, '', '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>', ''),
('nn::fssrv::sf::IFileSystem', 2, '', '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>', ''),
('nn::fssrv::sf::IFileSystem', 3, '', '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>', ''),
('nn::fssrv::sf::IFileSystem', 4, '', '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>', ''),
('nn::fssrv::sf::IFileSystem', 5, '', '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>, Buffer<1,0x19,0x301>', ''),
('nn::fssrv::sf::IFileSystem', 6, '', '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>, Buffer<1,0x19,0x301>', ''),
('nn::fssrv::sf::IFileSystem', 7, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0x19,0x301>', ''),
('nn::fssrv::sf::IFileSystem', 8, '', '4 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x301>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IFileSystem', 9, '', '4 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x301>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IFileSystem', 10, '', '0 bytes in - 0 bytes out', ''),
('nn::fssrv::sf::IFileSystem', 11, '', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0x19,0x301>', ''),
('nn::fssrv::sf::IFileSystem', 12, '', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0x19,0x301>', ''),
('nn::fssrv::sf::IFileSystem', 13, '', '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>', ''),
('nn::fssrv::sf::IFileSystem', 14, '', '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>, Buffer<0,0x19,0x301>', ''),
('nn::fssrv::sf::IFile', 0, '', '0x18 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,0x46,0>, InRaw<8,8,0x10>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IFile', 1, '', '0x18 bytes in - 0 bytes out - InRaw<8,8,8>, Buffer<0,0x45,0>, InRaw<8,8,0x10>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IFile', 2, '', '0 bytes in - 0 bytes out', ''),
('nn::fssrv::sf::IFile', 3, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::fssrv::sf::IFile', 4, '', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', ''),
('nn::fssrv::sf::IDirectory', 0, '', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>', ''),
('nn::fssrv::sf::IDirectory', 1, '', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', ''),
('nn::fssrv::sf::IStorage', 0, '', '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,0x46,0>, InRaw<8,8,8>', ''),
('nn::fssrv::sf::IStorage', 1, '', '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,0x45,0>, InRaw<8,8,8>', ''),
('nn::fssrv::sf::IStorage', 2, '', '0 bytes in - 0 bytes out', ''),
('nn::fssrv::sf::IStorage', 3, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::fssrv::sf::IStorage', 4, '', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', ''),
('nn::fssrv::sf::ISaveDataInfoReader', 0, '', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 0, '', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 1, '', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 2, '', '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 3, '', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 4, '', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 5, '', '8 bytes in - 0x18 bytes out - OutRaw<0x10,4,0>, OutRaw<8,8,0x10>, Buffer<0,6,0>, InRaw<8,8,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 100, '', '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 101, '', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 110, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 111, '', '4 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 112, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 113, '', '8 bytes in - 0x18 bytes out - OutRaw<0x10,4,0>, OutRaw<8,8,0x10>, Buffer<0,6,0>, InRaw<8,8,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 114, '', '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 200, '', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 201, '', '0x10 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<8,8,8>', ''),
('nn::fssrv::sf::IDeviceOperator', 202, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 203, '', '4 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 204, '', '0 bytes in - 0 bytes out', ''),
('nn::fssrv::sf::IDeviceOperator', 205, '', '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 206, '', '0x10 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,8>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 207, '', '0x10 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>, Buffer<1,5,0>, InRaw<8,8,8>', ''),
('nn::fssrv::sf::IDeviceOperator', 208, '', '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 209, '', '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,6,0>, InRaw<8,8,8>', ''),
('nn::fssrv::sf::IDeviceOperator', 210, '', '1 bytes in - 0 bytes out - InRaw<1,1,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 211, '', '0x10 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,8>, InRaw<4,4,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 212, '', '0x10 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>, Buffer<1,5,0>, InRaw<8,8,8>', ''),
('nn::fssrv::sf::IDeviceOperator', 213, '', '8 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<8,8,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 214, '', '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 215, '', '0 bytes in - 0 bytes out', ''),
('nn::fssrv::sf::IDeviceOperator', 216, '', '0 bytes in - 0x10 bytes out - OutRaw<0x10,2,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 217, '', '0 bytes in - 0x40 bytes out - OutRaw<0x40,4,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 218, '', '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 300, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>', ''),
('nn::fssrv::sf::IDeviceOperator', 301, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::fssrv::sf::IEventNotifier', 0, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::fssrv::sf::IFileSystemProxyForLoader', 0, '', '8 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x301>, InRaw<8,8,0>', ''),
('nn::fssrv::sf::IFileSystemProxyForLoader', 1, '', '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,8,0>', ''),
('nn::fssrv::sf::IProgramRegistry', 0, '', '0x28 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<8,8,0x10>, InRaw<1,1,0>, Buffer<0,5,0>, InRaw<8,8,0x18>, Buffer<1,5,0>, InRaw<8,8,0x20>', ''),
('nn::fssrv::sf::IProgramRegistry', 1, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::fssrv::sf::IProgramRegistry', 256, '', '1 bytes in - 0 bytes out - InRaw<1,1,0>', ''),
('nn::tma::IHtcManager', 0, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, Buffer<1,5,0>', ''),
('nn::tma::IHtcManager', 1, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,5,0>', ''),
('nn::tma::IHtcManager', 2, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::tma::IHtcManager', 3, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::tma::IHtcManager', 4, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::tma::IHtcManager', 5, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::tma::IHtcManager', 6, '', '0 bytes in - 0 bytes out - Buffer<0,6,0>', ''),
('nn::tma::IHtcManager', 7, '', '0 bytes in - 0 bytes out - Buffer<0,6,0>', ''),
('nn::tma::IHtcManager', 8, '', '1 bytes in - 0 bytes out - InRaw<1,1,0>', ''),
('nn::htc::tenv::IServiceManager', 0, '', '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>', ''),
('nn::htc::tenv::IService', 0, '', '0x40 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>, InRaw<0x40,1,0>', ''),
('nn::htc::tenv::IService', 1, '', '0x40 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<0x40,1,0>', ''),
('nn::htc::tenv::IService', 2, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::ro::detail::IRoInterface', 0, '', '0x28 bytes in - 8 bytes out - takes pid - OutRaw<8,8,0>, InRaw<8,8,0>, InRaw<8,8,8>, InRaw<8,8,0x10>, InRaw<8,8,0x18>, InRaw<8,8,0x20>', ''),
('nn::ro::detail::IRoInterface', 1, '', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>', ''),
('nn::ro::detail::IRoInterface', 2, '', '0x18 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, InRaw<8,8,0x10>', ''),
('nn::ro::detail::IRoInterface', 3, '', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>', ''),
('nn::ro::detail::IRoInterface', 4, '', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InHandle<0,1>', ''),
('nn::sm::detail::IUserInterface', 0, '', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', ''),
('nn::sm::detail::IUserInterface', 1, '', '8 bytes in - 0 bytes out - OutHandle<0,2>, InRaw<8,1,0>', ''),
('nn::sm::detail::IUserInterface', 2, '', '0x10 bytes in - 0 bytes out - OutHandle<0,2>, InRaw<8,1,0>, InRaw<4,4,0xC>, InRaw<1,1,8>', ''),
('nn::sm::detail::IUserInterface', 3, '', '8 bytes in - 0 bytes out - InRaw<8,1,0>', ''),
('nn::sm::detail::IManagerInterface', 0, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,5,0>, Buffer<1,5,0>', ''),
('nn::sm::detail::IManagerInterface', 1, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::socket::sf::IClient', 0, '', '0x30 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, InRaw<8,8,0x20>, InHandle<0,1>, InRaw<8,8,0x28>, InRaw<0x20,4,0>', ''),
('nn::socket::sf::IClient', 1, '', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', ''),
('nn::socket::sf::IClient', 2, '', '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 3, '', '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 4, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<0,0x21,0>, InRaw<4,4,0>', ''),
('nn::socket::sf::IClient', 5, '', '0x20 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>, Buffer<1,0x21,0>, Buffer<2,0x21,0>, Buffer<3,0x22,0>, Buffer<4,0x22,0>, Buffer<5,0x22,0>, InRaw<0x18,8,8>', ''),
('nn::socket::sf::IClient', 6, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<0,0x21,0>, Buffer<1,0x22,0>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::socket::sf::IClient', 7, '', '0 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<0,0x21,0>, Buffer<1,0x22,0>, OutRaw<4,4,8>, Buffer<2,0x21,0>', ''),
('nn::socket::sf::IClient', 8, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, InRaw<4,4,4>', ''),
('nn::socket::sf::IClient', 9, '', '8 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, InRaw<4,4,4>, Buffer<1,0x22,0>, OutRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 10, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>, InRaw<4,4,4>', ''),
('nn::socket::sf::IClient', 11, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>, InRaw<4,4,4>, Buffer<1,0x21,0>', ''),
('nn::socket::sf::IClient', 12, '', '4 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, OutRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 13, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>', ''),
('nn::socket::sf::IClient', 14, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>', ''),
('nn::socket::sf::IClient', 15, '', '4 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, OutRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 16, '', '4 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, OutRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 17, '', '0xC bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>, Buffer<0,0x22,0>, OutRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 18, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::socket::sf::IClient', 19, '', '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, Buffer<0,0x21,0>, Buffer<1,0x21,0>, Buffer<2,0x21,0>, Buffer<3,0x21,0>, Buffer<4,0x22,0>, Buffer<5,0x22,0>, Buffer<6,0x22,0>, Buffer<7,0x22,0>, InRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 20, '', '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 21, '', '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>, Buffer<0,0x21,0>', ''),
('nn::socket::sf::IClient', 22, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::socket::sf::IClient', 23, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>', ''),
('nn::socket::sf::IClient', 24, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>', ''),
('nn::socket::sf::IClient', 25, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>', ''),
('nn::socket::sf::IClient', 26, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>', ''),
('nn::socket::sf::IClient', 27, '', '0x10 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<8,8,8>', ''),
('nn::socket::sf::IClient', 28, '', '8 bytes in - 8 bytes out - takes pid - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<8,8,0>, Buffer<0,0x22,0>', ''),
('nn::socket::sf::IClient', 29, '', '0x20 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, InRaw<4,4,4>, InRaw<4,4,8>, InRaw<0x10,8,0x10>', ''),
('nn::socket::sf::IClient', 30, '', '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>, InRaw<4,4,4>, Buffer<1,0x21,0>, InRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 0, '', '0x30 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, InRaw<8,8,0x20>, InHandle<0,1>, InRaw<8,8,0x28>, InRaw<0x20,4,0>', ''),
('nn::socket::sf::IClient', 1, '', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', ''),
('nn::socket::sf::IClient', 2, '', '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 3, '', '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 4, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<0,0x21,0>, InRaw<4,4,0>', ''),
('nn::socket::sf::IClient', 5, '', '0x20 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>, Buffer<1,0x21,0>, Buffer<2,0x21,0>, Buffer<3,0x22,0>, Buffer<4,0x22,0>, Buffer<5,0x22,0>, InRaw<0x18,8,8>', ''),
('nn::socket::sf::IClient', 6, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<0,0x21,0>, Buffer<1,0x22,0>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::socket::sf::IClient', 7, '', '0 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<0,0x21,0>, Buffer<1,0x22,0>, OutRaw<4,4,8>, Buffer<2,0x21,0>', ''),
('nn::socket::sf::IClient', 8, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, InRaw<4,4,4>', ''),
('nn::socket::sf::IClient', 9, '', '8 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, InRaw<4,4,4>, Buffer<1,0x22,0>, OutRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 10, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>, InRaw<4,4,4>', ''),
('nn::socket::sf::IClient', 11, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>, InRaw<4,4,4>, Buffer<1,0x21,0>', ''),
('nn::socket::sf::IClient', 12, '', '4 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, OutRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 13, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>', ''),
('nn::socket::sf::IClient', 14, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>', ''),
('nn::socket::sf::IClient', 15, '', '4 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, OutRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 16, '', '4 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, OutRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 17, '', '0xC bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>, Buffer<0,0x22,0>, OutRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 18, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::socket::sf::IClient', 19, '', '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, Buffer<0,0x21,0>, Buffer<1,0x21,0>, Buffer<2,0x21,0>, Buffer<3,0x21,0>, Buffer<4,0x22,0>, Buffer<5,0x22,0>, Buffer<6,0x22,0>, Buffer<7,0x22,0>, InRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 20, '', '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>', ''),
('nn::socket::sf::IClient', 21, '', '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>, Buffer<0,0x21,0>', ''),
('nn::socket::sf::IClient', 22, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::socket::sf::IClient', 23, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>', ''),
('nn::socket::sf::IClient', 24, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>', ''),
('nn::socket::sf::IClient', 25, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>', ''),
('nn::socket::sf::IClient', 26, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>', ''),
('nn::socket::sf::IClient', 27, '', '0x10 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<8,8,8>', ''),
('nn::socket::sf::IClient', 28, '', '8 bytes in - 8 bytes out - takes pid - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<8,8,0>, Buffer<0,0x22,0>', ''),
('nn::socket::sf::IClient', 29, '', '0x20 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, InRaw<4,4,4>, InRaw<4,4,8>, InRaw<0x10,8,0x10>', ''),
('nn::socket::sf::IClient', 30, '', '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>, InRaw<4,4,4>, Buffer<1,0x21,0>, InRaw<4,4,8>', ''),
('nn::socket::resolver::IResolver', 0, '', '4 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<4,4,0>', ''),
('nn::socket::resolver::IResolver', 1, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>, Buffer<0,6,0>', ''),
('nn::socket::resolver::IResolver', 2, '', '0x10 bytes in - 0xC bytes out - takes pid - InRaw<4,4,4>, InRaw<8,8,8>, InRaw<1,1,0>, Buffer<0,5,0>, OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<1,6,0>, OutRaw<4,4,8>', ''),
('nn::socket::resolver::IResolver', 3, '', '0x18 bytes in - 0xC bytes out - takes pid - InRaw<4,4,0>, InRaw<8,8,0x10>, Buffer<0,5,0>, InRaw<4,4,4>, InRaw<4,4,8>, OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<1,6,0>, OutRaw<4,4,8>', ''),
('nn::socket::resolver::IResolver', 4, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>, Buffer<0,6,0>', ''),
('nn::socket::resolver::IResolver', 5, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>, Buffer<0,6,0>', ''),
('nn::socket::resolver::IResolver', 6, '', '0x10 bytes in - 0xC bytes out - takes pid - InRaw<4,4,4>, InRaw<8,8,8>, InRaw<1,1,0>, Buffer<0,5,0>, Buffer<1,5,0>, Buffer<2,5,0>, Buffer<3,6,0>, OutRaw<4,4,0>, OutRaw<4,4,4>, OutRaw<4,4,8>', ''),
('nn::socket::resolver::IResolver', 7, '', '0x10 bytes in - 8 bytes out - takes pid - InRaw<4,4,0>, InRaw<8,8,8>, Buffer<0,5,0>, Buffer<1,6,0>, Buffer<2,6,0>, InRaw<4,4,4>, OutRaw<4,4,0>, OutRaw<4,4,4>', ''),
('nn::socket::resolver::IResolver', 8, '', '8 bytes in - 4 bytes out - takes pid - InRaw<8,8,0>, OutRaw<4,4,0>', ''),
('nn::socket::resolver::IResolver', 9, '', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', ''),
('nn::account::IAccountServiceForApplication', 0, 'GetUserCount', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::account::IAccountServiceForApplication', 1, 'GetUserExistence', '0x10 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<0x10,8,0>', '(nn::sf::Out<bool,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForApplication', 2, 'ListAllUsers', '0 bytes in - 0 bytes out - Buffer<0,0xA,0>', '(nn::sf::OutArray<nn::account::Uid> const&)'),
('nn::account::IAccountServiceForApplication', 3, 'ListOpenUsers', '0 bytes in - 0 bytes out - Buffer<0,0xA,0>', '(nn::sf::OutArray<nn::account::Uid> const&)'),
('nn::account::IAccountServiceForApplication', 4, 'GetLastOpenedUser', '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>', '(nn::sf::Out<nn::account::Uid,void>)'),
('nn::account::IAccountServiceForApplication', 5, 'GetProfile', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::profile::IProfile>,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForApplication', 6, 'GetProfileDigest', '0x10 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::account::ProfileDigest,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForApplication', 50, 'IsUserRegistrationRequestPermitted', '8 bytes in - 1 bytes out - takes pid - OutRaw<1,1,0>, InRaw<8,8,0>', '(nn::sf::Out<bool,void>,unsigned long)'),
('nn::account::IAccountServiceForApplication', 51, 'TrySelectUserWithoutInteraction', '1 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<1,1,0>', '(nn::sf::Out<nn::account::Uid,void>,bool)'),
('nn::account::IAccountServiceForApplication', 100, 'InitializeApplicationInfo', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(unsigned long)'),
('nn::account::IAccountServiceForApplication', 101, 'GetBaasAccountManagerForApplication', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::baas::IManagerForApplication>,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForApplication', 102, 'AuthenticateApplicationAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::IAccountServiceForApplication', 110, 'StoreSaveDataThumbnail', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>, Buffer<0,5,0>', '(nn::account::Uid const&,nn::sf::InBuffer const&)'),
('nn::account::IAccountServiceForApplication', 111, 'ClearSaveDataThumbnail', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::account::IAccountServiceForApplication', 120, 'CreateGuestLoginRequest', '4 bytes in - 0 bytes out - OutObject<0,0>, InHandle<0,1>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::baas::IGuestLoginRequest>,void>,nn::sf::NativeHandle &&,unsigned int)'),
('nn::account::profile::IProfile', 0, 'Get', '0 bytes in - 0x38 bytes out - OutRaw<0x38,8,0>, Buffer<0,0x1A,0x80>', '(nn::sf::Out<nn::account::profile::ProfileBase,void>,nn::sf::Out<nn::account::profile::UserData,void>)'),
('nn::account::profile::IProfile', 1, 'GetBase', '0 bytes in - 0x38 bytes out - OutRaw<0x38,8,0>', '(nn::sf::Out<nn::account::profile::ProfileBase,void>)'),
('nn::account::profile::IProfile', 10, 'GetImageSize', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>)'),
('nn::account::profile::IProfile', 11, 'LoadImage', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)'),
('nn::account::baas::IManagerForApplication', 0, 'CheckAvailability', '0 bytes in - 0 bytes out', '(void)'),
('nn::account::baas::IManagerForApplication', 1, 'GetAccountId', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::account::NetworkServiceAccountId,void>)'),
('nn::account::baas::IManagerForApplication', 2, 'EnsureIdTokenCacheAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::baas::IManagerForApplication', 3, 'LoadIdTokenCache', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)'),
('nn::account::baas::IManagerForApplication', 130, 'GetNintendoAccountUserResourceCacheForApplication', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0x1A,0x68>, Buffer<1,6,0>', '(nn::sf::Out<nn::account::NintendoAccountId,void>,nn::sf::Out<nn::account::nas::NasUserBaseForApplication,void>,nn::sf::OutBuffer const&)'),
('nn::account::baas::IManagerForApplication', 150, 'CreateAuthorizationRequest', '4 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x200>, InHandle<0,1>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::nas::IAuthorizationRequest>,void>,nn::account::NintendoAccountAuthorizationRequestParameters const&,nn::sf::NativeHandle &&,unsigned int)'),
('nn::account::detail::IAsyncContext', 0, 'GetSystemEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::account::detail::IAsyncContext', 1, 'Cancel', '0 bytes in - 0 bytes out', '(void)'),
('nn::account::detail::IAsyncContext', 2, 'HasDone', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::account::detail::IAsyncContext', 3, 'GetResult', '0 bytes in - 0 bytes out', '(void)'),
('nn::account::nas::IAuthorizationRequest', 0, 'GetSessionId', '0 bytes in - 0x10 bytes out - OutRaw<0x10,4,0>', '(nn::sf::Out<nn::account::detail::Uuid,void>)'),
('nn::account::nas::IAuthorizationRequest', 10, 'InvokeWithoutInteractionAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::nas::IAuthorizationRequest', 19, 'IsAuthorized', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::account::nas::IAuthorizationRequest', 20, 'GetAuthorizationCode', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)'),
('nn::account::nas::IAuthorizationRequest', 21, 'GetIdToken', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)'),
('nn::account::nas::IAuthorizationRequest', 22, 'GetState', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x80>', '(nn::sf::Out<nn::account::nas::State,void>)'),
('nn::account::baas::IGuestLoginRequest', 0, 'GetSessionId', '0 bytes in - 0x10 bytes out - OutRaw<0x10,4,0>', '(nn::sf::Out<nn::account::detail::Uuid,void>)'),
('nn::account::baas::IGuestLoginRequest', 12, 'GetAccountId', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::account::NetworkServiceAccountId,void>)'),
('nn::account::baas::IGuestLoginRequest', 13, 'GetLinkedNintendoAccountId', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::account::NintendoAccountId,void>)'),
('nn::account::baas::IGuestLoginRequest', 14, 'GetNickname', '0 bytes in - 0 bytes out - Buffer<0,0xA,0>', '(nn::sf::OutArray<char> const&)'),
('nn::account::baas::IGuestLoginRequest', 15, 'GetProfileImage', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)'),
('nn::account::baas::IGuestLoginRequest', 21, 'LoadIdTokenCache', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)'),
('nn::account::IAccountServiceForSystemService', 0, 'GetUserCount', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::account::IAccountServiceForSystemService', 1, 'GetUserExistence', '0x10 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<0x10,8,0>', '(nn::sf::Out<bool,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForSystemService', 2, 'ListAllUsers', '0 bytes in - 0 bytes out - Buffer<0,0xA,0>', '(nn::sf::OutArray<nn::account::Uid> const&)'),
('nn::account::IAccountServiceForSystemService', 3, 'ListOpenUsers', '0 bytes in - 0 bytes out - Buffer<0,0xA,0>', '(nn::sf::OutArray<nn::account::Uid> const&)'),
('nn::account::IAccountServiceForSystemService', 4, 'GetLastOpenedUser', '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>', '(nn::sf::Out<nn::account::Uid,void>)'),
('nn::account::IAccountServiceForSystemService', 5, 'GetProfile', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::profile::IProfile>,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForSystemService', 6, 'GetProfileDigest', '0x10 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::account::ProfileDigest,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForSystemService', 50, 'IsUserRegistrationRequestPermitted', '8 bytes in - 1 bytes out - takes pid - OutRaw<1,1,0>, InRaw<8,8,0>', '(nn::sf::Out<bool,void>,unsigned long)'),
('nn::account::IAccountServiceForSystemService', 51, 'TrySelectUserWithoutInteraction', '1 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<1,1,0>', '(nn::sf::Out<nn::account::Uid,void>,bool)'),
('nn::account::IAccountServiceForSystemService', 100, 'GetUserRegistrationNotifier', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)'),
('nn::account::IAccountServiceForSystemService', 101, 'GetUserStateChangeNotifier', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)'),
('nn::account::IAccountServiceForSystemService', 102, 'GetBaasAccountManagerForSystemService', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::baas::IManagerForSystemService>,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForSystemService', 103, 'GetBaasUserAvailabilityChangeNotifier', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)'),
('nn::account::IAccountServiceForSystemService', 104, 'GetProfileUpdateNotifier', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)'),
('nn::account::IAccountServiceForSystemService', 110, 'StoreSaveDataThumbnail', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>, Buffer<0,5,0>', '(nn::account::Uid const&,nn::ApplicationId,nn::sf::InBuffer const&)'),
('nn::account::IAccountServiceForSystemService', 111, 'ClearSaveDataThumbnail', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::account::Uid const&,nn::ApplicationId)'),
('nn::account::IAccountServiceForSystemService', 112, 'LoadSaveDataThumbnail', '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&,nn::account::Uid const&,nn::ApplicationId)'),
('nn::account::IAccountServiceForSystemService', 190, 'GetUserLastOpenedApplication', '0x10 bytes in - 0x10 bytes out - OutRaw<8,8,8>, OutRaw<4,4,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::ApplicationId,void>,nn::sf::Out<unsigned int,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForSystemService', 997, 'DebugInvalidateTokenCacheForUser', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::account::IAccountServiceForSystemService', 998, 'DebugSetUserStateClose', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::account::IAccountServiceForSystemService', 999, 'DebugSetUserStateOpen', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::account::detail::INotifier', 0, 'GetSystemEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::account::baas::IManagerForSystemService', 0, 'CheckAvailability', '0 bytes in - 0 bytes out', '(void)'),
('nn::account::baas::IManagerForSystemService', 1, 'GetAccountId', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::account::NetworkServiceAccountId,void>)'),
('nn::account::baas::IManagerForSystemService', 2, 'EnsureIdTokenCacheAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::baas::IManagerForSystemService', 3, 'LoadIdTokenCache', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)'),
('nn::account::baas::IManagerForSystemService', 100, 'SetSystemProgramIdentification', '8 bytes in - 0 bytes out - takes pid - Buffer<0,0x19,0x10>, InRaw<8,8,0>', '(nn::account::SystemProgramIdentification const&,unsigned long)'),
('nn::account::baas::IManagerForSystemService', 120, 'GetNintendoAccountId', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::account::NintendoAccountId,void>)'),
('nn::account::baas::IManagerForSystemService', 130, 'GetNintendoAccountUserResourceCache', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0x1A,0x24F>, Buffer<1,6,0>', '(nn::sf::Out<nn::account::NintendoAccountId,void>,nn::sf::Out<nn::account::nas::NasUserBase,void>,nn::sf::OutBuffer const&)'),
('nn::account::baas::IManagerForSystemService', 131, 'RefreshNintendoAccountUserResourceCacheAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::baas::IManagerForSystemService', 132, 'RefreshNintendoAccountUserResourceCacheAsyncIfSecondsElapsed', '4 bytes in - 1 bytes out - OutRaw<1,1,0>, OutObject<0,0>, InRaw<4,4,0>', '(nn::sf::Out<bool,void>,nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,unsigned int)'),
('nn::account::baas::IManagerForSystemService', 150, 'CreateAuthorizationRequest', '4 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x108>, Buffer<1,0x19,0x200>, InHandle<0,1>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::nas::IAuthorizationRequest>,void>,nn::account::nas::NasClientInfo const&,nn::account::NintendoAccountAuthorizationRequestParameters const&,nn::sf::NativeHandle &&,unsigned int)'),
('nn::account::IAccountServiceForAdministrator', 0, 'GetUserCount', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::account::IAccountServiceForAdministrator', 1, 'GetUserExistence', '0x10 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<0x10,8,0>', '(nn::sf::Out<bool,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForAdministrator', 2, 'ListAllUsers', '0 bytes in - 0 bytes out - Buffer<0,0xA,0>', '(nn::sf::OutArray<nn::account::Uid> const&)'),
('nn::account::IAccountServiceForAdministrator', 3, 'ListOpenUsers', '0 bytes in - 0 bytes out - Buffer<0,0xA,0>', '(nn::sf::OutArray<nn::account::Uid> const&)'),
('nn::account::IAccountServiceForAdministrator', 4, 'GetLastOpenedUser', '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>', '(nn::sf::Out<nn::account::Uid,void>)'),
('nn::account::IAccountServiceForAdministrator', 5, 'GetProfile', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::profile::IProfile>,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForAdministrator', 6, 'GetProfileDigest', '0x10 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::account::ProfileDigest,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForAdministrator', 50, 'IsUserRegistrationRequestPermitted', '8 bytes in - 1 bytes out - takes pid - OutRaw<1,1,0>, InRaw<8,8,0>', '(nn::sf::Out<bool,void>,unsigned long)'),
('nn::account::IAccountServiceForAdministrator', 51, 'TrySelectUserWithoutInteraction', '1 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<1,1,0>', '(nn::sf::Out<nn::account::Uid,void>,bool)'),
('nn::account::IAccountServiceForAdministrator', 100, 'GetUserRegistrationNotifier', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)'),
('nn::account::IAccountServiceForAdministrator', 101, 'GetUserStateChangeNotifier', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)'),
('nn::account::IAccountServiceForAdministrator', 102, 'GetBaasAccountManagerForSystemService', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::baas::IManagerForSystemService>,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForAdministrator', 103, 'GetBaasUserAvailabilityChangeNotifier', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)'),
('nn::account::IAccountServiceForAdministrator', 104, 'GetProfileUpdateNotifier', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)'),
('nn::account::IAccountServiceForAdministrator', 110, 'StoreSaveDataThumbnail', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>, Buffer<0,5,0>', '(nn::account::Uid const&,nn::ApplicationId,nn::sf::InBuffer const&)'),
('nn::account::IAccountServiceForAdministrator', 111, 'ClearSaveDataThumbnail', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::account::Uid const&,nn::ApplicationId)'),
('nn::account::IAccountServiceForAdministrator', 112, 'LoadSaveDataThumbnail', '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&,nn::account::Uid const&,nn::ApplicationId)'),
('nn::account::IAccountServiceForAdministrator', 190, 'GetUserLastOpenedApplication', '0x10 bytes in - 0x10 bytes out - OutRaw<8,8,8>, OutRaw<4,4,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::ApplicationId,void>,nn::sf::Out<unsigned int,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForAdministrator', 997, 'DebugInvalidateTokenCacheForUser', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::account::IAccountServiceForAdministrator', 998, 'DebugSetUserStateClose', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::account::IAccountServiceForAdministrator', 999, 'DebugSetUserStateOpen', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::account::IAccountServiceForAdministrator', 200, 'BeginUserRegistration', '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>', '(nn::sf::Out<nn::account::Uid,void>)'),
('nn::account::IAccountServiceForAdministrator', 201, 'CompleteUserRegistration', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::account::IAccountServiceForAdministrator', 202, 'CancelUserRegistration', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::account::IAccountServiceForAdministrator', 203, 'DeleteUser', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::account::IAccountServiceForAdministrator', 204, 'SetUserPosition', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<4,4,0>', '(nn::account::Uid const&,int)'),
('nn::account::IAccountServiceForAdministrator', 205, 'GetProfileEditor', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::profile::IProfileEditor>,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForAdministrator', 206, 'CompleteUserRegistrationForcibly', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::account::IAccountServiceForAdministrator', 210, 'CreateFloatingRegistrationRequest', '4 bytes in - 0 bytes out - OutObject<0,0>, InHandle<0,1>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::baas::IFloatingRegistrationRequest>,void>,nn::sf::NativeHandle &&,unsigned int)'),
('nn::account::IAccountServiceForAdministrator', 230, 'AuthenticateServiceAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::IAccountServiceForAdministrator', 250, 'GetBaasAccountAdministrator', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::baas::IAdministrator>,void>,nn::account::Uid const&)'),
('nn::account::IAccountServiceForAdministrator', 290, 'ProxyProcedureForGuestLoginWithNintendoAccount', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::nas::IOAuthProcedureForExternalNsa>,void>,nn::account::detail::Uuid const&)'),
('nn::account::IAccountServiceForAdministrator', 291, 'ProxyProcedureForFloatingRegistrationWithNintendoAccount', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::nas::IOAuthProcedureForExternalNsa>,void>,nn::account::detail::Uuid const&)'),
('nn::account::IAccountServiceForAdministrator', 299, 'SuspendBackgroundDaemon', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::ISessionObject>,void>)'),
('nn::account::profile::IProfileEditor', 0, 'Get', '0 bytes in - 0x38 bytes out - OutRaw<0x38,8,0>, Buffer<0,0x1A,0x80>', '(nn::sf::Out<nn::account::profile::ProfileBase,void>,nn::sf::Out<nn::account::profile::UserData,void>)'),
('nn::account::profile::IProfileEditor', 1, 'GetBase', '0 bytes in - 0x38 bytes out - OutRaw<0x38,8,0>', '(nn::sf::Out<nn::account::profile::ProfileBase,void>)'),
('nn::account::profile::IProfileEditor', 10, 'GetImageSize', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>)'),
('nn::account::profile::IProfileEditor', 11, 'LoadImage', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)'),
('nn::account::profile::IProfileEditor', 100, 'Store', '0x38 bytes in - 0 bytes out - InRaw<0x38,8,0>, Buffer<0,0x19,0x80>', '(nn::account::profile::ProfileBase const&,nn::account::profile::UserData const&)'),
('nn::account::profile::IProfileEditor', 101, 'StoreWithImage', '0x38 bytes in - 0 bytes out - InRaw<0x38,8,0>, Buffer<0,0x19,0x80>, Buffer<1,5,0>', '(nn::account::profile::ProfileBase const&,nn::account::profile::UserData const&,nn::sf::InBuffer const&)'),
('nn::account::baas::IFloatingRegistrationRequest', 0, 'GetSessionId', '0 bytes in - 0x10 bytes out - OutRaw<0x10,4,0>', '(nn::sf::Out<nn::account::detail::Uuid,void>)'),
('nn::account::baas::IFloatingRegistrationRequest', 12, 'GetAccountId', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::account::NetworkServiceAccountId,void>)'),
('nn::account::baas::IFloatingRegistrationRequest', 13, 'GetLinkedNintendoAccountId', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::account::NintendoAccountId,void>)'),
('nn::account::baas::IFloatingRegistrationRequest', 14, 'GetNickname', '0 bytes in - 0 bytes out - Buffer<0,0xA,0>', '(nn::sf::OutArray<char> const&)'),
('nn::account::baas::IFloatingRegistrationRequest', 15, 'GetProfileImage', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)'),
('nn::account::baas::IFloatingRegistrationRequest', 21, 'LoadIdTokenCache', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)'),
('nn::account::baas::IFloatingRegistrationRequest', 100, 'RegisterAsync', '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, OutObject<0,0>', '(nn::sf::Out<nn::account::Uid,void>,nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::baas::IFloatingRegistrationRequest', 101, 'RegisterWithUidAsync', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,nn::account::Uid const&)'),
('nn::account::baas::IFloatingRegistrationRequest', 110, 'SetSystemProgramIdentification', '8 bytes in - 0 bytes out - takes pid - Buffer<0,0x19,0x10>, InRaw<8,8,0>', '(nn::account::SystemProgramIdentification const&,unsigned long)'),
('nn::account::baas::IFloatingRegistrationRequest', 111, 'EnsureIdTokenCacheAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::baas::IAdministrator', 0, 'CheckAvailability', '0 bytes in - 0 bytes out', '(void)'),
('nn::account::baas::IAdministrator', 1, 'GetAccountId', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::account::NetworkServiceAccountId,void>)'),
('nn::account::baas::IAdministrator', 2, 'EnsureIdTokenCacheAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::baas::IAdministrator', 3, 'LoadIdTokenCache', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)'),
('nn::account::baas::IAdministrator', 100, 'SetSystemProgramIdentification', '8 bytes in - 0 bytes out - takes pid - Buffer<0,0x19,0x10>, InRaw<8,8,0>', '(nn::account::SystemProgramIdentification const&,unsigned long)'),
('nn::account::baas::IAdministrator', 120, 'GetNintendoAccountId', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::account::NintendoAccountId,void>)'),
('nn::account::baas::IAdministrator', 130, 'GetNintendoAccountUserResourceCache', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0x1A,0x24F>, Buffer<1,6,0>', '(nn::sf::Out<nn::account::NintendoAccountId,void>,nn::sf::Out<nn::account::nas::NasUserBase,void>,nn::sf::OutBuffer const&)'),
('nn::account::baas::IAdministrator', 131, 'RefreshNintendoAccountUserResourceCacheAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::baas::IAdministrator', 132, 'RefreshNintendoAccountUserResourceCacheAsyncIfSecondsElapsed', '4 bytes in - 1 bytes out - OutRaw<1,1,0>, OutObject<0,0>, InRaw<4,4,0>', '(nn::sf::Out<bool,void>,nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,unsigned int)'),
('nn::account::baas::IAdministrator', 150, 'CreateAuthorizationRequest', '4 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x108>, Buffer<1,0x19,0x200>, InHandle<0,1>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::nas::IAuthorizationRequest>,void>,nn::account::nas::NasClientInfo const&,nn::account::NintendoAccountAuthorizationRequestParameters const&,nn::sf::NativeHandle &&,unsigned int)'),
('nn::account::baas::IAdministrator', 200, 'IsRegistered', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::account::baas::IAdministrator', 201, 'RegisterAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::baas::IAdministrator', 202, 'UnregisterAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::baas::IAdministrator', 203, 'DeleteRegistrationInfoLocally', '0 bytes in - 0 bytes out', '(void)'),
('nn::account::baas::IAdministrator', 220, 'SynchronizeProfileAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::baas::IAdministrator', 221, 'UploadProfileAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::baas::IAdministrator', 222, 'SynchronizeProfileAsyncIfSecondsElapsed', '4 bytes in - 1 bytes out - OutRaw<1,1,0>, OutObject<0,0>, InRaw<4,4,0>', '(nn::sf::Out<bool,void>,nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,unsigned int)'),
('nn::account::baas::IAdministrator', 250, 'IsLinkedWithNintendoAccount', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::account::baas::IAdministrator', 251, 'CreateProcedureToLinkWithNintendoAccount', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::nas::IOAuthProcedureForNintendoAccountLinkage>,void>)'),
('nn::account::baas::IAdministrator', 252, 'ResumeProcedureToLinkWithNintendoAccount', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::nas::IOAuthProcedureForNintendoAccountLinkage>,void>,nn::account::detail::Uuid const&)'),
('nn::account::baas::IAdministrator', 255, 'CreateProcedureToUpdateLinkageStateOfNintendoAccount', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::http::IOAuthProcedure>,void>)'),
('nn::account::baas::IAdministrator', 256, 'ResumeProcedureToUpdateLinkageStateOfNintendoAccount', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::http::IOAuthProcedure>,void>,nn::account::detail::Uuid const&)'),
('nn::account::baas::IAdministrator', 260, 'CreateProcedureToLinkNnidWithNintendoAccount', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::http::IOAuthProcedure>,void>)'),
('nn::account::baas::IAdministrator', 261, 'ResumeProcedureToLinkNnidWithNintendoAccount', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::http::IOAuthProcedure>,void>,nn::account::detail::Uuid const&)'),
('nn::account::baas::IAdministrator', 280, 'ProxyProcedureToAcquireApplicationAuthorizationForNintendoAccount', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::http::IOAuthProcedure>,void>,nn::account::detail::Uuid const&)'),
('nn::account::baas::IAdministrator', 997, 'DebugUnlinkNintendoAccountAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::baas::IAdministrator', 998, 'DebugSetAvailabilityErrorDetail', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(unsigned int)'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 0, 'PrepareAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 1, 'GetRequest', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x1000>, Buffer<1,0x1A,0x100>', '(nn::sf::Out<nn::account::RequestUrl,void>,nn::sf::Out<nn::account::CallbackUri,void>)'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 2, 'ApplyResponse', '0 bytes in - 0 bytes out - Buffer<0,9,0>', '(nn::sf::InArray<char> const&)'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 3, 'ApplyResponseAsync', '0 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,9,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,nn::sf::InArray<char> const&)'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 10, 'Suspend', '0 bytes in - 0x10 bytes out - OutRaw<0x10,4,0>', '(nn::sf::Out<nn::account::detail::Uuid,void>)'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 100, 'GetRequestWithTheme', '4 bytes in - 0 bytes out - Buffer<0,0x1A,0x1000>, Buffer<1,0x1A,0x100>, InRaw<4,4,0>', '(nn::sf::Out<nn::account::RequestUrl,void>,nn::sf::Out<nn::account::CallbackUri,void>,int)'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 101, 'IsNetworkServiceAccountReplaced', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 199, 'GetUrlForIntroductionOfExtraMembership', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x1000>', '(nn::sf::Out<nn::account::RequestUrl,void>)'),
('nn::account::http::IOAuthProcedure', 0, 'PrepareAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::http::IOAuthProcedure', 1, 'GetRequest', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x1000>, Buffer<1,0x1A,0x100>', '(nn::sf::Out<nn::account::RequestUrl,void>,nn::sf::Out<nn::account::CallbackUri,void>)'),
('nn::account::http::IOAuthProcedure', 2, 'ApplyResponse', '0 bytes in - 0 bytes out - Buffer<0,9,0>', '(nn::sf::InArray<char> const&)'),
('nn::account::http::IOAuthProcedure', 3, 'ApplyResponseAsync', '0 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,9,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,nn::sf::InArray<char> const&)'),
('nn::account::http::IOAuthProcedure', 10, 'Suspend', '0 bytes in - 0x10 bytes out - OutRaw<0x10,4,0>', '(nn::sf::Out<nn::account::detail::Uuid,void>)'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 0, 'PrepareAsync', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 1, 'GetRequest', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x1000>, Buffer<1,0x1A,0x100>', '(nn::sf::Out<nn::account::RequestUrl,void>,nn::sf::Out<nn::account::CallbackUri,void>)'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 2, 'ApplyResponse', '0 bytes in - 0 bytes out - Buffer<0,9,0>', '(nn::sf::InArray<char> const&)'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 3, 'ApplyResponseAsync', '0 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,9,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,nn::sf::InArray<char> const&)'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 10, 'Suspend', '0 bytes in - 0x10 bytes out - OutRaw<0x10,4,0>', '(nn::sf::Out<nn::account::detail::Uuid,void>)'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 100, 'GetAccountId', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::account::NetworkServiceAccountId,void>)'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 101, 'GetLinkedNintendoAccountId', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::account::NintendoAccountId,void>)'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 102, 'GetNickname', '0 bytes in - 0 bytes out - Buffer<0,0xA,0>', '(nn::sf::OutArray<char> const&)'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 103, 'GetProfileImage', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)'),
('nn::account::detail::ISessionObject', 999, 'Dummy', '0 bytes in - 0 bytes out', '(void)'),
('nn::account::IBaasAccessTokenAccessor', 0, 'EnsureCacheAsync', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,nn::account::Uid const&)'),
('nn::account::IBaasAccessTokenAccessor', 1, 'LoadCache', '0x10 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&,nn::account::Uid const&)'),
('nn::account::IBaasAccessTokenAccessor', 2, 'GetDeviceAccountId', '0x10 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<0x10,8,0>', '(nn::sf::Out<unsigned long,void>,nn::account::Uid const&)'),
('nn::account::IBaasAccessTokenAccessor', 50, 'RegisterNotificationTokenAsync', '0x38 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0x28>, InRaw<0x28,1,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,nn::account::Uid const&,nn::npns::NotificationToken const&)'),
('nn::account::IBaasAccessTokenAccessor', 51, 'UnregisterNotificationTokenAsync', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,nn::account::Uid const&)'),
('nn::account::detail::IAsyncContext', 0, 'GetSystemEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::account::detail::IAsyncContext', 1, 'Cancel', '0 bytes in - 0 bytes out', '(void)'),
('nn::account::detail::IAsyncContext', 2, 'HasDone', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::account::detail::IAsyncContext', 3, 'GetResult', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IAllSystemAppletProxiesService', 100, 'OpenSystemAppletProxy', '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>, InHandle<0,1>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ISystemAppletProxy>,void>,unsigned long,nn::sf::NativeHandle &&)'),
('nn::am::service::IAllSystemAppletProxiesService', 200, 'OpenLibraryAppletProxyOld', '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>, InHandle<0,1>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletProxy>,void>,unsigned long,nn::sf::NativeHandle &&)'),
('nn::am::service::IAllSystemAppletProxiesService', 201, 'OpenLibraryAppletProxy', '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>, InHandle<0,1>, Buffer<0,0x15,0x80>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletProxy>,void>,unsigned long,nn::sf::NativeHandle &&,nn::am::AppletAttribute const&)'),
('nn::am::service::IAllSystemAppletProxiesService', 300, 'OpenOverlayAppletProxy', '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>, InHandle<0,1>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IOverlayAppletProxy>,void>,unsigned long,nn::sf::NativeHandle &&)'),
('nn::am::service::IAllSystemAppletProxiesService', 350, 'OpenSystemApplicationProxy', '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>, InHandle<0,1>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationProxy>,void>,unsigned long,nn::sf::NativeHandle &&)'),
('nn::am::service::IAllSystemAppletProxiesService', 400, 'CreateSelfLibraryAppletCreatorForDevelop', '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletCreator>,void>,unsigned long)'),
('nn::am::service::ISystemAppletProxy', 0, 'GetCommonStateGetter', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ICommonStateGetter>,void>)'),
('nn::am::service::ISystemAppletProxy', 1, 'GetSelfController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ISelfController>,void>)'),
('nn::am::service::ISystemAppletProxy', 2, 'GetWindowController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IWindowController>,void>)'),
('nn::am::service::ISystemAppletProxy', 3, 'GetAudioController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IAudioController>,void>)'),
('nn::am::service::ISystemAppletProxy', 4, 'GetDisplayController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDisplayController>,void>)'),
('nn::am::service::ISystemAppletProxy', 1000, 'GetDebugFunctions', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDebugFunctions>,void>)'),
('nn::am::service::ISystemAppletProxy', 10, 'GetProcessWindingController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IProcessWindingController>,void>)'),
('nn::am::service::ISystemAppletProxy', 11, 'GetLibraryAppletCreator', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletCreator>,void>)'),
('nn::am::service::ISystemAppletProxy', 20, 'GetHomeMenuFunctions', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IHomeMenuFunctions>,void>)'),
('nn::am::service::ISystemAppletProxy', 21, 'GetGlobalStateController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IGlobalStateController>,void>)'),
('nn::am::service::ISystemAppletProxy', 22, 'GetApplicationCreator', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationCreator>,void>)'),
('nn::am::service::ICommonStateGetter', 0, 'GetEventHandle', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::ICommonStateGetter', 1, 'ReceiveMessage', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<nn::am::AppletMessage,void>)'),
('nn::am::service::ICommonStateGetter', 2, 'GetThisAppletKind', '0 bytes in - 8 bytes out - OutRaw<8,4,0>', '(nn::sf::Out<nn::am::service::AppletKind,void>)'),
('nn::am::service::ICommonStateGetter', 3, 'AllowToEnterSleep', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ICommonStateGetter', 4, 'DisallowToEnterSleep', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ICommonStateGetter', 5, 'GetOperationMode', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<unsigned char,void>)'),
('nn::am::service::ICommonStateGetter', 6, 'GetPerformanceMode', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>)'),
('nn::am::service::ICommonStateGetter', 7, 'GetCradleStatus', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<unsigned char,void>)'),
('nn::am::service::ICommonStateGetter', 8, 'GetBootMode', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<unsigned char,void>)'),
('nn::am::service::ICommonStateGetter', 9, 'GetCurrentFocusState', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<unsigned char,void>)'),
('nn::am::service::ICommonStateGetter', 10, 'RequestToAcquireSleepLock', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ICommonStateGetter', 11, 'ReleaseSleepLock', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ICommonStateGetter', 12, 'ReleaseSleepLockTransiently', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ICommonStateGetter', 13, 'GetAcquiredSleepLockEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::ICommonStateGetter', 20, 'PushToGeneralChannel', '0 bytes in - 0 bytes out - InObject<0,0>', '(nn::sf::SharedPointer<nn::am::service::IStorage>)'),
('nn::am::service::ICommonStateGetter', 30, 'GetHomeButtonReaderLockAccessor', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILockAccessor>,void>)'),
('nn::am::service::ICommonStateGetter', 31, 'GetReaderLockAccessorEx', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILockAccessor>,void>,int)'),
('nn::am::service::ICommonStateGetter', 40, 'GetCradleFwVersion', '0 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, OutRaw<4,4,8>, OutRaw<4,4,0xC>', '(nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>)'),
('nn::am::service::ICommonStateGetter', 50, 'IsVrModeEnabled', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::am::service::ICommonStateGetter', 51, 'SetVrModeEnabled', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::am::service::ICommonStateGetter', 55, 'IsInControllerFirmwareUpdateSection', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::am::service::ICommonStateGetter', 60, 'GetDefaultDisplayResolution', '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>', '(nn::sf::Out<int,void>,nn::sf::Out<int,void>)'),
('nn::am::service::ICommonStateGetter', 61, 'GetDefaultDisplayResolutionChangeEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::ILockAccessor', 1, 'TryLock', '1 bytes in - 1 bytes out - OutRaw<1,1,0>, OutHandle<0,1>, InRaw<1,1,0>', '(nn::sf::Out<bool,void>,nn::sf::Out<nn::sf::NativeHandle,void>,bool)'),
('nn::am::service::ILockAccessor', 2, 'Unlock', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ILockAccessor', 3, 'GetEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::ISelfController', 0, 'Exit', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ISelfController', 1, 'LockExit', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ISelfController', 2, 'UnlockExit', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ISelfController', 3, 'EnterFatalSection', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ISelfController', 4, 'LeaveFatalSection', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ISelfController', 9, 'GetLibraryAppletLaunchableEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::ISelfController', 10, 'SetScreenShotPermission', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::am::service::ISelfController', 11, 'SetOperationModeChangedNotification', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::am::service::ISelfController', 12, 'SetPerformanceModeChangedNotification', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::am::service::ISelfController', 13, 'SetFocusHandlingMode', '3 bytes in - 0 bytes out - InRaw<1,1,0>, InRaw<1,1,1>, InRaw<1,1,2>', '(bool,bool,bool)'),
('nn::am::service::ISelfController', 14, 'SetRestartMessageEnabled', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::am::service::ISelfController', 15, 'SetScreenShotAppletIdentityInfo', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::am::service::AppletIdentityInfo const&)'),
('nn::am::service::ISelfController', 16, 'SetOutOfFocusSuspendingEnabled', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::am::service::ISelfController', 17, 'SetControllerFirmwareUpdateSection', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::am::service::ISelfController', 18, 'SetRequiresCaptureButtonShortPressedMessage', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::am::service::ISelfController', 19, 'SetScreenShotImageOrientation', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::am::service::ISelfController', 40, 'CreateManagedDisplayLayer', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<unsigned long,void>)'),
('nn::am::service::ISelfController', 50, 'SetHandlesRequestToDisplay', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::am::service::ISelfController', 51, 'ApproveToDisplay', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ISelfController', 60, 'OverrideAutoSleepTimeAndDimmingTime', '0x10 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>, InRaw<4,4,0xC>', '(int,int,int,int)'),
('nn::am::service::ISelfController', 61, 'SetMediaPlaybackState', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::am::service::ISelfController', 62, 'SetIdleTimeDetectionExtension', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(unsigned int)'),
('nn::am::service::ISelfController', 63, 'GetIdleTimeDetectionExtension', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>)'),
('nn::am::service::ISelfController', 64, 'SetInputDetectionSourceSet', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(unsigned int)'),
('nn::am::service::ISelfController', 65, 'ReportUserIsActive', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ISelfController', 66, 'GetCurrentIlluminance', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<float,void>)'),
('nn::am::service::ISelfController', 67, 'IsIlluminanceAvailable', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::am::service::IWindowController', 0, 'CreateWindow', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IWindow>,void>,nn::am::service::WindowCreationOption)'),
('nn::am::service::IWindowController', 1, 'GetAppletResourceUserId', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::applet::AppletResourceUserId,void>)'),
('nn::am::service::IWindowController', 10, 'AcquireForegroundRights', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IWindowController', 11, 'ReleaseForegroundRights', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IWindowController', 12, 'RejectToChangeIntoBackground', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IAudioController', 0, 'SetExpectedMasterVolume', '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>', '(float,float)'),
('nn::am::service::IAudioController', 1, 'GetMainAppletExpectedMasterVolume', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<float,void>)'),
('nn::am::service::IAudioController', 2, 'GetLibraryAppletExpectedMasterVolume', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<float,void>)'),
('nn::am::service::IAudioController', 3, 'ChangeMainAppletMasterVolume', '0x10 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<8,8,8>', '(float,long)'),
('nn::am::service::IAudioController', 4, 'SetTransparentVolumeRate', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(float)'),
('nn::am::service::IDisplayController', 0, 'GetLastForegroundCaptureImage', '0 bytes in - 0 bytes out - Buffer<0,6,0>', '(nn::sf::OutBuffer const&)'),
('nn::am::service::IDisplayController', 1, 'UpdateLastForegroundCaptureImage', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IDisplayController', 2, 'GetLastApplicationCaptureImage', '0 bytes in - 0 bytes out - Buffer<0,6,0>', '(nn::sf::OutBuffer const&)'),
('nn::am::service::IDisplayController', 3, 'GetCallerAppletCaptureImage', '0 bytes in - 0 bytes out - Buffer<0,6,0>', '(nn::sf::OutBuffer const&)'),
('nn::am::service::IDisplayController', 4, 'UpdateCallerAppletCaptureImage', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IDisplayController', 5, 'GetLastForegroundCaptureImageEx', '0 bytes in - 1 bytes out - OutRaw<1,1,0>, Buffer<0,6,0>', '(nn::sf::Out<bool,void>,nn::sf::OutBuffer const&)'),
('nn::am::service::IDisplayController', 6, 'GetLastApplicationCaptureImageEx', '0 bytes in - 1 bytes out - OutRaw<1,1,0>, Buffer<0,6,0>', '(nn::sf::Out<bool,void>,nn::sf::OutBuffer const&)'),
('nn::am::service::IDisplayController', 7, 'GetCallerAppletCaptureImageEx', '0 bytes in - 1 bytes out - OutRaw<1,1,0>, Buffer<0,6,0>', '(nn::sf::Out<bool,void>,nn::sf::OutBuffer const&)'),
('nn::am::service::IDisplayController', 8, 'TakeScreenShotOfOwnLayer', '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>', '(int,bool)'),
('nn::am::service::IDisplayController', 10, 'AcquireLastApplicationCaptureBuffer', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::IDisplayController', 11, 'ReleaseLastApplicationCaptureBuffer', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IDisplayController', 12, 'AcquireLastForegroundCaptureBuffer', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::IDisplayController', 13, 'ReleaseLastForegroundCaptureBuffer', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IDisplayController', 14, 'AcquireCallerAppletCaptureBuffer', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::IDisplayController', 15, 'ReleaseCallerAppletCaptureBuffer', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IDisplayController', 16, 'AcquireLastApplicationCaptureBufferEx', '0 bytes in - 1 bytes out - OutRaw<1,1,0>, OutHandle<0,1>', '(nn::sf::Out<bool,void>,nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::IDisplayController', 17, 'AcquireLastForegroundCaptureBufferEx', '0 bytes in - 1 bytes out - OutRaw<1,1,0>, OutHandle<0,1>', '(nn::sf::Out<bool,void>,nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::IDisplayController', 18, 'AcquireCallerAppletCaptureBufferEx', '0 bytes in - 1 bytes out - OutRaw<1,1,0>, OutHandle<0,1>', '(nn::sf::Out<bool,void>,nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::IDisplayController', 20, 'ClearCaptureBuffer', '0xC bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>, InRaw<4,4,8>', '(int,bool,unsigned int)'),
('nn::am::service::IDisplayController', 21, 'ClearAppletTransitionBuffer', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(unsigned int)'),
('nn::am::service::IDebugFunctions', 0, 'NotifyMessageToHomeMenuForDebug', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::am::AppletMessage)'),
('nn::am::service::IDebugFunctions', 1, 'OpenMainApplication', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationAccessor>,void>)'),
('nn::am::service::IDebugFunctions', 10, 'EmulateButtonEvent', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::am::service::EmulatedButtonEvent)'),
('nn::am::service::IDebugFunctions', 20, 'InvalidateTransitionLayer', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IApplicationAccessor', 0, 'GetAppletStateChangedEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::IApplicationAccessor', 1, 'IsCompleted', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::am::service::IApplicationAccessor', 10, 'Start', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IApplicationAccessor', 20, 'RequestExit', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IApplicationAccessor', 25, 'Terminate', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IApplicationAccessor', 30, 'GetResult', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IApplicationAccessor', 101, 'RequestForApplicationToGetForeground', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IApplicationAccessor', 110, 'TerminateAllLibraryApplets', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IApplicationAccessor', 111, 'AreAnyLibraryAppletsLeft', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::am::service::IApplicationAccessor', 112, 'GetCurrentLibraryApplet', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IAppletAccessor>,void>)'),
('nn::am::service::IApplicationAccessor', 120, 'GetApplicationId', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::ncm::ApplicationId,void>)'),
('nn::am::service::IApplicationAccessor', 121, 'PushLaunchParameter', '4 bytes in - 0 bytes out - InRaw<4,4,0>, InObject<0,0>', '(unsigned int,nn::sf::SharedPointer<nn::am::service::IStorage>)'),
('nn::am::service::IApplicationAccessor', 122, 'GetApplicationControlProperty', '0 bytes in - 0 bytes out - Buffer<0,6,0>', '(nn::sf::OutBuffer const&)'),
('nn::am::service::IApplicationAccessor', 123, 'GetApplicationLaunchProperty', '0 bytes in - 0 bytes out - Buffer<0,6,0>', '(nn::sf::OutBuffer const&)'),
('nn::am::service::IAppletAccessor', 0, 'GetAppletStateChangedEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::IAppletAccessor', 1, 'IsCompleted', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::am::service::IAppletAccessor', 10, 'Start', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IAppletAccessor', 20, 'RequestExit', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IAppletAccessor', 25, 'Terminate', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IAppletAccessor', 30, 'GetResult', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IProcessWindingController', 0, 'GetLaunchReason', '0 bytes in - 4 bytes out - OutRaw<4,1,0>', '(nn::sf::Out<nn::am::service::AppletProcessLaunchReason,void>)'),
('nn::am::service::IProcessWindingController', 11, 'OpenCallingLibraryApplet', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletAccessor>,void>)'),
('nn::am::service::IProcessWindingController', 21, 'PushContext', '0 bytes in - 0 bytes out - InObject<0,0>', '(nn::sf::SharedPointer<nn::am::service::IStorage>)'),
('nn::am::service::IProcessWindingController', 22, 'PopContext', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>)'),
('nn::am::service::IProcessWindingController', 23, 'CancelWindingReservation', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IProcessWindingController', 30, 'WindAndDoReserved', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IProcessWindingController', 40, 'ReserveToStartAndWaitAndUnwindThis', '0 bytes in - 0 bytes out - InObject<0,0>', '(nn::sf::SharedPointer<nn::am::service::ILibraryAppletAccessor>)'),
('nn::am::service::ILibraryAppletAccessor', 0, 'GetAppletStateChangedEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::ILibraryAppletAccessor', 1, 'IsCompleted', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::am::service::ILibraryAppletAccessor', 10, 'Start', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ILibraryAppletAccessor', 20, 'RequestExit', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ILibraryAppletAccessor', 25, 'Terminate', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ILibraryAppletAccessor', 30, 'GetResult', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ILibraryAppletAccessor', 50, 'SetOutOfFocusApplicationSuspendingEnabled', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::am::service::ILibraryAppletAccessor', 100, 'PushInData', '0 bytes in - 0 bytes out - InObject<0,0>', '(nn::sf::SharedPointer<nn::am::service::IStorage>)'),
('nn::am::service::ILibraryAppletAccessor', 101, 'PopOutData', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>)'),
('nn::am::service::ILibraryAppletAccessor', 102, 'PushExtraStorage', '0 bytes in - 0 bytes out - InObject<0,0>', '(nn::sf::SharedPointer<nn::am::service::IStorage>)'),
('nn::am::service::ILibraryAppletAccessor', 103, 'PushInteractiveInData', '0 bytes in - 0 bytes out - InObject<0,0>', '(nn::sf::SharedPointer<nn::am::service::IStorage>)'),
('nn::am::service::ILibraryAppletAccessor', 104, 'PopInteractiveOutData', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>)'),
('nn::am::service::ILibraryAppletAccessor', 105, 'GetPopOutDataEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::ILibraryAppletAccessor', 106, 'GetPopInteractiveOutDataEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::ILibraryAppletAccessor', 110, 'NeedsToExitProcess', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::am::service::ILibraryAppletAccessor', 120, 'GetLibraryAppletInfo', '0 bytes in - 8 bytes out - OutRaw<8,4,0>', '(nn::sf::Out<nn::am::service::LibraryAppletInfo,void>)'),
('nn::am::service::ILibraryAppletAccessor', 150, 'RequestForAppletToGetForeground', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ILibraryAppletAccessor', 160, 'GetIndirectLayerConsumerHandle', '8 bytes in - 8 bytes out - takes pid - OutRaw<8,8,0>, InRaw<8,8,0>', '(nn::sf::Out<unsigned long,void>,nn::applet::AppletResourceUserId)'),
('nn::am::service::IStorage', 0, 'Open', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorageAccessor>,void>)'),
('nn::am::service::IStorage', 1, 'OpenTransferStorage', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ITransferStorageAccessor>,void>)'),
('nn::am::service::IStorageAccessor', 0, 'GetSize', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<long,void>)'),
('nn::am::service::IStorageAccessor', 10, 'Write', '8 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,0x21,0>', '(long,nn::sf::InBuffer const&)'),
('nn::am::service::IStorageAccessor', 11, 'Read', '8 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,0x22,0>', '(long,nn::sf::OutBuffer const&)'),
('nn::am::service::ITransferStorageAccessor', 0, 'GetSize', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<long,void>)'),
('nn::am::service::ITransferStorageAccessor', 1, 'GetHandle', '0 bytes in - 8 bytes out - OutHandle<0,1>, OutRaw<8,8,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,nn::sf::Out<unsigned long,void>)'),
('nn::am::service::ILibraryAppletCreator', 0, 'CreateLibraryApplet', '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>, InRaw<4,4,4>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletAccessor>,void>,unsigned int,unsigned int)'),
('nn::am::service::ILibraryAppletCreator', 1, 'TerminateAllLibraryApplets', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ILibraryAppletCreator', 2, 'AreAnyLibraryAppletsLeft', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::am::service::ILibraryAppletCreator', 10, 'CreateStorage', '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>,long)'),
('nn::am::service::ILibraryAppletCreator', 11, 'CreateTransferMemoryStorage', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InHandle<0,1>, InRaw<8,8,8>, InRaw<1,1,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>,nn::sf::NativeHandle &&,long,bool)'),
('nn::am::service::ILibraryAppletCreator', 12, 'CreateHandleStorage', '8 bytes in - 0 bytes out - OutObject<0,0>, InHandle<0,1>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>,nn::sf::NativeHandle &&,long)'),
('nn::am::service::IHomeMenuFunctions', 10, 'RequestToGetForeground', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IHomeMenuFunctions', 11, 'LockForeground', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IHomeMenuFunctions', 12, 'UnlockForeground', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IHomeMenuFunctions', 20, 'PopFromGeneralChannel', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>)'),
('nn::am::service::IHomeMenuFunctions', 21, 'GetPopFromGeneralChannelEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::IHomeMenuFunctions', 30, 'GetHomeButtonWriterLockAccessor', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILockAccessor>,void>)'),
('nn::am::service::IHomeMenuFunctions', 31, 'GetWriterLockAccessorEx', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILockAccessor>,void>,int)'),
('nn::am::service::IGlobalStateController', 0, 'RequestToEnterSleep', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IGlobalStateController', 1, 'EnterSleep', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IGlobalStateController', 2, 'StartSleepSequence', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::am::service::IGlobalStateController', 3, 'StartShutdownSequence', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IGlobalStateController', 4, 'StartRebootSequence', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IGlobalStateController', 10, 'LoadAndApplyIdlePolicySettings', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IGlobalStateController', 11, 'NotifyCecSettingsChanged', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IGlobalStateController', 12, 'SetDefaultHomeButtonLongPressTime', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(long)'),
('nn::am::service::IGlobalStateController', 13, 'UpdateDefaultDisplayResolution', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IGlobalStateController', 14, 'ShouldSleepOnBoot', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::am::service::IApplicationCreator', 0, 'CreateApplication', '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationAccessor>,void>,nn::ncm::ApplicationId)'),
('nn::am::service::IApplicationCreator', 1, 'PopLaunchRequestedApplication', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationAccessor>,void>)'),
('nn::am::service::IApplicationCreator', 10, 'CreateSystemApplication', '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationAccessor>,void>,nn::ncm::SystemApplicationId)'),
('nn::am::service::IApplicationCreator', 100, 'PopFloatingApplicationForDevelopment', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationAccessor>,void>)'),
('nn::am::service::ILibraryAppletProxy', 0, 'GetCommonStateGetter', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ICommonStateGetter>,void>)'),
('nn::am::service::ILibraryAppletProxy', 1, 'GetSelfController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ISelfController>,void>)'),
('nn::am::service::ILibraryAppletProxy', 2, 'GetWindowController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IWindowController>,void>)'),
('nn::am::service::ILibraryAppletProxy', 3, 'GetAudioController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IAudioController>,void>)'),
('nn::am::service::ILibraryAppletProxy', 4, 'GetDisplayController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDisplayController>,void>)'),
('nn::am::service::ILibraryAppletProxy', 1000, 'GetDebugFunctions', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDebugFunctions>,void>)'),
('nn::am::service::ILibraryAppletProxy', 10, 'GetProcessWindingController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IProcessWindingController>,void>)'),
('nn::am::service::ILibraryAppletProxy', 11, 'GetLibraryAppletCreator', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletCreator>,void>)'),
('nn::am::service::ILibraryAppletProxy', 20, 'OpenLibraryAppletSelfAccessor', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletSelfAccessor>,void>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 0, 'PopInData', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 1, 'PushOutData', '0 bytes in - 0 bytes out - InObject<0,0>', '(nn::sf::SharedPointer<nn::am::service::IStorage>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 2, 'PopInteractiveInData', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 3, 'PushInteractiveOutData', '0 bytes in - 0 bytes out - InObject<0,0>', '(nn::sf::SharedPointer<nn::am::service::IStorage>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 5, 'GetPopInDataEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 6, 'GetPopInteractiveInDataEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 10, 'ExitProcessAndReturn', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::ILibraryAppletSelfAccessor', 11, 'GetLibraryAppletInfo', '0 bytes in - 8 bytes out - OutRaw<8,4,0>', '(nn::sf::Out<nn::am::service::LibraryAppletInfo,void>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 12, 'GetMainAppletIdentityInfo', '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>', '(nn::sf::Out<nn::am::service::AppletIdentityInfo,void>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 13, 'CanUseApplicationCore', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 14, 'GetCallerAppletIdentityInfo', '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>', '(nn::sf::Out<nn::am::service::AppletIdentityInfo,void>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 15, 'GetMainAppletApplicationControlProperty', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x4000>', '(nn::sf::Out<nn::ns::ApplicationControlProperty,void>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 16, 'GetMainAppletStorageId', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<nn::ncm::StorageId,void>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 17, 'GetCallerAppletIdentityInfoStack', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::am::service::AppletIdentityInfo> const&)'),
('nn::am::service::ILibraryAppletSelfAccessor', 20, 'PopExtraStorage', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 25, 'GetPopExtraStorageEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 30, 'UnpopInData', '0 bytes in - 0 bytes out - InObject<0,0>', '(nn::sf::SharedPointer<nn::am::service::IStorage>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 31, 'UnpopExtraStorage', '0 bytes in - 0 bytes out - InObject<0,0>', '(nn::sf::SharedPointer<nn::am::service::IStorage>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 40, 'GetIndirectLayerProducerHandle', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<unsigned long,void>)'),
('nn::am::service::ILibraryAppletSelfAccessor', 50, 'ReportVisibleError', '8 bytes in - 0 bytes out - InRaw<8,4,0>', '(nn::err::ErrorCode)'),
('nn::am::service::IOverlayAppletProxy', 0, 'GetCommonStateGetter', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ICommonStateGetter>,void>)'),
('nn::am::service::IOverlayAppletProxy', 1, 'GetSelfController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ISelfController>,void>)'),
('nn::am::service::IOverlayAppletProxy', 2, 'GetWindowController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IWindowController>,void>)'),
('nn::am::service::IOverlayAppletProxy', 3, 'GetAudioController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IAudioController>,void>)'),
('nn::am::service::IOverlayAppletProxy', 4, 'GetDisplayController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDisplayController>,void>)'),
('nn::am::service::IOverlayAppletProxy', 1000, 'GetDebugFunctions', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDebugFunctions>,void>)'),
('nn::am::service::IOverlayAppletProxy', 10, 'GetProcessWindingController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IProcessWindingController>,void>)'),
('nn::am::service::IOverlayAppletProxy', 11, 'GetLibraryAppletCreator', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletCreator>,void>)'),
('nn::am::service::IOverlayAppletProxy', 20, 'GetOverlayFunctions', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IOverlayFunctions>,void>)'),
('nn::am::service::IOverlayFunctions', 0, 'BeginToWatchShortHomeButtonMessage', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IOverlayFunctions', 1, 'EndToWatchShortHomeButtonMessage', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IOverlayFunctions', 2, 'GetApplicationIdForLogo', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::ncm::ApplicationId,void>)'),
('nn::am::service::IOverlayFunctions', 3, 'SetGpuTimeSliceBoost', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(unsigned long)'),
('nn::am::service::IOverlayFunctions', 4, 'SetAutoSleepTimeAndDimmingTimeEnabled', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::am::service::IOverlayFunctions', 5, 'TerminateApplicationAndSetReason', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(unsigned int)'),
('nn::am::service::IOverlayFunctions', 6, 'SetScreenShotPermissionGlobally', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::am::service::IApplicationProxy', 0, 'GetCommonStateGetter', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ICommonStateGetter>,void>)'),
('nn::am::service::IApplicationProxy', 1, 'GetSelfController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ISelfController>,void>)'),
('nn::am::service::IApplicationProxy', 2, 'GetWindowController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IWindowController>,void>)'),
('nn::am::service::IApplicationProxy', 3, 'GetAudioController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IAudioController>,void>)'),
('nn::am::service::IApplicationProxy', 4, 'GetDisplayController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDisplayController>,void>)'),
('nn::am::service::IApplicationProxy', 1000, 'GetDebugFunctions', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDebugFunctions>,void>)'),
('nn::am::service::IApplicationProxy', 10, 'GetProcessWindingController', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IProcessWindingController>,void>)'),
('nn::am::service::IApplicationProxy', 11, 'GetLibraryAppletCreator', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletCreator>,void>)'),
('nn::am::service::IApplicationProxy', 20, 'GetApplicationFunctions', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationFunctions>,void>)'),
('nn::am::service::IApplicationFunctions', 1, 'PopLaunchParameter', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>,unsigned int)'),
('nn::am::service::IApplicationFunctions', 10, 'CreateApplicationAndPushAndRequestToStart', '8 bytes in - 0 bytes out - InRaw<8,8,0>, InObject<0,0>', '(nn::ncm::ApplicationId,nn::sf::SharedPointer<nn::am::service::IStorage>)'),
('nn::am::service::IApplicationFunctions', 11, 'CreateApplicationAndPushAndRequestToStartForQuest', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InObject<0,0>, InRaw<4,4,0>, InRaw<4,4,4>', '(nn::ncm::ApplicationId,nn::sf::SharedPointer<nn::am::service::IStorage>,unsigned int,unsigned int)'),
('nn::am::service::IApplicationFunctions', 20, 'EnsureSaveData', '0x10 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<0x10,8,0>', '(nn::sf::Out<long,void>,nn::account::Uid const&)'),
('nn::am::service::IApplicationFunctions', 21, 'GetDesiredLanguage', '0 bytes in - 8 bytes out - OutRaw<8,1,0>', '(nn::sf::Out<nn::settings::LanguageCode,void>)'),
('nn::am::service::IApplicationFunctions', 22, 'SetTerminateResult', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(unsigned int)'),
('nn::am::service::IApplicationFunctions', 23, 'GetDisplayVersion', '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>', '(nn::sf::Out<nn::oe::DisplayVersion,void>)'),
('nn::am::service::IApplicationFunctions', 24, 'GetLaunchStorageInfoForDebug', '0 bytes in - 2 bytes out - OutRaw<1,1,0>, OutRaw<1,1,1>', '(nn::sf::Out<nn::ncm::StorageId,void>,nn::sf::Out<nn::ncm::StorageId,void>)'),
('nn::am::service::IApplicationFunctions', 25, 'ExtendSaveData', '0x28 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<1,1,0>, InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<8,8,0x20>', '(nn::sf::Out<long,void>,unsigned char,nn::account::Uid const&,long,long)'),
('nn::am::service::IApplicationFunctions', 26, 'GetSaveDataSize', '0x18 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>, InRaw<1,1,0>, InRaw<0x10,8,8>', '(nn::sf::Out<long,void>,nn::sf::Out<long,void>,unsigned char,nn::account::Uid const&)'),
('nn::am::service::IApplicationFunctions', 30, 'BeginBlockingHomeButtonShortAndLongPressed', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(long)'),
('nn::am::service::IApplicationFunctions', 31, 'EndBlockingHomeButtonShortAndLongPressed', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IApplicationFunctions', 32, 'BeginBlockingHomeButton', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(long)'),
('nn::am::service::IApplicationFunctions', 33, 'EndBlockingHomeButton', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IApplicationFunctions', 40, 'NotifyRunning', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::am::service::IApplicationFunctions', 50, 'GetPseudoDeviceId', '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>', '(nn::sf::Out<nn::util::Uuid,void>)'),
('nn::am::service::IApplicationFunctions', 60, 'SetMediaPlaybackStateForApplication', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::am::service::IApplicationFunctions', 65, 'IsGamePlayRecordingSupported', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::am::service::IApplicationFunctions', 66, 'InitializeGamePlayRecording', '8 bytes in - 0 bytes out - InHandle<0,1>, InRaw<8,8,0>', '(nn::sf::NativeHandle &&,unsigned long)'),
('nn::am::service::IApplicationFunctions', 67, 'SetGamePlayRecordingState', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::am::service::IApplicationFunctions', 70, 'RequestToShutdown', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IApplicationFunctions', 71, 'RequestToReboot', '0 bytes in - 0 bytes out', '(void)'),
('nn::am::service::IApplicationProxyService', 0, 'OpenApplicationProxy', '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>, InHandle<0,1>', '(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationProxy>,void>,unsigned long,nn::sf::NativeHandle &&)'),
('nn::apm::IManager', 0, 'OpenSession', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::apm::ISession>,void>)'),
('nn::apm::IManager', 1, 'GetPerformanceMode', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<nn::apm::PerformanceMode,void>)'),
('nn::apm::ISession', 0, 'SetPerformanceConfiguration', '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>', '(nn::apm::PerformanceMode,nn::apm::PerformanceConfiguration)'),
('nn::apm::ISession', 1, 'GetPerformanceConfiguration', '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::apm::PerformanceConfiguration,void>,nn::apm::PerformanceMode)'),
('nn::apm::ISystemManager', 0, 'RequestPerformanceMode', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::apm::PerformanceMode)'),
('nn::apm::ISystemManager', 1, 'GetPerformanceEvent', '4 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,nn::apm::EventTarget)'),
('nn::apm::ISystemManager', 2, 'GetThrottlingState', '0 bytes in - 0x28 bytes out - OutRaw<0x28,8,0>', '(nn::sf::Out<nn::apm::ThrottlingState,void>)'),
('nn::apm::ISystemManager', 3, 'GetLastThrottlingState', '0 bytes in - 0x28 bytes out - OutRaw<0x28,8,0>', '(nn::sf::Out<nn::apm::ThrottlingState,void>)'),
('nn::apm::ISystemManager', 4, 'ClearLastThrottlingState', '0 bytes in - 0 bytes out', '(void)'),
('nn::apm::IManagerPrivileged', 0, 'OpenSession', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::apm::ISession>,void>)'),
('nn::bcat::detail::ipc::IServiceCreator', 0, 'CreateBcatService', '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::bcat::detail::ipc::IBcatService>,void>,unsigned long)'),
('nn::bcat::detail::ipc::IServiceCreator', 1, 'CreateDeliveryCacheStorageService', '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::bcat::detail::ipc::IDeliveryCacheStorageService>,void>,unsigned long)'),
('nn::bcat::detail::ipc::IServiceCreator', 2, 'CreateDeliveryCacheStorageServiceWithApplicationId', '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::bcat::detail::ipc::IDeliveryCacheStorageService>,void>,nn::ApplicationId)'),
('nn::bcat::detail::ipc::IBcatService', 10100, 'RequestSyncDeliveryCache', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::bcat::detail::ipc::IDeliveryCacheProgressService>,void>)'),
('nn::bcat::detail::ipc::IBcatService', 20100, 'RequestSyncDeliveryCacheWithApplicationId', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,8>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::bcat::detail::ipc::IDeliveryCacheProgressService>,void>,nn::ApplicationId,unsigned int)'),
('nn::bcat::detail::ipc::IBcatService', 30100, 'SetPassphrase', '8 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,9,0>', '(nn::ApplicationId,nn::sf::InArray<char> const&)'),
('nn::bcat::detail::ipc::IBcatService', 30200, 'RegisterBackgroundDeliveryTask', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::ApplicationId,unsigned int)'),
('nn::bcat::detail::ipc::IBcatService', 30201, 'UnregisterBackgroundDeliveryTask', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::ApplicationId)'),
('nn::bcat::detail::ipc::IBcatService', 30202, 'BlockDeliveryTask', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::ApplicationId)'),
('nn::bcat::detail::ipc::IBcatService', 30203, 'UnblockDeliveryTask', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::ApplicationId)'),
('nn::bcat::detail::ipc::IBcatService', 90100, 'EnumerateBackgroundDeliveryTask', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::bcat::TaskInfo> const&)'),
('nn::bcat::detail::ipc::IBcatService', 90200, 'GetDeliveryList', '8 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>, InRaw<8,8,0>', '(nn::sf::Out<unsigned long,void>,nn::sf::OutBuffer const&,nn::ApplicationId)'),
('nn::bcat::detail::ipc::IBcatService', 90201, 'ClearDeliveryCacheStorage', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::ApplicationId)'),
('nn::bcat::detail::ipc::IBcatService', 90300, 'GetPushNotificationLog', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::bcat::PushNotificationLog> const&)'),
('nn::bcat::detail::ipc::IDeliveryCacheProgressService', 0, 'GetEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::bcat::detail::ipc::IDeliveryCacheProgressService', 1, 'GetImpl', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x200>', '(nn::sf::Out<nn::bcat::detail::DeliveryCacheProgressImpl,void>)'),
('nn::bcat::detail::ipc::IDeliveryCacheStorageService', 0, 'CreateFileService', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::bcat::detail::ipc::IDeliveryCacheFileService>,void>)'),
('nn::bcat::detail::ipc::IDeliveryCacheStorageService', 1, 'CreateDirectoryService', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::bcat::detail::ipc::IDeliveryCacheDirectoryService>,void>)'),
('nn::bcat::detail::ipc::IDeliveryCacheStorageService', 10, 'EnumerateDeliveryCacheDirectory', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::bcat::DirectoryName> const&)'),
('nn::bcat::detail::ipc::IDeliveryCacheFileService', 0, 'Open', '0x40 bytes in - 0 bytes out - InRaw<0x20,1,0>, InRaw<0x20,1,0x20>', '(nn::bcat::DirectoryName const&,nn::bcat::FileName const&)'),
('nn::bcat::detail::ipc::IDeliveryCacheFileService', 1, 'Read', '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned long,void>,long,nn::sf::OutBuffer const&)'),
('nn::bcat::detail::ipc::IDeliveryCacheFileService', 2, 'GetSize', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<long,void>)'),
('nn::bcat::detail::ipc::IDeliveryCacheFileService', 3, 'GetDigest', '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>', '(nn::sf::Out<nn::bcat::Digest,void>)'),
('nn::bcat::detail::ipc::IDeliveryCacheDirectoryService', 0, 'Open', '0x20 bytes in - 0 bytes out - InRaw<0x20,1,0>', '(nn::bcat::DirectoryName const&)'),
('nn::bcat::detail::ipc::IDeliveryCacheDirectoryService', 1, 'Read', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::bcat::DeliveryCacheDirectoryEntry> const&)'),
('nn::bcat::detail::ipc::IDeliveryCacheDirectoryService', 2, 'GetCount', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::codec::detail::IHardwareOpusDecoderManager', 0, '', '0xC bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,4,0>, InHandle<0,1>, InRaw<4,4,8>', ''),
('nn::codec::detail::IHardwareOpusDecoderManager', 1, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>', ''),
('nn::codec::detail::IHardwareOpusDecoderManager', 2, '', '4 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x110>, InHandle<0,1>, InRaw<4,4,0>', ''),
('nn::codec::detail::IHardwareOpusDecoderManager', 3, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0x19,0x110>', ''),
('nn::codec::detail::IHardwareOpusDecoder', 0, '', '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<0,6,0>, Buffer<1,5,0>', ''),
('nn::codec::detail::IHardwareOpusDecoder', 1, '', '0 bytes in - 0 bytes out - Buffer<0,5,0>', ''),
('nn::codec::detail::IHardwareOpusDecoder', 2, '', '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<0,6,0>, Buffer<1,5,0>', ''),
('nn::codec::detail::IHardwareOpusDecoder', 3, '', '0 bytes in - 0 bytes out - Buffer<0,5,0>', ''),
('nn::friends::detail::ipc::IServiceCreator', 0, 'CreateFriendService', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::friends::detail::ipc::IFriendService>,void>)'),
('nn::friends::detail::ipc::IServiceCreator', 1, 'CreateNotificationService', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::friends::detail::ipc::INotificationService>,void>,nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 0, 'GetCompletionEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::friends::detail::ipc::IFriendService', 1, 'Cancel', '0 bytes in - 0 bytes out', '(void)'),
('nn::friends::detail::ipc::IFriendService', 10100, 'GetFriendListIds', '0x30 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, Buffer<0,0xA,0>, InRaw<0x10,8,8>, InRaw<4,4,0>, InRaw<0x10,8,0x18>, InRaw<8,8,0x28>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::account::NetworkServiceAccountId> const&,nn::account::Uid const&,int,nn::friends::detail::ipc::SizedFriendFilter const&,unsigned long)'),
('nn::friends::detail::ipc::IFriendService', 10101, 'GetFriendList', '0x30 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,8>, InRaw<4,4,0>, InRaw<0x10,8,0x18>, InRaw<8,8,0x28>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::friends::detail::FriendImpl> const&,nn::account::Uid const&,int,nn::friends::detail::ipc::SizedFriendFilter const&,unsigned long)'),
('nn::friends::detail::ipc::IFriendService', 10102, 'UpdateFriendInfo', '0x18 bytes in - 0 bytes out - takes pid - Buffer<0,6,0>, InRaw<0x10,8,0>, Buffer<1,9,0>, InRaw<8,8,0x10>', '(nn::sf::OutArray<nn::friends::detail::FriendImpl> const&,nn::account::Uid const&,nn::sf::InArray<nn::account::NetworkServiceAccountId> const&,unsigned long)'),
('nn::friends::detail::ipc::IFriendService', 10110, 'GetFriendProfileImage', '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<0x10,8,0>, InRaw<8,8,0x10>, Buffer<0,6,0>', '(nn::sf::Out<int,void>,nn::account::Uid const&,nn::account::NetworkServiceAccountId,nn::sf::OutBuffer const&)'),
('nn::friends::detail::ipc::IFriendService', 10200, 'SendFriendRequestForApplication', '0x20 bytes in - 0 bytes out - takes pid - InRaw<0x10,8,0>, InRaw<8,8,0x10>, Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>, InRaw<8,8,0x18>', '(nn::account::Uid const&,nn::account::NetworkServiceAccountId,nn::friends::InAppScreenName const&,nn::friends::InAppScreenName const&,unsigned long)'),
('nn::friends::detail::ipc::IFriendService', 10211, 'AddFacedFriendRequestForApplication', '0x80 bytes in - 0 bytes out - takes pid - InRaw<0x10,8,0x68>, InRaw<0x40,1,0>, InRaw<0x21,1,0x40>, Buffer<2,5,0>, Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>, InRaw<8,8,0x78>', '(nn::account::Uid const&,nn::friends::FacedFriendRequestRegistrationKey const&,nn::account::Nickname const&,nn::sf::InBuffer const&,nn::friends::InAppScreenName const&,nn::friends::InAppScreenName const&,unsigned long)'),
('nn::friends::detail::ipc::IFriendService', 10400, 'GetBlockedUserListIds', '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>, InRaw<0x10,8,8>, InRaw<4,4,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::account::NetworkServiceAccountId> const&,nn::account::Uid const&,int)'),
('nn::friends::detail::ipc::IFriendService', 10500, 'GetProfileList', '0x10 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<0x10,8,0>, Buffer<1,9,0>', '(nn::sf::OutArray<nn::friends::detail::ProfileImpl> const&,nn::account::Uid const&,nn::sf::InArray<nn::account::NetworkServiceAccountId> const&)'),
('nn::friends::detail::ipc::IFriendService', 10600, 'DeclareOpenOnlinePlaySession', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 10601, 'DeclareCloseOnlinePlaySession', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 10610, 'UpdateUserPresence', '0x18 bytes in - 0 bytes out - takes pid - InRaw<0x10,8,0>, Buffer<0,0x19,0xE0>, InRaw<8,8,0x10>', '(nn::account::Uid const&,nn::friends::detail::UserPresenceImpl const&,unsigned long)'),
('nn::friends::detail::ipc::IFriendService', 10700, 'GetPlayHistoryRegistrationKey', '0x18 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<0x10,8,8>, InRaw<1,1,0>', '(nn::sf::Out<nn::friends::PlayHistoryRegistrationKey,void>,nn::account::Uid const&,bool)'),
('nn::friends::detail::ipc::IFriendService', 10701, 'GetPlayHistoryRegistrationKeyWithNetworkServiceAccountId', '0x10 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,8,8>, InRaw<1,1,0>', '(nn::sf::Out<nn::friends::PlayHistoryRegistrationKey,void>,nn::account::NetworkServiceAccountId,bool)'),
('nn::friends::detail::ipc::IFriendService', 10702, 'AddPlayHistory', '0x18 bytes in - 0 bytes out - takes pid - InRaw<0x10,8,0>, Buffer<0,0x19,0x40>, Buffer<1,0x19,0x48>, Buffer<2,0x19,0x48>, InRaw<8,8,0x10>', '(nn::account::Uid const&,nn::friends::PlayHistoryRegistrationKey const&,nn::friends::InAppScreenName const&,nn::friends::InAppScreenName const&,unsigned long)'),
('nn::friends::detail::ipc::IFriendService', 11000, 'GetProfileImageUrl', '0xA4 bytes in - 0xA0 bytes out - OutRaw<0xA0,1,0>, InRaw<0xA0,1,0>, InRaw<4,4,0xA0>', '(nn::sf::Out<nn::friends::Url,void>,nn::friends::Url const&,int)'),
('nn::friends::detail::ipc::IFriendService', 20100, 'GetFriendCount', '0x28 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, InRaw<0x10,8,0>, InRaw<0x10,8,0x10>, InRaw<8,8,0x20>', '(nn::sf::Out<int,void>,nn::account::Uid const&,nn::friends::detail::ipc::SizedFriendFilter const&,unsigned long)'),
('nn::friends::detail::ipc::IFriendService', 20101, 'GetNewlyFriendCount', '0x10 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<0x10,8,0>', '(nn::sf::Out<int,void>,nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 20102, 'GetFriendDetailedInfo', '0x18 bytes in - 0 bytes out - Buffer<0,0x1A,0x800>, InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::sf::Out<nn::friends::detail::FriendDetailedInfoImpl,void>,nn::account::Uid const&,nn::account::NetworkServiceAccountId)'),
('nn::friends::detail::ipc::IFriendService', 20103, 'SyncFriendList', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 20104, 'RequestSyncFriendList', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 20110, 'LoadFriendSetting', '0x18 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::sf::Out<nn::friends::detail::FriendSettingImpl,void>,nn::account::Uid const&,nn::account::NetworkServiceAccountId)'),
('nn::friends::detail::ipc::IFriendService', 20200, 'GetReceivedFriendRequestCount', '0x10 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<0x10,8,0>', '(nn::sf::Out<int,void>,nn::sf::Out<int,void>,nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 20201, 'GetFriendRequestList', '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,8>, InRaw<4,4,0>, InRaw<4,4,4>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::friends::detail::FriendRequestImpl> const&,nn::account::Uid const&,int,int)'),
('nn::friends::detail::ipc::IFriendService', 20300, 'GetFriendCandidateList', '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,8>, InRaw<4,4,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::friends::detail::FriendCandidateImpl> const&,nn::account::Uid const&,int)'),
('nn::friends::detail::ipc::IFriendService', 20301, 'GetNintendoNetworkIdInfo', '0x18 bytes in - 4 bytes out - Buffer<0,0x1A,0x38>, OutRaw<4,4,0>, Buffer<1,6,0>, InRaw<0x10,8,8>, InRaw<4,4,0>', '(nn::sf::Out<nn::friends::NintendoNetworkIdUserInfo,void>,nn::sf::Out<int,void>,nn::sf::OutArray<nn::friends::detail::NintendoNetworkIdFriendImpl> const&,nn::account::Uid const&,int)'),
('nn::friends::detail::ipc::IFriendService', 20400, 'GetBlockedUserList', '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,8>, InRaw<4,4,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::friends::detail::BlockedUserImpl> const&,nn::account::Uid const&,int)'),
('nn::friends::detail::ipc::IFriendService', 20401, 'SyncBlockedUserList', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 20500, 'GetProfileExtraList', '0x10 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<0x10,8,0>, Buffer<1,9,0>', '(nn::sf::OutArray<nn::friends::detail::ProfileExtraImpl> const&,nn::account::Uid const&,nn::sf::InArray<nn::account::NetworkServiceAccountId> const&)'),
('nn::friends::detail::ipc::IFriendService', 20501, 'GetRelationship', '0x18 bytes in - 8 bytes out - OutRaw<8,1,0>, InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::sf::Out<nn::friends::Relationship,void>,nn::account::Uid const&,nn::account::NetworkServiceAccountId)'),
('nn::friends::detail::ipc::IFriendService', 20600, 'GetUserPresenceView', '0x10 bytes in - 0 bytes out - Buffer<0,0x1A,0xE0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::friends::detail::UserPresenceViewImpl,void>,nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 20700, 'GetPlayHistoryList', '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,8>, InRaw<4,4,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::friends::detail::PlayHistoryImpl> const&,nn::account::Uid const&,int)'),
('nn::friends::detail::ipc::IFriendService', 20701, 'GetPlayHistoryStatistics', '0x10 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::friends::PlayHistoryStatistics,void>,nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 20800, 'LoadUserSetting', '0x10 bytes in - 0 bytes out - Buffer<0,0x1A,0x800>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::friends::detail::UserSettingImpl,void>,nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 20801, 'SyncUserSetting', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 20900, 'RequestListSummaryOverlayNotification', '0 bytes in - 0 bytes out', '(void)'),
('nn::friends::detail::ipc::IFriendService', 21000, 'GetExternalApplicationCatalog', '0x18 bytes in - 0 bytes out - Buffer<0,0x1A,0x4B8>, InRaw<0x10,8,8>, InRaw<8,1,0>', '(nn::sf::Out<nn::friends::ExternalApplicationCatalog,void>,nn::friends::ExternalApplicationCatalogId const&,nn::settings::LanguageCode)'),
('nn::friends::detail::ipc::IFriendService', 30100, 'DropFriendNewlyFlags', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 30101, 'DeleteFriend', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::account::Uid const&,nn::account::NetworkServiceAccountId)'),
('nn::friends::detail::ipc::IFriendService', 30110, 'DropFriendNewlyFlag', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::account::Uid const&,nn::account::NetworkServiceAccountId)'),
('nn::friends::detail::ipc::IFriendService', 30120, 'ChangeFriendFavoriteFlag', '0x20 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<1,1,0>', '(nn::account::Uid const&,nn::account::NetworkServiceAccountId,bool)'),
('nn::friends::detail::ipc::IFriendService', 30121, 'ChangeFriendOnlineNotificationFlag', '0x20 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<1,1,0>', '(nn::account::Uid const&,nn::account::NetworkServiceAccountId,bool)'),
('nn::friends::detail::ipc::IFriendService', 30200, 'SendFriendRequest', '0x20 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<4,4,0>', '(nn::account::Uid const&,nn::account::NetworkServiceAccountId,int)'),
('nn::friends::detail::ipc::IFriendService', 30201, 'SendFriendRequestWithApplicationInfo', '0x30 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<4,4,0>, InRaw<0x10,8,0x20>, Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>', '(nn::account::Uid const&,nn::account::NetworkServiceAccountId,int,nn::friends::ApplicationInfo const&,nn::friends::InAppScreenName const&,nn::friends::InAppScreenName const&)'),
('nn::friends::detail::ipc::IFriendService', 30202, 'CancelFriendRequest', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::account::Uid const&,nn::friends::RequestId)'),
('nn::friends::detail::ipc::IFriendService', 30203, 'AcceptFriendRequest', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::account::Uid const&,nn::friends::RequestId)'),
('nn::friends::detail::ipc::IFriendService', 30204, 'RejectFriendRequest', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::account::Uid const&,nn::friends::RequestId)'),
('nn::friends::detail::ipc::IFriendService', 30205, 'ReadFriendRequest', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::account::Uid const&,nn::friends::RequestId)'),
('nn::friends::detail::ipc::IFriendService', 30210, 'GetFacedFriendRequestRegistrationKey', '0x10 bytes in - 0x40 bytes out - OutRaw<0x40,1,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::friends::FacedFriendRequestRegistrationKey,void>,nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 30211, 'AddFacedFriendRequest', '0x78 bytes in - 0 bytes out - InRaw<0x10,8,0x68>, InRaw<0x40,1,0>, InRaw<0x21,1,0x40>, Buffer<0,5,0>', '(nn::account::Uid const&,nn::friends::FacedFriendRequestRegistrationKey const&,nn::account::Nickname const&,nn::sf::InBuffer const&)'),
('nn::friends::detail::ipc::IFriendService', 30212, 'CancelFacedFriendRequest', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::account::Uid const&,nn::account::NetworkServiceAccountId)'),
('nn::friends::detail::ipc::IFriendService', 30213, 'GetFacedFriendRequestProfileImage', '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<0x10,8,0>, InRaw<8,8,0x10>, Buffer<0,6,0>', '(nn::sf::Out<int,void>,nn::account::Uid const&,nn::account::NetworkServiceAccountId,nn::sf::OutBuffer const&)'),
('nn::friends::detail::ipc::IFriendService', 30214, 'GetFacedFriendRequestProfileImageFromPath', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,9,0>, Buffer<1,6,0>', '(nn::sf::Out<int,void>,nn::sf::InArray<char> const&,nn::sf::OutBuffer const&)'),
('nn::friends::detail::ipc::IFriendService', 30215, 'SendFriendRequestWithExternalApplicationCatalogId', '0x30 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<4,4,0>, InRaw<0x10,8,0x20>, Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>', '(nn::account::Uid const&,nn::account::NetworkServiceAccountId,int,nn::friends::ExternalApplicationCatalogId const&,nn::friends::InAppScreenName const&,nn::friends::InAppScreenName const&)'),
('nn::friends::detail::ipc::IFriendService', 30216, 'ResendFacedFriendRequest', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::account::Uid const&,nn::account::NetworkServiceAccountId)'),
('nn::friends::detail::ipc::IFriendService', 30217, 'SendFriendRequestWithNintendoNetworkIdInfo', '0x80 bytes in - 0 bytes out - InRaw<0x10,8,0x68>, InRaw<8,8,0x78>, InRaw<4,4,0x60>, InRaw<0x20,1,0>, InRaw<0x10,1,0x20>, InRaw<0x20,1,0x30>, InRaw<0x10,1,0x50>', '(nn::account::Uid const&,nn::account::NetworkServiceAccountId,int,nn::friends::MiiName const&,nn::friends::MiiImageUrlParam const&,nn::friends::MiiName const&,nn::friends::MiiImageUrlParam const&)'),
('nn::friends::detail::ipc::IFriendService', 30400, 'BlockUser', '0x20 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<4,4,0>', '(nn::account::Uid const&,nn::account::NetworkServiceAccountId,int)'),
('nn::friends::detail::ipc::IFriendService', 30401, 'BlockUserWithApplicationInfo', '0x30 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<4,4,0>, InRaw<0x10,8,0x20>, Buffer<0,0x19,0x48>', '(nn::account::Uid const&,nn::account::NetworkServiceAccountId,int,nn::friends::ApplicationInfo const&,nn::friends::InAppScreenName const&)'),
('nn::friends::detail::ipc::IFriendService', 30402, 'UnblockUser', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>', '(nn::account::Uid const&,nn::account::NetworkServiceAccountId)'),
('nn::friends::detail::ipc::IFriendService', 30500, 'GetProfileExtraFromFriendCode', '0x30 bytes in - 0 bytes out - Buffer<0,0x1A,0x400>, InRaw<0x10,8,0x20>, InRaw<0x20,1,0>', '(nn::sf::Out<nn::friends::detail::ProfileExtraImpl,void>,nn::account::Uid const&,nn::friends::FriendCode const&)'),
('nn::friends::detail::ipc::IFriendService', 30700, 'DeletePlayHistory', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 30810, 'ChangePresencePermission', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<4,4,0>', '(nn::account::Uid const&,int)'),
('nn::friends::detail::ipc::IFriendService', 30811, 'ChangeFriendRequestReception', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<1,1,0>', '(nn::account::Uid const&,bool)'),
('nn::friends::detail::ipc::IFriendService', 30812, 'ChangePlayLogPermission', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<4,4,0>', '(nn::account::Uid const&,int)'),
('nn::friends::detail::ipc::IFriendService', 30820, 'IssueFriendCode', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 30830, 'ClearPlayLog', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::friends::detail::ipc::IFriendService', 49900, 'DeleteNetworkServiceAccountCache', '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>', '(nn::account::Uid const&)'),
('nn::friends::detail::ipc::INotificationService', 0, 'GetEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::friends::detail::ipc::INotificationService', 1, 'Clear', '0 bytes in - 0 bytes out', '(void)'),
('nn::friends::detail::ipc::INotificationService', 2, 'Pop', '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>', '(nn::sf::Out<nn::friends::detail::ipc::SizedNotificationInfo,void>)'),
('nn::tma::IHtcsManager', 0, '', '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>', ''),
('nn::tma::IHtcsManager', 1, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>', ''),
('nn::tma::IHtcsManager', 2, '', '0x48 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0x44>, InRaw<0x42,2,0>', ''),
('nn::tma::IHtcsManager', 3, '', '0x48 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0x44>, InRaw<0x42,2,0>', ''),
('nn::tma::IHtcsManager', 4, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::tma::IHtcsManager', 5, '', '4 bytes in - 0x4C bytes out - OutRaw<4,4,0x44>, OutRaw<4,4,0x48>, OutRaw<0x42,2,0>, InRaw<4,4,0>', ''),
('nn::tma::IHtcsManager', 6, '', '8 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, Buffer<0,6,0>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::tma::IHtcsManager', 7, '', '8 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, InRaw<4,4,0>, Buffer<0,5,0>, InRaw<4,4,4>', ''),
('nn::tma::IHtcsManager', 8, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::tma::IHtcsManager', 9, '', '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>', ''),
('nn::tma::IHtcsManager', 10, '', '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>', ''),
('nn::tma::IHtcsManager', 11, '', '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>', ''),
('nn::tma::IHtcsManager', 12, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, OutObject<0,0>', ''),
('nn::tma::IHtcsManager', 13, '', '1 bytes in - 4 bytes out - OutRaw<4,4,0>, OutObject<0,0>, InRaw<1,1,0>', ''),
('nn::tma::IHtcsManager', 100, '', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', ''),
('nn::tma::IHtcsManager', 101, '', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', ''),
('nn::tma::ISocket', 0, '', '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>', ''),
('nn::tma::ISocket', 1, '', '0x42 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<0x42,2,0>', ''),
('nn::tma::ISocket', 2, '', '0x42 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<0x42,2,0>', ''),
('nn::tma::ISocket', 3, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 4, '', '0 bytes in - 0x48 bytes out - OutRaw<4,4,0x44>, OutObject<0,0>, OutRaw<0x42,2,0>', ''),
('nn::tma::ISocket', 5, '', '4 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, Buffer<0,0x22,0>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 6, '', '4 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, Buffer<0,0x21,0>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 7, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 8, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::tma::ISocket', 9, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, OutHandle<0,1>', ''),
('nn::tma::ISocket', 10, '', '4 bytes in - 0x48 bytes out - OutRaw<4,4,0x44>, OutObject<0,0>, OutRaw<0x42,2,0>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 11, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, OutHandle<0,1>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::tma::ISocket', 12, '', '4 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, Buffer<0,0x22,0>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 13, '', '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, OutHandle<0,1>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<8,8,0x10>, InHandle<0,1>, InRaw<4,4,8>', ''),
('nn::tma::ISocket', 14, '', '4 bytes in - 4 bytes out - OutRaw<4,4,0>, OutHandle<0,1>, Buffer<0,0x21,0>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 15, '', '0x10 bytes in - 4 bytes out - OutRaw<4,4,0>, OutHandle<0,1>, Buffer<0,0x21,0>, Buffer<1,0x21,0>, InHandle<0,1>, InRaw<8,8,8>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 16, '', '4 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, InRaw<4,4,0>', ''),
('nn::tma::IHtcsManager', 0, '', '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>', ''),
('nn::tma::IHtcsManager', 1, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>', ''),
('nn::tma::IHtcsManager', 2, '', '0x48 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0x44>, InRaw<0x42,2,0>', ''),
('nn::tma::IHtcsManager', 3, '', '0x48 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0x44>, InRaw<0x42,2,0>', ''),
('nn::tma::IHtcsManager', 4, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::tma::IHtcsManager', 5, '', '4 bytes in - 0x4C bytes out - OutRaw<4,4,0x44>, OutRaw<4,4,0x48>, OutRaw<0x42,2,0>, InRaw<4,4,0>', ''),
('nn::tma::IHtcsManager', 6, '', '8 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, Buffer<0,6,0>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::tma::IHtcsManager', 7, '', '8 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, InRaw<4,4,0>, Buffer<0,5,0>, InRaw<4,4,4>', ''),
('nn::tma::IHtcsManager', 8, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::tma::IHtcsManager', 9, '', '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>', ''),
('nn::tma::IHtcsManager', 10, '', '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>', ''),
('nn::tma::IHtcsManager', 11, '', '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>', ''),
('nn::tma::IHtcsManager', 12, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, OutObject<0,0>', ''),
('nn::tma::IHtcsManager', 13, '', '1 bytes in - 4 bytes out - OutRaw<4,4,0>, OutObject<0,0>, InRaw<1,1,0>', ''),
('nn::tma::IHtcsManager', 100, '', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', ''),
('nn::tma::IHtcsManager', 101, '', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', ''),
('nn::tma::ISocket', 0, '', '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>', ''),
('nn::tma::ISocket', 1, '', '0x42 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<0x42,2,0>', ''),
('nn::tma::ISocket', 2, '', '0x42 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<0x42,2,0>', ''),
('nn::tma::ISocket', 3, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 4, '', '0 bytes in - 0x48 bytes out - OutRaw<4,4,0x44>, OutObject<0,0>, OutRaw<0x42,2,0>', ''),
('nn::tma::ISocket', 5, '', '4 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, Buffer<0,0x22,0>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 6, '', '4 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, Buffer<0,0x21,0>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 7, '', '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 8, '', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::tma::ISocket', 9, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, OutHandle<0,1>', ''),
('nn::tma::ISocket', 10, '', '4 bytes in - 0x48 bytes out - OutRaw<4,4,0x44>, OutObject<0,0>, OutRaw<0x42,2,0>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 11, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, OutHandle<0,1>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::tma::ISocket', 12, '', '4 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, Buffer<0,0x22,0>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 13, '', '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, OutHandle<0,1>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<8,8,0x10>, InHandle<0,1>, InRaw<4,4,8>', ''),
('nn::tma::ISocket', 14, '', '4 bytes in - 4 bytes out - OutRaw<4,4,0>, OutHandle<0,1>, Buffer<0,0x21,0>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 15, '', '0x10 bytes in - 4 bytes out - OutRaw<4,4,0>, OutHandle<0,1>, Buffer<0,0x21,0>, Buffer<1,0x21,0>, InHandle<0,1>, InRaw<8,8,8>, InRaw<4,4,0>', ''),
('nn::tma::ISocket', 16, '', '4 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, InRaw<4,4,0>', ''),
('nn::lm::ILogService', 0, '', '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>', ''),
('nn::lm::ILogger', 0, '', '0 bytes in - 0 bytes out - Buffer<0,0x21,0>', ''),
('nn::lm::ILogger', 1, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>', ''),
('nn::nfc::detail::ISystemManager', 0, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::nfc::detail::ISystem', 0, '', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,5,0>', ''),
('nn::nfc::detail::ISystem', 1, '', '0 bytes in - 0 bytes out', ''),
('nn::nfc::detail::ISystem', 2, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::nfc::detail::ISystem', 3, '', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', ''),
('nn::nfc::detail::ISystem', 100, '', '1 bytes in - 0 bytes out - InRaw<1,1,0>', ''),
('nn::nfc::detail::IUserManager', 0, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::nfc::detail::IUser', 0, '', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,5,0>', ''),
('nn::nfc::detail::IUser', 1, '', '0 bytes in - 0 bytes out', ''),
('nn::nfc::detail::IUser', 2, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::nfc::detail::IUser', 3, '', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', ''),
('nn::nfc::mifare::detail::IUserManager', 0, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::nfc::mifare::detail::IUser', 0, '', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,5,0>', ''),
('nn::nfc::mifare::detail::IUser', 1, '', '0 bytes in - 0 bytes out', ''),
('nn::nfc::mifare::detail::IUser', 2, '', '0 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>', ''),
('nn::nfc::mifare::detail::IUser', 3, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfc::mifare::detail::IUser', 4, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfc::mifare::detail::IUser', 5, '', '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,4,0>, Buffer<1,5,0>', ''),
('nn::nfc::mifare::detail::IUser', 6, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>, Buffer<0,5,0>', ''),
('nn::nfc::mifare::detail::IUser', 7, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x58>, InRaw<8,4,0>', ''),
('nn::nfc::mifare::detail::IUser', 8, '', '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>', ''),
('nn::nfc::mifare::detail::IUser', 9, '', '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>', ''),
('nn::nfc::mifare::detail::IUser', 10, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::nfc::mifare::detail::IUser', 11, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>', ''),
('nn::nfc::mifare::detail::IUser', 12, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>', ''),
('nn::nfc::mifare::detail::IUser', 13, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::nfp::detail::IDebugManager', 0, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::nfp::detail::IDebug', 0, '', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,5,0>', ''),
('nn::nfp::detail::IDebug', 1, '', '0 bytes in - 0 bytes out', ''),
('nn::nfp::detail::IDebug', 2, '', '0 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>', ''),
('nn::nfp::detail::IDebug', 3, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 4, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 5, '', '0x10 bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>, InRaw<4,4,0xC>', ''),
('nn::nfp::detail::IDebug', 6, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 7, '', '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>', ''),
('nn::nfp::detail::IDebug', 8, '', '8 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 9, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>, Buffer<0,5,0>', ''),
('nn::nfp::detail::IDebug', 10, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 11, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 12, '', '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>, Buffer<0,5,0>', ''),
('nn::nfp::detail::IDebug', 13, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x58>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 14, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 15, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 16, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 17, '', '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 18, '', '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 19, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::nfp::detail::IDebug', 20, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 21, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 22, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 23, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::nfp::detail::IDebug', 24, '', '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>, Buffer<0,5,0>', ''),
('nn::nfp::detail::IDebug', 100, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 101, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 102, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 103, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>, Buffer<0,0x19,0x100>', ''),
('nn::nfp::detail::IDebug', 104, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 105, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 106, '', '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 200, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x298>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 201, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>, Buffer<0,0x19,0x298>', ''),
('nn::nfp::detail::IDebug', 202, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 203, '', '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>', ''),
('nn::nfp::detail::IDebug', 204, '', '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>', ''),
('nn::nfp::detail::IDebug', 205, '', '0 bytes in - 0 bytes out - Buffer<0,5,0>', ''),
('nn::nfp::detail::IDebug', 206, '', '0xC bytes in - 0 bytes out - InRaw<8,4,0>, Buffer<0,5,0>, InRaw<4,4,8>', ''),
('nn::nfp::detail::IDebug', 300, '', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,5,0>', ''),
('nn::nfp::detail::IDebug', 301, '', '0 bytes in - 0 bytes out', ''),
('nn::nfp::detail::IDebug', 302, '', '0 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>', ''),
('nn::nfp::detail::IDebug', 303, '', '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>', ''),
('nn::nfp::detail::IDebug', 304, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 305, '', '0x10 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, InRaw<8,4,0>, Buffer<1,5,0>, InRaw<8,8,8>', ''),
('nn::nfp::detail::IDebug', 306, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x58>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 307, '', '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 308, '', '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 309, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::nfp::detail::IDebug', 310, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 311, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 312, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 313, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IDebug', 314, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::nfp::detail::ISystemManager', 0, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::nfp::detail::ISystem', 0, '', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,5,0>', ''),
('nn::nfp::detail::ISystem', 1, '', '0 bytes in - 0 bytes out', ''),
('nn::nfp::detail::ISystem', 2, '', '0 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>', ''),
('nn::nfp::detail::ISystem', 3, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 4, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 5, '', '0x10 bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>, InRaw<4,4,0xC>', ''),
('nn::nfp::detail::ISystem', 6, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 10, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 11, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 13, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x58>, InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 14, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>, InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 15, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 16, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 17, '', '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 18, '', '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 19, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::nfp::detail::ISystem', 20, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 21, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 23, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::nfp::detail::ISystem', 100, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 101, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 102, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>, InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 103, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>, Buffer<0,0x19,0x100>', ''),
('nn::nfp::detail::ISystem', 104, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 105, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::ISystem', 106, '', '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IUserManager', 0, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::nfp::detail::IUser', 0, '', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,5,0>', ''),
('nn::nfp::detail::IUser', 1, '', '0 bytes in - 0 bytes out', ''),
('nn::nfp::detail::IUser', 2, '', '0 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>', ''),
('nn::nfp::detail::IUser', 3, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IUser', 4, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IUser', 5, '', '0x10 bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>, InRaw<4,4,0xC>', ''),
('nn::nfp::detail::IUser', 6, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IUser', 7, '', '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>', ''),
('nn::nfp::detail::IUser', 8, '', '8 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IUser', 9, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>, Buffer<0,5,0>', ''),
('nn::nfp::detail::IUser', 10, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IUser', 11, '', '8 bytes in - 0 bytes out - InRaw<8,4,0>', ''),
('nn::nfp::detail::IUser', 12, '', '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>, Buffer<0,5,0>', ''),
('nn::nfp::detail::IUser', 13, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x58>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IUser', 14, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IUser', 15, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IUser', 16, '', '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IUser', 17, '', '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IUser', 18, '', '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IUser', 19, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::nfp::detail::IUser', 20, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IUser', 21, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IUser', 22, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>', ''),
('nn::nfp::detail::IUser', 23, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::nfp::detail::IUser', 24, '', '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>, Buffer<0,5,0>', ''),
('nn::nifm::detail::IStaticService', 4, 'CreateGeneralServiceOld', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::nifm::detail::IGeneralService>,void>)'),
('nn::nifm::detail::IStaticService', 5, 'CreateGeneralService', '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::nifm::detail::IGeneralService>,void>,unsigned long)'),
('nn::nifm::detail::IGeneralService', 1, 'GetClientId', '0 bytes in - 0 bytes out - Buffer<0,0x1A,4>', '(nn::sf::Out<nn::nifm::ClientId,void>)'),
('nn::nifm::detail::IGeneralService', 2, 'CreateScanRequest', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::nifm::detail::IScanRequest>,void>)'),
('nn::nifm::detail::IGeneralService', 4, 'CreateRequest', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::nifm::detail::IRequest>,void>,int)'),
('nn::nifm::detail::IGeneralService', 5, 'GetCurrentNetworkProfile', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x17C>', '(nn::sf::Out<nn::nifm::detail::sf::NetworkProfileData,void>)'),
('nn::nifm::detail::IGeneralService', 6, 'EnumerateNetworkInterfaces', '4 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>, InRaw<4,4,0>', '(nn::sf::OutArray<nn::nifm::detail::sf::NetworkInterfaceInfo> const&,nn::sf::Out<int,void>,unsigned int)'),
('nn::nifm::detail::IGeneralService', 7, 'EnumerateNetworkProfiles', '1 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, InRaw<1,1,0>', '(nn::sf::OutArray<nn::nifm::detail::sf::NetworkProfileBasicInfo> const&,nn::sf::Out<int,void>,unsigned char)'),
('nn::nifm::detail::IGeneralService', 8, 'GetNetworkProfile', '0x10 bytes in - 0 bytes out - Buffer<0,0x1A,0x17C>, InRaw<0x10,1,0>', '(nn::sf::Out<nn::nifm::detail::sf::NetworkProfileData,void>,nn::util::Uuid const&)'),
('nn::nifm::detail::IGeneralService', 9, 'SetNetworkProfile', '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, Buffer<0,0x19,0x17C>', '(nn::sf::Out<nn::util::Uuid,void>,nn::nifm::detail::sf::NetworkProfileData const&)'),
('nn::nifm::detail::IGeneralService', 10, 'RemoveNetworkProfile', '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>', '(nn::util::Uuid const&)'),
('nn::nifm::detail::IGeneralService', 11, 'GetScanData', '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>', '(nn::sf::OutArray<nn::nifm::detail::sf::AccessPointData> const&,nn::sf::Out<int,void>)'),
('nn::nifm::detail::IGeneralService', 12, 'GetCurrentIpAddress', '0 bytes in - 4 bytes out - OutRaw<4,1,0>', '(nn::sf::Out<nn::nifm::IpV4Address,void>)'),
('nn::nifm::detail::IGeneralService', 13, 'GetCurrentAccessPoint', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x34>', '(nn::sf::Out<nn::nifm::detail::sf::AccessPointData,void>)'),
('nn::nifm::detail::IGeneralService', 14, 'CreateTemporaryNetworkProfile', '0 bytes in - 0x10 bytes out - OutObject<0,0>, OutRaw<0x10,1,0>, Buffer<0,0x19,0x17C>', '(nn::sf::Out<nn::sf::SharedPointer<nn::nifm::detail::INetworkProfile>,void>,nn::sf::Out<nn::util::Uuid,void>,nn::nifm::detail::sf::NetworkProfileData const&)'),
('nn::nifm::detail::IGeneralService', 15, 'GetCurrentIpConfigInfo', '0 bytes in - 0x16 bytes out - OutRaw<0xD,1,0>, OutRaw<9,1,0xD>', '(nn::sf::Out<nn::nifm::IpAddressSetting,void>,nn::sf::Out<nn::nifm::DnsSetting,void>)'),
('nn::nifm::detail::IGeneralService', 16, 'SetWirelessCommunicationEnabled', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::nifm::detail::IGeneralService', 17, 'IsWirelessCommunicationEnabled', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::nifm::detail::IGeneralService', 18, 'GetInternetConnectionStatus', '0 bytes in - 3 bytes out - OutRaw<3,1,0>', '(nn::sf::Out<nn::nifm::detail::sf::InternetConnectionStatus,void>)'),
('nn::nifm::detail::IGeneralService', 19, 'SetEthernetCommunicationEnabled', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::nifm::detail::IGeneralService', 20, 'IsEthernetCommunicationEnabled', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::nifm::detail::IGeneralService', 21, 'IsAnyInternetRequestAccepted', '0 bytes in - 1 bytes out - OutRaw<1,1,0>, Buffer<0,0x19,4>', '(nn::sf::Out<bool,void>,nn::nifm::ClientId)'),
('nn::nifm::detail::IGeneralService', 22, 'IsAnyForegroundRequestAccepted', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::nifm::detail::IGeneralService', 23, 'PutToSleep', '0 bytes in - 0 bytes out', '(void)'),
('nn::nifm::detail::IGeneralService', 24, 'WakeUp', '0 bytes in - 0 bytes out', '(void)'),
('nn::nifm::detail::IGeneralService', 25, 'GetSsidListVersion', '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>', '(nn::sf::Out<nn::nifm::SsidListVersion,void>)'),
('nn::nifm::detail::IGeneralService', 26, 'SetExclusiveClient', '0 bytes in - 0 bytes out - Buffer<0,0x19,4>', '(nn::nifm::ClientId)'),
('nn::nifm::detail::IGeneralService', 27, 'GetDefaultIpSetting', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0xC2>', '(nn::sf::Out<nn::nifm::IpSettingData,void>)'),
('nn::nifm::detail::IGeneralService', 28, 'SetDefaultIpSetting', '0 bytes in - 0 bytes out - Buffer<0,0x19,0xC2>', '(nn::nifm::IpSettingData const&)'),
('nn::nifm::detail::IGeneralService', 29, 'SetWirelessCommunicationEnabledForTest', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::nifm::detail::IGeneralService', 30, 'SetEthernetCommunicationEnabledForTest', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::nifm::detail::IGeneralService', 31, 'GetTelemetorySystemEventReadableHandle', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::nifm::detail::IGeneralService', 32, 'GetTelemetryInfo', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x20C>', '(nn::sf::Out<nn::nifm::TelemetryInfo,void>)'),
('nn::nifm::detail::IGeneralService', 33, 'ConfirmSystemAvailability', '0 bytes in - 0 bytes out', '(void)'),
('nn::nifm::detail::IScanRequest', 0, 'Submit', '0 bytes in - 0 bytes out', '(void)'),
('nn::nifm::detail::IScanRequest', 1, 'IsProcessing', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::nifm::detail::IScanRequest', 2, 'GetResult', '0 bytes in - 0 bytes out', '(void)'),
('nn::nifm::detail::IScanRequest', 3, 'GetSystemEventReadableHandle', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::nifm::detail::IRequest', 0, 'GetRequestState', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::nifm::detail::IRequest', 1, 'GetResult', '0 bytes in - 0 bytes out', '(void)'),
('nn::nifm::detail::IRequest', 2, 'GetSystemEventReadableHandles', '0 bytes in - 0 bytes out - OutHandle<0,1>, OutHandle<1,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>,nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::nifm::detail::IRequest', 3, 'Cancel', '0 bytes in - 0 bytes out', '(void)'),
('nn::nifm::detail::IRequest', 4, 'Submit', '0 bytes in - 0 bytes out', '(void)'),
('nn::nifm::detail::IRequest', 5, 'SetRequirement', '0x24 bytes in - 0 bytes out - InRaw<0x24,4,0>', '(nn::nifm::Requirement const&)'),
('nn::nifm::detail::IRequest', 6, 'SetRequirementPreset', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::nifm::detail::IRequest', 8, 'SetPriority', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(unsigned char)'),
('nn::nifm::detail::IRequest', 9, 'SetNetworkProfileId', '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>', '(nn::util::Uuid const&)'),
('nn::nifm::detail::IRequest', 10, 'SetRejectable', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::nifm::detail::IRequest', 11, 'SetConnectionConfirmationOption', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(signed char)'),
('nn::nifm::detail::IRequest', 12, 'SetPersistent', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::nifm::detail::IRequest', 13, 'SetInstant', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::nifm::detail::IRequest', 14, 'SetSustainable', '2 bytes in - 0 bytes out - InRaw<1,1,0>, InRaw<1,1,1>', '(bool,unsigned char)'),
('nn::nifm::detail::IRequest', 15, 'SetRawPriority', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(unsigned char)'),
('nn::nifm::detail::IRequest', 16, 'SetGreedy', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::nifm::detail::IRequest', 17, 'SetSharable', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::nifm::detail::IRequest', 18, 'SetRequirementByRevision', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(unsigned int)'),
('nn::nifm::detail::IRequest', 19, 'GetRequirement', '0 bytes in - 0x24 bytes out - OutRaw<0x24,4,0>', '(nn::sf::Out<nn::nifm::Requirement,void>)'),
('nn::nifm::detail::IRequest', 20, 'GetRevision', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>)'),
('nn::nifm::detail::IRequest', 21, 'GetAppletInfo', '4 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, OutRaw<4,4,8>, Buffer<0,6,0>, InRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&,unsigned int)'),
('nn::nifm::detail::IRequest', 22, 'GetAdditionalInfo', '0 bytes in - 4 bytes out - Buffer<0,0x16,0x410>, OutRaw<4,4,0>', '(nn::sf::Out<nn::nifm::AdditionalInfo,void>,nn::sf::Out<unsigned int,void>)'),
('nn::nifm::detail::IRequest', 23, 'SetKeptInSleep', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::nifm::detail::IRequest', 24, 'RegisterSocketDescriptor', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::nifm::detail::IRequest', 25, 'UnregisterSocketDescriptor', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::nifm::detail::INetworkProfile', 0, 'Update', '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, Buffer<0,0x19,0x17C>', '(nn::sf::Out<nn::util::Uuid,void>,nn::nifm::detail::sf::NetworkProfileData const&)'),
('nn::nifm::detail::INetworkProfile', 1, 'PersistOld', '0x10 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<0x10,1,0>', '(nn::sf::Out<nn::util::Uuid,void>,nn::util::Uuid const&)'),
('nn::nifm::detail::INetworkProfile', 2, 'Persist', '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>', '(nn::sf::Out<nn::util::Uuid,void>)'),
('nn::nsd::detail::IManager', 10, '', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x100>', ''),
('nn::nsd::detail::IManager', 11, '', '0 bytes in - 0 bytes out - Buffer<0,0x16,8>', ''),
('nn::nsd::detail::IManager', 12, '', '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>', ''),
('nn::nsd::detail::IManager', 13, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>', ''),
('nn::nsd::detail::IManager', 14, '', '4 bytes in - 0 bytes out - Buffer<0,5,0>, Buffer<1,6,0>, InRaw<4,4,0>', ''),
('nn::nsd::detail::IManager', 20, '', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x100>, Buffer<1,0x15,0x100>', ''),
('nn::nsd::detail::IManager', 21, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0x16,0x100>, Buffer<1,0x15,0x100>', ''),
('nn::nsd::detail::IManager', 30, '', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x108>, Buffer<1,0x15,0x10>', ''),
('nn::nsd::detail::IManager', 31, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0x16,0x108>, Buffer<1,0x15,0x10>', ''),
('nn::nsd::detail::IManager', 40, '', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x100>', ''),
('nn::nsd::detail::IManager', 41, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0x16,0x100>', ''),
('nn::nsd::detail::IManager', 42, '', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x100>', ''),
('nn::nsd::detail::IManager', 43, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0x16,0x100>', ''),
('nn::nsd::detail::IManager', 50, '', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x12BF0>', ''),
('nn::nsd::detail::IManager', 60, '', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x12BF0>', ''),
('nn::nsd::detail::IManager', 61, '', '0 bytes in - 0 bytes out - Buffer<0,0x15,0x12BF0>', ''),
('nn::nsd::detail::IManager', 62, '', '0 bytes in - 0 bytes out', ''),
('nn::pctl::detail::ipc::IParentalControlServiceFactory', 0, 'CreateService', '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::pctl::detail::ipc::IParentalControlService>,void>,unsigned long)'),
('nn::pctl::detail::ipc::IParentalControlService', 1001, 'CheckFreeCommunicationPermission', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1002, 'ConfirmLaunchApplicationPermission', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, Buffer<0,9,0>, InRaw<1,1,0>', '(nn::ncm::ApplicationId,nn::sf::InArray<signed char> const&,bool)'),
('nn::pctl::detail::ipc::IParentalControlService', 1003, 'ConfirmResumeApplicationPermission', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, Buffer<0,9,0>, InRaw<1,1,0>', '(nn::ncm::ApplicationId,nn::sf::InArray<signed char> const&,bool)'),
('nn::pctl::detail::ipc::IParentalControlService', 1004, 'ConfirmSnsPostPermission', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1005, 'ConfirmSystemSettingsPermission', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1006, 'IsRestrictionTemporaryUnlocked', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1007, 'RevertRestrictionTemporaryUnlocked', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1008, 'EnterRestrictedSystemSettings', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1009, 'LeaveRestrictedSystemSettings', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1010, 'IsRestrictedSystemSettingsEntered', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1011, 'RevertRestrictedSystemSettingsEntered', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1012, 'GetRestrictedFeatures', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1031, 'IsRestrictionEnabled', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1032, 'GetSafetyLevel', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1033, 'SetSafetyLevel', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::pctl::detail::ipc::IParentalControlService', 1034, 'GetSafetyLevelSettings', '4 bytes in - 3 bytes out - OutRaw<3,1,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::pctl::SafetyLevelSettings,void>,int)'),
('nn::pctl::detail::ipc::IParentalControlService', 1035, 'GetCurrentSettings', '0 bytes in - 3 bytes out - OutRaw<3,1,0>', '(nn::sf::Out<nn::pctl::SafetyLevelSettings,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1036, 'SetCustomSafetyLevelSettings', '3 bytes in - 0 bytes out - InRaw<3,1,0>', '(nn::pctl::SafetyLevelSettings)'),
('nn::pctl::detail::ipc::IParentalControlService', 1037, 'GetDefaultRatingOrganization', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1038, 'SetDefaultRatingOrganization', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::pctl::detail::ipc::IParentalControlService', 1039, 'GetFreeCommunicationApplicationListCount', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1042, 'AddToFreeCommunicationApplicationList', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::ncm::ApplicationId)'),
('nn::pctl::detail::ipc::IParentalControlService', 1043, 'DeleteSettings', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1044, 'GetFreeCommunicationApplicationList', '4 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<4,4,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::pctl::FreeCommunicationApplicationInfo> const&,int)'),
('nn::pctl::detail::ipc::IParentalControlService', 1045, 'UpdateFreeCommunicationApplicationList', '0 bytes in - 0 bytes out - Buffer<0,5,0>', '(nn::sf::InArray<nn::pctl::FreeCommunicationApplicationInfo> const&)'),
('nn::pctl::detail::ipc::IParentalControlService', 1046, 'DisableFeaturesForReset', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1047, 'NotifyApplicationDownloadStarted', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::ncm::ApplicationId)'),
('nn::pctl::detail::ipc::IParentalControlService', 1201, 'UnlockRestrictionTemporarily', '0 bytes in - 0 bytes out - Buffer<0,9,0>', '(nn::sf::InArray<char> const&)'),
('nn::pctl::detail::ipc::IParentalControlService', 1202, 'UnlockSystemSettingsRestriction', '0 bytes in - 0 bytes out - Buffer<0,9,0>', '(nn::sf::InArray<char> const&)'),
('nn::pctl::detail::ipc::IParentalControlService', 1203, 'SetPinCode', '0 bytes in - 0 bytes out - Buffer<0,9,0>', '(nn::sf::InArray<char> const&)'),
('nn::pctl::detail::ipc::IParentalControlService', 1204, 'GenerateInquiryCode', '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>', '(nn::sf::Out<nn::pctl::InquiryCode,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1205, 'CheckMasterKey', '0x20 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<0x20,1,0>, Buffer<0,9,0>', '(nn::sf::Out<bool,void>,nn::pctl::InquiryCode const&,nn::sf::InArray<char> const&)'),
('nn::pctl::detail::ipc::IParentalControlService', 1206, 'GetPinCodeLength', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1207, 'GetPinCodeChangedEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1403, 'IsPairingActive', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1406, 'GetSettingsLastUpdated', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::time::PosixTime,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1411, 'GetPairingAccountInfo', '0x10 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::pctl::detail::PairingAccountInfoBase,void>,nn::pctl::detail::PairingInfoBase const&)'),
('nn::pctl::detail::ipc::IParentalControlService', 1421, 'GetAccountNickname', '0x10 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>, InRaw<0x10,8,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutArray<char> const&,nn::pctl::detail::PairingAccountInfoBase const&)'),
('nn::pctl::detail::ipc::IParentalControlService', 1424, 'GetAccountState', '0x10 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<0x10,8,0>', '(nn::sf::Out<int,void>,nn::pctl::detail::PairingAccountInfoBase const&)'),
('nn::pctl::detail::ipc::IParentalControlService', 1432, 'GetSynchronizationEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1451, 'StartPlayTimer', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1452, 'StopPlayTimer', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1453, 'IsPlayTimerEnabled', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1454, 'GetPlayTimerRemainingTime', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::TimeSpanType,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1455, 'IsRestrictedByPlayTimer', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1456, 'GetPlayTimerSettings', '0 bytes in - 0x34 bytes out - OutRaw<0x34,2,0>', '(nn::sf::Out<nn::pctl::PlayTimerSettings,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1457, 'GetPlayTimerEventToRequestSuspension', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1471, 'NotifyWrongPinCodeInputManyTimes', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1472, 'CancelNetworkRequest', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1473, 'GetUnlinkedEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1474, 'ClearUnlinkedEvent', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1601, 'DisableAllFeatures', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1602, 'PostEnableAllFeatures', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1603, 'IsAllFeaturesDisabled', '0 bytes in - 2 bytes out - OutRaw<1,1,0>, OutRaw<1,1,1>', '(nn::sf::Out<bool,void>,nn::sf::Out<bool,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 1901, 'DeleteFromFreeCommunicationApplicationListForDebug', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::ncm::ApplicationId)'),
('nn::pctl::detail::ipc::IParentalControlService', 1902, 'ClearFreeCommunicationApplicationListForDebug', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1941, 'DeletePairing', '0 bytes in - 0 bytes out', '(void)'),
('nn::pctl::detail::ipc::IParentalControlService', 1951, 'SetPlayTimerSettingsForDebug', '0x34 bytes in - 0 bytes out - InRaw<0x34,2,0>', '(nn::pctl::PlayTimerSettings const&)'),
('nn::pctl::detail::ipc::IParentalControlService', 1952, 'GetPlayTimerSpentTimeForTest', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::TimeSpanType,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 2001, 'RequestPairingAsync', '0 bytes in - 8 bytes out - OutRaw<8,4,0>, OutHandle<0,1>, Buffer<0,9,0>', '(nn::sf::Out<nn::pctl::detail::AsyncData,void>,nn::sf::Out<nn::sf::NativeHandle,void>,nn::sf::InArray<char> const&)'),
('nn::pctl::detail::ipc::IParentalControlService', 2002, 'FinishRequestPairing', '8 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<8,4,0>', '(nn::sf::Out<nn::pctl::detail::PairingInfoBase,void>,nn::pctl::detail::AsyncData)'),
('nn::pctl::detail::ipc::IParentalControlService', 2003, 'AuthorizePairingAsync', '0x10 bytes in - 8 bytes out - OutRaw<8,4,0>, OutHandle<0,1>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::pctl::detail::AsyncData,void>,nn::sf::Out<nn::sf::NativeHandle,void>,nn::pctl::detail::PairingInfoBase const&)'),
('nn::pctl::detail::ipc::IParentalControlService', 2004, 'FinishAuthorizePairing', '8 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<8,4,0>', '(nn::sf::Out<nn::pctl::detail::PairingInfoBase,void>,nn::pctl::detail::AsyncData)'),
('nn::pctl::detail::ipc::IParentalControlService', 2005, 'RetrievePairingInfoAsync', '0 bytes in - 8 bytes out - OutRaw<8,4,0>, OutHandle<0,1>', '(nn::sf::Out<nn::pctl::detail::AsyncData,void>,nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 2006, 'FinishRetrievePairingInfo', '8 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<8,4,0>', '(nn::sf::Out<nn::pctl::detail::PairingInfoBase,void>,nn::pctl::detail::AsyncData)'),
('nn::pctl::detail::ipc::IParentalControlService', 2007, 'UnlinkPairingAsync', '1 bytes in - 8 bytes out - OutRaw<8,4,0>, OutHandle<0,1>, InRaw<1,1,0>', '(nn::sf::Out<nn::pctl::detail::AsyncData,void>,nn::sf::Out<nn::sf::NativeHandle,void>,bool)'),
('nn::pctl::detail::ipc::IParentalControlService', 2008, 'FinishUnlinkPairing', '0xC bytes in - 0 bytes out - InRaw<8,4,4>, InRaw<1,1,0>', '(nn::pctl::detail::AsyncData,bool)'),
('nn::pctl::detail::ipc::IParentalControlService', 2009, 'GetAccountMiiImageAsync', '0x10 bytes in - 0xC bytes out - OutRaw<8,4,0>, OutHandle<0,1>, OutRaw<4,4,8>, Buffer<0,6,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::pctl::detail::AsyncData,void>,nn::sf::Out<nn::sf::NativeHandle,void>,nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&,nn::pctl::detail::PairingAccountInfoBase const&)'),
('nn::pctl::detail::ipc::IParentalControlService', 2010, 'FinishGetAccountMiiImage', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<8,4,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&,nn::pctl::detail::AsyncData)'),
('nn::pctl::detail::ipc::IParentalControlService', 2011, 'GetAccountMiiImageContentTypeAsync', '0x10 bytes in - 0xC bytes out - OutRaw<8,4,0>, OutHandle<0,1>, OutRaw<4,4,8>, Buffer<0,0xA,0>, InRaw<0x10,8,0>', '(nn::sf::Out<nn::pctl::detail::AsyncData,void>,nn::sf::Out<nn::sf::NativeHandle,void>,nn::sf::Out<unsigned int,void>,nn::sf::OutArray<char> const&,nn::pctl::detail::PairingAccountInfoBase const&)'),
('nn::pctl::detail::ipc::IParentalControlService', 2012, 'FinishGetAccountMiiImageContentType', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>, InRaw<8,4,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutArray<char> const&,nn::pctl::detail::AsyncData)'),
('nn::pctl::detail::ipc::IParentalControlService', 2013, 'SynchronizeParentalControlSettingsAsync', '0 bytes in - 8 bytes out - OutRaw<8,4,0>, OutHandle<0,1>', '(nn::sf::Out<nn::pctl::detail::AsyncData,void>,nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::pctl::detail::ipc::IParentalControlService', 2014, 'FinishSynchronizeParentalControlSettings', '8 bytes in - 0 bytes out - InRaw<8,4,0>', '(nn::pctl::detail::AsyncData)'),
('nn::pctl::detail::ipc::IParentalControlService', 2015, 'FinishSynchronizeParentalControlSettingsWithLastUpdated', '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,4,0>', '(nn::sf::Out<nn::time::PosixTime,void>,nn::pctl::detail::AsyncData)'),
('nn::prepo::detail::ipc::IPrepoService', 10100, 'SaveReport', '8 bytes in - 0 bytes out - takes pid - Buffer<0,9,0>, Buffer<1,5,0>, InRaw<8,8,0>', '(nn::sf::InArray<char> const&,nn::sf::InBuffer const&,unsigned long)'),
('nn::prepo::detail::ipc::IPrepoService', 10101, 'SaveReportWithUser', '0x18 bytes in - 0 bytes out - takes pid - InRaw<0x10,8,0>, Buffer<0,9,0>, Buffer<1,5,0>, InRaw<8,8,0x10>', '(nn::account::Uid const&,nn::sf::InArray<char> const&,nn::sf::InBuffer const&,unsigned long)'),
('nn::prepo::detail::ipc::IPrepoService', 10200, 'RequestImmediateTransmission', '0 bytes in - 0 bytes out', '(void)'),
('nn::prepo::detail::ipc::IPrepoService', 10300, 'GetTransmissionStatus', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::prepo::detail::ipc::IPrepoService', 20100, 'SaveSystemReport', '8 bytes in - 0 bytes out - Buffer<0,9,0>, InRaw<8,8,0>, Buffer<1,5,0>', '(nn::sf::InArray<char> const&,nn::ApplicationId,nn::sf::InBuffer const&)'),
('nn::prepo::detail::ipc::IPrepoService', 20101, 'SaveSystemReportWithUser', '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, Buffer<0,9,0>, InRaw<8,8,0x10>, Buffer<1,5,0>', '(nn::account::Uid const&,nn::sf::InArray<char> const&,nn::ApplicationId,nn::sf::InBuffer const&)'),
('nn::prepo::detail::ipc::IPrepoService', 30100, 'ClearStorage', '0 bytes in - 0 bytes out', '(void)'),
('nn::prepo::detail::ipc::IPrepoService', 40100, 'IsUserAgreementCheckEnabled', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::prepo::detail::ipc::IPrepoService', 40101, 'SetUserAgreementCheckEnabled', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::prepo::detail::ipc::IPrepoService', 90100, 'GetStorageUsage', '0 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>', '(nn::sf::Out<long,void>,nn::sf::Out<long,void>)'),
('nn::settings::IFactorySettingsServer', 0, 'GetBluetoothBdAddress', '0 bytes in - 6 bytes out - OutRaw<6,1,0>', '(nn::sf::Out<nn::settings::factory::BdAddress,void>)'),
('nn::settings::IFactorySettingsServer', 1, 'GetConfigurationId1', '0 bytes in - 0x1E bytes out - OutRaw<0x1E,1,0>', '(nn::sf::Out<nn::settings::factory::ConfigurationId1,void>)'),
('nn::settings::IFactorySettingsServer', 2, 'GetAccelerometerOffset', '0 bytes in - 6 bytes out - OutRaw<6,2,0>', '(nn::sf::Out<nn::settings::factory::AccelerometerOffset,void>)'),
('nn::settings::IFactorySettingsServer', 3, 'GetAccelerometerScale', '0 bytes in - 6 bytes out - OutRaw<6,2,0>', '(nn::sf::Out<nn::settings::factory::AccelerometerScale,void>)'),
('nn::settings::IFactorySettingsServer', 4, 'GetGyroscopeOffset', '0 bytes in - 6 bytes out - OutRaw<6,2,0>', '(nn::sf::Out<nn::settings::factory::GyroscopeOffset,void>)'),
('nn::settings::IFactorySettingsServer', 5, 'GetGyroscopeScale', '0 bytes in - 6 bytes out - OutRaw<6,2,0>', '(nn::sf::Out<nn::settings::factory::GyroscopeScale,void>)'),
('nn::settings::IFactorySettingsServer', 6, 'GetWirelessLanMacAddress', '0 bytes in - 6 bytes out - OutRaw<6,1,0>', '(nn::sf::Out<nn::settings::factory::MacAddress,void>)'),
('nn::settings::IFactorySettingsServer', 7, 'GetWirelessLanCountryCodeCount', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::settings::IFactorySettingsServer', 8, 'GetWirelessLanCountryCodes', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::settings::factory::CountryCode> const&)'),
('nn::settings::IFactorySettingsServer', 9, 'GetSerialNumber', '0 bytes in - 0x18 bytes out - OutRaw<0x18,1,0>', '(nn::sf::Out<nn::settings::factory::SerialNumber,void>)'),
('nn::settings::IFactorySettingsServer', 10, 'SetInitialSystemAppletProgramId', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::ncm::ProgramId)'),
('nn::settings::IFactorySettingsServer', 11, 'SetOverlayDispProgramId', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::ncm::ProgramId)'),
('nn::settings::IFactorySettingsServer', 12, 'GetBatteryLot', '0 bytes in - 0x18 bytes out - OutRaw<0x18,1,0>', '(nn::sf::Out<nn::settings::factory::BatteryLot,void>)'),
('nn::settings::IFactorySettingsServer', 14, 'GetEciDeviceCertificate', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x180>', '(nn::sf::Out<nn::settings::factory::EccB233DeviceCertificate,void>)'),
('nn::settings::IFactorySettingsServer', 15, 'GetEticketDeviceCertificate', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x240>', '(nn::sf::Out<nn::settings::factory::Rsa2048DeviceCertificate,void>)'),
('nn::settings::IFactorySettingsServer', 16, 'GetSslKey', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x134>', '(nn::sf::Out<nn::settings::factory::SslKey,void>)'),
('nn::settings::IFactorySettingsServer', 17, 'GetSslCertificate', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x804>', '(nn::sf::Out<nn::settings::factory::SslCertificate,void>)'),
('nn::settings::IFactorySettingsServer', 18, 'GetGameCardKey', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x134>', '(nn::sf::Out<nn::settings::factory::GameCardKey,void>)'),
('nn::settings::IFactorySettingsServer', 19, 'GetGameCardCertificate', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x400>', '(nn::sf::Out<nn::settings::factory::GameCardCertificate,void>)'),
('nn::settings::IFactorySettingsServer', 20, 'GetEciDeviceKey', '0 bytes in - 0x54 bytes out - OutRaw<0x54,4,0>', '(nn::sf::Out<nn::settings::factory::EccB233DeviceKey,void>)'),
('nn::settings::IFactorySettingsServer', 21, 'GetEticketDeviceKey', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x244>', '(nn::sf::Out<nn::settings::factory::Rsa2048DeviceKey,void>)'),
('nn::settings::IFactorySettingsServer', 22, 'GetSpeakerParameter', '0 bytes in - 0x5A bytes out - OutRaw<0x5A,2,0>', '(nn::sf::Out<nn::settings::factory::SpeakerParameter,void>)'),
('nn::settings::IFirmwareDebugSettingsServer', 2, 'SetSettingsItemValue', '0 bytes in - 0 bytes out - Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>, Buffer<2,5,0>', '(nn::settings::SettingsName const&,nn::settings::SettingsItemKey const&,nn::sf::InBuffer const&)'),
('nn::settings::IFirmwareDebugSettingsServer', 3, 'ResetSettingsItemValue', '0 bytes in - 0 bytes out - Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>', '(nn::settings::SettingsName const&,nn::settings::SettingsItemKey const&)'),
('nn::settings::IFirmwareDebugSettingsServer', 4, 'CreateSettingsItemKeyIterator', '0 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x48>', '(nn::sf::Out<nn::sf::SharedPointer<nn::settings::ISettingsItemKeyIterator>,void>,nn::settings::SettingsName const&)'),
('nn::settings::ISettingsItemKeyIterator', 0, 'GoNext', '0 bytes in - 0 bytes out', '(void)'),
('nn::settings::ISettingsItemKeyIterator', 1, 'GetKeySize', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<unsigned long,void>)'),
('nn::settings::ISettingsItemKeyIterator', 2, 'GetKey', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned long,void>,nn::sf::OutBuffer const&)'),
('nn::settings::ISettingsServer', 0, 'GetLanguageCode', '0 bytes in - 8 bytes out - OutRaw<8,1,0>', '(nn::sf::Out<nn::settings::LanguageCode,void>)'),
('nn::settings::ISettingsServer', 1, 'GetAvailableLanguageCodes', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::settings::LanguageCode> const&)'),
('nn::settings::ISettingsServer', 3, 'GetAvailableLanguageCodeCount', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::settings::ISettingsServer', 4, 'GetRegionCode', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::settings::ISystemSettingsServer', 0, 'SetLanguageCode', '8 bytes in - 0 bytes out - InRaw<8,1,0>', '(nn::settings::LanguageCode)'),
('nn::settings::ISystemSettingsServer', 1, 'SetNetworkSettings', '0 bytes in - 0 bytes out - Buffer<0,5,0>', '(nn::sf::InArray<nn::settings::system::NetworkSettings> const&)'),
('nn::settings::ISystemSettingsServer', 2, 'GetNetworkSettings', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::settings::system::NetworkSettings> const&)'),
('nn::settings::ISystemSettingsServer', 3, 'GetFirmwareVersion', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>', '(nn::sf::Out<nn::settings::system::FirmwareVersion,void>)'),
('nn::settings::ISystemSettingsServer', 4, 'GetFirmwareVersion2', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>', '(nn::sf::Out<nn::settings::system::FirmwareVersion,void>)'),
('nn::settings::ISystemSettingsServer', 7, 'GetLockScreenFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 8, 'SetLockScreenFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 9, 'GetBacklightSettings', '0 bytes in - 0x28 bytes out - OutRaw<0x28,4,0>', '(nn::sf::Out<nn::settings::system::BacklightSettings,void>)'),
('nn::settings::ISystemSettingsServer', 10, 'SetBacklightSettings', '0x28 bytes in - 0 bytes out - InRaw<0x28,4,0>', '(nn::settings::system::BacklightSettings const&)'),
('nn::settings::ISystemSettingsServer', 11, 'SetBluetoothDevicesSettings', '0 bytes in - 0 bytes out - Buffer<0,5,0>', '(nn::sf::InArray<nn::settings::system::BluetoothDevicesSettings> const&)'),
('nn::settings::ISystemSettingsServer', 12, 'GetBluetoothDevicesSettings', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::settings::system::BluetoothDevicesSettings> const&)'),
('nn::settings::ISystemSettingsServer', 13, 'GetExternalSteadyClockSourceId', '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>', '(nn::sf::Out<nn::util::Uuid,void>)'),
('nn::settings::ISystemSettingsServer', 14, 'SetExternalSteadyClockSourceId', '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>', '(nn::util::Uuid const&)'),
('nn::settings::ISystemSettingsServer', 15, 'GetUserSystemClockContext', '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>', '(nn::sf::Out<nn::time::SystemClockContext,void>)'),
('nn::settings::ISystemSettingsServer', 16, 'SetUserSystemClockContext', '0x20 bytes in - 0 bytes out - InRaw<0x20,8,0>', '(nn::time::SystemClockContext const&)'),
('nn::settings::ISystemSettingsServer', 17, 'GetAccountSettings', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<nn::settings::system::AccountSettings,void>)'),
('nn::settings::ISystemSettingsServer', 18, 'SetAccountSettings', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::settings::system::AccountSettings)'),
('nn::settings::ISystemSettingsServer', 19, 'GetAudioVolume', '4 bytes in - 8 bytes out - OutRaw<8,4,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::settings::system::AudioVolume,void>,int)'),
('nn::settings::ISystemSettingsServer', 20, 'SetAudioVolume', '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>', '(nn::settings::system::AudioVolume,int)'),
('nn::settings::ISystemSettingsServer', 21, 'GetEulaVersions', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::settings::system::EulaVersion> const&)'),
('nn::settings::ISystemSettingsServer', 22, 'SetEulaVersions', '0 bytes in - 0 bytes out - Buffer<0,5,0>', '(nn::sf::InArray<nn::settings::system::EulaVersion> const&)'),
('nn::settings::ISystemSettingsServer', 23, 'GetColorSetId', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::settings::ISystemSettingsServer', 24, 'SetColorSetId', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::settings::ISystemSettingsServer', 25, 'GetConsoleInformationUploadFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 26, 'SetConsoleInformationUploadFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 27, 'GetAutomaticApplicationDownloadFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 28, 'SetAutomaticApplicationDownloadFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 29, 'GetNotificationSettings', '0 bytes in - 0x18 bytes out - OutRaw<0x18,4,0>', '(nn::sf::Out<nn::settings::system::NotificationSettings,void>)'),
('nn::settings::ISystemSettingsServer', 30, 'SetNotificationSettings', '0x18 bytes in - 0 bytes out - InRaw<0x18,4,0>', '(nn::settings::system::NotificationSettings const&)'),
('nn::settings::ISystemSettingsServer', 31, 'GetAccountNotificationSettings', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::settings::system::AccountNotificationSettings> const&)'),
('nn::settings::ISystemSettingsServer', 32, 'SetAccountNotificationSettings', '0 bytes in - 0 bytes out - Buffer<0,5,0>', '(nn::sf::InArray<nn::settings::system::AccountNotificationSettings> const&)'),
('nn::settings::ISystemSettingsServer', 35, 'GetVibrationMasterVolume', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<float,void>)'),
('nn::settings::ISystemSettingsServer', 36, 'SetVibrationMasterVolume', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(float)'),
('nn::settings::ISystemSettingsServer', 37, 'GetSettingsItemValueSize', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>', '(nn::sf::Out<unsigned long,void>,nn::settings::SettingsName const&,nn::settings::SettingsItemKey const&)'),
('nn::settings::ISystemSettingsServer', 38, 'GetSettingsItemValue', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<2,6,0>, Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>', '(nn::sf::Out<unsigned long,void>,nn::sf::OutBuffer const&,nn::settings::SettingsName const&,nn::settings::SettingsItemKey const&)'),
('nn::settings::ISystemSettingsServer', 39, 'GetTvSettings', '0 bytes in - 0x20 bytes out - OutRaw<0x20,4,0>', '(nn::sf::Out<nn::settings::system::TvSettings,void>)'),
('nn::settings::ISystemSettingsServer', 40, 'SetTvSettings', '0x20 bytes in - 0 bytes out - InRaw<0x20,4,0>', '(nn::settings::system::TvSettings const&)'),
('nn::settings::ISystemSettingsServer', 41, 'GetEdid', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>', '(nn::sf::Out<nn::settings::system::Edid,void>)'),
('nn::settings::ISystemSettingsServer', 42, 'SetEdid', '0 bytes in - 0 bytes out - Buffer<0,0x19,0x100>', '(nn::settings::system::Edid const&)'),
('nn::settings::ISystemSettingsServer', 43, 'GetAudioOutputMode', '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>', '(nn::sf::Out<int,void>,int)'),
('nn::settings::ISystemSettingsServer', 44, 'SetAudioOutputMode', '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>', '(int,int)'),
('nn::settings::ISystemSettingsServer', 45, 'IsForceMuteOnHeadphoneRemoved', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 46, 'SetForceMuteOnHeadphoneRemoved', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 47, 'GetQuestFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 48, 'SetQuestFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 49, 'GetDataDeletionSettings', '0 bytes in - 8 bytes out - OutRaw<8,4,0>', '(nn::sf::Out<nn::settings::system::DataDeletionSettings,void>)'),
('nn::settings::ISystemSettingsServer', 50, 'SetDataDeletionSettings', '8 bytes in - 0 bytes out - InRaw<8,4,0>', '(nn::settings::system::DataDeletionSettings)'),
('nn::settings::ISystemSettingsServer', 51, 'GetInitialSystemAppletProgramId', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::ncm::ProgramId,void>)'),
('nn::settings::ISystemSettingsServer', 52, 'GetOverlayDispProgramId', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::ncm::ProgramId,void>)'),
('nn::settings::ISystemSettingsServer', 53, 'GetDeviceTimeZoneLocationName', '0 bytes in - 0x24 bytes out - OutRaw<0x24,1,0>', '(nn::sf::Out<nn::time::LocationName,void>)'),
('nn::settings::ISystemSettingsServer', 54, 'SetDeviceTimeZoneLocationName', '0x24 bytes in - 0 bytes out - InRaw<0x24,1,0>', '(nn::time::LocationName const&)'),
('nn::settings::ISystemSettingsServer', 55, 'GetWirelessCertificationFileSize', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<unsigned long,void>)'),
('nn::settings::ISystemSettingsServer', 56, 'GetWirelessCertificationFile', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned long,void>,nn::sf::OutBuffer const&)'),
('nn::settings::ISystemSettingsServer', 57, 'SetRegionCode', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::settings::ISystemSettingsServer', 58, 'GetNetworkSystemClockContext', '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>', '(nn::sf::Out<nn::time::SystemClockContext,void>)'),
('nn::settings::ISystemSettingsServer', 59, 'SetNetworkSystemClockContext', '0x20 bytes in - 0 bytes out - InRaw<0x20,8,0>', '(nn::time::SystemClockContext const&)'),
('nn::settings::ISystemSettingsServer', 60, 'IsUserSystemClockAutomaticCorrectionEnabled', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 61, 'SetUserSystemClockAutomaticCorrectionEnabled', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 62, 'GetDebugModeFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 63, 'GetPrimaryAlbumStorage', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::settings::ISystemSettingsServer', 64, 'SetPrimaryAlbumStorage', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::settings::ISystemSettingsServer', 65, 'GetUsb30EnableFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 66, 'SetUsb30EnableFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 67, 'GetBatteryLot', '0 bytes in - 0x18 bytes out - OutRaw<0x18,1,0>', '(nn::sf::Out<nn::settings::system::BatteryLot,void>)'),
('nn::settings::ISystemSettingsServer', 68, 'GetSerialNumber', '0 bytes in - 0x18 bytes out - OutRaw<0x18,1,0>', '(nn::sf::Out<nn::settings::system::SerialNumber,void>)'),
('nn::settings::ISystemSettingsServer', 69, 'GetNfcEnableFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 70, 'SetNfcEnableFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 71, 'GetSleepSettings', '0 bytes in - 0xC bytes out - OutRaw<0xC,4,0>', '(nn::sf::Out<nn::settings::system::SleepSettings,void>)'),
('nn::settings::ISystemSettingsServer', 72, 'SetSleepSettings', '0xC bytes in - 0 bytes out - InRaw<0xC,4,0>', '(nn::settings::system::SleepSettings const&)'),
('nn::settings::ISystemSettingsServer', 73, 'GetWirelessLanEnableFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 74, 'SetWirelessLanEnableFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 75, 'GetInitialLaunchSettings', '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>', '(nn::sf::Out<nn::settings::system::InitialLaunchSettings,void>)'),
('nn::settings::ISystemSettingsServer', 76, 'SetInitialLaunchSettings', '0x20 bytes in - 0 bytes out - InRaw<0x20,8,0>', '(nn::settings::system::InitialLaunchSettings const&)'),
('nn::settings::ISystemSettingsServer', 77, 'GetDeviceNickName', '0 bytes in - 0 bytes out - Buffer<0,0x16,0x80>', '(nn::sf::Out<nn::settings::system::DeviceNickName,void>)'),
('nn::settings::ISystemSettingsServer', 78, 'SetDeviceNickName', '0 bytes in - 0 bytes out - Buffer<0,0x15,0x80>', '(nn::settings::system::DeviceNickName const&)'),
('nn::settings::ISystemSettingsServer', 79, 'GetProductModel', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::settings::ISystemSettingsServer', 80, 'GetLdnChannel', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::settings::ISystemSettingsServer', 81, 'SetLdnChannel', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::settings::ISystemSettingsServer', 82, 'AcquireTelemetryDirtyFlagEventHandle', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::settings::ISystemSettingsServer', 83, 'GetTelemetryDirtyFlags', '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>', '(nn::sf::Out<nn::util::BitFlagSet<128,nn::settings::system::TelemetryDirtyFlag>,void>)'),
('nn::settings::ISystemSettingsServer', 84, 'GetPtmBatteryLot', '0 bytes in - 0x18 bytes out - OutRaw<0x18,1,0>', '(nn::sf::Out<nn::settings::factory::BatteryLot,void>)'),
('nn::settings::ISystemSettingsServer', 85, 'SetPtmBatteryLot', '0x18 bytes in - 0 bytes out - InRaw<0x18,1,0>', '(nn::settings::factory::BatteryLot const&)'),
('nn::settings::ISystemSettingsServer', 86, 'GetPtmFuelGaugeParameter', '0 bytes in - 0x18 bytes out - OutRaw<0x18,4,0>', '(nn::sf::Out<nn::settings::system::PtmFuelGaugeParameter,void>)'),
('nn::settings::ISystemSettingsServer', 87, 'SetPtmFuelGaugeParameter', '0x18 bytes in - 0 bytes out - InRaw<0x18,4,0>', '(nn::settings::system::PtmFuelGaugeParameter const&)'),
('nn::settings::ISystemSettingsServer', 88, 'GetBluetoothEnableFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 89, 'SetBluetoothEnableFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 90, 'GetMiiAuthorId', '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>', '(nn::sf::Out<nn::util::Uuid,void>)'),
('nn::settings::ISystemSettingsServer', 91, 'SetShutdownRtcValue', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(long)'),
('nn::settings::ISystemSettingsServer', 92, 'GetShutdownRtcValue', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<long,void>)'),
('nn::settings::ISystemSettingsServer', 93, 'AcquireFatalDirtyFlagEventHandle', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::settings::ISystemSettingsServer', 94, 'GetFatalDirtyFlags', '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>', '(nn::sf::Out<nn::util::BitFlagSet<128,nn::settings::system::FatalDirtyFlag>,void>)'),
('nn::settings::ISystemSettingsServer', 95, 'GetAutoUpdateEnableFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 96, 'SetAutoUpdateEnableFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 97, 'GetNxControllerSettings', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::settings::system::NxControllerSettings> const&)'),
('nn::settings::ISystemSettingsServer', 98, 'SetNxControllerSettings', '0 bytes in - 0 bytes out - Buffer<0,5,0>', '(nn::sf::InArray<nn::settings::system::NxControllerSettings> const&)'),
('nn::settings::ISystemSettingsServer', 99, 'GetBatteryPercentageFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 100, 'SetBatteryPercentageFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 101, 'GetExternalRtcResetFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 102, 'SetExternalRtcResetFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 103, 'GetUsbFullKeyEnableFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 104, 'SetUsbFullKeyEnableFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 105, 'SetExternalSteadyClockInternalOffset', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(long)'),
('nn::settings::ISystemSettingsServer', 106, 'GetExternalSteadyClockInternalOffset', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<long,void>)'),
('nn::settings::ISystemSettingsServer', 107, 'GetBacklightSettingsEx', '0 bytes in - 0x2C bytes out - OutRaw<0x2C,4,0>', '(nn::sf::Out<nn::settings::system::BacklightSettingsEx,void>)'),
('nn::settings::ISystemSettingsServer', 108, 'SetBacklightSettingsEx', '0x2C bytes in - 0 bytes out - InRaw<0x2C,4,0>', '(nn::settings::system::BacklightSettingsEx const&)'),
('nn::settings::ISystemSettingsServer', 109, 'GetHeadphoneVolumeWarningCount', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::settings::ISystemSettingsServer', 110, 'SetHeadphoneVolumeWarningCount', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::settings::ISystemSettingsServer', 111, 'GetBluetoothAfhEnableFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 112, 'SetBluetoothAfhEnableFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 113, 'GetBluetoothBoostEnableFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 114, 'SetBluetoothBoostEnableFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 115, 'GetInRepairProcessEnableFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 116, 'SetInRepairProcessEnableFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 117, 'GetHeadphoneVolumeUpdateFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::settings::ISystemSettingsServer', 118, 'SetHeadphoneVolumeUpdateFlag', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::settings::ISystemSettingsServer', 119, 'NeedsToUpdateHeadphoneVolume', '1 bytes in - 3 bytes out - OutRaw<1,1,0>, OutRaw<1,1,1>, OutRaw<1,1,2>, InRaw<1,1,0>', '(nn::sf::Out<bool,void>,nn::sf::Out<bool,void>,nn::sf::Out<signed char,void>,bool)'),
('nn::settings::ISystemSettingsServer', 120, 'GetPushNotificationActivityModeOnSleep', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::settings::ISystemSettingsServer', 121, 'SetPushNotificationActivityModeOnSleep', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::ssl::sf::ISslService', 0, 'CreateContext', '0x10 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<4,4,0>, InRaw<8,8,8>', '(nn::sf::Out<nn::sf::SharedPointer<nn::ssl::sf::ISslContext>,void>,nn::ssl::sf::SslVersion,unsigned long)'),
('nn::ssl::sf::ISslService', 1, 'GetContextCount', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>)'),
('nn::ssl::sf::ISslService', 2, 'GetCertificates', '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, Buffer<1,5,0>', '(nn::sf::OutBuffer const&,nn::sf::Out<unsigned int,void>,nn::sf::InBuffer const&)'),
('nn::ssl::sf::ISslService', 3, 'GetCertificateBufSize', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,5,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::InBuffer const&)'),
('nn::ssl::sf::ISslService', 4, 'DebugIoctl', '8 bytes in - 0 bytes out - Buffer<0,6,0>, Buffer<1,5,0>, InRaw<8,8,0>', '(nn::sf::OutBuffer const&,nn::sf::InBuffer const&,unsigned long)'),
('nn::ssl::sf::ISslService', 5, 'SetInterfaceVersion', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(unsigned int)'),
('nn::ssl::sf::ISslContext', 0, 'SetOption', '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>', '(nn::ssl::sf::ContextOption,int)'),
('nn::ssl::sf::ISslContext', 1, 'GetOption', '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>', '(nn::sf::Out<int,void>,nn::ssl::sf::ContextOption)'),
('nn::ssl::sf::ISslContext', 2, 'CreateConnection', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::ssl::sf::ISslConnection>,void>)'),
('nn::ssl::sf::ISslContext', 3, 'GetConnectionCount', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>)'),
('nn::ssl::sf::ISslContext', 4, 'ImportServerPki', '4 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,5,0>, InRaw<4,4,0>', '(nn::sf::Out<unsigned long,void>,nn::sf::InBuffer const&,nn::ssl::sf::CertificateFormat)'),
('nn::ssl::sf::ISslContext', 5, 'ImportClientPki', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,5,0>, Buffer<1,5,0>', '(nn::sf::Out<unsigned long,void>,nn::sf::InBuffer const&,nn::sf::InBuffer const&)'),
('nn::ssl::sf::ISslContext', 6, 'RemoveServerPki', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(unsigned long)'),
('nn::ssl::sf::ISslContext', 7, 'RemoveClientPki', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(unsigned long)'),
('nn::ssl::sf::ISslContext', 8, 'RegisterInternalPki', '4 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<4,4,0>', '(nn::sf::Out<unsigned long,void>,nn::ssl::sf::InternalPki)'),
('nn::ssl::sf::ISslContext', 9, 'AddPolicyOid', '0 bytes in - 0 bytes out - Buffer<0,5,0>', '(nn::sf::InBuffer const&)'),
('nn::ssl::sf::ISslContext', 10, 'ImportCrl', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,5,0>', '(nn::sf::Out<unsigned long,void>,nn::sf::InBuffer const&)'),
('nn::ssl::sf::ISslContext', 11, 'RemoveCrl', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(unsigned long)'),
('nn::ssl::sf::ISslConnection', 0, 'SetSocketDescriptor', '4 bytes in - 4 bytes out - InRaw<4,4,0>, OutRaw<4,4,0>', '(int,nn::sf::Out<int,void>)'),
('nn::ssl::sf::ISslConnection', 1, 'SetHostName', '0 bytes in - 0 bytes out - Buffer<0,5,0>', '(nn::sf::InBuffer const&)'),
('nn::ssl::sf::ISslConnection', 2, 'SetVerifyOption', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::ssl::sf::VerifyOption)'),
('nn::ssl::sf::ISslConnection', 3, 'SetIoMode', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::ssl::sf::IoMode)'),
('nn::ssl::sf::ISslConnection', 4, 'GetSocketDescriptor', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::ssl::sf::ISslConnection', 5, 'GetHostName', '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>', '(nn::sf::OutBuffer const&,nn::sf::Out<unsigned int,void>)'),
('nn::ssl::sf::ISslConnection', 6, 'GetVerifyOption', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<nn::ssl::sf::VerifyOption,void>)'),
('nn::ssl::sf::ISslConnection', 7, 'GetIoMode', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<nn::ssl::sf::IoMode,void>)'),
('nn::ssl::sf::ISslConnection', 8, 'DoHandshake', '0 bytes in - 0 bytes out', '(void)'),
('nn::ssl::sf::ISslConnection', 9, 'DoHandshakeGetServerCert', '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<0,6,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)'),
('nn::ssl::sf::ISslConnection', 10, 'Read', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)'),
('nn::ssl::sf::ISslConnection', 11, 'Write', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,5,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::InBuffer const&)'),
('nn::ssl::sf::ISslConnection', 12, 'Pending', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::ssl::sf::ISslConnection', 13, 'Peek', '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>', '(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)'),
('nn::ssl::sf::ISslConnection', 14, 'Poll', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>, InRaw<4,4,4>', '(nn::sf::Out<nn::ssl::sf::PollEvent,void>,nn::ssl::sf::PollEvent,unsigned int)'),
('nn::ssl::sf::ISslConnection', 15, 'GetVerifyCertError', '0 bytes in - 0 bytes out', '(void)'),
('nn::ssl::sf::ISslConnection', 16, 'GetNeededServerCertBufferSize', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>)'),
('nn::ssl::sf::ISslConnection', 17, 'SetSessionCacheMode', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::ssl::sf::SessionCacheMode)'),
('nn::ssl::sf::ISslConnection', 18, 'GetSessionCacheMode', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<nn::ssl::sf::SessionCacheMode,void>)'),
('nn::ssl::sf::ISslConnection', 19, 'FlushSessionCache', '0 bytes in - 0 bytes out', '(void)'),
('nn::ssl::sf::ISslConnection', 20, 'SetRenegotiationMode', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::ssl::sf::RenegotiationMode)'),
('nn::ssl::sf::ISslConnection', 21, 'GetRenegotiationMode', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<nn::ssl::sf::RenegotiationMode,void>)'),
('nn::ssl::sf::ISslConnection', 22, 'SetOption', '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>', '(nn::ssl::sf::OptionType,bool)'),
('nn::ssl::sf::ISslConnection', 23, 'GetOption', '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>', '(nn::sf::Out<bool,void>,nn::ssl::sf::OptionType)'),
('nn::ssl::sf::ISslConnection', 24, 'GetVerifyCertErrors', '0 bytes in - 8 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, OutRaw<4,4,4>', '(nn::sf::OutBuffer const&,nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>)'),
('nn::timesrv::detail::service::IStaticService', 0, 'GetStandardUserSystemClock', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::timesrv::detail::service::ISystemClock>,void>)'),
('nn::timesrv::detail::service::IStaticService', 1, 'GetStandardNetworkSystemClock', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::timesrv::detail::service::ISystemClock>,void>)'),
('nn::timesrv::detail::service::IStaticService', 2, 'GetStandardSteadyClock', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::timesrv::detail::service::ISteadyClock>,void>)'),
('nn::timesrv::detail::service::IStaticService', 3, 'GetTimeZoneService', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::timesrv::detail::service::ITimeZoneService>,void>)'),
('nn::timesrv::detail::service::IStaticService', 4, 'GetStandardLocalSystemClock', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::timesrv::detail::service::ISystemClock>,void>)'),
('nn::timesrv::detail::service::IStaticService', 100, 'IsStandardUserSystemClockAutomaticCorrectionEnabled', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::timesrv::detail::service::IStaticService', 101, 'SetStandardUserSystemClockAutomaticCorrectionEnabled', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::timesrv::detail::service::IStaticService', 200, 'IsStandardNetworkSystemClockAccuracySufficient', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::timesrv::detail::service::ISystemClock', 0, 'GetCurrentTime', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::time::PosixTime,void>)'),
('nn::timesrv::detail::service::ISystemClock', 1, 'SetCurrentTime', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::time::PosixTime)'),
('nn::timesrv::detail::service::ISystemClock', 2, 'GetSystemClockContext', '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>', '(nn::sf::Out<nn::time::SystemClockContext,void>)'),
('nn::timesrv::detail::service::ISystemClock', 3, 'SetSystemClockContext', '0x20 bytes in - 0 bytes out - InRaw<0x20,8,0>', '(nn::time::SystemClockContext const&)'),
('nn::timesrv::detail::service::ISteadyClock', 0, 'GetCurrentTimePoint', '0 bytes in - 0x18 bytes out - OutRaw<0x18,8,0>', '(nn::sf::Out<nn::time::SteadyClockTimePoint,void>)'),
('nn::timesrv::detail::service::ISteadyClock', 2, 'GetTestOffset', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::TimeSpanType,void>)'),
('nn::timesrv::detail::service::ISteadyClock', 3, 'SetTestOffset', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::TimeSpanType)'),
('nn::timesrv::detail::service::ISteadyClock', 100, 'GetRtcValue', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<long,void>)'),
('nn::timesrv::detail::service::ISteadyClock', 101, 'IsRtcResetDetected', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::timesrv::detail::service::ISteadyClock', 102, 'GetSetupResutltValue', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>)'),
('nn::timesrv::detail::service::ISteadyClock', 200, 'GetInternalOffset', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<nn::TimeSpanType,void>)'),
('nn::timesrv::detail::service::ISteadyClock', 201, 'SetInternalOffset', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::TimeSpanType)'),
('nn::timesrv::detail::service::ITimeZoneService', 0, 'GetDeviceLocationName', '0 bytes in - 0x24 bytes out - OutRaw<0x24,1,0>', '(nn::sf::Out<nn::time::LocationName,void>)'),
('nn::timesrv::detail::service::ITimeZoneService', 1, 'SetDeviceLocationName', '0x24 bytes in - 0 bytes out - InRaw<0x24,1,0>', '(nn::time::LocationName const&)'),
('nn::timesrv::detail::service::ITimeZoneService', 2, 'GetTotalLocationNameCount', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<int,void>)'),
('nn::timesrv::detail::service::ITimeZoneService', 3, 'LoadLocationNameList', '4 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<4,4,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::time::LocationName> const&,int)'),
('nn::timesrv::detail::service::ITimeZoneService', 4, 'LoadTimeZoneRule', '0x24 bytes in - 0 bytes out - Buffer<0,0x16,0x4000>, InRaw<0x24,1,0>', '(nn::sf::Out<nn::time::TimeZoneRule,void>,nn::time::LocationName const&)'),
('nn::timesrv::detail::service::ITimeZoneService', 5, 'GetTimeZoneRuleVersion', '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>', '(nn::sf::Out<nn::time::TimeZoneRuleVersion,void>)'),
('nn::timesrv::detail::service::ITimeZoneService', 100, 'ToCalendarTime', '8 bytes in - 0x20 bytes out - OutRaw<8,2,0>, OutRaw<0x18,4,8>, InRaw<8,8,0>, Buffer<0,0x15,0x4000>', '(nn::sf::Out<nn::time::CalendarTime,void>,nn::sf::Out<nn::time::sf::CalendarAdditionalInfo,void>,nn::time::PosixTime,nn::time::TimeZoneRule const&)'),
('nn::timesrv::detail::service::ITimeZoneService', 101, 'ToCalendarTimeWithMyRule', '8 bytes in - 0x20 bytes out - OutRaw<8,2,0>, OutRaw<0x18,4,8>, InRaw<8,8,0>', '(nn::sf::Out<nn::time::CalendarTime,void>,nn::sf::Out<nn::time::sf::CalendarAdditionalInfo,void>,nn::time::PosixTime)'),
('nn::timesrv::detail::service::ITimeZoneService', 201, 'ToPosixTime', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<1,0xA,0>, InRaw<8,2,0>, Buffer<0,0x15,0x4000>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::time::PosixTime> const&,nn::time::CalendarTime,nn::time::TimeZoneRule const&)'),
('nn::timesrv::detail::service::ITimeZoneService', 202, 'ToPosixTimeWithMyRule', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>, InRaw<8,2,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::time::PosixTime> const&,nn::time::CalendarTime)'),
('nn::ntc::detail::service::IStaticService', 0, '', '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>, InRaw<4,4,4>', ''),
('nn::ntc::detail::service::IStaticService', 100, '', '0 bytes in - 0 bytes out', ''),
('nn::ntc::detail::service::IStaticService', 101, '', '0 bytes in - 0 bytes out', ''),
('nn::ntc::detail::service::IEnsureNetworkClockAvailabilityService', 0, '', '0 bytes in - 0 bytes out', ''),
('nn::ntc::detail::service::IEnsureNetworkClockAvailabilityService', 1, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::ntc::detail::service::IEnsureNetworkClockAvailabilityService', 2, '', '0 bytes in - 0 bytes out', ''),
('nn::ntc::detail::service::IEnsureNetworkClockAvailabilityService', 3, '', '0 bytes in - 0 bytes out', ''),
('nn::ntc::detail::service::IEnsureNetworkClockAvailabilityService', 4, '', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', ''),
('nn::ntc::detail::service::IEnsureNetworkClockAvailabilityService', 5, '', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', ''),
('nn::aocsrv::detail::IAddOnContentManager', 0, 'CountAddOnContentByApplicationId', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>', '(nn::sf::Out<int,void>,nn::ncm::ApplicationId)'),
('nn::aocsrv::detail::IAddOnContentManager', 1, 'ListAddOnContentByApplicationId', '0x10 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<8,8,8>', '(nn::sf::Out<int,void>,nn::sf::OutArray<int> const&,int,int,nn::ncm::ApplicationId)'),
('nn::aocsrv::detail::IAddOnContentManager', 2, 'CountAddOnContent', '8 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, InRaw<8,8,0>', '(nn::sf::Out<int,void>,unsigned long)'),
('nn::aocsrv::detail::IAddOnContentManager', 3, 'ListAddOnContent', '0x10 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,4,4>', '(nn::sf::Out<int,void>,nn::sf::OutArray<int> const&,unsigned long,int,int)'),
('nn::aocsrv::detail::IAddOnContentManager', 4, 'GetAddOnContentBaseIdByApplicationId', '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>', '(nn::sf::Out<unsigned long,void>,nn::ncm::ApplicationId)'),
('nn::aocsrv::detail::IAddOnContentManager', 5, 'GetAddOnContentBaseId', '8 bytes in - 8 bytes out - takes pid - OutRaw<8,8,0>, InRaw<8,8,0>', '(nn::sf::Out<unsigned long,void>,unsigned long)'),
('nn::aocsrv::detail::IAddOnContentManager', 6, 'PrepareAddOnContentByApplicationId', '0x10 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<8,8,8>', '(int,nn::ncm::ApplicationId)'),
('nn::aocsrv::detail::IAddOnContentManager', 7, 'PrepareAddOnContent', '0x10 bytes in - 0 bytes out - takes pid - InRaw<4,4,0>, InRaw<8,8,8>', '(int,unsigned long)'),
('nn::audio::detail::IAudioDebugManager', 0, '', '0x10 bytes in - 0 bytes out - InHandle<0,1>, InRaw<8,8,8>, InRaw<4,4,0>', ''),
('nn::audio::detail::IAudioDebugManager', 1, '', '0 bytes in - 0 bytes out', ''),
('nn::audio::detail::IAudioDebugManager', 2, '', '0 bytes in - 0 bytes out', ''),
('nn::audio::detail::IAudioDebugManager', 3, '', '0 bytes in - 0 bytes out', ''),
('nn::audio::detail::IAudioInManager', 0, '', '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioInManager', 1, '', '0x10 bytes in - 0x10 bytes out - takes pid - OutObject<0,0>, Buffer<0,5,0>, InRaw<8,4,0>, InHandle<0,1>, OutRaw<0x10,4,0>, Buffer<1,6,0>, InRaw<8,8,8>', ''),
('nn::audio::detail::IAudioInManager', 2, '', '0 bytes in - 4 bytes out - Buffer<0,0x22,0>, OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioInManager', 3, '', '0x10 bytes in - 0x10 bytes out - takes pid - OutObject<0,0>, Buffer<0,0x21,0>, InRaw<8,4,0>, InHandle<0,1>, OutRaw<0x10,4,0>, Buffer<1,0x22,0>, InRaw<8,8,8>', ''),
('nn::audio::detail::IAudioInManager', 4, '', '0 bytes in - 4 bytes out - Buffer<0,0x22,0>, OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioIn', 0, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioIn', 1, '', '0 bytes in - 0 bytes out', ''),
('nn::audio::detail::IAudioIn', 2, '', '0 bytes in - 0 bytes out', ''),
('nn::audio::detail::IAudioIn', 3, '', '8 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<8,8,0>', ''),
('nn::audio::detail::IAudioIn', 4, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::audio::detail::IAudioIn', 5, '', '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioIn', 6, '', '8 bytes in - 1 bytes out - InRaw<8,8,0>, OutRaw<1,1,0>', ''),
('nn::audio::detail::IAudioIn', 7, '', '8 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<8,8,0>, InHandle<0,1>', ''),
('nn::audio::detail::IAudioIn', 8, '', '8 bytes in - 0 bytes out - Buffer<0,0x21,0>, InRaw<8,8,0>', ''),
('nn::audio::detail::IAudioIn', 9, '', '0 bytes in - 4 bytes out - Buffer<0,0x22,0>, OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioIn', 10, '', '8 bytes in - 0 bytes out - Buffer<0,0x21,0>, InRaw<8,8,0>, InHandle<0,1>', ''),
('nn::audio::detail::IAudioInManagerForApplet', 0, '', '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>', ''),
('nn::audio::detail::IAudioInManagerForApplet', 1, '', '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>', ''),
('nn::audio::detail::IAudioInManagerForApplet', 2, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>', ''),
('nn::audio::detail::IAudioInManagerForApplet', 3, '', '0x18 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<8,8,0x10>', ''),
('nn::audio::detail::IAudioInManagerForDebugger', 0, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::audio::detail::IAudioInManagerForDebugger', 1, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::audio::detail::IAudioOutManager', 0, '', '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioOutManager', 1, '', '0x10 bytes in - 0x10 bytes out - takes pid - OutObject<0,0>, Buffer<0,5,0>, InRaw<8,4,0>, InHandle<0,1>, OutRaw<0x10,4,0>, Buffer<1,6,0>, InRaw<8,8,8>', ''),
('nn::audio::detail::IAudioOutManager', 2, '', '0 bytes in - 4 bytes out - Buffer<0,0x22,0>, OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioOutManager', 3, '', '0x10 bytes in - 0x10 bytes out - takes pid - OutObject<0,0>, Buffer<0,0x21,0>, InRaw<8,4,0>, InHandle<0,1>, OutRaw<0x10,4,0>, Buffer<1,0x22,0>, InRaw<8,8,8>', ''),
('nn::audio::detail::IAudioOut', 0, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioOut', 1, '', '0 bytes in - 0 bytes out', ''),
('nn::audio::detail::IAudioOut', 2, '', '0 bytes in - 0 bytes out', ''),
('nn::audio::detail::IAudioOut', 3, '', '8 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<8,8,0>', ''),
('nn::audio::detail::IAudioOut', 4, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::audio::detail::IAudioOut', 5, '', '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioOut', 6, '', '8 bytes in - 1 bytes out - InRaw<8,8,0>, OutRaw<1,1,0>', ''),
('nn::audio::detail::IAudioOut', 7, '', '8 bytes in - 0 bytes out - Buffer<0,0x21,0>, InRaw<8,8,0>', ''),
('nn::audio::detail::IAudioOut', 8, '', '0 bytes in - 4 bytes out - Buffer<0,0x22,0>, OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioOutManagerForApplet', 0, '', '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>', ''),
('nn::audio::detail::IAudioOutManagerForApplet', 1, '', '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>', ''),
('nn::audio::detail::IAudioOutManagerForApplet', 2, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>', ''),
('nn::audio::detail::IAudioOutManagerForApplet', 3, '', '0x18 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<8,8,0x10>', ''),
('nn::audio::detail::IAudioOutManagerForDebugger', 0, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::audio::detail::IAudioOutManagerForDebugger', 1, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::audio::detail::IAudioRendererManager', 0, '', '0x48 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<0x34,4,0>, InHandle<0,1>, InHandle<1,1>, InRaw<8,8,0x38>, InRaw<8,8,0x40>', ''),
('nn::audio::detail::IAudioRendererManager', 1, '', '0x34 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<0x34,4,0>', ''),
('nn::audio::detail::IAudioRendererManager', 2, '', '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,0>', ''),
('nn::audio::detail::IAudioRendererManager', 3, '', '0x50 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<0x34,4,0>, InRaw<8,8,0x38>, InHandle<0,1>, InRaw<8,8,0x40>, InRaw<8,8,0x48>', ''),
('nn::audio::detail::IAudioRenderer', 0, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioRenderer', 1, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioRenderer', 2, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioRenderer', 3, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioRenderer', 4, '', '0 bytes in - 0 bytes out - Buffer<0,6,0>, Buffer<1,6,0>, Buffer<2,5,0>', ''),
('nn::audio::detail::IAudioRenderer', 5, '', '0 bytes in - 0 bytes out', ''),
('nn::audio::detail::IAudioRenderer', 6, '', '0 bytes in - 0 bytes out', ''),
('nn::audio::detail::IAudioRenderer', 7, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::audio::detail::IAudioRenderer', 8, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>', ''),
('nn::audio::detail::IAudioRenderer', 9, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioRenderer', 10, '', '0 bytes in - 0 bytes out - Buffer<0,0x22,0>, Buffer<1,0x22,0>, Buffer<2,0x21,0>', ''),
('nn::audio::detail::IAudioRenderer', 11, '', '0 bytes in - 0 bytes out', ''),
('nn::audio::detail::IAudioDevice', 0, '', '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioDevice', 1, '', '4 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<4,4,0>', ''),
('nn::audio::detail::IAudioDevice', 2, '', '0 bytes in - 4 bytes out - Buffer<0,5,0>, OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioDevice', 3, '', '0 bytes in - 0 bytes out - Buffer<0,6,0>', ''),
('nn::audio::detail::IAudioDevice', 4, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::audio::detail::IAudioDevice', 5, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioDevice', 6, '', '0 bytes in - 4 bytes out - Buffer<0,0x22,0>, OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioDevice', 7, '', '4 bytes in - 0 bytes out - Buffer<0,0x21,0>, InRaw<4,4,0>', ''),
('nn::audio::detail::IAudioDevice', 8, '', '0 bytes in - 4 bytes out - Buffer<0,0x21,0>, OutRaw<4,4,0>', ''),
('nn::audio::detail::IAudioDevice', 10, '', '0 bytes in - 0 bytes out - Buffer<0,0x22,0>', ''),
('nn::audio::detail::IAudioDevice', 11, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::audio::detail::IAudioDevice', 12, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::audio::detail::IAudioRendererManagerForApplet', 0, '', '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>', ''),
('nn::audio::detail::IAudioRendererManagerForApplet', 1, '', '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>', ''),
('nn::audio::detail::IAudioRendererManagerForApplet', 2, '', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>', ''),
('nn::audio::detail::IAudioRendererManagerForApplet', 3, '', '0x18 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<8,8,0x10>', ''),
('nn::audio::detail::IAudioRendererManagerForApplet', 4, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::audio::detail::IAudioRendererManagerForApplet', 5, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::audio::detail::IAudioRendererManagerForDebugger', 0, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::audio::detail::IAudioRendererManagerForDebugger', 1, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::audio::detail::IFinalOutputRecorderManager', 0, '', '0x10 bytes in - 0x10 bytes out - OutObject<0,0>, InRaw<8,4,0>, InHandle<0,1>, OutRaw<0x10,4,0>, InRaw<8,8,8>', ''),
('nn::audio::detail::IFinalOutputRecorder', 0, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::audio::detail::IFinalOutputRecorder', 1, '', '0 bytes in - 0 bytes out', ''),
('nn::audio::detail::IFinalOutputRecorder', 2, '', '0 bytes in - 0 bytes out', ''),
('nn::audio::detail::IFinalOutputRecorder', 3, '', '8 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<8,8,0>', ''),
('nn::audio::detail::IFinalOutputRecorder', 4, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::audio::detail::IFinalOutputRecorder', 5, '', '0 bytes in - 0x10 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, OutRaw<8,8,8>', ''),
('nn::audio::detail::IFinalOutputRecorder', 6, '', '8 bytes in - 1 bytes out - InRaw<8,8,0>, OutRaw<1,1,0>', ''),
('nn::audio::detail::IFinalOutputRecorder', 7, '', '8 bytes in - 8 bytes out - InRaw<8,8,0>, OutRaw<8,8,0>', ''),
('nn::audio::detail::IFinalOutputRecorder', 8, '', '8 bytes in - 0 bytes out - Buffer<0,0x21,0>, InRaw<8,8,0>', ''),
('nn::audio::detail::IFinalOutputRecorder', 9, '', '0 bytes in - 0x10 bytes out - Buffer<0,0x22,0>, OutRaw<4,4,0>, OutRaw<8,8,8>', ''),
('nn::audio::detail::IFinalOutputRecorderManagerForDebugger', 0, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::audio::detail::IFinalOutputRecorderManagerForDebugger', 1, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::audio::detail::IFinalOutputRecorderManagerForApplet', 0, '', '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>', ''),
('nn::audio::detail::IFinalOutputRecorderManagerForApplet', 1, '', '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>', ''),
('nn::mii::detail::IStaticService', 0, 'GetDatabaseService', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::mii::detail::IDatabaseService>,void>,int)'),
('nn::mii::detail::IDatabaseService', 0, 'IsUpdated', '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>', '(nn::sf::Out<bool,void>,int)'),
('nn::mii::detail::IDatabaseService', 1, 'IsFullDatabase', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::mii::detail::IDatabaseService', 2, 'GetCount', '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>', '(nn::sf::Out<int,void>,int)'),
('nn::mii::detail::IDatabaseService', 3, 'Get', '4 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<4,4,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::mii::CharInfoElement> const&,int)'),
('nn::mii::detail::IDatabaseService', 4, 'Get1', '4 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<4,4,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::mii::CharInfo> const&,int)'),
('nn::mii::detail::IDatabaseService', 5, 'UpdateLatest', '0x5C bytes in - 0x58 bytes out - OutRaw<0x58,4,0>, InRaw<0x58,4,0>, InRaw<4,4,0x58>', '(nn::sf::Out<nn::mii::CharInfo,void>,nn::mii::CharInfo const&,int)'),
('nn::mii::detail::IDatabaseService', 6, 'BuildRandom', '0xC bytes in - 0x58 bytes out - OutRaw<0x58,4,0>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>', '(nn::sf::Out<nn::mii::CharInfo,void>,int,int,int)'),
('nn::mii::detail::IDatabaseService', 7, 'BuildDefault', '4 bytes in - 0x58 bytes out - OutRaw<0x58,4,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::mii::CharInfo,void>,int)'),
('nn::mii::detail::IDatabaseService', 8, 'Get2', '4 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<4,4,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::mii::StoreDataElement> const&,int)'),
('nn::mii::detail::IDatabaseService', 9, 'Get3', '4 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<4,4,0>', '(nn::sf::Out<int,void>,nn::sf::OutArray<nn::mii::StoreData> const&,int)'),
('nn::mii::detail::IDatabaseService', 10, 'UpdateLatest1', '0x48 bytes in - 0x44 bytes out - OutRaw<0x44,4,0>, InRaw<0x44,4,0>, InRaw<4,4,0x44>', '(nn::sf::Out<nn::mii::StoreData,void>,nn::mii::StoreData const&,int)'),
('nn::mii::detail::IDatabaseService', 11, 'FindIndex', '0x11 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<0x10,1,0>, InRaw<1,1,0x10>', '(nn::sf::Out<int,void>,nn::mii::CreateId const&,bool)'),
('nn::mii::detail::IDatabaseService', 12, 'Move', '0x14 bytes in - 0 bytes out - InRaw<4,4,0x10>, InRaw<0x10,1,0>', '(int,nn::mii::CreateId const&)'),
('nn::mii::detail::IDatabaseService', 13, 'AddOrReplace', '0x44 bytes in - 0 bytes out - InRaw<0x44,4,0>', '(nn::mii::StoreData const&)'),
('nn::mii::detail::IDatabaseService', 14, 'Delete', '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>', '(nn::mii::CreateId const&)'),
('nn::mii::detail::IDatabaseService', 15, 'DestroyFile', '0 bytes in - 0 bytes out', '(void)'),
('nn::mii::detail::IDatabaseService', 16, 'DeleteFile', '0 bytes in - 0 bytes out', '(void)'),
('nn::mii::detail::IDatabaseService', 17, 'Format', '0 bytes in - 0 bytes out', '(void)'),
('nn::mii::detail::IDatabaseService', 18, 'Import', '0 bytes in - 0 bytes out - Buffer<0,5,0>', '(nn::sf::InBuffer const&)'),
('nn::mii::detail::IDatabaseService', 19, 'Export', '0 bytes in - 0 bytes out - Buffer<0,6,0>', '(nn::sf::OutBuffer const&)'),
('nn::mii::detail::IDatabaseService', 20, 'IsBrokenDatabaseWithClearFlag', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::mii::detail::IDatabaseService', 21, 'GetIndex', '0x58 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<0x58,4,0>', '(nn::sf::Out<int,void>,nn::mii::CharInfo const&)'),
('nn::pl::detail::ISharedFontManager', 0, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>', ''),
('nn::pl::detail::ISharedFontManager', 1, '', '4 bytes in - 4 bytes out - InRaw<4,4,0>, OutRaw<4,4,0>', ''),
('nn::pl::detail::ISharedFontManager', 2, '', '4 bytes in - 4 bytes out - InRaw<4,4,0>, OutRaw<4,4,0>', ''),
('nn::pl::detail::ISharedFontManager', 3, '', '4 bytes in - 4 bytes out - InRaw<4,4,0>, OutRaw<4,4,0>', ''),
('nn::pl::detail::ISharedFontManager', 4, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::pl::detail::ISharedFontManager', 5, '', '8 bytes in - 8 bytes out - OutRaw<1,1,0>, OutRaw<4,4,4>, Buffer<0,6,0>, Buffer<1,6,0>, Buffer<2,6,0>, InRaw<8,1,0>', ''),
('nn::visrv::sf::IManagerRootService', 2, 'GetDisplayService', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::visrv::sf::IApplicationDisplayService>,void>,unsigned int)'),
('nn::visrv::sf::IManagerRootService', 3, 'GetDisplayServiceWithProxyNameExchange', '0xC bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,8>, InRaw<8,1,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::visrv::sf::IApplicationDisplayService>,void>,unsigned int,nn::vi::ProxyName)'),
('nn::visrv::sf::IApplicationDisplayService', 100, 'GetRelayService', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nns::hosbinder::IHOSBinderDriver>,void>)'),
('nn::visrv::sf::IApplicationDisplayService', 101, 'GetSystemDisplayService', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::visrv::sf::ISystemDisplayService>,void>)'),
('nn::visrv::sf::IApplicationDisplayService', 102, 'GetManagerDisplayService', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::visrv::sf::IManagerDisplayService>,void>)'),
('nn::visrv::sf::IApplicationDisplayService', 103, 'GetIndirectDisplayTransactionService', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nns::hosbinder::IHOSBinderDriver>,void>)'),
('nn::visrv::sf::IApplicationDisplayService', 1000, 'ListDisplays', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>', '(nn::sf::Out<long,void>,nn::sf::OutArray<nn::vi::DisplayInfo> const&)'),
('nn::visrv::sf::IApplicationDisplayService', 1010, 'OpenDisplay', '0x40 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<0x40,1,0>', '(nn::sf::Out<unsigned long,void>,nn::vi::DisplayName const&)'),
('nn::visrv::sf::IApplicationDisplayService', 1011, 'OpenDefaultDisplay', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<unsigned long,void>)'),
('nn::visrv::sf::IApplicationDisplayService', 1020, 'CloseDisplay', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(unsigned long)'),
('nn::visrv::sf::IApplicationDisplayService', 1101, 'SetDisplayEnabled', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>', '(unsigned long,bool)'),
('nn::visrv::sf::IApplicationDisplayService', 1102, 'GetDisplayResolution', '8 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>, InRaw<8,8,0>', '(nn::sf::Out<long,void>,nn::sf::Out<long,void>,unsigned long)'),
('nn::visrv::sf::IApplicationDisplayService', 2020, 'OpenLayer', '0x50 bytes in - 8 bytes out - takes pid - OutRaw<8,8,0>, Buffer<0,6,0>, InRaw<8,8,0x40>, InRaw<0x40,1,0>, InRaw<8,8,0x48>', '(nn::sf::Out<long,void>,nn::sf::OutBuffer const&,unsigned long,nn::vi::DisplayName const&,nn::applet::AppletResourceUserId)'),
('nn::visrv::sf::IApplicationDisplayService', 2021, 'CloseLayer', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(unsigned long)'),
('nn::visrv::sf::IApplicationDisplayService', 2030, 'CreateStrayLayer', '0x10 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>, Buffer<0,6,0>, InRaw<8,8,8>, InRaw<4,4,0>', '(nn::sf::Out<unsigned long,void>,nn::sf::Out<long,void>,nn::sf::OutBuffer const&,unsigned long,unsigned int)'),
('nn::visrv::sf::IApplicationDisplayService', 2031, 'DestroyStrayLayer', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(unsigned long)'),
('nn::visrv::sf::IApplicationDisplayService', 2101, 'SetLayerScalingMode', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>', '(unsigned long,unsigned int)'),
('nn::visrv::sf::IApplicationDisplayService', 2450, 'GetIndirectLayerImageMap', '0x20 bytes in - 0x10 bytes out - takes pid - OutRaw<8,8,0>, OutRaw<8,8,8>, Buffer<0,0x46,0>, InRaw<8,8,0>, InRaw<8,8,8>, InRaw<8,8,0x10>, InRaw<8,8,0x18>', '(nn::sf::Out<long,void>,nn::sf::Out<long,void>,nn::sf::OutBuffer const&,long,long,unsigned long,nn::applet::AppletResourceUserId)'),
('nn::visrv::sf::IApplicationDisplayService', 2451, 'GetIndirectLayerImageCropMap', '0x30 bytes in - 0x10 bytes out - takes pid - OutRaw<8,8,0>, OutRaw<8,8,8>, Buffer<0,0x46,0>, InRaw<8,8,0x10>, InRaw<8,8,0x18>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>, InRaw<4,4,0xC>, InRaw<8,8,0x20>, InRaw<8,8,0x28>', '(nn::sf::Out<long,void>,nn::sf::Out<long,void>,nn::sf::OutBuffer const&,long,long,float,float,float,float,unsigned long,nn::applet::AppletResourceUserId)'),
('nn::visrv::sf::IApplicationDisplayService', 2460, 'GetIndirectLayerImageRequiredMemoryInfo', '0x10 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>, InRaw<8,8,0>, InRaw<8,8,8>', '(nn::sf::Out<long,void>,nn::sf::Out<long,void>,long,long)'),
('nn::visrv::sf::IApplicationDisplayService', 5202, 'GetDisplayVsyncEvent', '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,unsigned long)'),
('nn::visrv::sf::IApplicationDisplayService', 5203, 'GetDisplayVsyncEventForDebug', '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,unsigned long)'),
('nns::hosbinder::IHOSBinderDriver', 0, 'TransactParcel', '0xC bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>, Buffer<0,5,0>, Buffer<1,6,0>, InRaw<4,4,8>', '(int,unsigned int,nn::sf::InBuffer const&,nn::sf::OutBuffer const&,unsigned int)'),
('nns::hosbinder::IHOSBinderDriver', 1, 'AdjustRefcount', '0xC bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>', '(int,int,int)'),
('nns::hosbinder::IHOSBinderDriver', 2, 'GetNativeHandle', '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>, OutHandle<0,1>', '(int,unsigned int,nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nns::hosbinder::IHOSBinderDriver', 3, 'TransactParcelAuto', '0xC bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>, Buffer<0,0x21,0>, Buffer<1,0x22,0>, InRaw<4,4,8>', '(int,unsigned int,nn::sf::InBuffer const&,nn::sf::OutBuffer const&,unsigned int)'),
('nn::visrv::sf::ISystemDisplayService', 1200, 'GetZOrderCountMin', '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>', '(nn::sf::Out<long,void>,unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 1202, 'GetZOrderCountMax', '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>', '(nn::sf::Out<long,void>,unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 1203, 'GetDisplayLogicalResolution', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<8,8,0>', '(nn::sf::Out<int,void>,nn::sf::Out<int,void>,unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 1204, 'SetDisplayMagnification', '0x18 bytes in - 0 bytes out - InRaw<8,8,0x10>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>, InRaw<4,4,0xC>', '(unsigned long,int,int,int,int)'),
('nn::visrv::sf::ISystemDisplayService', 2201, 'SetLayerPosition', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,4,4>', '(unsigned long,float,float)'),
('nn::visrv::sf::ISystemDisplayService', 2203, 'SetLayerSize', '0x18 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>, InRaw<8,8,0x10>', '(unsigned long,long,long)'),
('nn::visrv::sf::ISystemDisplayService', 2204, 'GetLayerZ', '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>', '(nn::sf::Out<long,void>,unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 2205, 'SetLayerZ', '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>', '(unsigned long,long)'),
('nn::visrv::sf::ISystemDisplayService', 2207, 'SetLayerVisibility', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>', '(unsigned long,bool)'),
('nn::visrv::sf::ISystemDisplayService', 2209, 'SetLayerAlpha', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>', '(unsigned long,float)'),
('nn::visrv::sf::ISystemDisplayService', 2312, 'CreateStrayLayer', '0x10 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>, Buffer<0,6,0>, InRaw<8,8,8>, InRaw<4,4,0>', '(nn::sf::Out<unsigned long,void>,nn::sf::Out<long,void>,nn::sf::OutBuffer const&,unsigned long,unsigned int)'),
('nn::visrv::sf::ISystemDisplayService', 2400, 'OpenIndirectLayer', '0x10 bytes in - 8 bytes out - takes pid - OutRaw<8,8,0>, Buffer<0,6,0>, InRaw<8,8,0>, InRaw<8,8,8>', '(nn::sf::Out<long,void>,nn::sf::OutBuffer const&,unsigned long,nn::applet::AppletResourceUserId)'),
('nn::visrv::sf::ISystemDisplayService', 2401, 'CloseIndirectLayer', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 2402, 'FlipIndirectLayer', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 3000, 'ListDisplayModes', '8 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>, InRaw<8,8,0>', '(nn::sf::Out<long,void>,nn::sf::OutArray<nn::vi::DisplayModeInfo> const&,unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 3001, 'ListDisplayRgbRanges', '8 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>, InRaw<8,8,0>', '(nn::sf::Out<long,void>,nn::sf::OutArray<unsigned int> const&,unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 3002, 'ListDisplayContentTypes', '8 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>, InRaw<8,8,0>', '(nn::sf::Out<long,void>,nn::sf::OutArray<unsigned int> const&,unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 3200, 'GetDisplayMode', '8 bytes in - 0x10 bytes out - OutRaw<0x10,4,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::vi::DisplayModeInfo,void>,unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 3201, 'SetDisplayMode', '0x18 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<0x10,4,8>', '(unsigned long,nn::vi::DisplayModeInfo const&)'),
('nn::visrv::sf::ISystemDisplayService', 3202, 'GetDisplayUnderscan', '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>', '(nn::sf::Out<long,void>,unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 3203, 'SetDisplayUnderscan', '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>', '(unsigned long,long)'),
('nn::visrv::sf::ISystemDisplayService', 3204, 'GetDisplayContentType', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>', '(nn::sf::Out<unsigned int,void>,unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 3205, 'SetDisplayContentType', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>', '(unsigned long,unsigned int)'),
('nn::visrv::sf::ISystemDisplayService', 3206, 'GetDisplayRgbRange', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>', '(nn::sf::Out<unsigned int,void>,unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 3207, 'SetDisplayRgbRange', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>', '(unsigned long,unsigned int)'),
('nn::visrv::sf::ISystemDisplayService', 3208, 'GetDisplayCmuMode', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>', '(nn::sf::Out<unsigned int,void>,unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 3209, 'SetDisplayCmuMode', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>', '(unsigned long,unsigned int)'),
('nn::visrv::sf::ISystemDisplayService', 3210, 'GetDisplayContrastRatio', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>', '(nn::sf::Out<float,void>,unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 3211, 'SetDisplayContrastRatio', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>', '(unsigned long,float)'),
('nn::visrv::sf::ISystemDisplayService', 3214, 'GetDisplayGamma', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>', '(nn::sf::Out<float,void>,unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 3215, 'SetDisplayGamma', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>', '(unsigned long,float)'),
('nn::visrv::sf::ISystemDisplayService', 3216, 'GetDisplayCmuLuma', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>', '(nn::sf::Out<float,void>,unsigned long)'),
('nn::visrv::sf::ISystemDisplayService', 3217, 'SetDisplayCmuLuma', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>', '(unsigned long,float)'),
('nn::visrv::sf::IManagerDisplayService', 1102, 'GetDisplayResolution', '8 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>, InRaw<8,8,0>', '(nn::sf::Out<long,void>,nn::sf::Out<long,void>,unsigned long)'),
('nn::visrv::sf::IManagerDisplayService', 2010, 'CreateManagedLayer', '0x18 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,8>, InRaw<4,4,0>, InRaw<8,8,0x10>', '(nn::sf::Out<unsigned long,void>,unsigned long,unsigned int,nn::applet::AppletResourceUserId)'),
('nn::visrv::sf::IManagerDisplayService', 2011, 'DestroyManagedLayer', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(unsigned long)'),
('nn::visrv::sf::IManagerDisplayService', 2050, 'CreateIndirectLayer', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<unsigned long,void>)'),
('nn::visrv::sf::IManagerDisplayService', 2051, 'DestroyIndirectLayer', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(unsigned long)'),
('nn::visrv::sf::IManagerDisplayService', 2052, 'CreateIndirectProducerEndPoint', '0x10 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>, InRaw<8,8,8>', '(nn::sf::Out<unsigned long,void>,unsigned long,nn::applet::AppletResourceUserId)'),
('nn::visrv::sf::IManagerDisplayService', 2053, 'DestroyIndirectProducerEndPoint', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(unsigned long)'),
('nn::visrv::sf::IManagerDisplayService', 2054, 'CreateIndirectConsumerEndPoint', '0x10 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>, InRaw<8,8,8>', '(nn::sf::Out<unsigned long,void>,unsigned long,nn::applet::AppletResourceUserId)'),
('nn::visrv::sf::IManagerDisplayService', 2055, 'DestroyIndirectConsumerEndPoint', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(unsigned long)'),
('nn::visrv::sf::IManagerDisplayService', 2300, 'AcquireLayerTexturePresentingEvent', '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,unsigned long)'),
('nn::visrv::sf::IManagerDisplayService', 2301, 'ReleaseLayerTexturePresentingEvent', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(unsigned long)'),
('nn::visrv::sf::IManagerDisplayService', 2302, 'GetDisplayHotplugEvent', '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,unsigned long)'),
('nn::visrv::sf::IManagerDisplayService', 2402, 'GetDisplayHotplugState', '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>', '(nn::sf::Out<unsigned int,void>,unsigned long)'),
('nn::visrv::sf::IManagerDisplayService', 4201, 'SetDisplayAlpha', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>', '(unsigned long,float)'),
('nn::visrv::sf::IManagerDisplayService', 4203, 'SetDisplayLayerStack', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>', '(unsigned long,unsigned int)'),
('nn::visrv::sf::IManagerDisplayService', 4205, 'SetDisplayPowerState', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>', '(unsigned long,unsigned int)'),
('nn::visrv::sf::IManagerDisplayService', 6000, 'AddToLayerStack', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>', '(unsigned long,unsigned int)'),
('nn::visrv::sf::IManagerDisplayService', 6001, 'RemoveFromLayerStack', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>', '(unsigned long,unsigned int)'),
('nn::visrv::sf::IManagerDisplayService', 6002, 'SetLayerVisibility', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>', '(unsigned long,bool)'),
('nn::visrv::sf::IManagerDisplayService', 7000, 'SetContentVisibility', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::visrv::sf::IManagerDisplayService', 8000, 'SetConductorLayer', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>', '(unsigned long,bool)'),
('nn::visrv::sf::IManagerDisplayService', 8100, 'SetIndirectProducerFlipOffset', '0x18 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>, InRaw<8,8,0x10>', '(unsigned long,unsigned long,nn::TimeSpan)'),
('nn::visrv::sf::ISystemRootService', 1, 'GetDisplayService', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::visrv::sf::IApplicationDisplayService>,void>,unsigned int)'),
('nn::visrv::sf::ISystemRootService', 3, 'GetDisplayServiceWithProxyNameExchange', '0xC bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,8>, InRaw<8,1,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::visrv::sf::IApplicationDisplayService>,void>,unsigned int,nn::vi::ProxyName)'),
('nn::visrv::sf::IApplicationRootService', 0, 'GetDisplayService', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::visrv::sf::IApplicationDisplayService>,void>,unsigned int)'),
('nn::hid::IHidDebugServer', 0, 'DeactivateDebugPad', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 1, 'SetDebugPadAutoPilotState', '0x18 bytes in - 0 bytes out - InRaw<0x18,4,0>', '(nn::hid::debug::DebugPadAutoPilotState const&)'),
('nn::hid::IHidDebugServer', 2, 'UnsetDebugPadAutoPilotState', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 10, 'DeactivateTouchScreen', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 11, 'SetTouchScreenAutoPilotState', '0 bytes in - 0 bytes out - Buffer<0,5,0>', '(nn::sf::InArray<nn::hid::TouchState> const&)'),
('nn::hid::IHidDebugServer', 12, 'UnsetTouchScreenAutoPilotState', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 20, 'DeactivateMouse', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 21, 'SetMouseAutoPilotState', '0x1C bytes in - 0 bytes out - InRaw<0x1C,4,0>', '(nn::hid::debug::MouseAutoPilotState const&)'),
('nn::hid::IHidDebugServer', 22, 'UnsetMouseAutoPilotState', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 30, 'DeactivateKeyboard', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 31, 'SetKeyboardAutoPilotState', '0x28 bytes in - 0 bytes out - InRaw<0x28,8,0>', '(nn::hid::debug::KeyboardAutoPilotState const&)'),
('nn::hid::IHidDebugServer', 32, 'UnsetKeyboardAutoPilotState', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 50, 'DeactivateXpad', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::hid::BasicXpadId)'),
('nn::hid::IHidDebugServer', 51, 'SetXpadAutoPilotState', '0x20 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<0x1C,4,4>', '(nn::hid::BasicXpadId,nn::hid::debug::BasicXpadAutoPilotState const&)'),
('nn::hid::IHidDebugServer', 52, 'UnsetXpadAutoPilotState', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::hid::BasicXpadId)'),
('nn::hid::IHidDebugServer', 60, 'DeactivateJoyXpad', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::hid::JoyXpadId)'),
('nn::hid::IHidDebugServer', 91, 'DeactivateGesture', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 110, 'DeactivateHomeButton', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 111, 'SetHomeButtonAutoPilotState', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::hid::debug::HomeButtonAutoPilotState)'),
('nn::hid::IHidDebugServer', 112, 'UnsetHomeButtonAutoPilotState', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 120, 'DeactivateSleepButton', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 121, 'SetSleepButtonAutoPilotState', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::hid::debug::SleepButtonAutoPilotState)'),
('nn::hid::IHidDebugServer', 122, 'UnsetSleepButtonAutoPilotState', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 123, 'DeactivateInputDetector', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 130, 'DeactivateCaptureButton', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 131, 'SetCaptureButtonAutoPilotState', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::hid::debug::CaptureButtonAutoPilotState)'),
('nn::hid::IHidDebugServer', 132, 'UnsetCaptureButtonAutoPilotState', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 133, 'SetShiftAccelerometerCalibrationValue', '0x18 bytes in - 0 bytes out - takes pid - InRaw<4,4,0>, InRaw<8,8,0x10>, InRaw<4,4,4>, InRaw<4,4,8>', '(nn::hid::SixAxisSensorHandle,nn::applet::AppletResourceUserId,float,float)'),
('nn::hid::IHidDebugServer', 134, 'GetShiftAccelerometerCalibrationValue', '0x10 bytes in - 8 bytes out - takes pid - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<8,8,8>', '(nn::sf::Out<float,void>,nn::sf::Out<float,void>,nn::hid::SixAxisSensorHandle,nn::applet::AppletResourceUserId)'),
('nn::hid::IHidDebugServer', 135, 'SetShiftGyroscopeCalibrationValue', '0x18 bytes in - 0 bytes out - takes pid - InRaw<4,4,0>, InRaw<8,8,0x10>, InRaw<4,4,4>, InRaw<4,4,8>', '(nn::hid::SixAxisSensorHandle,nn::applet::AppletResourceUserId,float,float)'),
('nn::hid::IHidDebugServer', 136, 'GetShiftGyroscopeCalibrationValue', '0x10 bytes in - 8 bytes out - takes pid - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<8,8,8>', '(nn::sf::Out<float,void>,nn::sf::Out<float,void>,nn::hid::SixAxisSensorHandle,nn::applet::AppletResourceUserId)'),
('nn::hid::IHidDebugServer', 140, 'DeactivateConsoleSixAxisSensor', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 201, 'ActivateFirmwareUpdate', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 202, 'DeactivateFirmwareUpdate', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 203, 'StartFirmwareUpdate', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::hid::system::UniquePadId)'),
('nn::hid::IHidDebugServer', 204, 'GetFirmwareUpdateStage', '0 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>', '(nn::sf::Out<long,void>,nn::sf::Out<long,void>)'),
('nn::hid::IHidDebugServer', 205, 'GetFirmwareVersion', '8 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<4,4,0>, InRaw<4,4,4>', '(nn::sf::Out<nn::hid::system::FirmwareVersion,void>,unsigned int,nn::util::BitFlagSet<32,nn::hid::system::DeviceType>)'),
('nn::hid::IHidDebugServer', 206, 'GetDestinationFirmwareVersion', '8 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<4,4,0>, InRaw<4,4,4>', '(nn::sf::Out<nn::hid::system::FirmwareVersion,void>,unsigned int,nn::util::BitFlagSet<32,nn::hid::system::DeviceType>)'),
('nn::hid::IHidDebugServer', 207, 'DiscardFirmwareInfoCacheForRevert', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidDebugServer', 208, 'StartFirmwareUpdateForRevert', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::hid::system::UniquePadId)'),
('nn::hid::IHidDebugServer', 209, 'GetAvailableFirmwareVersionForRevert', '8 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::hid::system::FirmwareVersion,void>,nn::hid::system::UniquePadId)'),
('nn::hid::IHidDebugServer', 221, 'UpdateControllerColor', '0x10 bytes in - 0 bytes out - InRaw<4,1,0>, InRaw<4,1,4>, InRaw<8,8,8>', '(nn::util::Unorm8x4,nn::util::Unorm8x4,nn::hid::system::UniquePadId)'),
('nn::hid::IHidServer', 0, 'CreateAppletResource', '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::hid::IAppletResource>,void>,nn::applet::AppletResourceUserId)'),
('nn::hid::IHidServer', 1, 'ActivateDebugPad', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidServer', 11, 'ActivateTouchScreen', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidServer', 21, 'ActivateMouse', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidServer', 31, 'ActivateKeyboard', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidServer', 40, 'AcquireXpadIdEventHandle', '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,unsigned long)'),
('nn::hid::IHidServer', 41, 'ReleaseXpadIdEventHandle', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(unsigned long)'),
('nn::hid::IHidServer', 51, 'ActivateXpad', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,nn::hid::BasicXpadId)'),
('nn::hid::IHidServer', 55, 'GetXpadIds', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>', '(nn::sf::Out<long,void>,nn::sf::OutArray<nn::hid::BasicXpadId> const&)'),
('nn::hid::IHidServer', 56, 'ActivateJoyXpad', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::hid::JoyXpadId)'),
('nn::hid::IHidServer', 58, 'GetJoyXpadLifoHandle', '4 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,nn::hid::JoyXpadId)'),
('nn::hid::IHidServer', 59, 'GetJoyXpadIds', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>', '(nn::sf::Out<long,void>,nn::sf::OutArray<nn::hid::JoyXpadId> const&)'),
('nn::hid::IHidServer', 60, 'ActivateSixAxisSensor', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::hid::BasicXpadId)'),
('nn::hid::IHidServer', 61, 'DeactivateSixAxisSensor', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::hid::BasicXpadId)'),
('nn::hid::IHidServer', 62, 'GetSixAxisSensorLifoHandle', '4 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,nn::hid::BasicXpadId)'),
('nn::hid::IHidServer', 63, 'ActivateJoySixAxisSensor', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::hid::JoyXpadId)'),
('nn::hid::IHidServer', 64, 'DeactivateJoySixAxisSensor', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::hid::JoyXpadId)'),
('nn::hid::IHidServer', 65, 'GetJoySixAxisSensorLifoHandle', '4 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,nn::hid::JoyXpadId)'),
('nn::hid::IHidServer', 66, 'StartSixAxisSensor', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)'),
('nn::hid::IHidServer', 67, 'StopSixAxisSensor', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)'),
('nn::hid::IHidServer', 68, 'IsSixAxisSensorFusionEnabled', '0x10 bytes in - 1 bytes out - takes pid - OutRaw<1,1,0>, InRaw<8,8,8>, InRaw<4,4,0>', '(nn::sf::Out<bool,void>,nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)'),
('nn::hid::IHidServer', 69, 'EnableSixAxisSensorFusion', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,4>, InRaw<1,1,0>', '(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle,bool)'),
('nn::hid::IHidServer', 70, 'SetSixAxisSensorFusionParameters', '0x18 bytes in - 0 bytes out - takes pid - InRaw<8,8,0x10>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>', '(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle,float,float)'),
('nn::hid::IHidServer', 71, 'GetSixAxisSensorFusionParameters', '0x10 bytes in - 8 bytes out - takes pid - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<8,8,8>, InRaw<4,4,0>', '(nn::sf::Out<float,void>,nn::sf::Out<float,void>,nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)'),
('nn::hid::IHidServer', 72, 'ResetSixAxisSensorFusionParameters', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)'),
('nn::hid::IHidServer', 73, 'SetAccelerometerParameters', '0x18 bytes in - 0 bytes out - takes pid - InRaw<8,8,0x10>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>', '(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle,float,float)'),
('nn::hid::IHidServer', 74, 'GetAccelerometerParameters', '0x10 bytes in - 8 bytes out - takes pid - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<8,8,8>, InRaw<4,4,0>', '(nn::sf::Out<float,void>,nn::sf::Out<float,void>,nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)'),
('nn::hid::IHidServer', 75, 'ResetAccelerometerParameters', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)'),
('nn::hid::IHidServer', 76, 'SetAccelerometerPlayMode', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,4,4>', '(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle,unsigned int)'),
('nn::hid::IHidServer', 77, 'GetAccelerometerPlayMode', '0x10 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, InRaw<8,8,8>, InRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>,nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)'),
('nn::hid::IHidServer', 78, 'ResetAccelerometerPlayMode', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)'),
('nn::hid::IHidServer', 79, 'SetGyroscopeZeroDriftMode', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,4,4>', '(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle,unsigned int)'),
('nn::hid::IHidServer', 80, 'GetGyroscopeZeroDriftMode', '0x10 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, InRaw<8,8,8>, InRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>,nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)'),
('nn::hid::IHidServer', 81, 'ResetGyroscopeZeroDriftMode', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)'),
('nn::hid::IHidServer', 82, 'IsSixAxisSensorAtRest', '0x10 bytes in - 1 bytes out - takes pid - OutRaw<1,1,0>, InRaw<8,8,8>, InRaw<4,4,0>', '(nn::sf::Out<bool,void>,nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)'),
('nn::hid::IHidServer', 91, 'ActivateGesture', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,int)'),
('nn::hid::IHidServer', 100, 'SetSupportedNpadStyleSet', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,nn::util::BitFlagSet<32,nn::hid::NpadStyleTag>)'),
('nn::hid::IHidServer', 101, 'GetSupportedNpadStyleSet', '8 bytes in - 4 bytes out - takes pid - InRaw<8,8,0>, OutRaw<4,4,0>', '(nn::applet::AppletResourceUserId,nn::sf::Out<nn::util::BitFlagSet<32,nn::hid::NpadStyleTag>,void>)'),
('nn::hid::IHidServer', 102, 'SetSupportedNpadIdType', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, Buffer<0,9,0>', '(nn::applet::AppletResourceUserId,nn::sf::InArray<unsigned int> const&)'),
('nn::hid::IHidServer', 103, 'ActivateNpad', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidServer', 104, 'DeactivateNpad', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidServer', 106, 'AcquireNpadStyleSetUpdateEventHandle', '0x18 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, OutHandle<0,1>, InRaw<4,4,0>, InRaw<8,8,0x10>', '(nn::applet::AppletResourceUserId,nn::sf::Out<nn::sf::NativeHandle,void>,unsigned int,unsigned long)'),
('nn::hid::IHidServer', 107, 'DisconnectNpad', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,unsigned int)'),
('nn::hid::IHidServer', 108, 'GetPlayerLedPattern', '4 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<4,4,0>', '(nn::sf::Out<unsigned long,void>,unsigned int)'),
('nn::hid::IHidServer', 120, 'SetNpadJoyHoldType', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>', '(nn::applet::AppletResourceUserId,long)'),
('nn::hid::IHidServer', 121, 'GetNpadJoyHoldType', '8 bytes in - 8 bytes out - takes pid - InRaw<8,8,0>, OutRaw<8,8,0>', '(nn::applet::AppletResourceUserId,nn::sf::Out<long,void>)'),
('nn::hid::IHidServer', 122, 'SetNpadJoyAssignmentModeSingleByDefault', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,unsigned int)'),
('nn::hid::IHidServer', 123, 'SetNpadJoyAssignmentModeSingle', '0x18 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<8,8,0x10>', '(nn::applet::AppletResourceUserId,unsigned int,long)'),
('nn::hid::IHidServer', 124, 'SetNpadJoyAssignmentModeDual', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,unsigned int)'),
('nn::hid::IHidServer', 125, 'MergeSingleJoyAsDualJoy', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,4,4>', '(nn::applet::AppletResourceUserId,unsigned int,unsigned int)'),
('nn::hid::IHidServer', 126, 'StartLrAssignmentMode', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidServer', 127, 'StopLrAssignmentMode', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidServer', 128, 'SetNpadHandheldActivationMode', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>', '(nn::applet::AppletResourceUserId,long)'),
('nn::hid::IHidServer', 129, 'GetNpadHandheldActivationMode', '8 bytes in - 8 bytes out - takes pid - InRaw<8,8,0>, OutRaw<8,8,0>', '(nn::applet::AppletResourceUserId,nn::sf::Out<long,void>)'),
('nn::hid::IHidServer', 130, 'SwapNpadAssignment', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,4,4>', '(nn::applet::AppletResourceUserId,unsigned int,unsigned int)'),
('nn::hid::IHidServer', 131, 'IsUnintendedHomeButtonInputProtectionEnabled', '0x10 bytes in - 1 bytes out - takes pid - OutRaw<1,1,0>, InRaw<8,8,8>, InRaw<4,4,0>', '(nn::sf::Out<bool,void>,nn::applet::AppletResourceUserId,unsigned int)'),
('nn::hid::IHidServer', 132, 'EnableUnintendedHomeButtonInputProtection', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,4>, InRaw<1,1,0>', '(nn::applet::AppletResourceUserId,unsigned int,bool)'),
('nn::hid::IHidServer', 200, 'GetVibrationDeviceInfo', '4 bytes in - 8 bytes out - OutRaw<8,4,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::hid::VibrationDeviceInfoForIpc,void>,nn::hid::VibrationDeviceHandle)'),
('nn::hid::IHidServer', 201, 'SendVibrationValue', '0x20 bytes in - 0 bytes out - takes pid - InRaw<8,8,0x18>, InRaw<4,4,0>, InRaw<0x10,4,4>', '(nn::applet::AppletResourceUserId,nn::hid::VibrationDeviceHandle,nn::hid::VibrationValue const&)'),
('nn::hid::IHidServer', 202, 'GetActualVibrationValue', '0x10 bytes in - 0x10 bytes out - takes pid - OutRaw<0x10,4,0>, InRaw<8,8,8>, InRaw<4,4,0>', '(nn::sf::Out<nn::hid::VibrationValue,void>,nn::applet::AppletResourceUserId,nn::hid::VibrationDeviceHandle)'),
('nn::hid::IHidServer', 203, 'CreateActiveVibrationDeviceList', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::hid::IActiveVibrationDeviceList>,void>)'),
('nn::hid::IHidServer', 204, 'PermitVibration', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::hid::IHidServer', 205, 'IsVibrationPermitted', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::hid::IHidServer', 206, 'SendVibrationValues', '8 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,9,0>, Buffer<1,9,0>', '(nn::applet::AppletResourceUserId,nn::sf::InArray<nn::hid::VibrationDeviceHandle> const&,nn::sf::InArray<nn::hid::VibrationValue> const&)'),
('nn::hid::IHidServer', 300, 'ActivateConsoleSixAxisSensor', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidServer', 301, 'StartConsoleSixAxisSensor', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,nn::hid::ConsoleSixAxisSensorHandle)'),
('nn::hid::IHidServer', 302, 'StopConsoleSixAxisSensor', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,nn::hid::ConsoleSixAxisSensorHandle)'),
('nn::hid::IHidServer', 400, 'IsUsbFullKeyControllerEnabled', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::hid::IHidServer', 401, 'EnableUsbFullKeyController', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::hid::IHidServer', 402, 'IsUsbFullKeyControllerConnected', '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>', '(nn::sf::Out<bool,void>,unsigned int)'),
('nn::hid::IHidServer', 1000, 'SetNpadCommunicationMode', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>', '(nn::applet::AppletResourceUserId,long)'),
('nn::hid::IHidServer', 1001, 'GetNpadCommunicationMode', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<long,void>)'),
('nn::hid::IAppletResource', 0, 'GetSharedMemoryHandle', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::hid::IActiveVibrationDeviceList', 0, 'ActivateVibrationDevice', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::hid::VibrationDeviceHandle)'),
('nn::hid::IHidSystemServer', 31, 'SendKeyboardLockKeyEvent', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::util::BitFlagSet<32,nn::hid::system::KeyboardLockKeyEvent>)'),
('nn::hid::IHidSystemServer', 101, 'AcquireHomeButtonEventHandle', '8 bytes in - 0 bytes out - takes pid - OutHandle<0,1>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 111, 'ActivateHomeButton', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 121, 'AcquireSleepButtonEventHandle', '8 bytes in - 0 bytes out - takes pid - OutHandle<0,1>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 131, 'ActivateSleepButton', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 141, 'AcquireCaptureButtonEventHandle', '8 bytes in - 0 bytes out - takes pid - OutHandle<0,1>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 151, 'ActivateCaptureButton', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 210, 'AcquireNfcDeviceUpdateEventHandle', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::hid::IHidSystemServer', 211, 'GetNpadsWithNfc', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>', '(nn::sf::Out<long,void>,nn::sf::OutArray<unsigned int> const&)'),
('nn::hid::IHidSystemServer', 212, 'AcquireNfcActivateEventHandle', '4 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,unsigned int)'),
('nn::hid::IHidSystemServer', 213, 'ActivateNfc', '0x10 bytes in - 0 bytes out - takes pid - InRaw<4,4,4>, InRaw<1,1,0>, InRaw<8,8,8>', '(unsigned int,bool,nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 230, 'AcquireIrSensorEventHandle', '4 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<4,4,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,unsigned int)'),
('nn::hid::IHidSystemServer', 231, 'ActivateIrSensor', '0x10 bytes in - 0 bytes out - takes pid - InRaw<4,4,4>, InRaw<1,1,0>, InRaw<8,8,8>', '(unsigned int,bool,nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 301, 'ActivateNpadSystem', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(unsigned int)'),
('nn::hid::IHidSystemServer', 303, 'ApplyNpadSystemCommonPolicy', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 304, 'EnableAssigningSingleOnSlSrPress', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 305, 'DisableAssigningSingleOnSlSrPress', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 306, 'GetLastActiveNpad', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>)'),
('nn::hid::IHidSystemServer', 307, 'GetNpadSystemExtStyle', '4 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>, InRaw<4,4,0>', '(nn::sf::Out<long,void>,nn::sf::Out<long,void>,unsigned int)'),
('nn::hid::IHidSystemServer', 311, 'SetNpadPlayerLedBlinkingDevice', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,4,4>', '(nn::applet::AppletResourceUserId,unsigned int,nn::util::BitFlagSet<32,nn::hid::system::DeviceType>)'),
('nn::hid::IHidSystemServer', 321, 'GetUniquePadsFromNpad', '4 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>, InRaw<4,4,0>', '(nn::sf::Out<long,void>,nn::sf::OutArray<nn::hid::system::UniquePadId> const&,unsigned int)'),
('nn::hid::IHidSystemServer', 322, 'GetIrSensorState', '0x10 bytes in - 8 bytes out - takes pid - InRaw<4,4,0>, OutRaw<8,8,0>, InRaw<8,8,8>', '(unsigned int,nn::sf::Out<long,void>,nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 323, 'GetXcdHandleForNpadWithIrSensor', '0x10 bytes in - 8 bytes out - takes pid - InRaw<4,4,0>, OutRaw<8,8,0>, InRaw<8,8,8>', '(unsigned int,nn::sf::Out<unsigned long,void>,nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 500, 'SetAppletResourceUserId', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 501, 'RegisterAppletResourceUserId', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>', '(nn::applet::AppletResourceUserId,bool)'),
('nn::hid::IHidSystemServer', 502, 'UnregisterAppletResourceUserId', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 503, 'EnableAppletToGetInput', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>', '(nn::applet::AppletResourceUserId,bool)'),
('nn::hid::IHidSystemServer', 504, 'SetAruidValidForVibration', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>', '(nn::applet::AppletResourceUserId,bool)'),
('nn::hid::IHidSystemServer', 505, 'EnableAppletToGetSixAxisSensor', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>', '(nn::applet::AppletResourceUserId,bool)'),
('nn::hid::IHidSystemServer', 510, 'SetVibrationMasterVolume', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(float)'),
('nn::hid::IHidSystemServer', 511, 'GetVibrationMasterVolume', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<float,void>)'),
('nn::hid::IHidSystemServer', 512, 'BeginPermitVibrationSession', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 513, 'EndPermitVibrationSession', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidSystemServer', 520, 'EnableHandheldHids', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidSystemServer', 521, 'DisableHandheldHids', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidSystemServer', 540, 'AcquirePlayReportControllerUsageUpdateEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::hid::IHidSystemServer', 541, 'GetPlayReportControllerUsages', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>', '(nn::sf::Out<long,void>,nn::sf::OutArray<nn::hid::system::PlayReportControllerUsage> const&)'),
('nn::hid::IHidSystemServer', 542, 'AcquirePlayReportRegisteredDeviceUpdateEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::hid::IHidSystemServer', 543, 'GetRegisteredDevices', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>', '(nn::sf::Out<long,void>,nn::sf::OutArray<nn::hid::system::RegisteredDevice> const&)'),
('nn::hid::IHidSystemServer', 544, 'AcquireConnectionTriggerTimeoutEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::hid::IHidSystemServer', 545, 'SendConnectionTrigger', '6 bytes in - 0 bytes out - InRaw<6,1,0>', '(nn::bluetooth::Address)'),
('nn::hid::IHidSystemServer', 546, 'AcquireDeviceRegisteredEventForControllerSupport', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::hid::IHidSystemServer', 547, 'GetAllowedBluetoothLinksCount', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', '(nn::sf::Out<long,void>)'),
('nn::hid::IHidSystemServer', 700, 'ActivateUniquePad', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>', '(nn::applet::AppletResourceUserId,nn::hid::system::UniquePadId)'),
('nn::hid::IHidSystemServer', 702, 'AcquireUniquePadConnectionEventHandle', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::hid::IHidSystemServer', 703, 'GetUniquePadIds', '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>', '(nn::sf::Out<long,void>,nn::sf::OutArray<nn::hid::system::UniquePadId> const&)'),
('nn::hid::IHidSystemServer', 751, 'AcquireJoyDetachOnBluetoothOffEventHandle', '8 bytes in - 0 bytes out - takes pid - OutHandle<0,1>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 800, 'ListSixAxisSensorHandles', '8 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>, InRaw<8,8,0>', '(nn::sf::Out<long,void>,nn::sf::OutArray<nn::hid::system::UniqueSixAxisSensorHandle> const&,nn::hid::system::UniquePadId)'),
('nn::hid::IHidSystemServer', 801, 'IsSixAxisSensorUserCalibrationSupported', '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>', '(nn::sf::Out<bool,void>,nn::hid::system::UniqueSixAxisSensorHandle)'),
('nn::hid::IHidSystemServer', 802, 'ResetSixAxisSensorCalibrationValues', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::hid::system::UniqueSixAxisSensorHandle)'),
('nn::hid::IHidSystemServer', 803, 'StartSixAxisSensorUserCalibration', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::hid::system::UniqueSixAxisSensorHandle)'),
('nn::hid::IHidSystemServer', 804, 'CancelSixAxisSensorUserCalibration', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::hid::system::UniqueSixAxisSensorHandle)'),
('nn::hid::IHidSystemServer', 805, 'GetUniquePadBluetoothAddress', '8 bytes in - 6 bytes out - OutRaw<6,1,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::bluetooth::Address,void>,nn::hid::system::UniquePadId)'),
('nn::hid::IHidSystemServer', 806, 'DisconnectUniquePad', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::hid::system::UniquePadId)'),
('nn::hid::IHidSystemServer', 821, 'StartAnalogStickManualCalibration', '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>', '(nn::hid::system::UniquePadId,long)'),
('nn::hid::IHidSystemServer', 822, 'RetryCurrentAnalogStickManualCalibrationStage', '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>', '(nn::hid::system::UniquePadId,long)'),
('nn::hid::IHidSystemServer', 823, 'CancelAnalogStickManualCalibration', '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>', '(nn::hid::system::UniquePadId,long)'),
('nn::hid::IHidSystemServer', 824, 'ResetAnalogStickManualCalibration', '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>', '(nn::hid::system::UniquePadId,long)'),
('nn::hid::IHidSystemServer', 850, 'IsUsbFullKeyControllerEnabled', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::hid::IHidSystemServer', 851, 'EnableUsbFullKeyController', '1 bytes in - 0 bytes out - InRaw<1,1,0>', '(bool)'),
('nn::hid::IHidSystemServer', 852, 'IsUsbConnected', '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,8,0>', '(nn::sf::Out<bool,void>,nn::hid::system::UniquePadId)'),
('nn::hid::IHidSystemServer', 900, 'ActivateInputDetector', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::hid::IHidSystemServer', 901, 'NotifyInputDetector', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::util::BitFlagSet<32,nn::hid::system::InputSourceId>)'),
('nn::hid::IHidSystemServer', 1000, 'InitializeFirmwareUpdate', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidSystemServer', 1001, 'GetFirmwareVersion', '8 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::hid::system::FirmwareVersion,void>,nn::hid::system::UniquePadId)'),
('nn::hid::IHidSystemServer', 1002, 'GetAvailableFirmwareVersion', '8 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::hid::system::FirmwareVersion,void>,nn::hid::system::UniquePadId)'),
('nn::hid::IHidSystemServer', 1003, 'IsFirmwareUpdateAvailable', '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,8,0>', '(nn::sf::Out<bool,void>,nn::hid::system::UniquePadId)'),
('nn::hid::IHidSystemServer', 1004, 'CheckFirmwareUpdateRequired', '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>', '(nn::sf::Out<long,void>,nn::hid::system::UniquePadId)'),
('nn::hid::IHidSystemServer', 1005, 'StartFirmwareUpdate', '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::hid::system::FirmwareUpdateDeviceHandle,void>,nn::hid::system::UniquePadId)'),
('nn::hid::IHidSystemServer', 1006, 'AbortFirmwareUpdate', '0 bytes in - 0 bytes out', '(void)'),
('nn::hid::IHidSystemServer', 1007, 'GetFirmwareUpdateState', '8 bytes in - 4 bytes out - OutRaw<4,1,0>, InRaw<8,8,0>', '(nn::sf::Out<nn::hid::system::FirmwareUpdateState,void>,nn::hid::system::FirmwareUpdateDeviceHandle)'),
('nn::hid::IHidTemporaryServer', 0, 'GetConsoleSixAxisSensorCalibrationValues', '0x10 bytes in - 0x18 bytes out - takes pid - OutRaw<0x18,2,0>, InRaw<8,8,8>, InRaw<4,4,0>', '(nn::sf::Out<nn::hid::tmp::ConsoleSixAxisSensorCalibrationValues,void>,nn::applet::AppletResourceUserId,nn::hid::ConsoleSixAxisSensorHandle)'),
('nn::irsensor::IIrSensorServer', 302, 'ActivateIrsensor', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::irsensor::IIrSensorServer', 303, 'DeactivateIrsensor', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::irsensor::IIrSensorServer', 304, 'GetIrsensorSharedMemoryHandle', '8 bytes in - 0 bytes out - takes pid - OutHandle<0,1>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,nn::applet::AppletResourceUserId)'),
('nn::irsensor::IIrSensorServer', 305, 'StopImageProcessor', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle)'),
('nn::irsensor::IIrSensorServer', 306, 'RunMomentProcessor', '0x30 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<0x20,8,0x10>', '(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle,nn::irsensor::PackedMomentProcessorConfig const&)'),
('nn::irsensor::IIrSensorServer', 307, 'RunClusteringProcessor', '0x38 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<0x28,8,0x10>', '(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle,nn::irsensor::PackedClusteringProcessorConfig const&)'),
('nn::irsensor::IIrSensorServer', 308, 'RunImageTransferProcessor', '0x30 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<0x18,8,0x10>, InHandle<0,1>, InRaw<8,8,0x28>', '(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle,nn::irsensor::PackedImageTransferProcessorConfig const&,nn::sf::NativeHandle &&,unsigned long)'),
('nn::irsensor::IIrSensorServer', 309, 'GetImageTransferProcessorState', '0x10 bytes in - 0x10 bytes out - takes pid - InRaw<8,8,8>, OutRaw<0x10,8,0>, Buffer<0,6,0>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,nn::sf::Out<nn::irsensor::ImageTransferProcessorState,void>,nn::sf::OutBuffer const&,nn::irsensor::IrCameraHandle)'),
('nn::irsensor::IIrSensorServer', 310, 'RunTeraPluginProcessor', '0x18 bytes in - 0 bytes out - takes pid - InRaw<8,8,0x10>, InRaw<4,4,0>, InRaw<8,2,4>', '(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle,nn::irsensor::PackedTeraPluginProcessorConfig)'),
('nn::irsensor::IIrSensorServer', 311, 'GetNpadIrCameraHandle', '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::irsensor::IrCameraHandle,void>,unsigned int)'),
('nn::irsensor::IIrSensorServer', 312, 'RunDpdProcessor', '0x18 bytes in - 0 bytes out - takes pid - InRaw<8,8,0x10>, InRaw<4,4,0>, InRaw<0xC,2,4>', '(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle,nn::irsensor::PackedDpdProcessorConfig const&)'),
('nn::irsensor::IIrSensorServer', 313, 'SuspendImageProcessor', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>', '(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle)'),
('nn::irsensor::IIrSensorServer', 314, 'CheckFirmwareVersion', '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,2,4>', '(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle,nn::irsensor::PackedMcuVersion)'),
('nn::irsensor::IIrSensorSystemServer', 500, 'SetAppletResourceUserId', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::irsensor::IIrSensorSystemServer', 501, 'RegisterAppletResourceUserId', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>', '(nn::applet::AppletResourceUserId,bool)'),
('nn::irsensor::IIrSensorSystemServer', 502, 'UnregisterAppletResourceUserId', '8 bytes in - 0 bytes out - InRaw<8,8,0>', '(nn::applet::AppletResourceUserId)'),
('nn::irsensor::IIrSensorSystemServer', 503, 'EnableAppletToGetInput', '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>', '(nn::applet::AppletResourceUserId,bool)'),
('nn::capsrv::sf::IScreenShotApplicationService', 201, 'SaveScreenShot', '0x10 bytes in - 0x20 bytes out - takes pid - OutRaw<0x20,1,0>, Buffer<0,0x45,0>, InRaw<4,4,0>, InRaw<8,8,8>, InRaw<4,4,4>', '(nn::sf::Out<nn::capsrv::ApplicationAlbumEntry,void>,nn::sf::InBuffer const&,unsigned int,nn::applet::AppletResourceUserId,unsigned int)'),
('nn::capsrv::sf::IScreenShotApplicationService', 203, 'SaveScreenShotEx0', '0x50 bytes in - 0x20 bytes out - takes pid - OutRaw<0x20,1,0>, Buffer<0,0x45,0>, InRaw<0x40,4,0>, InRaw<8,8,0x48>, InRaw<4,4,0x40>', '(nn::sf::Out<nn::capsrv::ApplicationAlbumEntry,void>,nn::sf::InBuffer const&,nn::capsrv::detail::ScreenShotAttributeEx0 const&,nn::applet::AppletResourceUserId,unsigned int)'),
('nn::ldn::detail::IUserServiceCreator', 0, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 0, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 1, '', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x480>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 2, '', '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 3, '', '0 bytes in - 2 bytes out - OutRaw<2,2,0>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 4, '', '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 5, '', '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 100, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 101, '', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x480>, Buffer<1,0xA,0>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 102, '', '0x68 bytes in - 2 bytes out - Buffer<0,0x22,0>, OutRaw<2,2,0>, InRaw<0x60,8,8>, InRaw<2,2,0>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 103, '', '0x68 bytes in - 2 bytes out - Buffer<0,0x22,0>, OutRaw<2,2,0>, InRaw<0x60,8,8>, InRaw<2,2,0>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 200, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 201, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 202, '', '0x98 bytes in - 0 bytes out - InRaw<0x20,8,0x78>, InRaw<0x44,2,0>, InRaw<0x30,1,0x44>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 203, '', '0xB8 bytes in - 0 bytes out - InRaw<0x20,8,0x98>, InRaw<0x44,2,0>, InRaw<0x20,1,0x44>, InRaw<0x30,1,0x64>, Buffer<0,9,0>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 204, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 205, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 206, '', '0 bytes in - 0 bytes out - Buffer<0,0x21,0>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 207, '', '1 bytes in - 0 bytes out - InRaw<1,1,0>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 208, '', '6 bytes in - 0 bytes out - InRaw<6,1,0>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 209, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 300, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 301, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 302, '', '0x7C bytes in - 0 bytes out - Buffer<0,0x19,0x480>, InRaw<0x44,2,0>, InRaw<0x30,1,0x44>, InRaw<4,4,0x74>, InRaw<4,4,0x78>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 303, '', '0xC0 bytes in - 0 bytes out - InRaw<0x20,8,0xA0>, InRaw<0x44,2,0>, InRaw<0x20,1,0x44>, InRaw<0x30,1,0x64>, InRaw<4,4,0x94>, InRaw<4,4,0x98>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 304, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 400, '', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', ''),
('nn::ldn::detail::IUserLocalCommunicationService', 401, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::IMonitorServiceCreator', 0, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::ldn::detail::IMonitorService', 0, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::ldn::detail::IMonitorService', 1, '', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x480>', ''),
('nn::ldn::detail::IMonitorService', 2, '', '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>', ''),
('nn::ldn::detail::IMonitorService', 3, '', '0 bytes in - 2 bytes out - OutRaw<2,2,0>', ''),
('nn::ldn::detail::IMonitorService', 4, '', '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>', ''),
('nn::ldn::detail::IMonitorService', 5, '', '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>', ''),
('nn::ldn::detail::IMonitorService', 100, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::IMonitorService', 101, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::ISystemServiceCreator', 0, '', '0 bytes in - 0 bytes out - OutObject<0,0>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 0, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 1, '', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x480>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 2, '', '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 3, '', '0 bytes in - 2 bytes out - OutRaw<2,2,0>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 4, '', '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 5, '', '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 100, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 101, '', '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x480>, Buffer<1,0xA,0>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 102, '', '0x68 bytes in - 2 bytes out - Buffer<0,0x22,0>, OutRaw<2,2,0>, InRaw<0x60,8,8>, InRaw<2,2,0>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 103, '', '0x68 bytes in - 2 bytes out - Buffer<0,0x22,0>, OutRaw<2,2,0>, InRaw<0x60,8,8>, InRaw<2,2,0>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 200, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 201, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 202, '', '0x98 bytes in - 0 bytes out - InRaw<0x20,8,0x78>, InRaw<0x44,2,0>, InRaw<0x30,1,0x44>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 203, '', '0xB8 bytes in - 0 bytes out - InRaw<0x20,8,0x98>, InRaw<0x44,2,0>, InRaw<0x20,1,0x44>, InRaw<0x30,1,0x64>, Buffer<0,9,0>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 204, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 205, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 206, '', '0 bytes in - 0 bytes out - Buffer<0,0x21,0>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 207, '', '1 bytes in - 0 bytes out - InRaw<1,1,0>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 208, '', '6 bytes in - 0 bytes out - InRaw<6,1,0>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 209, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 300, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 301, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 302, '', '0x7C bytes in - 0 bytes out - Buffer<0,0x19,0x480>, InRaw<0x44,2,0>, InRaw<0x30,1,0x44>, InRaw<4,4,0x74>, InRaw<4,4,0x78>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 303, '', '0xC0 bytes in - 0 bytes out - InRaw<0x20,8,0xA0>, InRaw<0x44,2,0>, InRaw<0x20,1,0x44>, InRaw<0x30,1,0x64>, InRaw<4,4,0x94>, InRaw<4,4,0x98>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 304, '', '0 bytes in - 0 bytes out', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 400, '', '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>', ''),
('nn::ldn::detail::ISystemLocalCommunicationService', 401, '', '0 bytes in - 0 bytes out', ''),
('nn::fgm::sf::ISession', 0, 'Initialize', '0 bytes in - 0 bytes out - OutObject<0,0>', '(nn::sf::Out<nn::sf::SharedPointer<nn::fgm::sf::IRequest>,void>)'),
('nn::fgm::sf::IRequest', 0, 'Initialize', '0x10 bytes in - 0 bytes out - takes pid - OutHandle<0,1>, InRaw<4,4,0>, InRaw<8,8,8>', '(nn::sf::Out<nn::sf::NativeHandle,void>,nn::fgm::Module,unsigned long)'),
('nn::fgm::sf::IRequest', 1, 'Set', '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>', '(unsigned int,unsigned int)'),
('nn::fgm::sf::IRequest', 2, 'Get', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>)'),
('nn::fgm::sf::IRequest', 3, 'Cancel', '0 bytes in - 0 bytes out', '(void)'),
('nn::fgm::sf::IDebugger', 0, 'Initialize', '8 bytes in - 0 bytes out - OutHandle<0,1>, InHandle<0,1>, InRaw<8,8,0>', '(nn::sf::Out<nn::sf::NativeHandle,void>,nn::sf::NativeHandle&&,unsigned long)'),
('nn::fgm::sf::IDebugger', 1, 'Read', '0 bytes in - 0xC bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, OutRaw<4,4,4>, OutRaw<4,4,8>', '(nn::sf::OutBuffer const&,nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>)'),
('nn::fgm::sf::IDebugger', 2, 'Cancel', '0 bytes in - 0 bytes out', '(void)'),
('nn::gpio::IManager', 0, '', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', ''),
('nn::gpio::IManager', 1, '', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', ''),
('nn::gpio::IManager', 2, '', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', ''),
('nn::gpio::IManager', 3, '', '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>', ''),
('nn::gpio::IManager', 4, '', '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>', ''),
('nn::gpio::IManager', 5, '', '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>', ''),
('nn::gpio::IManager', 6, '', '1 bytes in - 0 bytes out - InRaw<1,1,0>', ''),
('nn::gpio::IPadSession', 0, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>', ''),
('nn::gpio::IPadSession', 1, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::gpio::IPadSession', 2, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>', ''),
('nn::gpio::IPadSession', 3, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::gpio::IPadSession', 4, '', '1 bytes in - 0 bytes out - InRaw<1,1,0>', ''),
('nn::gpio::IPadSession', 5, '', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', ''),
('nn::gpio::IPadSession', 6, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::gpio::IPadSession', 7, '', '0 bytes in - 0 bytes out', ''),
('nn::gpio::IPadSession', 8, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>', ''),
('nn::gpio::IPadSession', 9, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::gpio::IPadSession', 10, '', '0 bytes in - 0 bytes out - OutHandle<0,1>', ''),
('nn::gpio::IPadSession', 11, '', '0 bytes in - 0 bytes out', ''),
('nn::gpio::IPadSession', 12, '', '1 bytes in - 0 bytes out - InRaw<1,1,0>', ''),
('nn::gpio::IPadSession', 13, '', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', ''),
('nn::gpio::IPadSession', 14, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>', ''),
('nn::gpio::IPadSession', 15, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::i2c::IManager', 0, '', '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,4>, InRaw<2,2,0>, InRaw<4,4,8>, InRaw<4,4,0xC>', ''),
('nn::i2c::IManager', 1, '', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', ''),
('nn::i2c::IManager', 2, '', '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>', ''),
('nn::i2c::IManager', 3, '', '0x10 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,4>, InRaw<2,2,0>, InRaw<4,4,8>, InRaw<4,4,0xC>', ''),
('nn::i2c::ISession', 0, '', '4 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<4,4,0>', ''),
('nn::i2c::ISession', 1, '', '4 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<4,4,0>', ''),
('nn::i2c::ISession', 2, '', '0 bytes in - 0 bytes out - Buffer<0,6,0>, Buffer<1,9,0>', ''),
('nn::i2c::ISession', 10, '', '4 bytes in - 0 bytes out - Buffer<0,0x21,0>, InRaw<4,4,0>', ''),
('nn::i2c::ISession', 11, '', '4 bytes in - 0 bytes out - Buffer<0,0x22,0>, InRaw<4,4,0>', ''),
('nn::i2c::ISession', 12, '', '0 bytes in - 0 bytes out - Buffer<0,0x22,0>, Buffer<1,9,0>', ''),
('nn::pcv::detail::IPcvService', 0, 'SetPowerEnabled', '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>', '(int,bool)'),
('nn::pcv::detail::IPcvService', 1, 'SetClockEnabled', '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>', '(int,bool)'),
('nn::pcv::detail::IPcvService', 2, 'SetClockRate', '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>', '(int,unsigned int)'),
('nn::pcv::detail::IPcvService', 3, 'GetClockRate', '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>,int)'),
('nn::pcv::detail::IPcvService', 4, 'GetState', '4 bytes in - 0xC bytes out - OutRaw<0xC,4,0>, InRaw<4,4,0>', '(nn::sf::Out<nn::pcv::ModuleState,void>,int)'),
('nn::pcv::detail::IPcvService', 5, 'GetPossibleClockRates', '8 bytes in - 8 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>', '(nn::sf::Out<int,void>,nn::sf::OutArray<unsigned int> const&,nn::sf::Out<int,void>,int,int)'),
('nn::pcv::detail::IPcvService', 6, 'SetMinVClockRate', '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>', '(int,unsigned int)'),
('nn::pcv::detail::IPcvService', 7, 'SetReset', '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>', '(int,bool)'),
('nn::pcv::detail::IPcvService', 8, 'SetVoltageEnabled', '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>', '(int,bool)'),
('nn::pcv::detail::IPcvService', 9, 'GetVoltageEnabled', '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>', '(nn::sf::Out<bool,void>,int)'),
('nn::pcv::detail::IPcvService', 10, 'GetVoltageRange', '4 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, OutRaw<4,4,8>, InRaw<4,4,0>', '(nn::sf::Out<int,void>,nn::sf::Out<int,void>,nn::sf::Out<int,void>,int)'),
('nn::pcv::detail::IPcvService', 11, 'SetVoltageValue', '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>', '(int,int)'),
('nn::pcv::detail::IPcvService', 12, 'GetVoltageValue', '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>', '(nn::sf::Out<int,void>,int)'),
('nn::pcv::detail::IPcvService', 13, 'GetTemperatureThresholds', '4 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>, InRaw<4,4,0>', '(nn::sf::OutArray<nn::pcv::TemperatureThreshold> const&,nn::sf::Out<int,void>,int)'),
('nn::pcv::detail::IPcvService', 14, 'SetTemperature', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::pcv::detail::IPcvService', 15, 'Initialize', '0 bytes in - 0 bytes out', '(void)'),
('nn::pcv::detail::IPcvService', 16, 'IsInitialized', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', '(nn::sf::Out<bool,void>)'),
('nn::pcv::detail::IPcvService', 17, 'Finalize', '0 bytes in - 0 bytes out', '(void)'),
('nn::pcv::detail::IPcvService', 18, 'PowerOn', '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>', '(nn::pcv::PowerControlTarget,int)'),
('nn::pcv::detail::IPcvService', 19, 'PowerOff', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(nn::pcv::PowerControlTarget)'),
('nn::pcv::detail::IPcvService', 20, 'ChangeVoltage', '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>', '(nn::pcv::PowerControlTarget,int)'),
('nn::pcv::detail::IPcvService', 21, 'GetPowerClockInfoEvent', '0 bytes in - 0 bytes out - OutHandle<0,1>', '(nn::sf::Out<nn::sf::NativeHandle,void>)'),
('nn::pcv::detail::IPcvService', 22, 'GetOscillatorClock', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', '(nn::sf::Out<unsigned int,void>)'),
('nn::pcv::detail::IPcvService', 23, 'GetDvfsTable', '8 bytes in - 4 bytes out - Buffer<0,0xA,0>, Buffer<1,0xA,0>, OutRaw<4,4,0>, InRaw<4,4,0>, InRaw<4,4,4>', '(nn::sf::OutArray<unsigned int> const&,nn::sf::OutArray<int> const&,nn::sf::Out<int,void>,int,int)'),
('nn::pcv::detail::IPcvService', 24, 'GetModuleStateTable', '4 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>, InRaw<4,4,0>', '(nn::sf::OutArray<nn::pcv::ModuleState> const&,nn::sf::Out<int,void>,int)'),
('nn::pcv::detail::IPcvService', 25, 'GetPowerDomainStateTable', '4 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>, InRaw<4,4,0>', '(nn::sf::OutArray<nn::pcv::PowerDomainState> const&,nn::sf::Out<int,void>,int)'),
('nn::pcv::detail::IPcvService', 26, 'GetFuseInfo', '4 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>, InRaw<4,4,0>', '(nn::sf::OutArray<unsigned int> const&,nn::sf::Out<int,void>,int)'),
('nn::pcv::IImmediateManager', 0, 'SetClockRate', '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>', '(int,unsigned int)'),
('nn::pcv::IArbitrationManager', 0, 'ReleaseControl', '4 bytes in - 0 bytes out - InRaw<4,4,0>', '(int)'),
('nn::pwm::IManager', 0, '', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', ''),
('nn::pwm::IManager', 1, '', '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>', ''),
('nn::pwm::IChannelSession', 0, '', '8 bytes in - 0 bytes out - InRaw<8,8,0>', ''),
('nn::pwm::IChannelSession', 1, '', '0 bytes in - 8 bytes out - OutRaw<8,8,0>', ''),
('nn::pwm::IChannelSession', 2, '', '4 bytes in - 0 bytes out - InRaw<4,4,0>', ''),
('nn::pwm::IChannelSession', 3, '', '0 bytes in - 4 bytes out - OutRaw<4,4,0>', ''),
('nn::pwm::IChannelSession', 4, '', '1 bytes in - 0 bytes out - InRaw<1,1,0>', ''),
('nn::pwm::IChannelSession', 5, '', '0 bytes in - 1 bytes out - OutRaw<1,1,0>', ''),
('nn::am::service::IWindow', 12345, '', '0 bytes in - 0 bytes out', ''), # BS entry to make this interface exist.
]
serverInfo = {
"nn::pcv::IArbitrationManager": {
"0": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "ReleaseControl"}
},
"nn::timesrv::detail::service::ISystemClock": {
"1": {"inbytes": 8, "args": "(nn::time::PosixTime)", "outbytes": 0, "name": "SetCurrentTime"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::time::PosixTime,void>)", "outbytes": 8, "name": "GetCurrentTime"},
"3": {"inbytes": 32, "args": "(nn::time::SystemClockContext const&)", "outbytes": 0, "name": "SetSystemClockContext"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::time::SystemClockContext,void>)", "outbytes": 32, "name": "GetSystemClockContext"}
},
"nn::wlan::detail::IInfraManager": {
"24": {"inbytes": 0, "outbytes": 92},
"25": {"inbytes": 2, "outbytes": 0},
"20": {"inbytes": 0, "outbytes": 0},
"21": {"inbytes": 0, "outbytes": 4},
"22": {"inbytes": 4, "outbytes": 0},
"23": {"inbytes": 4, "outbytes": 0},
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 0, "buffers": [21]},
"2": {"inbytes": 0, "outbytes": 6},
"5": {"inbytes": 124, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 0},
"7": {"inbytes": 0, "outbytes": 0},
"6": {"inbytes": 0, "outbytes": 0},
"9": {"inbytes": 0, "outbytes": 60},
"8": {"inbytes": 4, "outhandles": [1], "outbytes": 0},
"11": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"10": {"inbytes": 0, "outbytes": 4},
"13": {"inbytes": 4, "outbytes": 0},
"12": {"inbytes": 0, "outbytes": 4},
"15": {"inbytes": 0, "outbytes": 0},
"14": {"inbytes": 0, "outbytes": 0, "buffers": [10]},
"17": {"inbytes": 8, "outbytes": 0, "buffers": [9]},
"16": {"inbytes": 0, "outbytes": 0},
"19": {"inbytes": 24, "outbytes": 0},
"18": {"inbytes": 0, "outbytes": 4}
},
"nn::account::profile::IProfile": {
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::profile::ProfileBase,void>)", "outbytes": 56, "name": "GetBase"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::profile::ProfileBase,void>,nn::sf::Out<nn::account::profile::UserData,void>)", "outbytes": 56, "buffers": [26], "name": "Get"},
"10": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>)", "outbytes": 4, "name": "GetImageSize"},
"11": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "LoadImage"}
},
"nn::nim::detail::IAsyncData": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0},
"3": {"inbytes": 8, "outbytes": 8, "buffers": [6]},
"2": {"inbytes": 0, "outbytes": 8},
"4": {"inbytes": 0, "outbytes": 40}
},
"nn::pdm::detail::INotifyService": {
"0": {"inbytes": 16, "outbytes": 0},
"3": {"inbytes": 1, "outbytes": 0},
"2": {"inbytes": 1, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"4": {"inbytes": 0, "outbytes": 0}
},
"nn::htc::tenv::IService": {
"1": {"inbytes": 64, "outbytes": 8},
"0": {"inbytes": 64, "outbytes": 8, "buffers": [6]},
"2": {"inbytes": 8, "outbytes": 0}
},
"nn::codec::detail::IHardwareOpusDecoderManager": {
"1": {"inbytes": 8, "outbytes": 4},
"0": {"inbytes": 12, "inhandles": [1], "outbytes": 0, "outinterfaces": ["nn::codec::detail::IHardwareOpusDecoder"]},
"3": {"inbytes": 0, "outbytes": 4, "buffers": [25]},
"2": {"inbytes": 4, "inhandles": [1], "outbytes": 0, "buffers": [25], "outinterfaces": ["nn::codec::detail::IHardwareOpusDecoder"]}
},
"nn::hid::IHidDebugServer": {
"140": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DeactivateConsoleSixAxisSensor"},
"112": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "UnsetHomeButtonAutoPilotState"},
"133": {"inbytes": 24, "args": "(nn::hid::SixAxisSensorHandle,nn::applet::AppletResourceUserId,float,float)", "pid": True, "outbytes": 0, "name": "SetShiftAccelerometerCalibrationValue"},
"132": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "UnsetCaptureButtonAutoPilotState"},
"131": {"inbytes": 8, "args": "(nn::hid::debug::CaptureButtonAutoPilotState)", "outbytes": 0, "name": "SetCaptureButtonAutoPilotState"},
"130": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DeactivateCaptureButton"},
"111": {"inbytes": 8, "args": "(nn::hid::debug::HomeButtonAutoPilotState)", "outbytes": 0, "name": "SetHomeButtonAutoPilotState"},
"136": {"inbytes": 16, "args": "(nn::sf::Out<float,void>,nn::sf::Out<float,void>,nn::hid::SixAxisSensorHandle,nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 8, "name": "GetShiftGyroscopeCalibrationValue"},
"135": {"inbytes": 24, "args": "(nn::hid::SixAxisSensorHandle,nn::applet::AppletResourceUserId,float,float)", "pid": True, "outbytes": 0, "name": "SetShiftGyroscopeCalibrationValue"},
"134": {"inbytes": 16, "args": "(nn::sf::Out<float,void>,nn::sf::Out<float,void>,nn::hid::SixAxisSensorHandle,nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 8, "name": "GetShiftAccelerometerCalibrationValue"},
"20": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DeactivateMouse"},
"21": {"inbytes": 28, "args": "(nn::hid::debug::MouseAutoPilotState const&)", "outbytes": 0, "name": "SetMouseAutoPilotState"},
"22": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "UnsetMouseAutoPilotState"},
"1": {"inbytes": 24, "args": "(nn::hid::debug::DebugPadAutoPilotState const&)", "outbytes": 0, "name": "SetDebugPadAutoPilotState"},
"0": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DeactivateDebugPad"},
"2": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "UnsetDebugPadAutoPilotState"},
"10": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DeactivateTouchScreen"},
"201": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ActivateFirmwareUpdate"},
"203": {"inbytes": 8, "args": "(nn::hid::system::UniquePadId)", "outbytes": 0, "name": "StartFirmwareUpdate"},
"202": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DeactivateFirmwareUpdate"},
"205": {"inbytes": 8, "args": "(nn::sf::Out<nn::hid::system::FirmwareVersion,void>,unsigned int,nn::util::BitFlagSet<32,nn::hid::system::DeviceType>)", "outbytes": 16, "name": "GetFirmwareVersion"},
"204": {"inbytes": 0, "args": "(nn::sf::Out<long,void>,nn::sf::Out<long,void>)", "outbytes": 16, "name": "GetFirmwareUpdateStage"},
"207": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DiscardFirmwareInfoCacheForRevert"},
"206": {"inbytes": 8, "args": "(nn::sf::Out<nn::hid::system::FirmwareVersion,void>,unsigned int,nn::util::BitFlagSet<32,nn::hid::system::DeviceType>)", "outbytes": 16, "name": "GetDestinationFirmwareVersion"},
"209": {"inbytes": 8, "args": "(nn::sf::Out<nn::hid::system::FirmwareVersion,void>,nn::hid::system::UniquePadId)", "outbytes": 16, "name": "GetAvailableFirmwareVersionForRevert"},
"208": {"inbytes": 8, "args": "(nn::hid::system::UniquePadId)", "outbytes": 0, "name": "StartFirmwareUpdateForRevert"},
"120": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DeactivateSleepButton"},
"121": {"inbytes": 8, "args": "(nn::hid::debug::SleepButtonAutoPilotState)", "outbytes": 0, "name": "SetSleepButtonAutoPilotState"},
"122": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "UnsetSleepButtonAutoPilotState"},
"123": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DeactivateInputDetector"},
"91": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DeactivateGesture"},
"221": {"inbytes": 16, "args": "(nn::util::Unorm8x4,nn::util::Unorm8x4,nn::hid::system::UniquePadId)", "outbytes": 0, "name": "UpdateControllerColor"},
"11": {"inbytes": 0, "args": "(nn::sf::InArray<nn::hid::TouchState> const&)", "outbytes": 0, "buffers": [5], "name": "SetTouchScreenAutoPilotState"},
"60": {"inbytes": 4, "args": "(nn::hid::JoyXpadId)", "outbytes": 0, "name": "DeactivateJoyXpad"},
"12": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "UnsetTouchScreenAutoPilotState"},
"32": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "UnsetKeyboardAutoPilotState"},
"31": {"inbytes": 40, "args": "(nn::hid::debug::KeyboardAutoPilotState const&)", "outbytes": 0, "name": "SetKeyboardAutoPilotState"},
"30": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DeactivateKeyboard"},
"51": {"inbytes": 32, "args": "(nn::hid::BasicXpadId,nn::hid::debug::BasicXpadAutoPilotState const&)", "outbytes": 0, "name": "SetXpadAutoPilotState"},
"50": {"inbytes": 4, "args": "(nn::hid::BasicXpadId)", "outbytes": 0, "name": "DeactivateXpad"},
"52": {"inbytes": 4, "args": "(nn::hid::BasicXpadId)", "outbytes": 0, "name": "UnsetXpadAutoPilotState"},
"110": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DeactivateHomeButton"}
},
"nn::mii::detail::IStaticService": {
"0": {"inbytes": 4, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::mii::detail::IDatabaseService>,void>,int)", "outbytes": 0, "name": "GetDatabaseService", "outinterfaces": ["nn::mii::detail::IDatabaseService"]}
},
"nn::account::IAccountServiceForSystemService": {
"997": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "DebugInvalidateTokenCacheForUser"},
"51": {"inbytes": 1, "args": "(nn::sf::Out<nn::account::Uid,void>,bool)", "outbytes": 16, "name": "TrySelectUserWithoutInteraction"},
"6": {"inbytes": 16, "args": "(nn::sf::Out<nn::account::ProfileDigest,void>,nn::account::Uid const&)", "outbytes": 16, "name": "GetProfileDigest"},
"999": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "DebugSetUserStateOpen"},
"50": {"inbytes": 8, "args": "(nn::sf::Out<bool,void>,unsigned long)", "pid": True, "outbytes": 1, "name": "IsUserRegistrationRequestPermitted"},
"998": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "DebugSetUserStateClose"},
"190": {"inbytes": 16, "args": "(nn::sf::Out<nn::ApplicationId,void>,nn::sf::Out<unsigned int,void>,nn::account::Uid const&)", "outbytes": 16, "name": "GetUserLastOpenedApplication"},
"1": {"inbytes": 16, "args": "(nn::sf::Out<bool,void>,nn::account::Uid const&)", "outbytes": 1, "name": "GetUserExistence"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetUserCount"},
"3": {"inbytes": 0, "args": "(nn::sf::OutArray<nn::account::Uid> const&)", "outbytes": 0, "buffers": [10], "name": "ListOpenUsers"},
"2": {"inbytes": 0, "args": "(nn::sf::OutArray<nn::account::Uid> const&)", "outbytes": 0, "buffers": [10], "name": "ListAllUsers"},
"5": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::profile::IProfile>,void>,nn::account::Uid const&)", "outbytes": 0, "name": "GetProfile", "outinterfaces": ["nn::account::profile::IProfile"]},
"4": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::Uid,void>)", "outbytes": 16, "name": "GetLastOpenedUser"},
"112": {"inbytes": 24, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&,nn::account::Uid const&,nn::ApplicationId)", "outbytes": 4, "buffers": [6], "name": "LoadSaveDataThumbnail"},
"102": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::baas::IManagerForSystemService>,void>,nn::account::Uid const&)", "outbytes": 0, "name": "GetBaasAccountManagerForSystemService", "outinterfaces": ["nn::account::baas::IManagerForSystemService"]},
"103": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)", "outbytes": 0, "name": "GetBaasUserAvailabilityChangeNotifier", "outinterfaces": ["nn::account::detail::INotifier"]},
"111": {"inbytes": 24, "args": "(nn::account::Uid const&,nn::ApplicationId)", "outbytes": 0, "name": "ClearSaveDataThumbnail"},
"101": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)", "outbytes": 0, "name": "GetUserStateChangeNotifier", "outinterfaces": ["nn::account::detail::INotifier"]},
"100": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)", "outbytes": 0, "name": "GetUserRegistrationNotifier", "outinterfaces": ["nn::account::detail::INotifier"]},
"104": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)", "outbytes": 0, "name": "GetProfileUpdateNotifier", "outinterfaces": ["nn::account::detail::INotifier"]},
"110": {"inbytes": 24, "args": "(nn::account::Uid const&,nn::ApplicationId,nn::sf::InBuffer const&)", "outbytes": 0, "buffers": [5], "name": "StoreSaveDataThumbnail"}
},
"nn::settings::IFactorySettingsServer": {
"20": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::EccB233DeviceKey,void>)", "outbytes": 84, "name": "GetEciDeviceKey"},
"21": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::Rsa2048DeviceKey,void>)", "outbytes": 0, "buffers": [22], "name": "GetEticketDeviceKey"},
"22": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::SpeakerParameter,void>)", "outbytes": 90, "name": "GetSpeakerParameter"},
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::ConfigurationId1,void>)", "outbytes": 30, "name": "GetConfigurationId1"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::BdAddress,void>)", "outbytes": 6, "name": "GetBluetoothBdAddress"},
"3": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::AccelerometerScale,void>)", "outbytes": 6, "name": "GetAccelerometerScale"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::AccelerometerOffset,void>)", "outbytes": 6, "name": "GetAccelerometerOffset"},
"5": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::GyroscopeScale,void>)", "outbytes": 6, "name": "GetGyroscopeScale"},
"4": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::GyroscopeOffset,void>)", "outbytes": 6, "name": "GetGyroscopeOffset"},
"7": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetWirelessLanCountryCodeCount"},
"6": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::MacAddress,void>)", "outbytes": 6, "name": "GetWirelessLanMacAddress"},
"9": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::SerialNumber,void>)", "outbytes": 24, "name": "GetSerialNumber"},
"8": {"inbytes": 0, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::settings::factory::CountryCode> const&)", "outbytes": 4, "buffers": [10], "name": "GetWirelessLanCountryCodes"},
"11": {"inbytes": 8, "args": "(nn::ncm::ProgramId)", "outbytes": 0, "name": "SetOverlayDispProgramId"},
"10": {"inbytes": 8, "args": "(nn::ncm::ProgramId)", "outbytes": 0, "name": "SetInitialSystemAppletProgramId"},
"12": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::BatteryLot,void>)", "outbytes": 24, "name": "GetBatteryLot"},
"15": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::Rsa2048DeviceCertificate,void>)", "outbytes": 0, "buffers": [22], "name": "GetEticketDeviceCertificate"},
"14": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::EccB233DeviceCertificate,void>)", "outbytes": 0, "buffers": [22], "name": "GetEciDeviceCertificate"},
"17": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::SslCertificate,void>)", "outbytes": 0, "buffers": [22], "name": "GetSslCertificate"},
"16": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::SslKey,void>)", "outbytes": 0, "buffers": [22], "name": "GetSslKey"},
"19": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::GameCardCertificate,void>)", "outbytes": 0, "buffers": [22], "name": "GetGameCardCertificate"},
"18": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::GameCardKey,void>)", "outbytes": 0, "buffers": [22], "name": "GetGameCardKey"}
},
"nn::pinmux::IManager": {
"0": {"inbytes": 4, "outbytes": 0, "outinterfaces": ["nn::pinmux::ISession"]}
},
"nn::nfc::mifare::detail::IUser": {
"11": {"inbytes": 8, "outbytes": 4},
"10": {"inbytes": 0, "outbytes": 4},
"13": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"12": {"inbytes": 8, "outbytes": 4},
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 16, "pid": True, "outbytes": 0, "buffers": [5]},
"3": {"inbytes": 8, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 4, "buffers": [10]},
"5": {"inbytes": 8, "outbytes": 0, "buffers": [6, 5]},
"4": {"inbytes": 8, "outbytes": 0},
"7": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"6": {"inbytes": 8, "outbytes": 0, "buffers": [5]},
"9": {"inbytes": 8, "outhandles": [1], "outbytes": 0},
"8": {"inbytes": 8, "outhandles": [1], "outbytes": 0}
},
"nn::am::service::IAppletAccessor": {
"25": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Terminate"},
"20": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "RequestExit"},
"10": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Start"},
"30": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "GetResult"},
"1": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsCompleted"},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetAppletStateChangedEvent"}
},
"nv::gemcoredump::INvGemCoreDump": {
"1": {"inbytes": 0, "outbytes": 16},
"0": {"inbytes": 0, "outbytes": 4},
"2": {"inbytes": 0, "outbytes": 4, "buffers": [34]}
},
"nn::account::http::IOAuthProcedure": {
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::RequestUrl,void>,nn::sf::Out<nn::account::CallbackUri,void>)", "outbytes": 0, "buffers": [26, 26], "name": "GetRequest"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "PrepareAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"3": {"name": "ApplyResponseAsync", "inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,nn::sf::InArray<char> const&)", "outinterfaces": ["nn::account::detail::IAsyncContext"], "buffers": [9], "outbytes": 0},
"2": {"inbytes": 0, "args": "(nn::sf::InArray<char> const&)", "outbytes": 0, "buffers": [9], "name": "ApplyResponse"},
"10": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::detail::Uuid,void>)", "outbytes": 16, "name": "Suspend"}
},
"nn::tma::IHtcManager": {
"1": {"inbytes": 0, "outbytes": 4, "buffers": [5]},
"0": {"inbytes": 0, "outbytes": 4, "buffers": [6, 5]},
"3": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"2": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"5": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"4": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"7": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"6": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"8": {"inbytes": 1, "outbytes": 0}
},
"nn::uart::IPortSession": {
"1": {"inbytes": 32, "inhandles": [1, 1], "outbytes": 1},
"0": {"inbytes": 32, "inhandles": [1, 1], "outbytes": 1},
"3": {"inbytes": 0, "outbytes": 8, "buffers": [33]},
"2": {"inbytes": 0, "outbytes": 8},
"5": {"inbytes": 0, "outbytes": 8, "buffers": [34]},
"4": {"inbytes": 0, "outbytes": 8},
"7": {"inbytes": 4, "outbytes": 1},
"6": {"inbytes": 16, "outhandles": [1], "outbytes": 1}
},
"nn::am::service::ILibraryAppletAccessor": {
"150": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "RequestForAppletToGetForeground"},
"10": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Start"},
"20": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "RequestExit"},
"25": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Terminate"},
"160": {"inbytes": 8, "args": "(nn::sf::Out<unsigned long,void>,nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 8, "name": "GetIndirectLayerConsumerHandle"},
"30": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "GetResult"},
"50": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetOutOfFocusApplicationSuspendingEnabled"},
"120": {"inbytes": 0, "args": "(nn::sf::Out<nn::am::service::LibraryAppletInfo,void>)", "outbytes": 8, "name": "GetLibraryAppletInfo"},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetAppletStateChangedEvent"},
"1": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsCompleted"},
"110": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "NeedsToExitProcess"},
"102": {"inbytes": 0, "args": "(nn::sf::SharedPointer<nn::am::service::IStorage>)", "outbytes": 0, "name": "PushExtraStorage", "ininterfaces": [None]},
"103": {"inbytes": 0, "args": "(nn::sf::SharedPointer<nn::am::service::IStorage>)", "outbytes": 0, "name": "PushInteractiveInData", "ininterfaces": [None]},
"100": {"inbytes": 0, "args": "(nn::sf::SharedPointer<nn::am::service::IStorage>)", "outbytes": 0, "name": "PushInData", "ininterfaces": [None]},
"101": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>)", "outbytes": 0, "name": "PopOutData", "outinterfaces": ["nn::am::service::IStorage"]},
"106": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetPopInteractiveOutDataEvent"},
"104": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>)", "outbytes": 0, "name": "PopInteractiveOutData", "outinterfaces": ["nn::am::service::IStorage"]},
"105": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetPopOutDataEvent"}
},
"nn::ns::detail::IAccountProxyInterface": {
"0": {"inbytes": 33, "outbytes": 0, "buffers": [5]}
},
"nn::ns::detail::ISystemUpdateInterface": {
"11": {"inbytes": 0, "outbytes": 0},
"10": {"inbytes": 0, "outbytes": 0},
"13": {"inbytes": 0, "outbytes": 0},
"12": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"15": {"inbytes": 0, "outbytes": 0},
"14": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"1": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::ns::detail::ISystemUpdateControl"]},
"0": {"inbytes": 0, "outbytes": 1},
"3": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 16, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 0},
"6": {"inbytes": 0, "outbytes": 0},
"9": {"inbytes": 0, "outhandles": [1], "outbytes": 0}
},
"nn::fssrv::sf::IFile": {
"1": {"inbytes": 24, "outbytes": 0, "buffers": [69]},
"0": {"inbytes": 24, "outbytes": 8, "buffers": [70]},
"3": {"inbytes": 8, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 8}
},
"nn::psc::sf::IPmControl": {
"1": {"inbytes": 12, "outbytes": 0},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 4},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 0},
"6": {"inbytes": 0, "outbytes": 40, "buffers": [6, 6]}
},
"nn::nfc::am::detail::IAm": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 8, "outbytes": 0}
},
"nn::am::service::ISelfController": {
"60": {"inbytes": 16, "args": "(int,int,int,int)", "outbytes": 0, "name": "OverrideAutoSleepTimeAndDimmingTime"},
"61": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetMediaPlaybackState"},
"62": {"inbytes": 4, "args": "(unsigned int)", "outbytes": 0, "name": "SetIdleTimeDetectionExtension"},
"63": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>)", "outbytes": 4, "name": "GetIdleTimeDetectionExtension"},
"64": {"inbytes": 4, "args": "(unsigned int)", "outbytes": 0, "name": "SetInputDetectionSourceSet"},
"65": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ReportUserIsActive"},
"66": {"inbytes": 0, "args": "(nn::sf::Out<float,void>)", "outbytes": 4, "name": "GetCurrentIlluminance"},
"67": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsIlluminanceAvailable"},
"40": {"inbytes": 0, "args": "(nn::sf::Out<unsigned long,void>)", "outbytes": 8, "name": "CreateManagedDisplayLayer"},
"1": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "LockExit"},
"0": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Exit"},
"3": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "EnterFatalSection"},
"2": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "UnlockExit"},
"4": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "LeaveFatalSection"},
"9": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetLibraryAppletLaunchableEvent"},
"11": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetOperationModeChangedNotification"},
"10": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "SetScreenShotPermission"},
"13": {"inbytes": 3, "args": "(bool,bool,bool)", "outbytes": 0, "name": "SetFocusHandlingMode"},
"12": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetPerformanceModeChangedNotification"},
"15": {"inbytes": 16, "args": "(nn::am::service::AppletIdentityInfo const&)", "outbytes": 0, "name": "SetScreenShotAppletIdentityInfo"},
"14": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetRestartMessageEnabled"},
"17": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetControllerFirmwareUpdateSection"},
"16": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetOutOfFocusSuspendingEnabled"},
"19": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "SetScreenShotImageOrientation"},
"18": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetRequiresCaptureButtonShortPressedMessage"},
"51": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ApproveToDisplay"},
"50": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetHandlesRequestToDisplay"}
},
"nn::usb::hs::IClientIfSession": {
"1": {"inbytes": 1, "outbytes": 0, "buffers": [6]},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"3": {"inbytes": 1, "outbytes": 0, "buffers": [6]},
"2": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"5": {"inbytes": 16, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 4},
"7": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"6": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"9": {"inbytes": 20, "outbytes": 7, "outinterfaces": ["nn::usb::hs::IClientEpSession"]},
"8": {"inbytes": 0, "outbytes": 0}
},
"nn::erpt::sf::IManager": {
"1": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"0": {"inbytes": 4, "outbytes": 0, "buffers": [6]}
},
"nn::fssrv::sf::IDirectory": {
"1": {"inbytes": 0, "outbytes": 8},
"0": {"inbytes": 0, "outbytes": 8, "buffers": [6]}
},
"nn::nim::detail::INetworkInstallManager": {
"42": {"inbytes": 16, "outbytes": 16},
"29": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncValue"]},
"24": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "buffers": [5, 5], "outinterfaces": ["nn::nim::detail::IAsyncValue"]},
"25": {"inbytes": 16, "outhandles": [1], "outbytes": 0, "buffers": [5, 5], "outinterfaces": ["nn::nim::detail::IAsyncResult"]},
"26": {"inbytes": 40, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncResult"]},
"27": {"inbytes": 40, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncData"]},
"20": {"inbytes": 16, "outbytes": 8},
"21": {"inbytes": 16, "outbytes": 1},
"22": {"inbytes": 0, "outbytes": 16},
"23": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncValue"]},
"46": {"inbytes": 0, "outbytes": 0},
"44": {"inbytes": 16, "outbytes": 1},
"45": {"inbytes": 40, "outbytes": 8},
"28": {"inbytes": 16, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncValue"]},
"43": {"inbytes": 0, "outbytes": 16},
"40": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"41": {"inbytes": 16, "outbytes": 0},
"1": {"inbytes": 16, "outbytes": 0},
"0": {"inbytes": 24, "outbytes": 16},
"3": {"inbytes": 16, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncResult"]},
"2": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"5": {"inbytes": 16, "outbytes": 0},
"4": {"inbytes": 16, "outbytes": 56},
"7": {"inbytes": 16, "outbytes": 0},
"6": {"inbytes": 16, "outbytes": 16, "buffers": [5]},
"9": {"inbytes": 16, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncResult"]},
"8": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"12": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncValue"]},
"11": {"inbytes": 16, "outbytes": 0},
"10": {"inbytes": 16, "outbytes": 64},
"39": {"inbytes": 0, "outbytes": 0},
"38": {"inbytes": 16, "outbytes": 8},
"15": {"inbytes": 20, "outbytes": 4, "buffers": [6]},
"14": {"inbytes": 8, "outbytes": 4, "buffers": [6]},
"17": {"inbytes": 24, "outbytes": 0},
"16": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncValue"]},
"19": {"inbytes": 24, "outbytes": 0, "buffers": [22]},
"18": {"inbytes": 16, "outbytes": 0, "buffers": [5]},
"31": {"inbytes": 32, "outbytes": 16, "buffers": [5]},
"30": {"inbytes": 40, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncData"]},
"37": {"inbytes": 16, "outbytes": 0},
"36": {"inbytes": 20, "outbytes": 4, "buffers": [6]},
"35": {"inbytes": 16, "outbytes": 48},
"34": {"inbytes": 16, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncResult"]},
"33": {"inbytes": 8, "outbytes": 4, "buffers": [6]},
"32": {"inbytes": 16, "outbytes": 0}
},
"nn::fssrv::sf::IProgramRegistry": {
"1": {"inbytes": 8, "outbytes": 0},
"0": {"inbytes": 40, "outbytes": 0, "buffers": [5, 5]},
"256": {"inbytes": 1, "outbytes": 0}
},
"nn::usb::pd::detail::IPdCradleManager": {
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::usb::pd::detail::IPdCradleSession"]}
},
"nn::nfp::detail::IDebugManager": {
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::nfp::detail::IDebug"]}
},
"nn::account::baas::IGuestLoginRequest": {
"13": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::NintendoAccountId,void>)", "outbytes": 8, "name": "GetLinkedNintendoAccountId"},
"12": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::NetworkServiceAccountId,void>)", "outbytes": 8, "name": "GetAccountId"},
"15": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "GetProfileImage"},
"14": {"inbytes": 0, "args": "(nn::sf::OutArray<char> const&)", "outbytes": 0, "buffers": [10], "name": "GetNickname"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::detail::Uuid,void>)", "outbytes": 16, "name": "GetSessionId"},
"21": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "LoadIdTokenCache"}
},
"nn::nim::detail::IShopServiceManager": {
"200": {"inbytes": 40, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncResult"]},
"300": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncResult"]},
"301": {"inbytes": 16, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncResult"]},
"302": {"inbytes": 16, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncResult"]},
"303": {"inbytes": 16, "outbytes": 1},
"105": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncResult"]},
"1": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncValue"]},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncValue"]},
"104": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncValue"]},
"400": {"inbytes": 4, "outbytes": 16},
"102": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncValue"]},
"103": {"inbytes": 0, "outbytes": 32},
"100": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncResult"]},
"101": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncResult"]},
"106": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncResult"]},
"107": {"inbytes": 8, "outbytes": 1},
"500": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncProgressResult"]},
"501": {"inbytes": 16, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::nim::detail::IAsyncResult"]}
},
"nn::bluetooth::IBluetoothDriver": {
"42": {"inbytes": 0, "outbytes": 1},
"29": {"inbytes": 7, "outbytes": 0},
"24": {"inbytes": 0, "outbytes": 0, "buffers": [25]},
"25": {"inbytes": 6, "outbytes": 0, "buffers": [26]},
"26": {"inbytes": 0, "outbytes": 0},
"27": {"inbytes": 0, "outbytes": 4, "buffers": [10]},
"20": {"inbytes": 6, "outbytes": 0, "buffers": [9]},
"21": {"inbytes": 12, "outbytes": 0, "buffers": [25]},
"22": {"inbytes": 12, "outbytes": 0},
"23": {"inbytes": 6, "outbytes": 0},
"44": {"inbytes": 0, "outbytes": 1},
"28": {"inbytes": 7, "outbytes": 0},
"43": {"inbytes": 1, "outbytes": 0},
"40": {"inbytes": 0, "outbytes": 0, "buffers": [22]},
"41": {"inbytes": 1, "outbytes": 0},
"1": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 0, "buffers": [26]},
"4": {"inbytes": 0, "outbytes": 0},
"7": {"inbytes": 4, "outbytes": 0, "buffers": [9]},
"6": {"inbytes": 4, "outbytes": 0, "buffers": [10]},
"9": {"inbytes": 0, "outbytes": 0},
"8": {"inbytes": 0, "outbytes": 0},
"13": {"inbytes": 24, "outbytes": 0},
"12": {"inbytes": 6, "outbytes": 0},
"11": {"inbytes": 6, "outbytes": 0},
"10": {"inbytes": 6, "outbytes": 0, "buffers": [25]},
"39": {"inbytes": 0, "outbytes": 0},
"38": {"inbytes": 0, "outbytes": 0, "buffers": [22]},
"15": {"inbytes": 0, "outbytes": 4, "buffers": [10]},
"14": {"inbytes": 12, "outbytes": 0},
"17": {"inbytes": 6, "outbytes": 0},
"16": {"inbytes": 2, "outhandles": [1], "outbytes": 0},
"19": {"inbytes": 6, "outbytes": 0, "buffers": [25]},
"18": {"inbytes": 6, "outbytes": 0},
"31": {"inbytes": 1, "outbytes": 0},
"30": {"inbytes": 6, "outbytes": 0, "buffers": [9]},
"37": {"inbytes": 0, "outbytes": 4, "buffers": [10]},
"36": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"35": {"inbytes": 2, "outbytes": 0},
"34": {"inbytes": 1, "outbytes": 0},
"33": {"inbytes": 0, "outbytes": 0},
"32": {"inbytes": 0, "outbytes": 0}
},
"nn::bgtc::ITaskService": {
"11": {"inbytes": 4, "outbytes": 0},
"13": {"inbytes": 0, "outbytes": 0},
"12": {"inbytes": 0, "outbytes": 4},
"15": {"inbytes": 8, "outbytes": 0},
"14": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"1": {"inbytes": 0, "outbytes": 0},
"3": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 0, "buffers": [9]},
"4": {"inbytes": 0, "outbytes": 1},
"6": {"inbytes": 0, "outbytes": 1},
"102": {"inbytes": 0, "outbytes": 1},
"103": {"inbytes": 0, "outbytes": 1},
"101": {"inbytes": 0, "outbytes": 4}
},
"nn::mmnv::IRequest": {
"1": {"inbytes": 4, "outbytes": 0},
"0": {"inbytes": 12, "outbytes": 0},
"3": {"inbytes": 4, "outbytes": 4},
"2": {"inbytes": 12, "outbytes": 0},
"5": {"inbytes": 4, "outbytes": 0},
"4": {"inbytes": 12, "outbytes": 4},
"7": {"inbytes": 4, "outbytes": 4},
"6": {"inbytes": 12, "outbytes": 0}
},
"nn::ldn::detail::IMonitorService": {
"1": {"inbytes": 0, "outbytes": 0, "buffers": [26]},
"0": {"inbytes": 0, "outbytes": 4},
"3": {"inbytes": 0, "outbytes": 2},
"2": {"inbytes": 0, "outbytes": 8},
"5": {"inbytes": 0, "outbytes": 32},
"4": {"inbytes": 0, "outbytes": 32},
"100": {"inbytes": 0, "outbytes": 0},
"101": {"inbytes": 0, "outbytes": 0}
},
"nn::apm::ISession": {
"1": {"inbytes": 4, "args": "(nn::sf::Out<nn::apm::PerformanceConfiguration,void>,nn::apm::PerformanceMode)", "outbytes": 4, "name": "GetPerformanceConfiguration"},
"0": {"inbytes": 8, "args": "(nn::apm::PerformanceMode,nn::apm::PerformanceConfiguration)", "outbytes": 0, "name": "SetPerformanceConfiguration"}
},
"nn::news::detail::ipc::IOverwriteEventHolder": {
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0}
},
"nn::ntc::detail::service::IStaticService": {
"0": {"inbytes": 8, "outbytes": 0, "outinterfaces": ["nn::ntc::detail::service::IEnsureNetworkClockAvailabilityService"]},
"100": {"inbytes": 0, "outbytes": 0},
"101": {"inbytes": 0, "outbytes": 0}
},
"nn::spsm::detail::IPowerStateInterface": {
"11": {"inbytes": 8, "outbytes": 0},
"10": {"inbytes": 0, "outbytes": 0},
"1": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 4},
"3": {"inbytes": 1, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 4},
"5": {"inbytes": 0, "outbytes": 4},
"4": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"7": {"inbytes": 0, "outbytes": 0},
"6": {"inbytes": 0, "outbytes": 80},
"9": {"inbytes": 8, "outbytes": 0},
"8": {"inbytes": 0, "outbytes": 0, "buffers": [6]}
},
"nn::pctl::detail::ipc::IParentalControlService": {
"1457": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetPlayTimerEventToRequestSuspension"},
"1205": {"inbytes": 32, "args": "(nn::sf::Out<bool,void>,nn::pctl::InquiryCode const&,nn::sf::InArray<char> const&)", "outbytes": 1, "buffers": [9], "name": "CheckMasterKey"},
"1204": {"inbytes": 0, "args": "(nn::sf::Out<nn::pctl::InquiryCode,void>)", "outbytes": 32, "name": "GenerateInquiryCode"},
"1207": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetPinCodeChangedEvent"},
"1206": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetPinCodeLength"},
"1201": {"inbytes": 0, "args": "(nn::sf::InArray<char> const&)", "outbytes": 0, "buffers": [9], "name": "UnlockRestrictionTemporarily"},
"1452": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "StopPlayTimer"},
"1203": {"inbytes": 0, "args": "(nn::sf::InArray<char> const&)", "outbytes": 0, "buffers": [9], "name": "SetPinCode"},
"1202": {"inbytes": 0, "args": "(nn::sf::InArray<char> const&)", "outbytes": 0, "buffers": [9], "name": "UnlockSystemSettingsRestriction"},
"1454": {"inbytes": 0, "args": "(nn::sf::Out<nn::TimeSpanType,void>)", "outbytes": 8, "name": "GetPlayTimerRemainingTime"},
"2007": {"inbytes": 1, "outhandles": [1], "outbytes": 8, "args": "(nn::sf::Out<nn::pctl::detail::AsyncData,void>,nn::sf::Out<nn::sf::NativeHandle,void>,bool)", "name": "UnlinkPairingAsync"},
"2008": {"inbytes": 12, "args": "(nn::pctl::detail::AsyncData,bool)", "outbytes": 0, "name": "FinishUnlinkPairing"},
"1902": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ClearFreeCommunicationApplicationListForDebug"},
"1901": {"inbytes": 8, "args": "(nn::ncm::ApplicationId)", "outbytes": 0, "name": "DeleteFromFreeCommunicationApplicationListForDebug"},
"1421": {"inbytes": 16, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutArray<char> const&,nn::pctl::detail::PairingAccountInfoBase const&)", "outbytes": 4, "buffers": [10], "name": "GetAccountNickname"},
"2002": {"inbytes": 8, "args": "(nn::sf::Out<nn::pctl::detail::PairingInfoBase,void>,nn::pctl::detail::AsyncData)", "outbytes": 16, "name": "FinishRequestPairing"},
"1453": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsPlayTimerEnabled"},
"1034": {"inbytes": 4, "args": "(nn::sf::Out<nn::pctl::SafetyLevelSettings,void>,int)", "outbytes": 3, "name": "GetSafetyLevelSettings"},
"1424": {"inbytes": 16, "args": "(nn::sf::Out<int,void>,nn::pctl::detail::PairingAccountInfoBase const&)", "outbytes": 4, "name": "GetAccountState"},
"2003": {"inbytes": 16, "outhandles": [1], "outbytes": 8, "args": "(nn::sf::Out<nn::pctl::detail::AsyncData,void>,nn::sf::Out<nn::sf::NativeHandle,void>,nn::pctl::detail::PairingInfoBase const&)", "name": "AuthorizePairingAsync"},
"1952": {"inbytes": 0, "args": "(nn::sf::Out<nn::TimeSpanType,void>)", "outbytes": 8, "name": "GetPlayTimerSpentTimeForTest"},
"1941": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DeletePairing"},
"1455": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsRestrictedByPlayTimer"},
"1038": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "SetDefaultRatingOrganization"},
"1471": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "NotifyWrongPinCodeInputManyTimes"},
"1003": {"inbytes": 16, "args": "(nn::ncm::ApplicationId,nn::sf::InArray<signed char> const&,bool)", "outbytes": 0, "buffers": [9], "name": "ConfirmResumeApplicationPermission"},
"1032": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetSafetyLevel"},
"2014": {"inbytes": 8, "args": "(nn::pctl::detail::AsyncData)", "outbytes": 0, "name": "FinishSynchronizeParentalControlSettings"},
"1031": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsRestrictionEnabled"},
"1036": {"inbytes": 3, "args": "(nn::pctl::SafetyLevelSettings)", "outbytes": 0, "name": "SetCustomSafetyLevelSettings"},
"1037": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetDefaultRatingOrganization"},
"2013": {"inbytes": 0, "outhandles": [1], "outbytes": 8, "args": "(nn::sf::Out<nn::pctl::detail::AsyncData,void>,nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "SynchronizeParentalControlSettingsAsync"},
"1035": {"inbytes": 0, "args": "(nn::sf::Out<nn::pctl::SafetyLevelSettings,void>)", "outbytes": 3, "name": "GetCurrentSettings"},
"1411": {"inbytes": 16, "args": "(nn::sf::Out<nn::pctl::detail::PairingAccountInfoBase,void>,nn::pctl::detail::PairingInfoBase const&)", "outbytes": 16, "name": "GetPairingAccountInfo"},
"2004": {"inbytes": 8, "args": "(nn::sf::Out<nn::pctl::detail::PairingInfoBase,void>,nn::pctl::detail::AsyncData)", "outbytes": 16, "name": "FinishAuthorizePairing"},
"1008": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "EnterRestrictedSystemSettings"},
"2015": {"inbytes": 8, "args": "(nn::sf::Out<nn::time::PosixTime,void>,nn::pctl::detail::AsyncData)", "outbytes": 8, "name": "FinishSynchronizeParentalControlSettingsWithLastUpdated"},
"1010": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsRestrictedSystemSettingsEntered"},
"1951": {"inbytes": 52, "args": "(nn::pctl::PlayTimerSettings const&)", "outbytes": 0, "name": "SetPlayTimerSettingsForDebug"},
"1033": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "SetSafetyLevel"},
"2010": {"inbytes": 8, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&,nn::pctl::detail::AsyncData)", "outbytes": 4, "buffers": [6], "name": "FinishGetAccountMiiImage"},
"1047": {"inbytes": 8, "args": "(nn::ncm::ApplicationId)", "outbytes": 0, "name": "NotifyApplicationDownloadStarted"},
"1403": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsPairingActive"},
"1451": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "StartPlayTimer"},
"2011": {"outhandles": [1], "outbytes": 12, "inbytes": 16, "args": "(nn::sf::Out<nn::pctl::detail::AsyncData,void>,nn::sf::Out<nn::sf::NativeHandle,void>,nn::sf::Out<unsigned int,void>,nn::sf::OutArray<char> const&,nn::pctl::detail::PairingAccountInfoBase const&)", "buffers": [10], "name": "GetAccountMiiImageContentTypeAsync"},
"1043": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DeleteSettings"},
"1042": {"inbytes": 8, "args": "(nn::ncm::ApplicationId)", "outbytes": 0, "name": "AddToFreeCommunicationApplicationList"},
"1474": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ClearUnlinkedEvent"},
"2009": {"outhandles": [1], "outbytes": 12, "inbytes": 16, "args": "(nn::sf::Out<nn::pctl::detail::AsyncData,void>,nn::sf::Out<nn::sf::NativeHandle,void>,nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&,nn::pctl::detail::PairingAccountInfoBase const&)", "buffers": [6], "name": "GetAccountMiiImageAsync"},
"1432": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetSynchronizationEvent"},
"1046": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DisableFeaturesForReset"},
"1045": {"inbytes": 0, "args": "(nn::sf::InArray<nn::pctl::FreeCommunicationApplicationInfo> const&)", "outbytes": 0, "buffers": [5], "name": "UpdateFreeCommunicationApplicationList"},
"1044": {"inbytes": 4, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::pctl::FreeCommunicationApplicationInfo> const&,int)", "outbytes": 4, "buffers": [6], "name": "GetFreeCommunicationApplicationList"},
"1601": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "DisableAllFeatures"},
"1039": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetFreeCommunicationApplicationListCount"},
"1603": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>,nn::sf::Out<bool,void>)", "outbytes": 2, "name": "IsAllFeaturesDisabled"},
"1602": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "PostEnableAllFeatures"},
"1011": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "RevertRestrictedSystemSettingsEntered"},
"1472": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "CancelNetworkRequest"},
"1473": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetUnlinkedEvent"},
"1456": {"inbytes": 0, "args": "(nn::sf::Out<nn::pctl::PlayTimerSettings,void>)", "outbytes": 52, "name": "GetPlayTimerSettings"},
"2001": {"outhandles": [1], "outbytes": 8, "inbytes": 0, "args": "(nn::sf::Out<nn::pctl::detail::AsyncData,void>,nn::sf::Out<nn::sf::NativeHandle,void>,nn::sf::InArray<char> const&)", "buffers": [9], "name": "RequestPairingAsync"},
"2006": {"inbytes": 8, "args": "(nn::sf::Out<nn::pctl::detail::PairingInfoBase,void>,nn::pctl::detail::AsyncData)", "outbytes": 16, "name": "FinishRetrievePairingInfo"},
"1012": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetRestrictedFeatures"},
"1009": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "LeaveRestrictedSystemSettings"},
"2005": {"inbytes": 0, "outhandles": [1], "outbytes": 8, "args": "(nn::sf::Out<nn::pctl::detail::AsyncData,void>,nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "RetrievePairingInfoAsync"},
"1007": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "RevertRestrictionTemporaryUnlocked"},
"1006": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsRestrictionTemporaryUnlocked"},
"1005": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ConfirmSystemSettingsPermission"},
"1004": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ConfirmSnsPostPermission"},
"1406": {"inbytes": 0, "args": "(nn::sf::Out<nn::time::PosixTime,void>)", "outbytes": 8, "name": "GetSettingsLastUpdated"},
"1002": {"inbytes": 16, "args": "(nn::ncm::ApplicationId,nn::sf::InArray<signed char> const&,bool)", "outbytes": 0, "buffers": [9], "name": "ConfirmLaunchApplicationPermission"},
"1001": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "CheckFreeCommunicationPermission"},
"2012": {"inbytes": 8, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutArray<char> const&,nn::pctl::detail::AsyncData)", "outbytes": 4, "buffers": [10], "name": "FinishGetAccountMiiImageContentType"}
},
"nn::audio::detail::IAudioOutManagerForApplet": {
"1": {"inbytes": 16, "outhandles": [1], "outbytes": 0},
"0": {"inbytes": 16, "outhandles": [1], "outbytes": 0},
"3": {"inbytes": 24, "outbytes": 0},
"2": {"inbytes": 8, "outbytes": 4}
},
"nn::psc::sf::IPmModule": {
"1": {"inbytes": 0, "outbytes": 8},
"0": {"inbytes": 4, "outhandles": [1], "outbytes": 0, "buffers": [5]},
"3": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0}
},
"nn::am::service::IAllSystemAppletProxiesService": {
"201": {"args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletProxy>,void>,unsigned long,nn::sf::NativeHandle &&,nn::am::AppletAttribute const&)", "outbytes": 0, "inbytes": 8, "inhandles": [1], "pid": True, "outinterfaces": ["nn::am::service::ILibraryAppletProxy"], "buffers": [21], "name": "OpenLibraryAppletProxy"},
"200": {"args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletProxy>,void>,unsigned long,nn::sf::NativeHandle &&)", "outbytes": 0, "inbytes": 8, "inhandles": [1], "pid": True, "outinterfaces": ["nn::am::service::ILibraryAppletProxy"], "name": "OpenLibraryAppletProxyOld"},
"300": {"args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IOverlayAppletProxy>,void>,unsigned long,nn::sf::NativeHandle &&)", "outbytes": 0, "inbytes": 8, "inhandles": [1], "pid": True, "outinterfaces": ["nn::am::service::IOverlayAppletProxy"], "name": "OpenOverlayAppletProxy"},
"400": {"outbytes": 0, "inbytes": 8, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletCreator>,void>,unsigned long)", "pid": True, "outinterfaces": ["nn::am::service::ILibraryAppletCreator"], "name": "CreateSelfLibraryAppletCreatorForDevelop"},
"350": {"args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationProxy>,void>,unsigned long,nn::sf::NativeHandle &&)", "outbytes": 0, "inbytes": 8, "inhandles": [1], "pid": True, "outinterfaces": ["nn::am::service::IApplicationProxy"], "name": "OpenSystemApplicationProxy"},
"100": {"args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ISystemAppletProxy>,void>,unsigned long,nn::sf::NativeHandle &&)", "outbytes": 0, "inbytes": 8, "inhandles": [1], "pid": True, "outinterfaces": ["nn::am::service::ISystemAppletProxy"], "name": "OpenSystemAppletProxy"}
},
"nn::ns::detail::IServiceGetterInterface": {
"7997": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::ns::detail::IDownloadTaskInterface"]},
"7996": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::ns::detail::IApplicationManagerInterface"]},
"7995": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAccountProxyInterface"]},
"7994": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::ns::detail::IFactoryResetInterface"]},
"7999": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::ns::detail::IDocumentInterface"]},
"7998": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::ns::detail::IContentManagementInterface"]}
},
"nn::pctl::detail::ipc::IParentalControlServiceFactory": {
"0": {"outbytes": 0, "inbytes": 8, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::pctl::detail::ipc::IParentalControlService>,void>,unsigned long)", "pid": True, "outinterfaces": ["nn::pctl::detail::ipc::IParentalControlService"], "name": "CreateService"}
},
"nn::account::IAccountServiceForAdministrator": {
"210": {"args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::baas::IFloatingRegistrationRequest>,void>,nn::sf::NativeHandle &&,unsigned int)", "outbytes": 0, "inbytes": 4, "inhandles": [1], "outinterfaces": ["nn::account::baas::IFloatingRegistrationRequest"], "name": "CreateFloatingRegistrationRequest"},
"203": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "DeleteUser"},
"111": {"inbytes": 24, "args": "(nn::account::Uid const&,nn::ApplicationId)", "outbytes": 0, "name": "ClearSaveDataThumbnail"},
"110": {"inbytes": 24, "args": "(nn::account::Uid const&,nn::ApplicationId,nn::sf::InBuffer const&)", "outbytes": 0, "buffers": [5], "name": "StoreSaveDataThumbnail"},
"112": {"inbytes": 24, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&,nn::account::Uid const&,nn::ApplicationId)", "outbytes": 4, "buffers": [6], "name": "LoadSaveDataThumbnail"},
"250": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::baas::IAdministrator>,void>,nn::account::Uid const&)", "outbytes": 0, "name": "GetBaasAccountAdministrator", "outinterfaces": ["nn::account::baas::IAdministrator"]},
"230": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "AuthenticateServiceAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"1": {"inbytes": 16, "args": "(nn::sf::Out<bool,void>,nn::account::Uid const&)", "outbytes": 1, "name": "GetUserExistence"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetUserCount"},
"3": {"inbytes": 0, "args": "(nn::sf::OutArray<nn::account::Uid> const&)", "outbytes": 0, "buffers": [10], "name": "ListOpenUsers"},
"2": {"inbytes": 0, "args": "(nn::sf::OutArray<nn::account::Uid> const&)", "outbytes": 0, "buffers": [10], "name": "ListAllUsers"},
"5": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::profile::IProfile>,void>,nn::account::Uid const&)", "outbytes": 0, "name": "GetProfile", "outinterfaces": ["nn::account::profile::IProfile"]},
"4": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::Uid,void>)", "outbytes": 16, "name": "GetLastOpenedUser"},
"6": {"inbytes": 16, "args": "(nn::sf::Out<nn::account::ProfileDigest,void>,nn::account::Uid const&)", "outbytes": 16, "name": "GetProfileDigest"},
"201": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "CompleteUserRegistration"},
"200": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::Uid,void>)", "outbytes": 16, "name": "BeginUserRegistration"},
"997": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "DebugInvalidateTokenCacheForUser"},
"202": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "CancelUserRegistration"},
"205": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::profile::IProfileEditor>,void>,nn::account::Uid const&)", "outbytes": 0, "name": "GetProfileEditor", "outinterfaces": ["nn::account::profile::IProfileEditor"]},
"204": {"inbytes": 24, "args": "(nn::account::Uid const&,int)", "outbytes": 0, "name": "SetUserPosition"},
"206": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "CompleteUserRegistrationForcibly"},
"999": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "DebugSetUserStateOpen"},
"998": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "DebugSetUserStateClose"},
"190": {"inbytes": 16, "args": "(nn::sf::Out<nn::ApplicationId,void>,nn::sf::Out<unsigned int,void>,nn::account::Uid const&)", "outbytes": 16, "name": "GetUserLastOpenedApplication"},
"102": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::baas::IManagerForSystemService>,void>,nn::account::Uid const&)", "outbytes": 0, "name": "GetBaasAccountManagerForSystemService", "outinterfaces": ["nn::account::baas::IManagerForSystemService"]},
"103": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)", "outbytes": 0, "name": "GetBaasUserAvailabilityChangeNotifier", "outinterfaces": ["nn::account::detail::INotifier"]},
"100": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)", "outbytes": 0, "name": "GetUserRegistrationNotifier", "outinterfaces": ["nn::account::detail::INotifier"]},
"101": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)", "outbytes": 0, "name": "GetUserStateChangeNotifier", "outinterfaces": ["nn::account::detail::INotifier"]},
"104": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::INotifier>,void>)", "outbytes": 0, "name": "GetProfileUpdateNotifier", "outinterfaces": ["nn::account::detail::INotifier"]},
"51": {"inbytes": 1, "args": "(nn::sf::Out<nn::account::Uid,void>,bool)", "outbytes": 16, "name": "TrySelectUserWithoutInteraction"},
"50": {"inbytes": 8, "args": "(nn::sf::Out<bool,void>,unsigned long)", "pid": True, "outbytes": 1, "name": "IsUserRegistrationRequestPermitted"},
"299": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::ISessionObject>,void>)", "outbytes": 0, "name": "SuspendBackgroundDaemon", "outinterfaces": ["nn::account::detail::ISessionObject"]},
"290": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::nas::IOAuthProcedureForExternalNsa>,void>,nn::account::detail::Uuid const&)", "outbytes": 0, "name": "ProxyProcedureForGuestLoginWithNintendoAccount", "outinterfaces": ["nn::account::nas::IOAuthProcedureForExternalNsa"]},
"291": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::nas::IOAuthProcedureForExternalNsa>,void>,nn::account::detail::Uuid const&)", "outbytes": 0, "name": "ProxyProcedureForFloatingRegistrationWithNintendoAccount", "outinterfaces": ["nn::account::nas::IOAuthProcedureForExternalNsa"]}
},
"nn::nim::detail::IAsyncValue": {
"1": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"0": {"inbytes": 0, "outbytes": 8},
"2": {"inbytes": 0, "outbytes": 0}
},
"nn::fssrv::sf::IStorage": {
"1": {"inbytes": 16, "outbytes": 0, "buffers": [69]},
"0": {"inbytes": 16, "outbytes": 0, "buffers": [70]},
"3": {"inbytes": 8, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 8}
},
"nn::gpio::IManager": {
"1": {"inbytes": 4, "outbytes": 0, "outinterfaces": ["nn::gpio::IPadSession"]},
"0": {"inbytes": 4, "outbytes": 0, "outinterfaces": ["nn::gpio::IPadSession"]},
"3": {"inbytes": 4, "outbytes": 1},
"2": {"inbytes": 4, "outbytes": 0, "outinterfaces": ["nn::gpio::IPadSession"]},
"5": {"inbytes": 8, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 16},
"6": {"inbytes": 1, "outbytes": 0}
},
"nn::lbl::detail::ILblController": {
"24": {"inbytes": 4, "outbytes": 0},
"25": {"inbytes": 0, "outbytes": 4},
"26": {"inbytes": 0, "outbytes": 0},
"27": {"inbytes": 0, "outbytes": 0},
"20": {"inbytes": 0, "outbytes": 12},
"21": {"inbytes": 12, "outbytes": 0},
"22": {"inbytes": 0, "outbytes": 12},
"23": {"inbytes": 0, "outbytes": 1},
"28": {"inbytes": 0, "outbytes": 1},
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 4},
"2": {"inbytes": 4, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 4},
"4": {"inbytes": 0, "outbytes": 0},
"7": {"inbytes": 8, "outbytes": 0},
"6": {"inbytes": 8, "outbytes": 0},
"9": {"inbytes": 0, "outbytes": 0},
"8": {"inbytes": 0, "outbytes": 4},
"11": {"inbytes": 0, "outbytes": 1},
"10": {"inbytes": 0, "outbytes": 0},
"13": {"inbytes": 0, "outbytes": 0},
"12": {"inbytes": 0, "outbytes": 0},
"15": {"inbytes": 4, "outbytes": 0},
"14": {"inbytes": 0, "outbytes": 1},
"17": {"inbytes": 8, "outbytes": 0},
"16": {"inbytes": 0, "outbytes": 4},
"19": {"inbytes": 12, "outbytes": 0},
"18": {"inbytes": 4, "outbytes": 4}
},
"nn::uart::IManager": {
"1": {"inbytes": 4, "outbytes": 1},
"0": {"inbytes": 4, "outbytes": 1},
"3": {"inbytes": 8, "outbytes": 1},
"2": {"inbytes": 8, "outbytes": 1},
"5": {"inbytes": 8, "outbytes": 1},
"4": {"inbytes": 8, "outbytes": 1},
"7": {"inbytes": 8, "outbytes": 1},
"6": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::uart::IPortSession"]},
"8": {"inbytes": 8, "outbytes": 1}
},
"nn::usb::ds::IDsInterface": {
"11": {"inbytes": 0, "outbytes": 0},
"10": {"inbytes": 0, "outbytes": 132},
"1": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 1, "buffers": [5], "outinterfaces": ["nn::usb::ds::IDsEndpoint"]},
"3": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"5": {"inbytes": 16, "outbytes": 4},
"4": {"inbytes": 0, "outbytes": 0},
"7": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"6": {"inbytes": 16, "outbytes": 4},
"9": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"8": {"inbytes": 0, "outbytes": 132}
},
"nn::btm::IBtmDebug": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 1},
"3": {"inbytes": 0, "outbytes": 0, "buffers": [26]},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 6, "outbytes": 0},
"4": {"inbytes": 6, "outbytes": 0},
"7": {"inbytes": 4, "outbytes": 0},
"6": {"inbytes": 12, "outbytes": 0},
"8": {"inbytes": 6, "outbytes": 0}
},
"nn::mii::detail::IDatabaseService": {
"20": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsBrokenDatabaseWithClearFlag"},
"21": {"inbytes": 88, "args": "(nn::sf::Out<int,void>,nn::mii::CharInfo const&)", "outbytes": 4, "name": "GetIndex"},
"1": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsFullDatabase"},
"0": {"inbytes": 4, "args": "(nn::sf::Out<bool,void>,int)", "outbytes": 1, "name": "IsUpdated"},
"3": {"inbytes": 4, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::mii::CharInfoElement> const&,int)", "outbytes": 4, "buffers": [6], "name": "Get"},
"2": {"inbytes": 4, "args": "(nn::sf::Out<int,void>,int)", "outbytes": 4, "name": "GetCount"},
"5": {"inbytes": 92, "args": "(nn::sf::Out<nn::mii::CharInfo,void>,nn::mii::CharInfo const&,int)", "outbytes": 88, "name": "UpdateLatest"},
"4": {"inbytes": 4, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::mii::CharInfo> const&,int)", "outbytes": 4, "buffers": [6], "name": "Get1"},
"7": {"inbytes": 4, "args": "(nn::sf::Out<nn::mii::CharInfo,void>,int)", "outbytes": 88, "name": "BuildDefault"},
"6": {"inbytes": 12, "args": "(nn::sf::Out<nn::mii::CharInfo,void>,int,int,int)", "outbytes": 88, "name": "BuildRandom"},
"9": {"inbytes": 4, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::mii::StoreData> const&,int)", "outbytes": 4, "buffers": [6], "name": "Get3"},
"8": {"inbytes": 4, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::mii::StoreDataElement> const&,int)", "outbytes": 4, "buffers": [6], "name": "Get2"},
"11": {"inbytes": 17, "args": "(nn::sf::Out<int,void>,nn::mii::CreateId const&,bool)", "outbytes": 4, "name": "FindIndex"},
"10": {"inbytes": 72, "args": "(nn::sf::Out<nn::mii::StoreData,void>,nn::mii::StoreData const&,int)", "outbytes": 68, "name": "UpdateLatest1"},
"13": {"inbytes": 68, "args": "(nn::mii::StoreData const&)", "outbytes": 0, "name": "AddOrReplace"},
"12": {"inbytes": 20, "args": "(int,nn::mii::CreateId const&)", "outbytes": 0, "name": "Move"},
"15": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DestroyFile"},
"14": {"inbytes": 16, "args": "(nn::mii::CreateId const&)", "outbytes": 0, "name": "Delete"},
"17": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Format"},
"16": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DeleteFile"},
"19": {"inbytes": 0, "args": "(nn::sf::OutBuffer const&)", "outbytes": 0, "buffers": [6], "name": "Export"},
"18": {"inbytes": 0, "args": "(nn::sf::InBuffer const&)", "outbytes": 0, "buffers": [5], "name": "Import"}
},
"nn::visrv::sf::ISystemRootService": {
"1": {"inbytes": 4, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::visrv::sf::IApplicationDisplayService>,void>,unsigned int)", "outbytes": 0, "name": "GetDisplayService", "outinterfaces": ["nn::visrv::sf::IApplicationDisplayService"]},
"3": {"inbytes": 12, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::visrv::sf::IApplicationDisplayService>,void>,unsigned int,nn::vi::ProxyName)", "outbytes": 0, "name": "GetDisplayServiceWithProxyNameExchange", "outinterfaces": ["nn::visrv::sf::IApplicationDisplayService"]}
},
"nn::ahid::IServerSession": {
"1": {"inbytes": 4, "outbytes": 0},
"0": {"inbytes": 4, "outbytes": 0},
"3": {"inbytes": 4, "outbytes": 0, "outinterfaces": ["nn::ahid::IReadSession"]},
"2": {"inbytes": 4, "outbytes": 0, "outinterfaces": ["nn::ahid::ICtrlSession"]}
},
"nn::am::service::ILibraryAppletCreator": {
"11": {"args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>,nn::sf::NativeHandle &&,long,bool)", "outbytes": 0, "inbytes": 16, "inhandles": [1], "outinterfaces": ["nn::am::service::IStorage"], "name": "CreateTransferMemoryStorage"},
"10": {"inbytes": 8, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>,long)", "outbytes": 0, "name": "CreateStorage", "outinterfaces": ["nn::am::service::IStorage"]},
"12": {"args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>,nn::sf::NativeHandle &&,long)", "outbytes": 0, "inbytes": 8, "inhandles": [1], "outinterfaces": ["nn::am::service::IStorage"], "name": "CreateHandleStorage"},
"1": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "TerminateAllLibraryApplets"},
"0": {"inbytes": 8, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletAccessor>,void>,unsigned int,unsigned int)", "outbytes": 0, "name": "CreateLibraryApplet", "outinterfaces": ["nn::am::service::ILibraryAppletAccessor"]},
"2": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "AreAnyLibraryAppletsLeft"}
},
"nn::am::service::IApplicationProxyService": {
"0": {"args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationProxy>,void>,unsigned long,nn::sf::NativeHandle &&)", "outbytes": 0, "inbytes": 8, "inhandles": [1], "pid": True, "outinterfaces": ["nn::am::service::IApplicationProxy"], "name": "OpenApplicationProxy"}
},
"nn::pcie::detail::ISession": {
"20": {"inbytes": 8, "outbytes": 0},
"21": {"inbytes": 8, "outbytes": 0},
"1": {"inbytes": 4, "outhandles": [1], "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"3": {"inbytes": 4, "outbytes": 0, "buffers": [6]},
"2": {"inbytes": 4, "outbytes": 0},
"5": {"inbytes": 12, "outbytes": 4},
"4": {"inbytes": 8, "outbytes": 24},
"7": {"inbytes": 16, "outbytes": 0, "buffers": [6]},
"6": {"inbytes": 16, "outbytes": 0},
"9": {"inbytes": 8, "outbytes": 4},
"8": {"inbytes": 16, "outbytes": 0, "buffers": [5]},
"11": {"inbytes": 24, "outbytes": 8},
"10": {"inbytes": 8, "outbytes": 4},
"13": {"inbytes": 16, "outbytes": 0},
"12": {"inbytes": 16, "outbytes": 0},
"15": {"inbytes": 4, "outbytes": 16},
"14": {"inbytes": 16, "outbytes": 8},
"17": {"inbytes": 8, "outhandles": [1], "outbytes": 0},
"16": {"inbytes": 8, "outbytes": 0},
"19": {"inbytes": 12, "outbytes": 0},
"18": {"inbytes": 4, "outbytes": 0}
},
"nv::gemcontrol::INvGemControl": {
"1": {"inbytes": 0, "outhandles": [1], "outbytes": 4},
"0": {"inbytes": 0, "outbytes": 4},
"3": {"inbytes": 16, "outbytes": 4},
"2": {"inbytes": 1, "outbytes": 4},
"5": {"inbytes": 0, "outbytes": 16},
"4": {"inbytes": 16, "outbytes": 4},
"7": {"inbytes": 0, "outbytes": 16},
"6": {"inbytes": 0, "outbytes": 4}
},
"nn::am::service::ISystemAppletProxy": {
"11": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletCreator>,void>)", "outbytes": 0, "name": "GetLibraryAppletCreator", "outinterfaces": ["nn::am::service::ILibraryAppletCreator"]},
"10": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IProcessWindingController>,void>)", "outbytes": 0, "name": "GetProcessWindingController", "outinterfaces": ["nn::am::service::IProcessWindingController"]},
"20": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IHomeMenuFunctions>,void>)", "outbytes": 0, "name": "GetHomeMenuFunctions", "outinterfaces": ["nn::am::service::IHomeMenuFunctions"]},
"21": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IGlobalStateController>,void>)", "outbytes": 0, "name": "GetGlobalStateController", "outinterfaces": ["nn::am::service::IGlobalStateController"]},
"22": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationCreator>,void>)", "outbytes": 0, "name": "GetApplicationCreator", "outinterfaces": ["nn::am::service::IApplicationCreator"]},
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ISelfController>,void>)", "outbytes": 0, "name": "GetSelfController", "outinterfaces": ["nn::am::service::ISelfController"]},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ICommonStateGetter>,void>)", "outbytes": 0, "name": "GetCommonStateGetter", "outinterfaces": ["nn::am::service::ICommonStateGetter"]},
"3": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IAudioController>,void>)", "outbytes": 0, "name": "GetAudioController", "outinterfaces": ["nn::am::service::IAudioController"]},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IWindowController>,void>)", "outbytes": 0, "name": "GetWindowController", "outinterfaces": ["nn::am::service::IWindowController"]},
"4": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDisplayController>,void>)", "outbytes": 0, "name": "GetDisplayController", "outinterfaces": ["nn::am::service::IDisplayController"]},
"1000": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDebugFunctions>,void>)", "outbytes": 0, "name": "GetDebugFunctions", "outinterfaces": ["nn::am::service::IDebugFunctions"]}
},
"nn::fan::detail::IController": {
"1": {"inbytes": 4, "outbytes": 4},
"0": {"inbytes": 4, "outbytes": 0},
"3": {"inbytes": 4, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 4},
"5": {"inbytes": 0, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 4},
"7": {"inbytes": 0, "outbytes": 4},
"6": {"inbytes": 0, "outbytes": 0}
},
"nn::am::service::IWindowController": {
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::applet::AppletResourceUserId,void>)", "outbytes": 8, "name": "GetAppletResourceUserId"},
"0": {"inbytes": 4, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IWindow>,void>,nn::am::service::WindowCreationOption)", "outbytes": 0, "name": "CreateWindow", "outinterfaces": ["nn::am::service::IWindow"]},
"12": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "RejectToChangeIntoBackground"},
"10": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "AcquireForegroundRights"},
"11": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ReleaseForegroundRights"}
},
"nn::ns::detail::ISystemUpdateControl": {
"11": {"inbytes": 8, "inhandles": [1], "outbytes": 0},
"10": {"inbytes": 0, "outbytes": 8, "buffers": [21, 6]},
"13": {"inbytes": 0, "outbytes": 8, "buffers": [21, 6]},
"12": {"inbytes": 0, "outbytes": 8, "buffers": [21]},
"1": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAsyncValue"]},
"0": {"inbytes": 0, "outbytes": 1},
"3": {"inbytes": 0, "outbytes": 16},
"2": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAsyncResult"]},
"5": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAsyncResult"]},
"4": {"inbytes": 0, "outbytes": 0},
"7": {"inbytes": 0, "outbytes": 1},
"6": {"inbytes": 0, "outbytes": 16},
"9": {"inbytes": 0, "outbytes": 8, "buffers": [21]},
"8": {"inbytes": 0, "outbytes": 0}
},
"nn::capsrv::sf::IAlbumAccessorService": {
"8012": {"inbytes": 1, "outbytes": 16},
"8011": {"inbytes": 1, "outbytes": 0},
"1": {"inbytes": 1, "outbytes": 8, "buffers": [6]},
"0": {"inbytes": 1, "outbytes": 8},
"3": {"inbytes": 24, "outbytes": 0},
"2": {"inbytes": 24, "outbytes": 8, "buffers": [6]},
"5": {"inbytes": 1, "outbytes": 1},
"4": {"inbytes": 32, "outbytes": 0},
"7": {"inbytes": 24, "outbytes": 8},
"6": {"inbytes": 1, "outbytes": 48},
"9": {"inbytes": 24, "outbytes": 16, "buffers": [70, 6]},
"8": {"inbytes": 24, "outbytes": 8, "buffers": [6]},
"501": {"inbytes": 2, "outbytes": 8},
"401": {"inbytes": 0, "outbytes": 1},
"301": {"inbytes": 0, "outbytes": 32, "buffers": [6]},
"10011": {"inbytes": 1, "outbytes": 0},
"8021": {"inbytes": 40, "pid": True, "outbytes": 32},
"8001": {"inbytes": 1, "outbytes": 0},
"8002": {"inbytes": 1, "outbytes": 0},
"11": {"inbytes": 40, "outbytes": 32},
"10": {"inbytes": 24, "outbytes": 16, "buffers": [70, 6]},
"13": {"inbytes": 56, "outbytes": 16, "buffers": [70, 6]},
"12": {"inbytes": 56, "outbytes": 16, "buffers": [70, 6]},
"14": {"inbytes": 56, "outbytes": 80, "buffers": [70, 6]},
"1002": {"inbytes": 56, "outbytes": 32, "buffers": [5, 5]},
"1001": {"inbytes": 56, "outbytes": 80, "buffers": [70, 6]}
},
"nn::eupld::sf::IControl": {
"1": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"0": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"3": {"inbytes": 8, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0, "buffers": [5, 5]}
},
"nn::ssl::sf::ISslConnection": {
"24": {"inbytes": 0, "args": "(nn::sf::OutBuffer const&,nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>)", "outbytes": 8, "buffers": [6], "name": "GetVerifyCertErrors"},
"20": {"inbytes": 4, "args": "(nn::ssl::sf::RenegotiationMode)", "outbytes": 0, "name": "SetRenegotiationMode"},
"21": {"inbytes": 0, "args": "(nn::sf::Out<nn::ssl::sf::RenegotiationMode,void>)", "outbytes": 4, "name": "GetRenegotiationMode"},
"22": {"inbytes": 8, "args": "(nn::ssl::sf::OptionType,bool)", "outbytes": 0, "name": "SetOption"},
"23": {"inbytes": 4, "args": "(nn::sf::Out<bool,void>,nn::ssl::sf::OptionType)", "outbytes": 1, "name": "GetOption"},
"1": {"inbytes": 0, "args": "(nn::sf::InBuffer const&)", "outbytes": 0, "buffers": [5], "name": "SetHostName"},
"0": {"inbytes": 4, "args": "(int,nn::sf::Out<int,void>)", "outbytes": 4, "name": "SetSocketDescriptor"},
"3": {"inbytes": 4, "args": "(nn::ssl::sf::IoMode)", "outbytes": 0, "name": "SetIoMode"},
"2": {"inbytes": 4, "args": "(nn::ssl::sf::VerifyOption)", "outbytes": 0, "name": "SetVerifyOption"},
"5": {"inbytes": 0, "args": "(nn::sf::OutBuffer const&,nn::sf::Out<unsigned int,void>)", "outbytes": 4, "buffers": [6], "name": "GetHostName"},
"4": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetSocketDescriptor"},
"7": {"inbytes": 0, "args": "(nn::sf::Out<nn::ssl::sf::IoMode,void>)", "outbytes": 4, "name": "GetIoMode"},
"6": {"inbytes": 0, "args": "(nn::sf::Out<nn::ssl::sf::VerifyOption,void>)", "outbytes": 4, "name": "GetVerifyOption"},
"9": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)", "outbytes": 8, "buffers": [6], "name": "DoHandshakeGetServerCert"},
"8": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DoHandshake"},
"11": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::InBuffer const&)", "outbytes": 4, "buffers": [5], "name": "Write"},
"10": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "Read"},
"13": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "Peek"},
"12": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "Pending"},
"15": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "GetVerifyCertError"},
"14": {"inbytes": 8, "args": "(nn::sf::Out<nn::ssl::sf::PollEvent,void>,nn::ssl::sf::PollEvent,unsigned int)", "outbytes": 4, "name": "Poll"},
"17": {"inbytes": 4, "args": "(nn::ssl::sf::SessionCacheMode)", "outbytes": 0, "name": "SetSessionCacheMode"},
"16": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>)", "outbytes": 4, "name": "GetNeededServerCertBufferSize"},
"19": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "FlushSessionCache"},
"18": {"inbytes": 0, "args": "(nn::sf::Out<nn::ssl::sf::SessionCacheMode,void>)", "outbytes": 4, "name": "GetSessionCacheMode"}
},
"nn::sm::detail::IManagerInterface": {
"1": {"inbytes": 8, "outbytes": 0},
"0": {"inbytes": 8, "outbytes": 0, "buffers": [5, 5]}
},
"nn::prepo::detail::ipc::IPrepoService": {
"90100": {"inbytes": 0, "args": "(nn::sf::Out<long,void>,nn::sf::Out<long,void>)", "outbytes": 16, "name": "GetStorageUsage"},
"10300": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetTransmissionStatus"},
"10200": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "RequestImmediateTransmission"},
"40100": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsUserAgreementCheckEnabled"},
"40101": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetUserAgreementCheckEnabled"},
"20101": {"inbytes": 24, "args": "(nn::account::Uid const&,nn::sf::InArray<char> const&,nn::ApplicationId,nn::sf::InBuffer const&)", "outbytes": 0, "buffers": [9, 5], "name": "SaveSystemReportWithUser"},
"10101": {"outbytes": 0, "inbytes": 24, "args": "(nn::account::Uid const&,nn::sf::InArray<char> const&,nn::sf::InBuffer const&,unsigned long)", "pid": True, "buffers": [9, 5], "name": "SaveReportWithUser"},
"10100": {"outbytes": 0, "inbytes": 8, "args": "(nn::sf::InArray<char> const&,nn::sf::InBuffer const&,unsigned long)", "pid": True, "buffers": [9, 5], "name": "SaveReport"},
"20100": {"inbytes": 8, "args": "(nn::sf::InArray<char> const&,nn::ApplicationId,nn::sf::InBuffer const&)", "outbytes": 0, "buffers": [9, 5], "name": "SaveSystemReport"},
"30100": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ClearStorage"}
},
"nn::sasbus::ISession": {
"1": {"inbytes": 1, "outbytes": 0, "buffers": [34]},
"0": {"inbytes": 1, "outbytes": 0, "buffers": [33]},
"3": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 24, "inhandles": [1], "outbytes": 0}
},
"nn::psc::sf::IPmService": {
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::psc::sf::IPmModule"]}
},
"nn::ldn::detail::IMonitorServiceCreator": {
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::ldn::detail::IMonitorService"]}
},
"nn::ns::detail::IApplicationManagerInterface": {
"1304": {"inbytes": 16, "outbytes": 0},
"1300": {"inbytes": 8, "outbytes": 1},
"1301": {"inbytes": 16, "outbytes": 0},
"1302": {"inbytes": 8, "outbytes": 0},
"1303": {"inbytes": 8, "outbytes": 0},
"26": {"inbytes": 16, "outbytes": 0},
"27": {"inbytes": 8, "outbytes": 0},
"21": {"inbytes": 16, "outbytes": 0, "buffers": [22]},
"22": {"inbytes": 8, "outbytes": 0},
"23": {"inbytes": 16, "outbytes": 0},
"0": {"inbytes": 4, "outbytes": 4, "buffers": [6]},
"405": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"404": {"inbytes": 8, "outbytes": 0},
"403": {"inbytes": 0, "outbytes": 4},
"4": {"inbytes": 8, "outbytes": 0},
"401": {"inbytes": 0, "outbytes": 0},
"400": {"inbytes": 16, "outbytes": 4, "buffers": [6]},
"8": {"inbytes": 16, "outbytes": 1},
"1700": {"inbytes": 16, "outbytes": 4, "buffers": [6]},
"1701": {"inbytes": 0, "outbytes": 0, "buffers": [6, 5]},
"1702": {"inbytes": 8, "outbytes": 1},
"59": {"inbytes": 1, "outbytes": 8},
"58": {"inbytes": 0, "outbytes": 0},
"55": {"inbytes": 4, "outbytes": 1},
"54": {"inbytes": 8, "outbytes": 0},
"57": {"inbytes": 8, "outbytes": 0},
"56": {"inbytes": 16, "outbytes": 0},
"53": {"inbytes": 8, "outbytes": 0},
"52": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"704": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"705": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAsyncValue"]},
"700": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"701": {"inbytes": 0, "outbytes": 0},
"702": {"inbytes": 0, "outbytes": 0},
"703": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAsyncResult"]},
"82": {"inbytes": 16, "outbytes": 0},
"80": {"inbytes": 16, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAsyncResult"]},
"81": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "buffers": [5], "outinterfaces": ["nn::ns::detail::IAsyncResult"]},
"3": {"inbytes": 0, "outbytes": 0, "buffers": [6, 5]},
"7": {"inbytes": 0, "outbytes": 0},
"1400": {"inbytes": 0, "outbytes": 0},
"300": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"301": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"302": {"inbytes": 8, "outbytes": 8},
"303": {"inbytes": 8, "outbytes": 0},
"304": {"inbytes": 0, "outbytes": 8},
"305": {"inbytes": 8, "outbytes": 0},
"306": {"inbytes": 0, "outbytes": 8},
"307": {"inbytes": 8, "outbytes": 0},
"102": {"inbytes": 0, "outbytes": 0},
"100": {"inbytes": 0, "outbytes": 0},
"101": {"inbytes": 0, "outbytes": 0},
"606": {"inbytes": 16, "outbytes": 1},
"902": {"inbytes": 8, "outbytes": 0},
"903": {"inbytes": 8, "outbytes": 0},
"39": {"inbytes": 8, "outbytes": 0},
"38": {"inbytes": 8, "outbytes": 0},
"906": {"inbytes": 8, "outbytes": 8},
"907": {"inbytes": 8, "outbytes": 0},
"904": {"inbytes": 8, "outbytes": 0},
"905": {"inbytes": 16, "outbytes": 0},
"33": {"inbytes": 8, "outbytes": 0},
"32": {"inbytes": 8, "outbytes": 0},
"31": {"inbytes": 16, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAsyncResult"]},
"30": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAsyncValue"]},
"37": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"36": {"inbytes": 16, "outbytes": 0},
"35": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"1002": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IProgressAsyncResult"]},
"1001": {"inbytes": 16, "outbytes": 0},
"1000": {"outinterfaces": ["nn::ns::detail::IProgressAsyncResult"], "inhandles": [1], "outbytes": 0, "inbytes": 16, "outhandles": [1]},
"60": {"inbytes": 8, "outbytes": 1},
"61": {"inbytes": 0, "outbytes": 16},
"62": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::ns::detail::IGameCardStopper"]},
"63": {"inbytes": 8, "outbytes": 1},
"64": {"inbytes": 8, "outbytes": 0},
"65": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::ns::detail::IRequestServerStopper"]},
"66": {"inbytes": 0, "outbytes": 16},
"67": {"inbytes": 8, "outbytes": 0},
"68": {"inbytes": 8, "outbytes": 0},
"69": {"inbytes": 8, "outbytes": 16},
"1900": {"inbytes": 4, "outbytes": 1},
"210": {"inbytes": 24, "outbytes": 0},
"1502": {"inbytes": 0, "outbytes": 0},
"1500": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"1504": {"inbytes": 0, "outbytes": 0},
"6": {"inbytes": 0, "outbytes": 1},
"506": {"inbytes": 0, "outbytes": 1},
"507": {"inbytes": 0, "outbytes": 0},
"504": {"inbytes": 32, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAsyncResult"]},
"505": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"502": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAsyncResult"]},
"503": {"inbytes": 24, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAsyncValue"]},
"402": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAsyncResult"]},
"508": {"inbytes": 0, "outbytes": 0},
"1505": {"inbytes": 0, "outbytes": 0},
"900": {"inbytes": 8, "outbytes": 24},
"901": {"inbytes": 8, "outbytes": 0, "buffers": [22]},
"220": {"inbytes": 16, "outbytes": 0},
"11": {"inbytes": 8, "outbytes": 128},
"17": {"inbytes": 16, "outbytes": 4, "buffers": [6]},
"16": {"inbytes": 16, "outbytes": 0, "buffers": [5]},
"19": {"inbytes": 8, "outbytes": 8},
"908": {"inbytes": 16, "outbytes": 4, "buffers": [6]},
"605": {"inbytes": 16, "outbytes": 4, "buffers": [6]},
"604": {"inbytes": 16, "outbytes": 0},
"909": {"inbytes": 8, "outbytes": 0},
"601": {"inbytes": 16, "outbytes": 4, "buffers": [6]},
"600": {"inbytes": 8, "outbytes": 4},
"603": {"inbytes": 16, "outbytes": 16},
"602": {"inbytes": 16, "outbytes": 4, "buffers": [6]},
"1200": {"inbytes": 0, "outbytes": 1},
"48": {"inbytes": 1, "outbytes": 8},
"49": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"46": {"inbytes": 0, "outbytes": 16},
"47": {"inbytes": 1, "outbytes": 8},
"44": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"45": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"42": {"inbytes": 0, "outbytes": 0},
"43": {"inbytes": 0, "outbytes": 0},
"40": {"inbytes": 8, "outbytes": 8, "buffers": [21, 6]},
"41": {"inbytes": 8, "outbytes": 16},
"1": {"inbytes": 0, "outbytes": 8},
"5": {"inbytes": 8, "outbytes": 0},
"9": {"inbytes": 16, "outbytes": 0},
"201": {"inbytes": 16, "outbytes": 0, "outinterfaces": ["nn::ns::detail::IProgressMonitorForDeleteUserSaveDataAll"]},
"200": {"inbytes": 16, "outbytes": 16},
"71": {"inbytes": 1, "outbytes": 16},
"70": {"inbytes": 0, "outbytes": 0},
"1501": {"inbytes": 0, "outbytes": 1},
"1803": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"1802": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"1801": {"inbytes": 0, "outbytes": 8},
"1800": {"inbytes": 0, "outbytes": 1},
"1601": {"inbytes": 0, "outbytes": 0},
"1600": {"inbytes": 0, "outbytes": 32},
"802": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAsyncValue"]},
"801": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"800": {"inbytes": 0, "outbytes": 0}
},
"nn::ns::detail::IProgressMonitorForDeleteUserSaveDataAll": {
"1": {"inbytes": 0, "outbytes": 1},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0},
"10": {"inbytes": 0, "outbytes": 40}
},
"nn::am::service::IStorage": {
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ITransferStorageAccessor>,void>)", "outbytes": 0, "name": "OpenTransferStorage", "outinterfaces": ["nn::am::service::ITransferStorageAccessor"]},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorageAccessor>,void>)", "outbytes": 0, "name": "Open", "outinterfaces": ["nn::am::service::IStorageAccessor"]}
},
"nn::audio::detail::IFinalOutputRecorderManagerForApplet": {
"1": {"inbytes": 16, "outhandles": [1], "outbytes": 0},
"0": {"inbytes": 16, "outhandles": [1], "outbytes": 0}
},
"nn::account::nas::IOAuthProcedureForExternalNsa": {
"10": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::detail::Uuid,void>)", "outbytes": 16, "name": "Suspend"},
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::RequestUrl,void>,nn::sf::Out<nn::account::CallbackUri,void>)", "outbytes": 0, "buffers": [26, 26], "name": "GetRequest"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "PrepareAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"3": {"name": "ApplyResponseAsync", "inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,nn::sf::InArray<char> const&)", "outinterfaces": ["nn::account::detail::IAsyncContext"], "buffers": [9], "outbytes": 0},
"2": {"inbytes": 0, "args": "(nn::sf::InArray<char> const&)", "outbytes": 0, "buffers": [9], "name": "ApplyResponse"},
"102": {"inbytes": 0, "args": "(nn::sf::OutArray<char> const&)", "outbytes": 0, "buffers": [10], "name": "GetNickname"},
"103": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "GetProfileImage"},
"100": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::NetworkServiceAccountId,void>)", "outbytes": 8, "name": "GetAccountId"},
"101": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::NintendoAccountId,void>)", "outbytes": 8, "name": "GetLinkedNintendoAccountId"}
},
"nn::nifm::detail::IScanRequest": {
"1": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsProcessing"},
"0": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Submit"},
"3": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetSystemEventReadableHandle"},
"2": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "GetResult"}
},
"nn::timesrv::detail::service::IStaticService": {
"200": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsStandardNetworkSystemClockAccuracySufficient"},
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::timesrv::detail::service::ISystemClock>,void>)", "outbytes": 0, "name": "GetStandardNetworkSystemClock", "outinterfaces": ["nn::timesrv::detail::service::ISystemClock"]},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::timesrv::detail::service::ISystemClock>,void>)", "outbytes": 0, "name": "GetStandardUserSystemClock", "outinterfaces": ["nn::timesrv::detail::service::ISystemClock"]},
"3": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::timesrv::detail::service::ITimeZoneService>,void>)", "outbytes": 0, "name": "GetTimeZoneService", "outinterfaces": ["nn::timesrv::detail::service::ITimeZoneService"]},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::timesrv::detail::service::ISteadyClock>,void>)", "outbytes": 0, "name": "GetStandardSteadyClock", "outinterfaces": ["nn::timesrv::detail::service::ISteadyClock"]},
"4": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::timesrv::detail::service::ISystemClock>,void>)", "outbytes": 0, "name": "GetStandardLocalSystemClock", "outinterfaces": ["nn::timesrv::detail::service::ISystemClock"]},
"100": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsStandardUserSystemClockAutomaticCorrectionEnabled"},
"101": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetStandardUserSystemClockAutomaticCorrectionEnabled"}
},
"nn::news::detail::ipc::IServiceCreator": {
"1": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::news::detail::ipc::INewlyArrivedEventHolder"]},
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::news::detail::ipc::INewsService"]},
"3": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::news::detail::ipc::INewsDatabaseService"]},
"2": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::news::detail::ipc::INewsDataService"]},
"4": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::news::detail::ipc::IOverwriteEventHolder"]}
},
"nn::ns::detail::IDownloadTaskInterface": {
"704": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"705": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAsyncValue"]},
"701": {"inbytes": 0, "outbytes": 0},
"702": {"inbytes": 0, "outbytes": 0},
"703": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "outinterfaces": ["nn::ns::detail::IAsyncResult"]}
},
"nn::am::service::ILockAccessor": {
"1": {"inbytes": 1, "outhandles": [1], "outbytes": 1, "args": "(nn::sf::Out<bool,void>,nn::sf::Out<nn::sf::NativeHandle,void>,bool)", "name": "TryLock"},
"3": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetEvent"},
"2": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Unlock"}
},
"nn::fssrv::sf::ISaveDataInfoReader": {
"0": {"inbytes": 0, "outbytes": 8, "buffers": [6]}
},
"nn::ovln::IReceiverService": {
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::ovln::IReceiver"]}
},
"nn::usb::hs::IClientEpSession": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"5": {"inbytes": 4, "outbytes": 4, "buffers": [34]},
"4": {"inbytes": 24, "outbytes": 4},
"6": {"inbytes": 32, "outbytes": 4, "buffers": [33]}
},
"nn::erpt::sf::IContext": {
"1": {"inbytes": 4, "outbytes": 0, "buffers": [5, 5, 5]},
"0": {"inbytes": 0, "outbytes": 0, "buffers": [5, 5]},
"3": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 24, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 0}
},
"nn::eupld::sf::IRequest": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"2": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"5": {"inbytes": 0, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 0}
},
"nn::bcat::detail::ipc::IDeliveryCacheProgressService": {
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::bcat::detail::DeliveryCacheProgressImpl,void>)", "outbytes": 0, "buffers": [26], "name": "GetImpl"},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetEvent"}
},
"nn::fssrv::sf::IFileSystem": {
"11": {"inbytes": 0, "outbytes": 8, "buffers": [25]},
"10": {"inbytes": 0, "outbytes": 0},
"13": {"inbytes": 0, "outbytes": 0, "buffers": [25]},
"12": {"inbytes": 0, "outbytes": 8, "buffers": [25]},
"14": {"inbytes": 0, "outbytes": 32, "buffers": [25]},
"1": {"inbytes": 0, "outbytes": 0, "buffers": [25]},
"0": {"inbytes": 16, "outbytes": 0, "buffers": [25]},
"3": {"inbytes": 0, "outbytes": 0, "buffers": [25]},
"2": {"inbytes": 0, "outbytes": 0, "buffers": [25]},
"5": {"inbytes": 0, "outbytes": 0, "buffers": [25, 25]},
"4": {"inbytes": 0, "outbytes": 0, "buffers": [25]},
"7": {"inbytes": 0, "outbytes": 4, "buffers": [25]},
"6": {"inbytes": 0, "outbytes": 0, "buffers": [25, 25]},
"9": {"inbytes": 4, "outbytes": 0, "buffers": [25], "outinterfaces": ["nn::fssrv::sf::IDirectory"]},
"8": {"inbytes": 4, "outbytes": 0, "buffers": [25], "outinterfaces": ["nn::fssrv::sf::IFile"]}
},
"nn::ldn::detail::ISystemLocalCommunicationService": {
"400": {"inbytes": 8, "pid": True, "outbytes": 0},
"1": {"inbytes": 0, "outbytes": 0, "buffers": [26]},
"0": {"inbytes": 0, "outbytes": 4},
"3": {"inbytes": 0, "outbytes": 2},
"2": {"inbytes": 0, "outbytes": 8},
"5": {"inbytes": 0, "outbytes": 32},
"4": {"inbytes": 0, "outbytes": 32},
"401": {"inbytes": 0, "outbytes": 0},
"301": {"inbytes": 0, "outbytes": 0},
"201": {"inbytes": 0, "outbytes": 0},
"200": {"inbytes": 0, "outbytes": 0},
"203": {"inbytes": 184, "outbytes": 0, "buffers": [9]},
"202": {"inbytes": 152, "outbytes": 0},
"205": {"inbytes": 4, "outbytes": 0},
"204": {"inbytes": 0, "outbytes": 0},
"207": {"inbytes": 1, "outbytes": 0},
"206": {"inbytes": 0, "outbytes": 0, "buffers": [33]},
"300": {"inbytes": 0, "outbytes": 0},
"208": {"inbytes": 6, "outbytes": 0},
"302": {"inbytes": 124, "outbytes": 0, "buffers": [25]},
"303": {"inbytes": 192, "outbytes": 0},
"304": {"inbytes": 0, "outbytes": 0},
"209": {"inbytes": 0, "outbytes": 0},
"102": {"inbytes": 104, "outbytes": 2, "buffers": [34]},
"103": {"inbytes": 104, "outbytes": 2, "buffers": [34]},
"100": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"101": {"inbytes": 0, "outbytes": 0, "buffers": [26, 10]}
},
"nn::htc::tenv::IServiceManager": {
"0": {"inbytes": 8, "pid": True, "outbytes": 0, "outinterfaces": [None]}
},
"nn::xcd::detail::ISystemServer": {
"11": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"10": {"inbytes": 8, "outhandles": [1, 1], "outbytes": 0},
"13": {"inbytes": 8, "outbytes": 0},
"12": {"inbytes": 16, "outbytes": 0},
"15": {"inbytes": 8, "outbytes": 0, "buffers": [25]},
"14": {"inbytes": 48, "outbytes": 0},
"17": {"inbytes": 8, "outbytes": 0, "buffers": [25]},
"16": {"inbytes": 8, "outbytes": 0, "buffers": [25]},
"19": {"inbytes": 8, "outbytes": 0, "buffers": [25]},
"18": {"inbytes": 16, "outbytes": 0},
"1": {"inbytes": 16, "outbytes": 0},
"0": {"inbytes": 8, "outbytes": 1},
"3": {"inbytes": 16, "outbytes": 0},
"2": {"inbytes": 8, "outbytes": 1},
"5": {"inbytes": 8, "outbytes": 0},
"4": {"inbytes": 8, "outbytes": 32},
"102": {"inbytes": 0, "outbytes": 8},
"20": {"inbytes": 8, "outbytes": 0, "buffers": [25]},
"101": {"inbytes": 0, "outbytes": 8}
},
"nn::am::service::IDisplayController": {
"11": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ReleaseLastApplicationCaptureBuffer"},
"10": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "AcquireLastApplicationCaptureBuffer"},
"13": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ReleaseLastForegroundCaptureBuffer"},
"12": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "AcquireLastForegroundCaptureBuffer"},
"15": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ReleaseCallerAppletCaptureBuffer"},
"14": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "AcquireCallerAppletCaptureBuffer"},
"17": {"inbytes": 0, "outhandles": [1], "outbytes": 1, "args": "(nn::sf::Out<bool,void>,nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "AcquireLastForegroundCaptureBufferEx"},
"16": {"inbytes": 0, "outhandles": [1], "outbytes": 1, "args": "(nn::sf::Out<bool,void>,nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "AcquireLastApplicationCaptureBufferEx"},
"18": {"inbytes": 0, "outhandles": [1], "outbytes": 1, "args": "(nn::sf::Out<bool,void>,nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "AcquireCallerAppletCaptureBufferEx"},
"21": {"inbytes": 4, "args": "(unsigned int)", "outbytes": 0, "name": "ClearAppletTransitionBuffer"},
"1": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "UpdateLastForegroundCaptureImage"},
"0": {"inbytes": 0, "args": "(nn::sf::OutBuffer const&)", "outbytes": 0, "buffers": [6], "name": "GetLastForegroundCaptureImage"},
"3": {"inbytes": 0, "args": "(nn::sf::OutBuffer const&)", "outbytes": 0, "buffers": [6], "name": "GetCallerAppletCaptureImage"},
"2": {"inbytes": 0, "args": "(nn::sf::OutBuffer const&)", "outbytes": 0, "buffers": [6], "name": "GetLastApplicationCaptureImage"},
"5": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>,nn::sf::OutBuffer const&)", "outbytes": 1, "buffers": [6], "name": "GetLastForegroundCaptureImageEx"},
"4": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "UpdateCallerAppletCaptureImage"},
"7": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>,nn::sf::OutBuffer const&)", "outbytes": 1, "buffers": [6], "name": "GetCallerAppletCaptureImageEx"},
"6": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>,nn::sf::OutBuffer const&)", "outbytes": 1, "buffers": [6], "name": "GetLastApplicationCaptureImageEx"},
"20": {"inbytes": 12, "args": "(int,bool,unsigned int)", "outbytes": 0, "name": "ClearCaptureBuffer"},
"8": {"inbytes": 8, "args": "(int,bool)", "outbytes": 0, "name": "TakeScreenShotOfOwnLayer"}
},
"nn::btm::IBtm": {
"11": {"inbytes": 6, "outbytes": 0},
"10": {"inbytes": 96, "outbytes": 0},
"13": {"inbytes": 6, "outbytes": 0},
"12": {"inbytes": 6, "outbytes": 0},
"15": {"inbytes": 0, "outbytes": 0},
"14": {"inbytes": 0, "outbytes": 0},
"17": {"inbytes": 6, "outbytes": 0, "buffers": [25]},
"16": {"inbytes": 6, "outbytes": 0},
"18": {"inbytes": 0, "outhandles": [1], "outbytes": 1},
"1": {"inbytes": 0, "outbytes": 42},
"0": {"inbytes": 0, "outbytes": 4},
"3": {"inbytes": 0, "outbytes": 0, "buffers": [26]},
"2": {"inbytes": 0, "outhandles": [1], "outbytes": 1},
"5": {"inbytes": 0, "outbytes": 0, "buffers": [25]},
"4": {"inbytes": 7, "outbytes": 0},
"7": {"inbytes": 4, "outbytes": 0},
"6": {"inbytes": 4, "outbytes": 0},
"9": {"inbytes": 0, "outbytes": 0, "buffers": [26]},
"8": {"inbytes": 0, "outhandles": [1], "outbytes": 1}
},
"nn::settings::ISettingsItemKeyIterator": {
"1": {"inbytes": 0, "args": "(nn::sf::Out<unsigned long,void>)", "outbytes": 8, "name": "GetKeySize"},
"0": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "GoNext"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<unsigned long,void>,nn::sf::OutBuffer const&)", "outbytes": 8, "buffers": [6], "name": "GetKey"}
},
"nns::hosbinder::IHOSBinderDriver": {
"1": {"inbytes": 12, "args": "(int,int,int)", "outbytes": 0, "name": "AdjustRefcount"},
"0": {"inbytes": 12, "args": "(int,unsigned int,nn::sf::InBuffer const&,nn::sf::OutBuffer const&,unsigned int)", "outbytes": 0, "buffers": [5, 6], "name": "TransactParcel"},
"3": {"inbytes": 12, "args": "(int,unsigned int,nn::sf::InBuffer const&,nn::sf::OutBuffer const&,unsigned int)", "outbytes": 0, "buffers": [33, 34], "name": "TransactParcelAuto"},
"2": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "args": "(int,unsigned int,nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetNativeHandle"}
},
"nn::nfc::am::detail::IAmManager": {
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::nfc::am::detail::IAm"]}
},
"nn::arp::detail::IWriter": {
"1": {"inbytes": 8, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::arp::detail::IRegistrar"]}
},
"nn::am::service::IGlobalStateController": {
"11": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "NotifyCecSettingsChanged"},
"10": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "LoadAndApplyIdlePolicySettings"},
"13": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "UpdateDefaultDisplayResolution"},
"12": {"inbytes": 8, "args": "(long)", "outbytes": 0, "name": "SetDefaultHomeButtonLongPressTime"},
"14": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "ShouldSleepOnBoot"},
"1": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "EnterSleep"},
"0": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "RequestToEnterSleep"},
"3": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "StartShutdownSequence"},
"2": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "StartSleepSequence"},
"4": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "StartRebootSequence"}
},
"nn::wlan::detail::ILocalGetFrame": {
"0": {"inbytes": 4, "outbytes": 4, "buffers": [6]}
},
"nn::account::IAccountServiceForApplication": {
"1": {"inbytes": 16, "args": "(nn::sf::Out<bool,void>,nn::account::Uid const&)", "outbytes": 1, "name": "GetUserExistence"},
"51": {"inbytes": 1, "args": "(nn::sf::Out<nn::account::Uid,void>,bool)", "outbytes": 16, "name": "TrySelectUserWithoutInteraction"},
"50": {"inbytes": 8, "args": "(nn::sf::Out<bool,void>,unsigned long)", "pid": True, "outbytes": 1, "name": "IsUserRegistrationRequestPermitted"},
"120": {"args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::baas::IGuestLoginRequest>,void>,nn::sf::NativeHandle &&,unsigned int)", "outbytes": 0, "inbytes": 4, "inhandles": [1], "outinterfaces": ["nn::account::baas::IGuestLoginRequest"], "name": "CreateGuestLoginRequest"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetUserCount"},
"3": {"inbytes": 0, "args": "(nn::sf::OutArray<nn::account::Uid> const&)", "outbytes": 0, "buffers": [10], "name": "ListOpenUsers"},
"2": {"inbytes": 0, "args": "(nn::sf::OutArray<nn::account::Uid> const&)", "outbytes": 0, "buffers": [10], "name": "ListAllUsers"},
"5": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::profile::IProfile>,void>,nn::account::Uid const&)", "outbytes": 0, "name": "GetProfile", "outinterfaces": ["nn::account::profile::IProfile"]},
"4": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::Uid,void>)", "outbytes": 16, "name": "GetLastOpenedUser"},
"6": {"inbytes": 16, "args": "(nn::sf::Out<nn::account::ProfileDigest,void>,nn::account::Uid const&)", "outbytes": 16, "name": "GetProfileDigest"},
"102": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "AuthenticateApplicationAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"111": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "ClearSaveDataThumbnail"},
"100": {"inbytes": 8, "args": "(unsigned long)", "pid": True, "outbytes": 0, "name": "InitializeApplicationInfo"},
"101": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::baas::IManagerForApplication>,void>,nn::account::Uid const&)", "outbytes": 0, "name": "GetBaasAccountManagerForApplication", "outinterfaces": ["nn::account::baas::IManagerForApplication"]},
"110": {"inbytes": 16, "args": "(nn::account::Uid const&,nn::sf::InBuffer const&)", "outbytes": 0, "buffers": [5], "name": "StoreSaveDataThumbnail"}
},
"nn::nfc::detail::IUserManager": {
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::nfc::detail::IUser"]}
},
"nn::npns::INpnsUser": {
"25": {"inbytes": 40, "outbytes": 1},
"21": {"inbytes": 16, "outbytes": 40},
"23": {"inbytes": 16, "outbytes": 0},
"1": {"inbytes": 0, "outbytes": 0},
"3": {"inbytes": 2, "outbytes": 0, "buffers": [6]},
"2": {"inbytes": 8, "outbytes": 0},
"5": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"4": {"inbytes": 2, "outbytes": 0, "buffers": [6]},
"7": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"102": {"inbytes": 0, "outbytes": 0},
"103": {"inbytes": 0, "outbytes": 4},
"111": {"inbytes": 0, "outbytes": 0, "buffers": [10]},
"101": {"inbytes": 0, "outbytes": 0},
"104": {"inbytes": 0, "outbytes": 0, "buffers": [6]}
},
"nn::ns::detail::IContentManagementInterface": {
"11": {"inbytes": 8, "outbytes": 128},
"605": {"inbytes": 16, "outbytes": 4, "buffers": [6]},
"607": {"inbytes": 0, "outbytes": 1},
"601": {"inbytes": 16, "outbytes": 4, "buffers": [6]},
"600": {"inbytes": 8, "outbytes": 4},
"48": {"inbytes": 1, "outbytes": 8},
"47": {"inbytes": 1, "outbytes": 8},
"43": {"inbytes": 0, "outbytes": 0}
},
"nn::am::service::IOverlayFunctions": {
"1": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "EndToWatchShortHomeButtonMessage"},
"0": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "BeginToWatchShortHomeButtonMessage"},
"3": {"inbytes": 8, "args": "(unsigned long)", "outbytes": 0, "name": "SetGpuTimeSliceBoost"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::ncm::ApplicationId,void>)", "outbytes": 8, "name": "GetApplicationIdForLogo"},
"5": {"inbytes": 4, "args": "(unsigned int)", "outbytes": 0, "name": "TerminateApplicationAndSetReason"},
"4": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetAutoSleepTimeAndDimmingTimeEnabled"},
"6": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetScreenShotPermissionGlobally"}
},
"nn::fgm::sf::IRequest": {
"1": {"inbytes": 8, "args": "(unsigned int,unsigned int)", "outbytes": 0, "name": "Set"},
"0": {"outhandles": [1], "outbytes": 0, "inbytes": 16, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,nn::fgm::Module,unsigned long)", "pid": True, "name": "Initialize"},
"3": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Cancel"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>)", "outbytes": 4, "name": "Get"}
},
"nn::timesrv::detail::service::ISteadyClock": {
"201": {"inbytes": 8, "args": "(nn::TimeSpanType)", "outbytes": 0, "name": "SetInternalOffset"},
"200": {"inbytes": 0, "args": "(nn::sf::Out<nn::TimeSpanType,void>)", "outbytes": 8, "name": "GetInternalOffset"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::time::SteadyClockTimePoint,void>)", "outbytes": 24, "name": "GetCurrentTimePoint"},
"3": {"inbytes": 8, "args": "(nn::TimeSpanType)", "outbytes": 0, "name": "SetTestOffset"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::TimeSpanType,void>)", "outbytes": 8, "name": "GetTestOffset"},
"102": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>)", "outbytes": 4, "name": "GetSetupResutltValue"},
"100": {"inbytes": 0, "args": "(nn::sf::Out<long,void>)", "outbytes": 8, "name": "GetRtcValue"},
"101": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsRtcResetDetected"}
},
"nn::nfc::detail::ISystemManager": {
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::nfc::detail::ISystem"]}
},
"nn::audio::detail::IAudioOutManager": {
"1": {"outbytes": 16, "inbytes": 16, "inhandles": [1], "pid": True, "outinterfaces": ["nn::audio::detail::IAudioOut"], "buffers": [5, 6]},
"0": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"3": {"outbytes": 16, "inbytes": 16, "inhandles": [1], "pid": True, "outinterfaces": ["nn::audio::detail::IAudioOut"], "buffers": [33, 34]},
"2": {"inbytes": 0, "outbytes": 4, "buffers": [34]}
},
"nn::irsensor::IIrSensorServer": {
"308": {"args": "(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle,nn::irsensor::PackedImageTransferProcessorConfig const&,nn::sf::NativeHandle &&,unsigned long)", "outbytes": 0, "inbytes": 48, "inhandles": [1], "pid": True, "name": "RunImageTransferProcessor"},
"309": {"outbytes": 16, "inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::sf::Out<nn::irsensor::ImageTransferProcessorState,void>,nn::sf::OutBuffer const&,nn::irsensor::IrCameraHandle)", "pid": True, "buffers": [6], "name": "GetImageTransferProcessorState"},
"303": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "DeactivateIrsensor"},
"313": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle)", "pid": True, "outbytes": 0, "name": "SuspendImageProcessor"},
"312": {"inbytes": 24, "args": "(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle,nn::irsensor::PackedDpdProcessorConfig const&)", "pid": True, "outbytes": 0, "name": "RunDpdProcessor"},
"302": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "ActivateIrsensor"},
"310": {"inbytes": 24, "args": "(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle,nn::irsensor::PackedTeraPluginProcessorConfig)", "pid": True, "outbytes": 0, "name": "RunTeraPluginProcessor"},
"304": {"outhandles": [1], "outbytes": 0, "inbytes": 8, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,nn::applet::AppletResourceUserId)", "pid": True, "name": "GetIrsensorSharedMemoryHandle"},
"305": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle)", "pid": True, "outbytes": 0, "name": "StopImageProcessor"},
"306": {"inbytes": 48, "args": "(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle,nn::irsensor::PackedMomentProcessorConfig const&)", "pid": True, "outbytes": 0, "name": "RunMomentProcessor"},
"307": {"inbytes": 56, "args": "(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle,nn::irsensor::PackedClusteringProcessorConfig const&)", "pid": True, "outbytes": 0, "name": "RunClusteringProcessor"},
"314": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::irsensor::IrCameraHandle,nn::irsensor::PackedMcuVersion)", "pid": True, "outbytes": 0, "name": "CheckFirmwareVersion"},
"311": {"inbytes": 4, "args": "(nn::sf::Out<nn::irsensor::IrCameraHandle,void>,unsigned int)", "outbytes": 4, "name": "GetNpadIrCameraHandle"}
},
"nn::usb::pd::detail::IPdManager": {
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::usb::pd::detail::IPdSession"]}
},
"nn::pcv::IImmediateManager": {
"0": {"inbytes": 8, "args": "(int,unsigned int)", "outbytes": 0, "name": "SetClockRate"}
},
"nn::erpt::sf::IReport": {
"1": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"0": {"inbytes": 20, "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 4},
"2": {"inbytes": 4, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 8},
"4": {"inbytes": 0, "outbytes": 0}
},
"nn::ahid::IReadSession": {
"0": {"inbytes": 8, "outbytes": 4, "buffers": [6]}
},
"nn::hid::IHidTemporaryServer": {
"0": {"inbytes": 16, "args": "(nn::sf::Out<nn::hid::tmp::ConsoleSixAxisSensorCalibrationValues,void>,nn::applet::AppletResourceUserId,nn::hid::ConsoleSixAxisSensorHandle)", "pid": True, "outbytes": 24, "name": "GetConsoleSixAxisSensorCalibrationValues"}
},
"nn::i2c::IManager": {
"1": {"inbytes": 4, "outbytes": 0, "outinterfaces": ["nn::i2c::ISession"]},
"0": {"inbytes": 16, "outbytes": 0, "outinterfaces": ["nn::i2c::ISession"]},
"3": {"inbytes": 16, "outbytes": 1},
"2": {"inbytes": 4, "outbytes": 1}
},
"nn::eth::sf::IEthInterfaceGroup": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"2": {"inbytes": 0, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 4}
},
"nn::am::service::IApplicationFunctions": {
"60": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetMediaPlaybackStateForApplication"},
"65": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsGamePlayRecordingSupported"},
"66": {"inbytes": 8, "inhandles": [1], "outbytes": 0, "args": "(nn::sf::NativeHandle &&,unsigned long)", "name": "InitializeGamePlayRecording"},
"67": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "SetGamePlayRecordingState"},
"24": {"inbytes": 0, "args": "(nn::sf::Out<nn::ncm::StorageId,void>,nn::sf::Out<nn::ncm::StorageId,void>)", "outbytes": 2, "name": "GetLaunchStorageInfoForDebug"},
"25": {"inbytes": 40, "args": "(nn::sf::Out<long,void>,unsigned char,nn::account::Uid const&,long,long)", "outbytes": 8, "name": "ExtendSaveData"},
"26": {"inbytes": 24, "args": "(nn::sf::Out<long,void>,nn::sf::Out<long,void>,unsigned char,nn::account::Uid const&)", "outbytes": 16, "name": "GetSaveDataSize"},
"20": {"inbytes": 16, "args": "(nn::sf::Out<long,void>,nn::account::Uid const&)", "outbytes": 8, "name": "EnsureSaveData"},
"21": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::LanguageCode,void>)", "outbytes": 8, "name": "GetDesiredLanguage"},
"22": {"inbytes": 4, "args": "(unsigned int)", "outbytes": 0, "name": "SetTerminateResult"},
"23": {"inbytes": 0, "args": "(nn::sf::Out<nn::oe::DisplayVersion,void>)", "outbytes": 16, "name": "GetDisplayVersion"},
"40": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "NotifyRunning"},
"1": {"inbytes": 4, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>,unsigned int)", "outbytes": 0, "name": "PopLaunchParameter", "outinterfaces": ["nn::am::service::IStorage"]},
"71": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "RequestToReboot"},
"70": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "RequestToShutdown"},
"11": {"inbytes": 16, "args": "(nn::ncm::ApplicationId,nn::sf::SharedPointer<nn::am::service::IStorage>,unsigned int,unsigned int)", "outbytes": 0, "name": "CreateApplicationAndPushAndRequestToStartForQuest", "ininterfaces": [None]},
"10": {"inbytes": 8, "args": "(nn::ncm::ApplicationId,nn::sf::SharedPointer<nn::am::service::IStorage>)", "outbytes": 0, "name": "CreateApplicationAndPushAndRequestToStart", "ininterfaces": [None]},
"33": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "EndBlockingHomeButton"},
"32": {"inbytes": 8, "args": "(long)", "outbytes": 0, "name": "BeginBlockingHomeButton"},
"31": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "EndBlockingHomeButtonShortAndLongPressed"},
"30": {"inbytes": 8, "args": "(long)", "outbytes": 0, "name": "BeginBlockingHomeButtonShortAndLongPressed"},
"50": {"inbytes": 0, "args": "(nn::sf::Out<nn::util::Uuid,void>)", "outbytes": 16, "name": "GetPseudoDeviceId"}
},
"nn::am::service::IDebugFunctions": {
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationAccessor>,void>)", "outbytes": 0, "name": "OpenMainApplication", "outinterfaces": ["nn::am::service::IApplicationAccessor"]},
"0": {"inbytes": 4, "args": "(nn::am::AppletMessage)", "outbytes": 0, "name": "NotifyMessageToHomeMenuForDebug"},
"20": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "InvalidateTransitionLayer"},
"10": {"inbytes": 4, "args": "(nn::am::service::EmulatedButtonEvent)", "outbytes": 0, "name": "EmulateButtonEvent"}
},
"nn::tma::IHtcsManager": {
"11": {"inbytes": 0, "outbytes": 32},
"10": {"inbytes": 0, "outbytes": 32},
"13": {"inbytes": 1, "outbytes": 4, "outinterfaces": [None]},
"12": {"inbytes": 0, "outbytes": 4, "outinterfaces": [None]},
"1": {"inbytes": 4, "outbytes": 8},
"0": {"inbytes": 0, "outbytes": 8},
"3": {"inbytes": 72, "outbytes": 8},
"2": {"inbytes": 72, "outbytes": 8},
"5": {"inbytes": 4, "outbytes": 76},
"4": {"inbytes": 8, "outbytes": 8},
"7": {"inbytes": 8, "outbytes": 16, "buffers": [5]},
"6": {"inbytes": 8, "outbytes": 16, "buffers": [6]},
"9": {"inbytes": 12, "outbytes": 8},
"8": {"inbytes": 8, "outbytes": 8},
"100": {"inbytes": 8, "pid": True, "outbytes": 0},
"101": {"inbytes": 8, "pid": True, "outbytes": 0}
},
"nns::nvdrv::INvDrvDebugFSServices": {
"1": {"inbytes": 4, "outbytes": 0},
"0": {"inbytes": 0, "inhandles": [1], "outbytes": 4},
"3": {"inbytes": 4, "outbytes": 4, "buffers": [5, 6]},
"2": {"inbytes": 4, "outbytes": 4, "buffers": [6]},
"4": {"inbytes": 4, "outbytes": 4, "buffers": [5, 5]}
},
"nn::am::service::IOverlayAppletProxy": {
"11": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletCreator>,void>)", "outbytes": 0, "name": "GetLibraryAppletCreator", "outinterfaces": ["nn::am::service::ILibraryAppletCreator"]},
"10": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IProcessWindingController>,void>)", "outbytes": 0, "name": "GetProcessWindingController", "outinterfaces": ["nn::am::service::IProcessWindingController"]},
"20": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IOverlayFunctions>,void>)", "outbytes": 0, "name": "GetOverlayFunctions", "outinterfaces": ["nn::am::service::IOverlayFunctions"]},
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ISelfController>,void>)", "outbytes": 0, "name": "GetSelfController", "outinterfaces": ["nn::am::service::ISelfController"]},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ICommonStateGetter>,void>)", "outbytes": 0, "name": "GetCommonStateGetter", "outinterfaces": ["nn::am::service::ICommonStateGetter"]},
"3": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IAudioController>,void>)", "outbytes": 0, "name": "GetAudioController", "outinterfaces": ["nn::am::service::IAudioController"]},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IWindowController>,void>)", "outbytes": 0, "name": "GetWindowController", "outinterfaces": ["nn::am::service::IWindowController"]},
"4": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDisplayController>,void>)", "outbytes": 0, "name": "GetDisplayController", "outinterfaces": ["nn::am::service::IDisplayController"]},
"1000": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDebugFunctions>,void>)", "outbytes": 0, "name": "GetDebugFunctions", "outinterfaces": ["nn::am::service::IDebugFunctions"]}
},
"nn::friends::detail::ipc::IServiceCreator": {
"1": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::friends::detail::ipc::INotificationService>,void>,nn::account::Uid const&)", "outbytes": 0, "name": "CreateNotificationService", "outinterfaces": ["nn::friends::detail::ipc::INotificationService"]},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::friends::detail::ipc::IFriendService>,void>)", "outbytes": 0, "name": "CreateFriendService", "outinterfaces": ["nn::friends::detail::ipc::IFriendService"]}
},
"nn::fan::detail::IManager": {
"0": {"inbytes": 4, "outbytes": 0, "outinterfaces": ["nn::fan::detail::IController"]}
},
"nn::hid::IHidSystemServer": {
"151": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "ActivateCaptureButton"},
"802": {"inbytes": 4, "args": "(nn::hid::system::UniqueSixAxisSensorHandle)", "outbytes": 0, "name": "ResetSixAxisSensorCalibrationValues"},
"212": {"inbytes": 4, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,unsigned int)", "name": "AcquireNfcActivateEventHandle"},
"213": {"inbytes": 16, "args": "(unsigned int,bool,nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "ActivateNfc"},
"210": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "AcquireNfcDeviceUpdateEventHandle"},
"211": {"inbytes": 0, "args": "(nn::sf::Out<long,void>,nn::sf::OutArray<unsigned int> const&)", "outbytes": 8, "buffers": [10], "name": "GetNpadsWithNfc"},
"311": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,unsigned int,nn::util::BitFlagSet<32,nn::hid::system::DeviceType>)", "pid": True, "outbytes": 0, "name": "SetNpadPlayerLedBlinkingDevice"},
"700": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::hid::system::UniquePadId)", "pid": True, "outbytes": 0, "name": "ActivateUniquePad"},
"702": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "AcquireUniquePadConnectionEventHandle"},
"703": {"inbytes": 0, "args": "(nn::sf::Out<long,void>,nn::sf::OutArray<nn::hid::system::UniquePadId> const&)", "outbytes": 8, "buffers": [10], "name": "GetUniquePadIds"},
"131": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "ActivateSleepButton"},
"111": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "ActivateHomeButton"},
"804": {"inbytes": 4, "args": "(nn::hid::system::UniqueSixAxisSensorHandle)", "outbytes": 0, "name": "CancelSixAxisSensorUserCalibration"},
"230": {"inbytes": 4, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,unsigned int)", "name": "AcquireIrSensorEventHandle"},
"231": {"inbytes": 16, "args": "(unsigned int,bool,nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "ActivateIrSensor"},
"542": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "AcquirePlayReportRegisteredDeviceUpdateEvent"},
"850": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsUsbFullKeyControllerEnabled"},
"851": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "EnableUsbFullKeyController"},
"852": {"inbytes": 8, "args": "(nn::sf::Out<bool,void>,nn::hid::system::UniquePadId)", "outbytes": 1, "name": "IsUsbConnected"},
"543": {"inbytes": 0, "args": "(nn::sf::Out<long,void>,nn::sf::OutArray<nn::hid::system::RegisteredDevice> const&)", "outbytes": 8, "buffers": [10], "name": "GetRegisteredDevices"},
"1005": {"inbytes": 8, "args": "(nn::sf::Out<nn::hid::system::FirmwareUpdateDeviceHandle,void>,nn::hid::system::UniquePadId)", "outbytes": 8, "name": "StartFirmwareUpdate"},
"322": {"inbytes": 16, "args": "(unsigned int,nn::sf::Out<long,void>,nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 8, "name": "GetIrSensorState"},
"323": {"inbytes": 16, "args": "(unsigned int,nn::sf::Out<unsigned long,void>,nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 8, "name": "GetXcdHandleForNpadWithIrSensor"},
"540": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "AcquirePlayReportControllerUsageUpdateEvent"},
"541": {"inbytes": 0, "args": "(nn::sf::Out<long,void>,nn::sf::OutArray<nn::hid::system::PlayReportControllerUsage> const&)", "outbytes": 8, "buffers": [10], "name": "GetPlayReportControllerUsages"},
"520": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "EnableHandheldHids"},
"521": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DisableHandheldHids"},
"544": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "AcquireConnectionTriggerTimeoutEvent"},
"545": {"inbytes": 6, "args": "(nn::bluetooth::Address)", "outbytes": 0, "name": "SendConnectionTrigger"},
"546": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "AcquireDeviceRegisteredEventForControllerSupport"},
"504": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,bool)", "outbytes": 0, "name": "SetAruidValidForVibration"},
"505": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,bool)", "outbytes": 0, "name": "EnableAppletToGetSixAxisSensor"},
"502": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "outbytes": 0, "name": "UnregisterAppletResourceUserId"},
"503": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,bool)", "outbytes": 0, "name": "EnableAppletToGetInput"},
"500": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "outbytes": 0, "name": "SetAppletResourceUserId"},
"547": {"inbytes": 0, "args": "(nn::sf::Out<long,void>)", "outbytes": 8, "name": "GetAllowedBluetoothLinksCount"},
"751": {"outhandles": [1], "outbytes": 0, "inbytes": 8, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,nn::applet::AppletResourceUserId)", "pid": True, "name": "AcquireJoyDetachOnBluetoothOffEventHandle"},
"141": {"outhandles": [1], "outbytes": 0, "inbytes": 8, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,nn::applet::AppletResourceUserId)", "pid": True, "name": "AcquireCaptureButtonEventHandle"},
"301": {"inbytes": 4, "args": "(unsigned int)", "outbytes": 0, "name": "ActivateNpadSystem"},
"303": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "ApplyNpadSystemCommonPolicy"},
"304": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "EnableAssigningSingleOnSlSrPress"},
"305": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "DisableAssigningSingleOnSlSrPress"},
"306": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>)", "outbytes": 4, "name": "GetLastActiveNpad"},
"307": {"inbytes": 4, "args": "(nn::sf::Out<long,void>,nn::sf::Out<long,void>,unsigned int)", "outbytes": 16, "name": "GetNpadSystemExtStyle"},
"121": {"outhandles": [1], "outbytes": 0, "inbytes": 8, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,nn::applet::AppletResourceUserId)", "pid": True, "name": "AcquireSleepButtonEventHandle"},
"901": {"inbytes": 4, "args": "(nn::util::BitFlagSet<32,nn::hid::system::InputSourceId>)", "outbytes": 0, "name": "NotifyInputDetector"},
"824": {"inbytes": 16, "args": "(nn::hid::system::UniquePadId,long)", "outbytes": 0, "name": "ResetAnalogStickManualCalibration"},
"1006": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "AbortFirmwareUpdate"},
"513": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "EndPermitVibrationSession"},
"101": {"outhandles": [1], "outbytes": 0, "inbytes": 8, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,nn::applet::AppletResourceUserId)", "pid": True, "name": "AcquireHomeButtonEventHandle"},
"1007": {"inbytes": 8, "args": "(nn::sf::Out<nn::hid::system::FirmwareUpdateState,void>,nn::hid::system::FirmwareUpdateDeviceHandle)", "outbytes": 4, "name": "GetFirmwareUpdateState"},
"321": {"inbytes": 4, "args": "(nn::sf::Out<long,void>,nn::sf::OutArray<nn::hid::system::UniquePadId> const&,unsigned int)", "outbytes": 8, "buffers": [10], "name": "GetUniquePadsFromNpad"},
"900": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "ActivateInputDetector"},
"1004": {"inbytes": 8, "args": "(nn::sf::Out<long,void>,nn::hid::system::UniquePadId)", "outbytes": 8, "name": "CheckFirmwareUpdateRequired"},
"821": {"inbytes": 16, "args": "(nn::hid::system::UniquePadId,long)", "outbytes": 0, "name": "StartAnalogStickManualCalibration"},
"31": {"inbytes": 4, "args": "(nn::util::BitFlagSet<32,nn::hid::system::KeyboardLockKeyEvent>)", "outbytes": 0, "name": "SendKeyboardLockKeyEvent"},
"511": {"inbytes": 0, "args": "(nn::sf::Out<float,void>)", "outbytes": 4, "name": "GetVibrationMasterVolume"},
"512": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "outbytes": 0, "name": "BeginPermitVibrationSession"},
"806": {"inbytes": 8, "args": "(nn::hid::system::UniquePadId)", "outbytes": 0, "name": "DisconnectUniquePad"},
"501": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,bool)", "outbytes": 0, "name": "RegisterAppletResourceUserId"},
"805": {"inbytes": 8, "args": "(nn::sf::Out<nn::bluetooth::Address,void>,nn::hid::system::UniquePadId)", "outbytes": 6, "name": "GetUniquePadBluetoothAddress"},
"823": {"inbytes": 16, "args": "(nn::hid::system::UniquePadId,long)", "outbytes": 0, "name": "CancelAnalogStickManualCalibration"},
"1000": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "InitializeFirmwareUpdate"},
"803": {"inbytes": 4, "args": "(nn::hid::system::UniqueSixAxisSensorHandle)", "outbytes": 0, "name": "StartSixAxisSensorUserCalibration"},
"510": {"inbytes": 4, "args": "(float)", "outbytes": 0, "name": "SetVibrationMasterVolume"},
"801": {"inbytes": 4, "args": "(nn::sf::Out<bool,void>,nn::hid::system::UniqueSixAxisSensorHandle)", "outbytes": 1, "name": "IsSixAxisSensorUserCalibrationSupported"},
"800": {"inbytes": 8, "args": "(nn::sf::Out<long,void>,nn::sf::OutArray<nn::hid::system::UniqueSixAxisSensorHandle> const&,nn::hid::system::UniquePadId)", "outbytes": 8, "buffers": [10], "name": "ListSixAxisSensorHandles"},
"1003": {"inbytes": 8, "args": "(nn::sf::Out<bool,void>,nn::hid::system::UniquePadId)", "outbytes": 1, "name": "IsFirmwareUpdateAvailable"},
"1002": {"inbytes": 8, "args": "(nn::sf::Out<nn::hid::system::FirmwareVersion,void>,nn::hid::system::UniquePadId)", "outbytes": 16, "name": "GetAvailableFirmwareVersion"},
"1001": {"inbytes": 8, "args": "(nn::sf::Out<nn::hid::system::FirmwareVersion,void>,nn::hid::system::UniquePadId)", "outbytes": 16, "name": "GetFirmwareVersion"},
"822": {"inbytes": 16, "args": "(nn::hid::system::UniquePadId,long)", "outbytes": 0, "name": "RetryCurrentAnalogStickManualCalibrationStage"}
},
"nn::ntc::detail::service::IEnsureNetworkClockAvailabilityService": {
"1": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 8},
"4": {"inbytes": 0, "outbytes": 1}
},
"nn::audio::detail::IAudioOut": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 4},
"3": {"inbytes": 8, "outbytes": 0, "buffers": [5]},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"4": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"7": {"inbytes": 8, "outbytes": 0, "buffers": [33]},
"6": {"inbytes": 8, "outbytes": 1},
"8": {"inbytes": 0, "outbytes": 4, "buffers": [34]}
},
"nn::sasbus::IManager": {
"0": {"inbytes": 4, "outbytes": 0, "outinterfaces": ["nn::sasbus::ISession"]}
},
"nn::visrv::sf::IApplicationDisplayService": {
"103": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nns::hosbinder::IHOSBinderDriver>,void>)", "outbytes": 0, "name": "GetIndirectDisplayTransactionService", "outinterfaces": ["nns::hosbinder::IHOSBinderDriver"]},
"2460": {"inbytes": 16, "args": "(nn::sf::Out<long,void>,nn::sf::Out<long,void>,long,long)", "outbytes": 16, "name": "GetIndirectLayerImageRequiredMemoryInfo"},
"1020": {"inbytes": 8, "args": "(unsigned long)", "outbytes": 0, "name": "CloseDisplay"},
"1101": {"inbytes": 16, "args": "(unsigned long,bool)", "outbytes": 0, "name": "SetDisplayEnabled"},
"2451": {"outbytes": 16, "inbytes": 48, "args": "(nn::sf::Out<long,void>,nn::sf::Out<long,void>,nn::sf::OutBuffer const&,long,long,float,float,float,float,unsigned long,nn::applet::AppletResourceUserId)", "pid": True, "buffers": [70], "name": "GetIndirectLayerImageCropMap"},
"2450": {"outbytes": 16, "inbytes": 32, "args": "(nn::sf::Out<long,void>,nn::sf::Out<long,void>,nn::sf::OutBuffer const&,long,long,unsigned long,nn::applet::AppletResourceUserId)", "pid": True, "buffers": [70], "name": "GetIndirectLayerImageMap"},
"1011": {"inbytes": 0, "args": "(nn::sf::Out<unsigned long,void>)", "outbytes": 8, "name": "OpenDefaultDisplay"},
"5203": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,unsigned long)", "name": "GetDisplayVsyncEventForDebug"},
"5202": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,unsigned long)", "name": "GetDisplayVsyncEvent"},
"2020": {"outbytes": 8, "inbytes": 80, "args": "(nn::sf::Out<long,void>,nn::sf::OutBuffer const&,unsigned long,nn::vi::DisplayName const&,nn::applet::AppletResourceUserId)", "pid": True, "buffers": [6], "name": "OpenLayer"},
"2021": {"inbytes": 8, "args": "(unsigned long)", "outbytes": 0, "name": "CloseLayer"},
"2031": {"inbytes": 8, "args": "(unsigned long)", "outbytes": 0, "name": "DestroyStrayLayer"},
"2030": {"inbytes": 16, "args": "(nn::sf::Out<unsigned long,void>,nn::sf::Out<long,void>,nn::sf::OutBuffer const&,unsigned long,unsigned int)", "outbytes": 16, "buffers": [6], "name": "CreateStrayLayer"},
"102": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::visrv::sf::IManagerDisplayService>,void>)", "outbytes": 0, "name": "GetManagerDisplayService", "outinterfaces": ["nn::visrv::sf::IManagerDisplayService"]},
"1102": {"inbytes": 8, "args": "(nn::sf::Out<long,void>,nn::sf::Out<long,void>,unsigned long)", "outbytes": 16, "name": "GetDisplayResolution"},
"2101": {"inbytes": 16, "args": "(unsigned long,unsigned int)", "outbytes": 0, "name": "SetLayerScalingMode"},
"101": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::visrv::sf::ISystemDisplayService>,void>)", "outbytes": 0, "name": "GetSystemDisplayService", "outinterfaces": ["nn::visrv::sf::ISystemDisplayService"]},
"1010": {"inbytes": 64, "args": "(nn::sf::Out<unsigned long,void>,nn::vi::DisplayName const&)", "outbytes": 8, "name": "OpenDisplay"},
"100": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nns::hosbinder::IHOSBinderDriver>,void>)", "outbytes": 0, "name": "GetRelayService", "outinterfaces": ["nns::hosbinder::IHOSBinderDriver"]},
"1000": {"inbytes": 0, "args": "(nn::sf::Out<long,void>,nn::sf::OutArray<nn::vi::DisplayInfo> const&)", "outbytes": 8, "buffers": [6], "name": "ListDisplays"}
},
"nn::audioctrl::detail::IAudioController": {
"20": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"21": {"inbytes": 0, "outbytes": 4},
"22": {"inbytes": 0, "outbytes": 0},
"1": {"inbytes": 8, "outbytes": 0},
"0": {"inbytes": 4, "outbytes": 4},
"3": {"inbytes": 0, "outbytes": 4},
"2": {"inbytes": 0, "outbytes": 4},
"5": {"inbytes": 8, "outbytes": 0},
"4": {"inbytes": 4, "outbytes": 1},
"7": {"inbytes": 24, "outbytes": 0},
"6": {"inbytes": 4, "outbytes": 1},
"9": {"inbytes": 4, "outbytes": 4},
"8": {"inbytes": 0, "outbytes": 4},
"11": {"inbytes": 4, "outbytes": 0},
"10": {"inbytes": 8, "outbytes": 0},
"13": {"inbytes": 4, "outbytes": 4},
"12": {"inbytes": 0, "outbytes": 4},
"15": {"inbytes": 4, "outbytes": 0},
"14": {"inbytes": 8, "outbytes": 0},
"17": {"inbytes": 4, "outbytes": 0},
"16": {"inbytes": 1, "outbytes": 0},
"19": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"18": {"inbytes": 0, "outbytes": 4}
},
"nn::account::baas::IManagerForApplication": {
"150": {"args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::nas::IAuthorizationRequest>,void>,nn::account::NintendoAccountAuthorizationRequestParameters const&,nn::sf::NativeHandle &&,unsigned int)", "name": "CreateAuthorizationRequest", "inbytes": 4, "inhandles": [1], "outinterfaces": ["nn::account::nas::IAuthorizationRequest"], "buffers": [25], "outbytes": 0},
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::NetworkServiceAccountId,void>)", "outbytes": 8, "name": "GetAccountId"},
"0": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "CheckAvailability"},
"3": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "LoadIdTokenCache"},
"130": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::NintendoAccountId,void>,nn::sf::Out<nn::account::nas::NasUserBaseForApplication,void>,nn::sf::OutBuffer const&)", "outbytes": 8, "buffers": [26, 6], "name": "GetNintendoAccountUserResourceCacheForApplication"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "EnsureIdTokenCacheAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]}
},
"nn::ldn::detail::ISystemServiceCreator": {
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::ldn::detail::ISystemLocalCommunicationService"]}
},
"nn::fssrv::sf::IEventNotifier": {
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0}
},
"nn::am::service::IAudioController": {
"1": {"inbytes": 0, "args": "(nn::sf::Out<float,void>)", "outbytes": 4, "name": "GetMainAppletExpectedMasterVolume"},
"0": {"inbytes": 8, "args": "(float,float)", "outbytes": 0, "name": "SetExpectedMasterVolume"},
"3": {"inbytes": 16, "args": "(float,long)", "outbytes": 0, "name": "ChangeMainAppletMasterVolume"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<float,void>)", "outbytes": 4, "name": "GetLibraryAppletExpectedMasterVolume"},
"4": {"inbytes": 4, "args": "(float)", "outbytes": 0, "name": "SetTransparentVolumeRate"}
},
"nn::cec::ICecManager": {
"1": {"inbytes": 4, "outbytes": 4},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 8},
"3": {"inbytes": 24, "outbytes": 4},
"2": {"inbytes": 4, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 32},
"4": {"inbytes": 4, "outbytes": 24},
"6": {"inbytes": 0, "outbytes": 8}
},
"nn::visrv::sf::ISystemDisplayService": {
"1204": {"inbytes": 24, "args": "(unsigned long,int,int,int,int)", "outbytes": 0, "name": "SetDisplayMagnification"},
"1200": {"inbytes": 8, "args": "(nn::sf::Out<long,void>,unsigned long)", "outbytes": 8, "name": "GetZOrderCountMin"},
"1203": {"inbytes": 8, "args": "(nn::sf::Out<int,void>,nn::sf::Out<int,void>,unsigned long)", "outbytes": 8, "name": "GetDisplayLogicalResolution"},
"1202": {"inbytes": 8, "args": "(nn::sf::Out<long,void>,unsigned long)", "outbytes": 8, "name": "GetZOrderCountMax"},
"3001": {"inbytes": 8, "args": "(nn::sf::Out<long,void>,nn::sf::OutArray<unsigned int> const&,unsigned long)", "outbytes": 8, "buffers": [6], "name": "ListDisplayRgbRanges"},
"3000": {"inbytes": 8, "args": "(nn::sf::Out<long,void>,nn::sf::OutArray<nn::vi::DisplayModeInfo> const&,unsigned long)", "outbytes": 8, "buffers": [6], "name": "ListDisplayModes"},
"3002": {"inbytes": 8, "args": "(nn::sf::Out<long,void>,nn::sf::OutArray<unsigned int> const&,unsigned long)", "outbytes": 8, "buffers": [6], "name": "ListDisplayContentTypes"},
"3214": {"inbytes": 8, "args": "(nn::sf::Out<float,void>,unsigned long)", "outbytes": 4, "name": "GetDisplayGamma"},
"2201": {"inbytes": 16, "args": "(unsigned long,float,float)", "outbytes": 0, "name": "SetLayerPosition"},
"3216": {"inbytes": 8, "args": "(nn::sf::Out<float,void>,unsigned long)", "outbytes": 4, "name": "GetDisplayCmuLuma"},
"2203": {"inbytes": 24, "args": "(unsigned long,long,long)", "outbytes": 0, "name": "SetLayerSize"},
"2204": {"inbytes": 8, "args": "(nn::sf::Out<long,void>,unsigned long)", "outbytes": 8, "name": "GetLayerZ"},
"2205": {"inbytes": 16, "args": "(unsigned long,long)", "outbytes": 0, "name": "SetLayerZ"},
"2207": {"inbytes": 16, "args": "(unsigned long,bool)", "outbytes": 0, "name": "SetLayerVisibility"},
"2209": {"inbytes": 16, "args": "(unsigned long,float)", "outbytes": 0, "name": "SetLayerAlpha"},
"2402": {"inbytes": 8, "args": "(unsigned long)", "outbytes": 0, "name": "FlipIndirectLayer"},
"2400": {"outbytes": 8, "inbytes": 16, "args": "(nn::sf::Out<long,void>,nn::sf::OutBuffer const&,unsigned long,nn::applet::AppletResourceUserId)", "pid": True, "buffers": [6], "name": "OpenIndirectLayer"},
"2401": {"inbytes": 8, "args": "(unsigned long)", "outbytes": 0, "name": "CloseIndirectLayer"},
"3215": {"inbytes": 16, "args": "(unsigned long,float)", "outbytes": 0, "name": "SetDisplayGamma"},
"3217": {"inbytes": 16, "args": "(unsigned long,float)", "outbytes": 0, "name": "SetDisplayCmuLuma"},
"3210": {"inbytes": 8, "args": "(nn::sf::Out<float,void>,unsigned long)", "outbytes": 4, "name": "GetDisplayContrastRatio"},
"3211": {"inbytes": 16, "args": "(unsigned long,float)", "outbytes": 0, "name": "SetDisplayContrastRatio"},
"3207": {"inbytes": 16, "args": "(unsigned long,unsigned int)", "outbytes": 0, "name": "SetDisplayRgbRange"},
"3206": {"inbytes": 8, "args": "(nn::sf::Out<unsigned int,void>,unsigned long)", "outbytes": 4, "name": "GetDisplayRgbRange"},
"3205": {"inbytes": 16, "args": "(unsigned long,unsigned int)", "outbytes": 0, "name": "SetDisplayContentType"},
"3204": {"inbytes": 8, "args": "(nn::sf::Out<unsigned int,void>,unsigned long)", "outbytes": 4, "name": "GetDisplayContentType"},
"3203": {"inbytes": 16, "args": "(unsigned long,long)", "outbytes": 0, "name": "SetDisplayUnderscan"},
"3202": {"inbytes": 8, "args": "(nn::sf::Out<long,void>,unsigned long)", "outbytes": 8, "name": "GetDisplayUnderscan"},
"3201": {"inbytes": 24, "args": "(unsigned long,nn::vi::DisplayModeInfo const&)", "outbytes": 0, "name": "SetDisplayMode"},
"3200": {"inbytes": 8, "args": "(nn::sf::Out<nn::vi::DisplayModeInfo,void>,unsigned long)", "outbytes": 16, "name": "GetDisplayMode"},
"2312": {"inbytes": 16, "args": "(nn::sf::Out<unsigned long,void>,nn::sf::Out<long,void>,nn::sf::OutBuffer const&,unsigned long,unsigned int)", "outbytes": 16, "buffers": [6], "name": "CreateStrayLayer"},
"3209": {"inbytes": 16, "args": "(unsigned long,unsigned int)", "outbytes": 0, "name": "SetDisplayCmuMode"},
"3208": {"inbytes": 8, "args": "(nn::sf::Out<unsigned int,void>,unsigned long)", "outbytes": 4, "name": "GetDisplayCmuMode"}
},
"nn::eth::sf::IEthInterface": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "buffers": [5]},
"3": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 12},
"4": {"inbytes": 4, "outbytes": 0}
},
"nn::am::service::IWindow": {},
"nn::settings::ISystemSettingsServer": {
"41": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::system::Edid,void>)", "outbytes": 0, "buffers": [26], "name": "GetEdid"},
"24": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "SetColorSetId"},
"25": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetConsoleInformationUploadFlag"},
"26": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetConsoleInformationUploadFlag"},
"27": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetAutomaticApplicationDownloadFlag"},
"20": {"inbytes": 12, "args": "(nn::settings::system::AudioVolume,int)", "outbytes": 0, "name": "SetAudioVolume"},
"21": {"inbytes": 0, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::settings::system::EulaVersion> const&)", "outbytes": 4, "buffers": [6], "name": "GetEulaVersions"},
"22": {"inbytes": 0, "args": "(nn::sf::InArray<nn::settings::system::EulaVersion> const&)", "outbytes": 0, "buffers": [5], "name": "SetEulaVersions"},
"23": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetColorSetId"},
"28": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetAutomaticApplicationDownloadFlag"},
"29": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::system::NotificationSettings,void>)", "outbytes": 24, "name": "GetNotificationSettings"},
"0": {"inbytes": 8, "args": "(nn::settings::LanguageCode)", "outbytes": 0, "name": "SetLanguageCode"},
"4": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::system::FirmwareVersion,void>)", "outbytes": 0, "buffers": [26], "name": "GetFirmwareVersion2"},
"8": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetLockScreenFlag"},
"120": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetPushNotificationActivityModeOnSleep"},
"121": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "SetPushNotificationActivityModeOnSleep"},
"59": {"inbytes": 32, "args": "(nn::time::SystemClockContext const&)", "outbytes": 0, "name": "SetNetworkSystemClockContext"},
"58": {"inbytes": 0, "args": "(nn::sf::Out<nn::time::SystemClockContext,void>)", "outbytes": 32, "name": "GetNetworkSystemClockContext"},
"55": {"inbytes": 0, "args": "(nn::sf::Out<unsigned long,void>)", "outbytes": 8, "name": "GetWirelessCertificationFileSize"},
"54": {"inbytes": 36, "args": "(nn::time::LocationName const&)", "outbytes": 0, "name": "SetDeviceTimeZoneLocationName"},
"57": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "SetRegionCode"},
"56": {"inbytes": 0, "args": "(nn::sf::Out<unsigned long,void>,nn::sf::OutBuffer const&)", "outbytes": 8, "buffers": [6], "name": "GetWirelessCertificationFile"},
"51": {"inbytes": 0, "args": "(nn::sf::Out<nn::ncm::ProgramId,void>)", "outbytes": 8, "name": "GetInitialSystemAppletProgramId"},
"50": {"inbytes": 8, "args": "(nn::settings::system::DataDeletionSettings)", "outbytes": 0, "name": "SetDataDeletionSettings"},
"53": {"inbytes": 0, "args": "(nn::sf::Out<nn::time::LocationName,void>)", "outbytes": 36, "name": "GetDeviceTimeZoneLocationName"},
"52": {"inbytes": 0, "args": "(nn::sf::Out<nn::ncm::ProgramId,void>)", "outbytes": 8, "name": "GetOverlayDispProgramId"},
"115": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetInRepairProcessEnableFlag"},
"114": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetBluetoothBoostEnableFlag"},
"88": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetBluetoothEnableFlag"},
"89": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetBluetoothEnableFlag"},
"111": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetBluetoothAfhEnableFlag"},
"110": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "SetHeadphoneVolumeWarningCount"},
"113": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetBluetoothBoostEnableFlag"},
"112": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetBluetoothAfhEnableFlag"},
"82": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "AcquireTelemetryDirtyFlagEventHandle"},
"83": {"inbytes": 0, "args": "(nn::sf::Out<nn::util::BitFlagSet<128,nn::settings::system::TelemetryDirtyFlag>,void>)", "outbytes": 16, "name": "GetTelemetryDirtyFlags"},
"80": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetLdnChannel"},
"81": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "SetLdnChannel"},
"119": {"inbytes": 1, "args": "(nn::sf::Out<bool,void>,nn::sf::Out<bool,void>,nn::sf::Out<signed char,void>,bool)", "outbytes": 3, "name": "NeedsToUpdateHeadphoneVolume"},
"118": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetHeadphoneVolumeUpdateFlag"},
"84": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::factory::BatteryLot,void>)", "outbytes": 24, "name": "GetPtmBatteryLot"},
"85": {"inbytes": 24, "args": "(nn::settings::factory::BatteryLot const&)", "outbytes": 0, "name": "SetPtmBatteryLot"},
"3": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::system::FirmwareVersion,void>)", "outbytes": 0, "buffers": [26], "name": "GetFirmwareVersion"},
"7": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetLockScreenFlag"},
"108": {"inbytes": 44, "args": "(nn::settings::system::BacklightSettingsEx const&)", "outbytes": 0, "name": "SetBacklightSettingsEx"},
"109": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetHeadphoneVolumeWarningCount"},
"102": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetExternalRtcResetFlag"},
"103": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetUsbFullKeyEnableFlag"},
"100": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetBatteryPercentageFlag"},
"101": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetExternalRtcResetFlag"},
"106": {"inbytes": 0, "args": "(nn::sf::Out<long,void>)", "outbytes": 8, "name": "GetExternalSteadyClockInternalOffset"},
"107": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::system::BacklightSettingsEx,void>)", "outbytes": 44, "name": "GetBacklightSettingsEx"},
"104": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetUsbFullKeyEnableFlag"},
"105": {"inbytes": 8, "args": "(long)", "outbytes": 0, "name": "SetExternalSteadyClockInternalOffset"},
"39": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::system::TvSettings,void>)", "outbytes": 32, "name": "GetTvSettings"},
"38": {"inbytes": 0, "args": "(nn::sf::Out<unsigned long,void>,nn::sf::OutBuffer const&,nn::settings::SettingsName const&,nn::settings::SettingsItemKey const&)", "outbytes": 8, "buffers": [25, 25, 6], "name": "GetSettingsItemValue"},
"32": {"inbytes": 0, "args": "(nn::sf::InArray<nn::settings::system::AccountNotificationSettings> const&)", "outbytes": 0, "buffers": [5], "name": "SetAccountNotificationSettings"},
"31": {"inbytes": 0, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::settings::system::AccountNotificationSettings> const&)", "outbytes": 4, "buffers": [6], "name": "GetAccountNotificationSettings"},
"30": {"inbytes": 24, "args": "(nn::settings::system::NotificationSettings const&)", "outbytes": 0, "name": "SetNotificationSettings"},
"37": {"inbytes": 0, "args": "(nn::sf::Out<unsigned long,void>,nn::settings::SettingsName const&,nn::settings::SettingsItemKey const&)", "outbytes": 8, "buffers": [25, 25], "name": "GetSettingsItemValueSize"},
"36": {"inbytes": 4, "args": "(float)", "outbytes": 0, "name": "SetVibrationMasterVolume"},
"35": {"inbytes": 0, "args": "(nn::sf::Out<float,void>)", "outbytes": 4, "name": "GetVibrationMasterVolume"},
"60": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsUserSystemClockAutomaticCorrectionEnabled"},
"61": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetUserSystemClockAutomaticCorrectionEnabled"},
"62": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetDebugModeFlag"},
"63": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetPrimaryAlbumStorage"},
"64": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "SetPrimaryAlbumStorage"},
"65": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetUsb30EnableFlag"},
"66": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetUsb30EnableFlag"},
"67": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::system::BatteryLot,void>)", "outbytes": 24, "name": "GetBatteryLot"},
"68": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::system::SerialNumber,void>)", "outbytes": 24, "name": "GetSerialNumber"},
"69": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetNfcEnableFlag"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::settings::system::NetworkSettings> const&)", "outbytes": 4, "buffers": [6], "name": "GetNetworkSettings"},
"99": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetBatteryPercentageFlag"},
"98": {"inbytes": 0, "args": "(nn::sf::InArray<nn::settings::system::NxControllerSettings> const&)", "outbytes": 0, "buffers": [5], "name": "SetNxControllerSettings"},
"91": {"inbytes": 8, "args": "(long)", "outbytes": 0, "name": "SetShutdownRtcValue"},
"90": {"inbytes": 0, "args": "(nn::sf::Out<nn::util::Uuid,void>)", "outbytes": 16, "name": "GetMiiAuthorId"},
"93": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "AcquireFatalDirtyFlagEventHandle"},
"92": {"inbytes": 0, "args": "(nn::sf::Out<long,void>)", "outbytes": 8, "name": "GetShutdownRtcValue"},
"95": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetAutoUpdateEnableFlag"},
"94": {"inbytes": 0, "args": "(nn::sf::Out<nn::util::BitFlagSet<128,nn::settings::system::FatalDirtyFlag>,void>)", "outbytes": 16, "name": "GetFatalDirtyFlags"},
"97": {"inbytes": 0, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::settings::system::NxControllerSettings> const&)", "outbytes": 4, "buffers": [6], "name": "GetNxControllerSettings"},
"96": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetAutoUpdateEnableFlag"},
"11": {"inbytes": 0, "args": "(nn::sf::InArray<nn::settings::system::BluetoothDevicesSettings> const&)", "outbytes": 0, "buffers": [5], "name": "SetBluetoothDevicesSettings"},
"10": {"inbytes": 40, "args": "(nn::settings::system::BacklightSettings const&)", "outbytes": 0, "name": "SetBacklightSettings"},
"13": {"inbytes": 0, "args": "(nn::sf::Out<nn::util::Uuid,void>)", "outbytes": 16, "name": "GetExternalSteadyClockSourceId"},
"12": {"inbytes": 0, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::settings::system::BluetoothDevicesSettings> const&)", "outbytes": 4, "buffers": [6], "name": "GetBluetoothDevicesSettings"},
"15": {"inbytes": 0, "args": "(nn::sf::Out<nn::time::SystemClockContext,void>)", "outbytes": 32, "name": "GetUserSystemClockContext"},
"14": {"inbytes": 16, "args": "(nn::util::Uuid const&)", "outbytes": 0, "name": "SetExternalSteadyClockSourceId"},
"17": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::system::AccountSettings,void>)", "outbytes": 4, "name": "GetAccountSettings"},
"16": {"inbytes": 32, "args": "(nn::time::SystemClockContext const&)", "outbytes": 0, "name": "SetUserSystemClockContext"},
"19": {"inbytes": 4, "args": "(nn::sf::Out<nn::settings::system::AudioVolume,void>,int)", "outbytes": 8, "name": "GetAudioVolume"},
"18": {"inbytes": 4, "args": "(nn::settings::system::AccountSettings)", "outbytes": 0, "name": "SetAccountSettings"},
"117": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetHeadphoneVolumeUpdateFlag"},
"116": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetInRepairProcessEnableFlag"},
"48": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetQuestFlag"},
"49": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::system::DataDeletionSettings,void>)", "outbytes": 8, "name": "GetDataDeletionSettings"},
"46": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetForceMuteOnHeadphoneRemoved"},
"86": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::system::PtmFuelGaugeParameter,void>)", "outbytes": 24, "name": "GetPtmFuelGaugeParameter"},
"44": {"inbytes": 8, "args": "(int,int)", "outbytes": 0, "name": "SetAudioOutputMode"},
"45": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsForceMuteOnHeadphoneRemoved"},
"42": {"inbytes": 0, "args": "(nn::settings::system::Edid const&)", "outbytes": 0, "buffers": [25], "name": "SetEdid"},
"43": {"inbytes": 4, "args": "(nn::sf::Out<int,void>,int)", "outbytes": 4, "name": "GetAudioOutputMode"},
"40": {"inbytes": 32, "args": "(nn::settings::system::TvSettings const&)", "outbytes": 0, "name": "SetTvSettings"},
"87": {"inbytes": 24, "args": "(nn::settings::system::PtmFuelGaugeParameter const&)", "outbytes": 0, "name": "SetPtmFuelGaugeParameter"},
"1": {"inbytes": 0, "args": "(nn::sf::InArray<nn::settings::system::NetworkSettings> const&)", "outbytes": 0, "buffers": [5], "name": "SetNetworkSettings"},
"9": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::system::BacklightSettings,void>)", "outbytes": 40, "name": "GetBacklightSettings"},
"77": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::system::DeviceNickName,void>)", "outbytes": 0, "buffers": [22], "name": "GetDeviceNickName"},
"76": {"inbytes": 32, "args": "(nn::settings::system::InitialLaunchSettings const&)", "outbytes": 0, "name": "SetInitialLaunchSettings"},
"75": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::system::InitialLaunchSettings,void>)", "outbytes": 32, "name": "GetInitialLaunchSettings"},
"74": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetWirelessLanEnableFlag"},
"73": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetWirelessLanEnableFlag"},
"72": {"inbytes": 12, "args": "(nn::settings::system::SleepSettings const&)", "outbytes": 0, "name": "SetSleepSettings"},
"71": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::system::SleepSettings,void>)", "outbytes": 12, "name": "GetSleepSettings"},
"70": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetNfcEnableFlag"},
"79": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetProductModel"},
"78": {"inbytes": 0, "args": "(nn::settings::system::DeviceNickName const&)", "outbytes": 0, "buffers": [21], "name": "SetDeviceNickName"},
"47": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "GetQuestFlag"}
},
"nn::account::baas::IFloatingRegistrationRequest": {
"13": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::NintendoAccountId,void>)", "outbytes": 8, "name": "GetLinkedNintendoAccountId"},
"12": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::NetworkServiceAccountId,void>)", "outbytes": 8, "name": "GetAccountId"},
"15": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "GetProfileImage"},
"21": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "LoadIdTokenCache"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::detail::Uuid,void>)", "outbytes": 16, "name": "GetSessionId"},
"111": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "EnsureIdTokenCacheAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"110": {"outbytes": 0, "inbytes": 8, "args": "(nn::account::SystemProgramIdentification const&,unsigned long)", "pid": True, "buffers": [25], "name": "SetSystemProgramIdentification"},
"100": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::Uid,void>,nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 16, "name": "RegisterAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"101": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,nn::account::Uid const&)", "outbytes": 0, "name": "RegisterWithUidAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"14": {"inbytes": 0, "args": "(nn::sf::OutArray<char> const&)", "outbytes": 0, "buffers": [10], "name": "GetNickname"}
},
"nn::omm::detail::IOperationModeManager": {
"11": {"inbytes": 0, "outbytes": 8},
"10": {"inbytes": 1, "outbytes": 0},
"13": {"inbytes": 0, "outbytes": 0},
"12": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"14": {"inbytes": 0, "outbytes": 1},
"1": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 1},
"3": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 1},
"4": {"inbytes": 0, "inhandles": [1], "outbytes": 0},
"7": {"inbytes": 0, "outbytes": 0},
"6": {"inbytes": 0, "outbytes": 0},
"9": {"inbytes": 0, "outbytes": 0},
"8": {"inbytes": 0, "outbytes": 16}
},
"nn::bcat::detail::ipc::IDeliveryCacheFileService": {
"1": {"inbytes": 8, "args": "(nn::sf::Out<unsigned long,void>,long,nn::sf::OutBuffer const&)", "outbytes": 8, "buffers": [6], "name": "Read"},
"0": {"inbytes": 64, "args": "(nn::bcat::DirectoryName const&,nn::bcat::FileName const&)", "outbytes": 0, "name": "Open"},
"3": {"inbytes": 0, "args": "(nn::sf::Out<nn::bcat::Digest,void>)", "outbytes": 16, "name": "GetDigest"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<long,void>)", "outbytes": 8, "name": "GetSize"}
},
"nn::usb::pd::detail::IPdCradleSession": {
"1": {"inbytes": 4, "outbytes": 4},
"0": {"inbytes": 8, "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 2},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 2},
"4": {"inbytes": 0, "outbytes": 2},
"7": {"inbytes": 0, "outbytes": 1},
"6": {"inbytes": 0, "outbytes": 2},
"8": {"inbytes": 0, "outbytes": 1}
},
"nn::account::nas::IOAuthProcedureForNintendoAccountLinkage": {
"10": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::detail::Uuid,void>)", "outbytes": 16, "name": "Suspend"},
"199": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::RequestUrl,void>)", "outbytes": 0, "buffers": [26], "name": "GetUrlForIntroductionOfExtraMembership"},
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::RequestUrl,void>,nn::sf::Out<nn::account::CallbackUri,void>)", "outbytes": 0, "buffers": [26, 26], "name": "GetRequest"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "PrepareAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"3": {"name": "ApplyResponseAsync", "inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,nn::sf::InArray<char> const&)", "outinterfaces": ["nn::account::detail::IAsyncContext"], "buffers": [9], "outbytes": 0},
"2": {"inbytes": 0, "args": "(nn::sf::InArray<char> const&)", "outbytes": 0, "buffers": [9], "name": "ApplyResponse"},
"100": {"inbytes": 4, "args": "(nn::sf::Out<nn::account::RequestUrl,void>,nn::sf::Out<nn::account::CallbackUri,void>,int)", "outbytes": 0, "buffers": [26, 26], "name": "GetRequestWithTheme"},
"101": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsNetworkServiceAccountReplaced"}
},
"nn::am::service::ILibraryAppletProxy": {
"11": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletCreator>,void>)", "outbytes": 0, "name": "GetLibraryAppletCreator", "outinterfaces": ["nn::am::service::ILibraryAppletCreator"]},
"10": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IProcessWindingController>,void>)", "outbytes": 0, "name": "GetProcessWindingController", "outinterfaces": ["nn::am::service::IProcessWindingController"]},
"20": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletSelfAccessor>,void>)", "outbytes": 0, "name": "OpenLibraryAppletSelfAccessor", "outinterfaces": ["nn::am::service::ILibraryAppletSelfAccessor"]},
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ISelfController>,void>)", "outbytes": 0, "name": "GetSelfController", "outinterfaces": ["nn::am::service::ISelfController"]},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ICommonStateGetter>,void>)", "outbytes": 0, "name": "GetCommonStateGetter", "outinterfaces": ["nn::am::service::ICommonStateGetter"]},
"3": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IAudioController>,void>)", "outbytes": 0, "name": "GetAudioController", "outinterfaces": ["nn::am::service::IAudioController"]},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IWindowController>,void>)", "outbytes": 0, "name": "GetWindowController", "outinterfaces": ["nn::am::service::IWindowController"]},
"4": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDisplayController>,void>)", "outbytes": 0, "name": "GetDisplayController", "outinterfaces": ["nn::am::service::IDisplayController"]},
"1000": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDebugFunctions>,void>)", "outbytes": 0, "name": "GetDebugFunctions", "outinterfaces": ["nn::am::service::IDebugFunctions"]}
},
"nn::account::baas::IManagerForSystemService": {
"150": {"args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::nas::IAuthorizationRequest>,void>,nn::account::nas::NasClientInfo const&,nn::account::NintendoAccountAuthorizationRequestParameters const&,nn::sf::NativeHandle &&,unsigned int)", "name": "CreateAuthorizationRequest", "inbytes": 4, "inhandles": [1], "outinterfaces": ["nn::account::nas::IAuthorizationRequest"], "buffers": [25, 25], "outbytes": 0},
"0": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "CheckAvailability"},
"3": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "LoadIdTokenCache"},
"120": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::NintendoAccountId,void>)", "outbytes": 8, "name": "GetNintendoAccountId"},
"132": {"inbytes": 4, "args": "(nn::sf::Out<bool,void>,nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,unsigned int)", "outbytes": 1, "name": "RefreshNintendoAccountUserResourceCacheAsyncIfSecondsElapsed", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"131": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "RefreshNintendoAccountUserResourceCacheAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"130": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::NintendoAccountId,void>,nn::sf::Out<nn::account::nas::NasUserBase,void>,nn::sf::OutBuffer const&)", "outbytes": 8, "buffers": [26, 6], "name": "GetNintendoAccountUserResourceCache"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "EnsureIdTokenCacheAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::NetworkServiceAccountId,void>)", "outbytes": 8, "name": "GetAccountId"},
"100": {"outbytes": 0, "inbytes": 8, "args": "(nn::account::SystemProgramIdentification const&,unsigned long)", "pid": True, "buffers": [25], "name": "SetSystemProgramIdentification"}
},
"nn::audio::detail::IAudioDevice": {
"11": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"10": {"inbytes": 0, "outbytes": 0, "buffers": [34]},
"12": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"1": {"inbytes": 4, "outbytes": 0, "buffers": [5]},
"0": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"3": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"2": {"inbytes": 0, "outbytes": 4, "buffers": [5]},
"5": {"inbytes": 0, "outbytes": 4},
"4": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"7": {"inbytes": 4, "outbytes": 0, "buffers": [33]},
"6": {"inbytes": 0, "outbytes": 4, "buffers": [34]},
"8": {"inbytes": 0, "outbytes": 4, "buffers": [33]}
},
"nn::settings::ISettingsServer": {
"1": {"inbytes": 0, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::settings::LanguageCode> const&)", "outbytes": 4, "buffers": [10], "name": "GetAvailableLanguageCodes"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::settings::LanguageCode,void>)", "outbytes": 8, "name": "GetLanguageCode"},
"3": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetAvailableLanguageCodeCount"},
"4": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetRegionCode"}
},
"nn::bpc::IRtcManager": {
"1": {"inbytes": 8, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 8},
"3": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 1},
"4": {"inbytes": 0, "outbytes": 0}
},
"nn::nim::detail::IAsyncResult": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0}
},
"nn::gpio::IPadSession": {
"11": {"inbytes": 0, "outbytes": 0},
"10": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"13": {"inbytes": 0, "outbytes": 1},
"12": {"inbytes": 1, "outbytes": 0},
"15": {"inbytes": 0, "outbytes": 4},
"14": {"inbytes": 4, "outbytes": 0},
"1": {"inbytes": 0, "outbytes": 4},
"0": {"inbytes": 4, "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 4},
"2": {"inbytes": 4, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 1},
"4": {"inbytes": 1, "outbytes": 0},
"7": {"inbytes": 0, "outbytes": 0},
"6": {"inbytes": 0, "outbytes": 4},
"9": {"inbytes": 0, "outbytes": 4},
"8": {"inbytes": 4, "outbytes": 0}
},
"nn::ns::detail::IAsyncValue": {
"1": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"0": {"inbytes": 0, "outbytes": 8},
"2": {"inbytes": 0, "outbytes": 0}
},
"nn::audio::detail::IAudioRenderer": {
"11": {"inbytes": 0, "outbytes": 0},
"10": {"inbytes": 0, "outbytes": 0, "buffers": [34, 34, 33]},
"1": {"inbytes": 0, "outbytes": 4},
"0": {"inbytes": 0, "outbytes": 4},
"3": {"inbytes": 0, "outbytes": 4},
"2": {"inbytes": 0, "outbytes": 4},
"5": {"inbytes": 0, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 0, "buffers": [6, 6, 5]},
"7": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"6": {"inbytes": 0, "outbytes": 0},
"9": {"inbytes": 0, "outbytes": 4},
"8": {"inbytes": 4, "outbytes": 0}
},
"nn::i2c::ISession": {
"11": {"inbytes": 4, "outbytes": 0, "buffers": [34]},
"10": {"inbytes": 4, "outbytes": 0, "buffers": [33]},
"12": {"inbytes": 0, "outbytes": 0, "buffers": [34, 9]},
"1": {"inbytes": 4, "outbytes": 0, "buffers": [6]},
"0": {"inbytes": 4, "outbytes": 0, "buffers": [5]},
"2": {"inbytes": 0, "outbytes": 0, "buffers": [6, 9]}
},
"nn::wlan::detail::ISocketManager": {
"11": {"inbytes": 0, "outbytes": 0},
"10": {"inbytes": 0, "outbytes": 0},
"1": {"inbytes": 4, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"3": {"inbytes": 4, "outbytes": 0},
"2": {"inbytes": 4, "outbytes": 4, "buffers": [9]},
"5": {"inbytes": 2, "outbytes": 4},
"4": {"inbytes": 8, "outbytes": 0},
"7": {"inbytes": 1, "outbytes": 0},
"6": {"inbytes": 0, "outbytes": 6},
"9": {"inbytes": 4, "inhandles": [1, 1, 1, 1, 1], "outbytes": 0},
"8": {"inbytes": 0, "outbytes": 8}
},
"nn::audio::detail::IAudioOutManagerForDebugger": {
"1": {"inbytes": 8, "outbytes": 0},
"0": {"inbytes": 8, "outbytes": 0}
},
"nn::am::service::ITransferStorageAccessor": {
"1": {"inbytes": 0, "outhandles": [1], "outbytes": 8, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,nn::sf::Out<unsigned long,void>)", "name": "GetHandle"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<long,void>)", "outbytes": 8, "name": "GetSize"}
},
"nn::idle::detail::IPolicyManagerSystem": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"3": {"inbytes": 56, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 0}
},
"nn::account::detail::IAsyncContext": {
"1": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Cancel"},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetSystemEvent"},
"3": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "GetResult"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "HasDone"}
},
"nn::visrv::sf::IManagerDisplayService": {
"7000": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetContentVisibility"},
"4203": {"inbytes": 16, "args": "(unsigned long,unsigned int)", "outbytes": 0, "name": "SetDisplayLayerStack"},
"4201": {"inbytes": 16, "args": "(unsigned long,float)", "outbytes": 0, "name": "SetDisplayAlpha"},
"4205": {"inbytes": 16, "args": "(unsigned long,unsigned int)", "outbytes": 0, "name": "SetDisplayPowerState"},
"2051": {"inbytes": 8, "args": "(unsigned long)", "outbytes": 0, "name": "DestroyIndirectLayer"},
"2050": {"inbytes": 0, "args": "(nn::sf::Out<unsigned long,void>)", "outbytes": 8, "name": "CreateIndirectLayer"},
"2053": {"inbytes": 8, "args": "(unsigned long)", "outbytes": 0, "name": "DestroyIndirectProducerEndPoint"},
"2052": {"inbytes": 16, "args": "(nn::sf::Out<unsigned long,void>,unsigned long,nn::applet::AppletResourceUserId)", "outbytes": 8, "name": "CreateIndirectProducerEndPoint"},
"2055": {"inbytes": 8, "args": "(unsigned long)", "outbytes": 0, "name": "DestroyIndirectConsumerEndPoint"},
"2054": {"inbytes": 16, "args": "(nn::sf::Out<unsigned long,void>,unsigned long,nn::applet::AppletResourceUserId)", "outbytes": 8, "name": "CreateIndirectConsumerEndPoint"},
"6000": {"inbytes": 16, "args": "(unsigned long,unsigned int)", "outbytes": 0, "name": "AddToLayerStack"},
"6001": {"inbytes": 16, "args": "(unsigned long,unsigned int)", "outbytes": 0, "name": "RemoveFromLayerStack"},
"2301": {"inbytes": 8, "args": "(unsigned long)", "outbytes": 0, "name": "ReleaseLayerTexturePresentingEvent"},
"2300": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,unsigned long)", "name": "AcquireLayerTexturePresentingEvent"},
"2302": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,unsigned long)", "name": "GetDisplayHotplugEvent"},
"2402": {"inbytes": 8, "args": "(nn::sf::Out<unsigned int,void>,unsigned long)", "outbytes": 4, "name": "GetDisplayHotplugState"},
"2011": {"inbytes": 8, "args": "(unsigned long)", "outbytes": 0, "name": "DestroyManagedLayer"},
"2010": {"inbytes": 24, "args": "(nn::sf::Out<unsigned long,void>,unsigned long,unsigned int,nn::applet::AppletResourceUserId)", "outbytes": 8, "name": "CreateManagedLayer"},
"8100": {"inbytes": 24, "args": "(unsigned long,unsigned long,nn::TimeSpan)", "outbytes": 0, "name": "SetIndirectProducerFlipOffset"},
"6002": {"inbytes": 16, "args": "(unsigned long,bool)", "outbytes": 0, "name": "SetLayerVisibility"},
"8000": {"inbytes": 16, "args": "(unsigned long,bool)", "outbytes": 0, "name": "SetConductorLayer"},
"1102": {"inbytes": 8, "args": "(nn::sf::Out<long,void>,nn::sf::Out<long,void>,unsigned long)", "outbytes": 16, "name": "GetDisplayResolution"}
},
"nn::ns::detail::IProgressAsyncResult": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0, "buffers": [6]}
},
"nn::account::baas::IAdministrator": {
"150": {"args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::nas::IAuthorizationRequest>,void>,nn::account::nas::NasClientInfo const&,nn::account::NintendoAccountAuthorizationRequestParameters const&,nn::sf::NativeHandle &&,unsigned int)", "name": "CreateAuthorizationRequest", "inbytes": 4, "inhandles": [1], "outinterfaces": ["nn::account::nas::IAuthorizationRequest"], "buffers": [25, 25], "outbytes": 0},
"997": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "DebugUnlinkNintendoAccountAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"132": {"inbytes": 4, "args": "(nn::sf::Out<bool,void>,nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,unsigned int)", "outbytes": 1, "name": "RefreshNintendoAccountUserResourceCacheAsyncIfSecondsElapsed", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"131": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "RefreshNintendoAccountUserResourceCacheAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"130": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::NintendoAccountId,void>,nn::sf::Out<nn::account::nas::NasUserBase,void>,nn::sf::OutBuffer const&)", "outbytes": 8, "buffers": [26, 6], "name": "GetNintendoAccountUserResourceCache"},
"252": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::nas::IOAuthProcedureForNintendoAccountLinkage>,void>,nn::account::detail::Uuid const&)", "outbytes": 0, "name": "ResumeProcedureToLinkWithNintendoAccount", "outinterfaces": ["nn::account::nas::IOAuthProcedureForNintendoAccountLinkage"]},
"250": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsLinkedWithNintendoAccount"},
"251": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::nas::IOAuthProcedureForNintendoAccountLinkage>,void>)", "outbytes": 0, "name": "CreateProcedureToLinkWithNintendoAccount", "outinterfaces": ["nn::account::nas::IOAuthProcedureForNintendoAccountLinkage"]},
"256": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::http::IOAuthProcedure>,void>,nn::account::detail::Uuid const&)", "outbytes": 0, "name": "ResumeProcedureToUpdateLinkageStateOfNintendoAccount", "outinterfaces": ["nn::account::http::IOAuthProcedure"]},
"255": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::http::IOAuthProcedure>,void>)", "outbytes": 0, "name": "CreateProcedureToUpdateLinkageStateOfNintendoAccount", "outinterfaces": ["nn::account::http::IOAuthProcedure"]},
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::NetworkServiceAccountId,void>)", "outbytes": 8, "name": "GetAccountId"},
"0": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "CheckAvailability"},
"3": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "LoadIdTokenCache"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "EnsureIdTokenCacheAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"280": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::http::IOAuthProcedure>,void>,nn::account::detail::Uuid const&)", "outbytes": 0, "name": "ProxyProcedureToAcquireApplicationAuthorizationForNintendoAccount", "outinterfaces": ["nn::account::http::IOAuthProcedure"]},
"201": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "RegisterAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"200": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsRegistered"},
"203": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DeleteRegistrationInfoLocally"},
"202": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "UnregisterAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"998": {"inbytes": 4, "args": "(unsigned int)", "outbytes": 0, "name": "DebugSetAvailabilityErrorDetail"},
"120": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::NintendoAccountId,void>)", "outbytes": 8, "name": "GetNintendoAccountId"},
"261": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::http::IOAuthProcedure>,void>,nn::account::detail::Uuid const&)", "outbytes": 0, "name": "ResumeProcedureToLinkNnidWithNintendoAccount", "outinterfaces": ["nn::account::http::IOAuthProcedure"]},
"260": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::http::IOAuthProcedure>,void>)", "outbytes": 0, "name": "CreateProcedureToLinkNnidWithNintendoAccount", "outinterfaces": ["nn::account::http::IOAuthProcedure"]},
"100": {"outbytes": 0, "inbytes": 8, "args": "(nn::account::SystemProgramIdentification const&,unsigned long)", "pid": True, "buffers": [25], "name": "SetSystemProgramIdentification"},
"222": {"inbytes": 4, "args": "(nn::sf::Out<bool,void>,nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,unsigned int)", "outbytes": 1, "name": "SynchronizeProfileAsyncIfSecondsElapsed", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"221": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "UploadProfileAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"220": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "SynchronizeProfileAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]}
},
"nn::news::detail::ipc::INewsDataService": {
"1": {"inbytes": 72, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0, "buffers": [9]},
"3": {"inbytes": 0, "outbytes": 8},
"2": {"inbytes": 8, "outbytes": 8, "buffers": [6]}
},
"nn::account::detail::ISessionObject": {
"999": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Dummy"}
},
"nn::usb::ds::IDsService": {
"1": {"inbytes": 0, "inhandles": [1], "outbytes": 0},
"0": {"inbytes": 4, "outbytes": 0},
"3": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 1, "buffers": [5, 5], "outinterfaces": ["nn::usb::ds::IDsInterface"]},
"5": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"4": {"inbytes": 0, "outbytes": 4}
},
"nn::bpc::IBoardPowerControlManager": {
"11": {"inbytes": 16, "outbytes": 4},
"10": {"inbytes": 0, "outbytes": 12},
"13": {"inbytes": 4, "outbytes": 0},
"12": {"inbytes": 0, "outbytes": 4},
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 4},
"2": {"inbytes": 0, "outbytes": 4},
"5": {"inbytes": 4, "outhandles": [1], "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 1},
"7": {"inbytes": 4, "outhandles": [1], "outbytes": 0},
"6": {"inbytes": 0, "outbytes": 4},
"9": {"inbytes": 4, "outbytes": 0},
"8": {"inbytes": 8, "outbytes": 4}
},
"nn::settings::IFirmwareDebugSettingsServer": {
"3": {"inbytes": 0, "args": "(nn::settings::SettingsName const&,nn::settings::SettingsItemKey const&)", "outbytes": 0, "buffers": [25, 25], "name": "ResetSettingsItemValue"},
"2": {"inbytes": 0, "args": "(nn::settings::SettingsName const&,nn::settings::SettingsItemKey const&,nn::sf::InBuffer const&)", "outbytes": 0, "buffers": [25, 25, 5], "name": "SetSettingsItemValue"},
"4": {"name": "CreateSettingsItemKeyIterator", "inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::settings::ISettingsItemKeyIterator>,void>,nn::settings::SettingsName const&)", "outinterfaces": ["nn::settings::ISettingsItemKeyIterator"], "buffers": [25], "outbytes": 0}
},
"nn::usb::hs::IClientRootSession": {
"1": {"inbytes": 16, "outbytes": 4, "buffers": [6]},
"0": {"inbytes": 0, "inhandles": [1], "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"2": {"inbytes": 16, "outbytes": 4, "buffers": [6]},
"5": {"inbytes": 1, "outbytes": 0},
"4": {"inbytes": 18, "outhandles": [1], "outbytes": 0},
"7": {"inbytes": 4, "outbytes": 0, "buffers": [6, 6], "outinterfaces": ["nn::usb::hs::IClientIfSession"]},
"6": {"inbytes": 0, "outhandles": [1], "outbytes": 0}
},
"nn::nim::detail::IAsyncProgressResult": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 16}
},
"nn::hid::IHidServer": {
"71": {"inbytes": 16, "args": "(nn::sf::Out<float,void>,nn::sf::Out<float,void>,nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)", "pid": True, "outbytes": 8, "name": "GetSixAxisSensorFusionParameters"},
"51": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::hid::BasicXpadId)", "pid": True, "outbytes": 0, "name": "ActivateXpad"},
"62": {"inbytes": 4, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,nn::hid::BasicXpadId)", "name": "GetSixAxisSensorLifoHandle"},
"70": {"inbytes": 24, "args": "(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle,float,float)", "pid": True, "outbytes": 0, "name": "SetSixAxisSensorFusionParameters"},
"60": {"inbytes": 4, "args": "(nn::hid::BasicXpadId)", "outbytes": 0, "name": "ActivateSixAxisSensor"},
"132": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,unsigned int,bool)", "pid": True, "outbytes": 0, "name": "EnableUnintendedHomeButtonInputProtection"},
"131": {"inbytes": 16, "args": "(nn::sf::Out<bool,void>,nn::applet::AppletResourceUserId,unsigned int)", "pid": True, "outbytes": 1, "name": "IsUnintendedHomeButtonInputProtectionEnabled"},
"130": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,unsigned int,unsigned int)", "pid": True, "outbytes": 0, "name": "SwapNpadAssignment"},
"64": {"inbytes": 4, "args": "(nn::hid::JoyXpadId)", "outbytes": 0, "name": "DeactivateJoySixAxisSensor"},
"65": {"inbytes": 4, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,nn::hid::JoyXpadId)", "name": "GetJoySixAxisSensorLifoHandle"},
"66": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)", "pid": True, "outbytes": 0, "name": "StartSixAxisSensor"},
"67": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)", "pid": True, "outbytes": 0, "name": "StopSixAxisSensor"},
"82": {"inbytes": 16, "args": "(nn::sf::Out<bool,void>,nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)", "pid": True, "outbytes": 1, "name": "IsSixAxisSensorAtRest"},
"69": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle,bool)", "pid": True, "outbytes": 0, "name": "EnableSixAxisSensorFusion"},
"80": {"inbytes": 16, "args": "(nn::sf::Out<unsigned int,void>,nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)", "pid": True, "outbytes": 4, "name": "GetGyroscopeZeroDriftMode"},
"81": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)", "pid": True, "outbytes": 0, "name": "ResetGyroscopeZeroDriftMode"},
"75": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)", "pid": True, "outbytes": 0, "name": "ResetAccelerometerParameters"},
"63": {"inbytes": 4, "args": "(nn::hid::JoyXpadId)", "outbytes": 0, "name": "ActivateJoySixAxisSensor"},
"21": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "ActivateMouse"},
"79": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle,unsigned int)", "pid": True, "outbytes": 0, "name": "SetGyroscopeZeroDriftMode"},
"102": {"outbytes": 0, "inbytes": 8, "args": "(nn::applet::AppletResourceUserId,nn::sf::InArray<unsigned int> const&)", "pid": True, "buffers": [9], "name": "SetSupportedNpadIdType"},
"40": {"inbytes": 8, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,unsigned long)", "name": "AcquireXpadIdEventHandle"},
"41": {"inbytes": 8, "args": "(unsigned long)", "outbytes": 0, "name": "ReleaseXpadIdEventHandle"},
"1": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "ActivateDebugPad"},
"0": {"outbytes": 0, "inbytes": 8, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::hid::IAppletResource>,void>,nn::applet::AppletResourceUserId)", "pid": True, "outinterfaces": ["nn::hid::IAppletResource"], "name": "CreateAppletResource"},
"402": {"inbytes": 4, "args": "(nn::sf::Out<bool,void>,unsigned int)", "outbytes": 1, "name": "IsUsbFullKeyControllerConnected"},
"401": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "EnableUsbFullKeyController"},
"400": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsUsbFullKeyControllerEnabled"},
"128": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,long)", "pid": True, "outbytes": 0, "name": "SetNpadHandheldActivationMode"},
"68": {"inbytes": 16, "args": "(nn::sf::Out<bool,void>,nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)", "pid": True, "outbytes": 1, "name": "IsSixAxisSensorFusionEnabled"},
"201": {"inbytes": 32, "args": "(nn::applet::AppletResourceUserId,nn::hid::VibrationDeviceHandle,nn::hid::VibrationValue const&)", "pid": True, "outbytes": 0, "name": "SendVibrationValue"},
"200": {"inbytes": 4, "args": "(nn::sf::Out<nn::hid::VibrationDeviceInfoForIpc,void>,nn::hid::VibrationDeviceHandle)", "outbytes": 8, "name": "GetVibrationDeviceInfo"},
"203": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::hid::IActiveVibrationDeviceList>,void>)", "outbytes": 0, "name": "CreateActiveVibrationDeviceList", "outinterfaces": ["nn::hid::IActiveVibrationDeviceList"]},
"202": {"inbytes": 16, "args": "(nn::sf::Out<nn::hid::VibrationValue,void>,nn::applet::AppletResourceUserId,nn::hid::VibrationDeviceHandle)", "pid": True, "outbytes": 16, "name": "GetActualVibrationValue"},
"205": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsVibrationPermitted"},
"204": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "PermitVibration"},
"206": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId,nn::sf::InArray<nn::hid::VibrationDeviceHandle> const&,nn::sf::InArray<nn::hid::VibrationValue> const&)", "outbytes": 0, "buffers": [9, 9], "name": "SendVibrationValues"},
"300": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "ActivateConsoleSixAxisSensor"},
"301": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::hid::ConsoleSixAxisSensorHandle)", "pid": True, "outbytes": 0, "name": "StartConsoleSixAxisSensor"},
"302": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::hid::ConsoleSixAxisSensorHandle)", "pid": True, "outbytes": 0, "name": "StopConsoleSixAxisSensor"},
"77": {"inbytes": 16, "args": "(nn::sf::Out<unsigned int,void>,nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)", "pid": True, "outbytes": 4, "name": "GetAccelerometerPlayMode"},
"76": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle,unsigned int)", "pid": True, "outbytes": 0, "name": "SetAccelerometerPlayMode"},
"108": {"inbytes": 4, "args": "(nn::sf::Out<unsigned long,void>,unsigned int)", "outbytes": 8, "name": "GetPlayerLedPattern"},
"123": {"inbytes": 24, "args": "(nn::applet::AppletResourceUserId,unsigned int,long)", "pid": True, "outbytes": 0, "name": "SetNpadJoyAssignmentModeSingle"},
"73": {"inbytes": 24, "args": "(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle,float,float)", "pid": True, "outbytes": 0, "name": "SetAccelerometerParameters"},
"125": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,unsigned int,unsigned int)", "pid": True, "outbytes": 0, "name": "MergeSingleJoyAsDualJoy"},
"126": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "StartLrAssignmentMode"},
"127": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "StopLrAssignmentMode"},
"91": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,int)", "pid": True, "outbytes": 0, "name": "ActivateGesture"},
"129": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId,nn::sf::Out<long,void>)", "pid": True, "outbytes": 8, "name": "GetNpadHandheldActivationMode"},
"100": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::util::BitFlagSet<32,nn::hid::NpadStyleTag>)", "pid": True, "outbytes": 0, "name": "SetSupportedNpadStyleSet"},
"101": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId,nn::sf::Out<nn::util::BitFlagSet<32,nn::hid::NpadStyleTag>,void>)", "pid": True, "outbytes": 4, "name": "GetSupportedNpadStyleSet"},
"106": {"outhandles": [1], "outbytes": 0, "inbytes": 24, "args": "(nn::applet::AppletResourceUserId,nn::sf::Out<nn::sf::NativeHandle,void>,unsigned int,unsigned long)", "pid": True, "name": "AcquireNpadStyleSetUpdateEventHandle"},
"107": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,unsigned int)", "pid": True, "outbytes": 0, "name": "DisconnectNpad"},
"104": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "DeactivateNpad"},
"78": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)", "pid": True, "outbytes": 0, "name": "ResetAccelerometerPlayMode"},
"11": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "ActivateTouchScreen"},
"120": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,long)", "pid": True, "outbytes": 0, "name": "SetNpadJoyHoldType"},
"59": {"inbytes": 0, "args": "(nn::sf::Out<long,void>,nn::sf::OutArray<nn::hid::JoyXpadId> const&)", "outbytes": 8, "buffers": [10], "name": "GetJoyXpadIds"},
"58": {"inbytes": 4, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,nn::hid::JoyXpadId)", "name": "GetJoyXpadLifoHandle"},
"121": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId,nn::sf::Out<long,void>)", "pid": True, "outbytes": 8, "name": "GetNpadJoyHoldType"},
"55": {"inbytes": 0, "args": "(nn::sf::Out<long,void>,nn::sf::OutArray<nn::hid::BasicXpadId> const&)", "outbytes": 8, "buffers": [10], "name": "GetXpadIds"},
"31": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "ActivateKeyboard"},
"56": {"inbytes": 4, "args": "(nn::hid::JoyXpadId)", "outbytes": 0, "name": "ActivateJoyXpad"},
"61": {"inbytes": 4, "args": "(nn::hid::BasicXpadId)", "outbytes": 0, "name": "DeactivateSixAxisSensor"},
"122": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,unsigned int)", "pid": True, "outbytes": 0, "name": "SetNpadJoyAssignmentModeSingleByDefault"},
"74": {"inbytes": 16, "args": "(nn::sf::Out<float,void>,nn::sf::Out<float,void>,nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)", "pid": True, "outbytes": 8, "name": "GetAccelerometerParameters"},
"124": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,unsigned int)", "pid": True, "outbytes": 0, "name": "SetNpadJoyAssignmentModeDual"},
"103": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "pid": True, "outbytes": 0, "name": "ActivateNpad"},
"1000": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,long)", "pid": True, "outbytes": 0, "name": "SetNpadCommunicationMode"},
"1001": {"inbytes": 0, "args": "(nn::sf::Out<long,void>)", "outbytes": 8, "name": "GetNpadCommunicationMode"},
"72": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,nn::hid::SixAxisSensorHandle)", "pid": True, "outbytes": 0, "name": "ResetSixAxisSensorFusionParameters"}
},
"nn::ro::detail::IRoInterface": {
"1": {"inbytes": 16, "pid": True, "outbytes": 0},
"0": {"inbytes": 40, "pid": True, "outbytes": 8},
"3": {"inbytes": 16, "pid": True, "outbytes": 0},
"2": {"inbytes": 24, "pid": True, "outbytes": 0},
"4": {"inbytes": 8, "inhandles": [1], "pid": True, "outbytes": 0}
},
"nn::nifm::detail::IGeneralService": {
"24": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "WakeUp"},
"25": {"inbytes": 0, "args": "(nn::sf::Out<nn::nifm::SsidListVersion,void>)", "outbytes": 16, "name": "GetSsidListVersion"},
"26": {"inbytes": 0, "args": "(nn::nifm::ClientId)", "outbytes": 0, "buffers": [25], "name": "SetExclusiveClient"},
"27": {"inbytes": 0, "args": "(nn::sf::Out<nn::nifm::IpSettingData,void>)", "outbytes": 0, "buffers": [26], "name": "GetDefaultIpSetting"},
"20": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsEthernetCommunicationEnabled"},
"21": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>,nn::nifm::ClientId)", "outbytes": 1, "buffers": [25], "name": "IsAnyInternetRequestAccepted"},
"22": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsAnyForegroundRequestAccepted"},
"23": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "PutToSleep"},
"28": {"inbytes": 0, "args": "(nn::nifm::IpSettingData const&)", "outbytes": 0, "buffers": [25], "name": "SetDefaultIpSetting"},
"29": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetWirelessCommunicationEnabledForTest"},
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::nifm::ClientId,void>)", "outbytes": 0, "buffers": [26], "name": "GetClientId"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::nifm::detail::IScanRequest>,void>)", "outbytes": 0, "name": "CreateScanRequest", "outinterfaces": ["nn::nifm::detail::IScanRequest"]},
"5": {"inbytes": 0, "args": "(nn::sf::Out<nn::nifm::detail::sf::NetworkProfileData,void>)", "outbytes": 0, "buffers": [26], "name": "GetCurrentNetworkProfile"},
"4": {"inbytes": 4, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::nifm::detail::IRequest>,void>,int)", "outbytes": 0, "name": "CreateRequest", "outinterfaces": ["nn::nifm::detail::IRequest"]},
"7": {"inbytes": 1, "args": "(nn::sf::OutArray<nn::nifm::detail::sf::NetworkProfileBasicInfo> const&,nn::sf::Out<int,void>,unsigned char)", "outbytes": 4, "buffers": [6], "name": "EnumerateNetworkProfiles"},
"6": {"inbytes": 4, "args": "(nn::sf::OutArray<nn::nifm::detail::sf::NetworkInterfaceInfo> const&,nn::sf::Out<int,void>,unsigned int)", "outbytes": 4, "buffers": [10], "name": "EnumerateNetworkInterfaces"},
"9": {"inbytes": 0, "args": "(nn::sf::Out<nn::util::Uuid,void>,nn::nifm::detail::sf::NetworkProfileData const&)", "outbytes": 16, "buffers": [25], "name": "SetNetworkProfile"},
"8": {"inbytes": 16, "args": "(nn::sf::Out<nn::nifm::detail::sf::NetworkProfileData,void>,nn::util::Uuid const&)", "outbytes": 0, "buffers": [26], "name": "GetNetworkProfile"},
"11": {"inbytes": 0, "args": "(nn::sf::OutArray<nn::nifm::detail::sf::AccessPointData> const&,nn::sf::Out<int,void>)", "outbytes": 4, "buffers": [6], "name": "GetScanData"},
"10": {"inbytes": 16, "args": "(nn::util::Uuid const&)", "outbytes": 0, "name": "RemoveNetworkProfile"},
"13": {"inbytes": 0, "args": "(nn::sf::Out<nn::nifm::detail::sf::AccessPointData,void>)", "outbytes": 0, "buffers": [26], "name": "GetCurrentAccessPoint"},
"12": {"inbytes": 0, "args": "(nn::sf::Out<nn::nifm::IpV4Address,void>)", "outbytes": 4, "name": "GetCurrentIpAddress"},
"15": {"inbytes": 0, "args": "(nn::sf::Out<nn::nifm::IpAddressSetting,void>,nn::sf::Out<nn::nifm::DnsSetting,void>)", "outbytes": 22, "name": "GetCurrentIpConfigInfo"},
"14": {"name": "CreateTemporaryNetworkProfile", "inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::nifm::detail::INetworkProfile>,void>,nn::sf::Out<nn::util::Uuid,void>,nn::nifm::detail::sf::NetworkProfileData const&)", "outinterfaces": ["nn::nifm::detail::INetworkProfile"], "buffers": [25], "outbytes": 16},
"17": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsWirelessCommunicationEnabled"},
"16": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetWirelessCommunicationEnabled"},
"19": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetEthernetCommunicationEnabled"},
"18": {"inbytes": 0, "args": "(nn::sf::Out<nn::nifm::detail::sf::InternetConnectionStatus,void>)", "outbytes": 3, "name": "GetInternetConnectionStatus"},
"31": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetTelemetorySystemEventReadableHandle"},
"30": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetEthernetCommunicationEnabledForTest"},
"33": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ConfirmSystemAvailability"},
"32": {"inbytes": 0, "args": "(nn::sf::Out<nn::nifm::TelemetryInfo,void>)", "outbytes": 0, "buffers": [22], "name": "GetTelemetryInfo"}
},
"nn::usb::pm::IPmService": {
"1": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 4},
"2": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"5": {"inbytes": 4, "outbytes": 4},
"4": {"inbytes": 8, "outbytes": 0}
},
"nn::fgm::sf::ISession": {
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::fgm::sf::IRequest>,void>)", "outbytes": 0, "name": "Initialize", "outinterfaces": ["nn::fgm::sf::IRequest"]}
},
"nn::es::IETicketService": {
"11": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"10": {"inbytes": 0, "outbytes": 4},
"13": {"inbytes": 0, "outbytes": 4, "buffers": [6, 5]},
"12": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"15": {"inbytes": 16, "outbytes": 8},
"14": {"inbytes": 16, "outbytes": 8},
"17": {"inbytes": 16, "outbytes": 8, "buffers": [6]},
"16": {"inbytes": 16, "outbytes": 8, "buffers": [6]},
"19": {"inbytes": 0, "outbytes": 4, "buffers": [6, 5]},
"18": {"inbytes": 0, "outbytes": 0, "buffers": [6, 5]},
"21": {"inbytes": 0, "outbytes": 0, "buffers": [22, 22, 5]},
"1": {"inbytes": 0, "outbytes": 0, "buffers": [5, 5]},
"3": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"2": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"5": {"inbytes": 0, "outbytes": 0},
"4": {"inbytes": 4, "outbytes": 0},
"7": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"6": {"inbytes": 0, "outbytes": 0},
"9": {"inbytes": 0, "outbytes": 4},
"20": {"inbytes": 16, "outbytes": 4, "buffers": [6]},
"8": {"inbytes": 20, "outbytes": 0, "buffers": [22]}
},
"nn::lm::ILogger": {
"1": {"inbytes": 4, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0, "buffers": [33]}
},
"nn::bcat::detail::ipc::IServiceCreator": {
"1": {"outbytes": 0, "inbytes": 8, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::bcat::detail::ipc::IDeliveryCacheStorageService>,void>,unsigned long)", "pid": True, "outinterfaces": ["nn::bcat::detail::ipc::IDeliveryCacheStorageService"], "name": "CreateDeliveryCacheStorageService"},
"0": {"outbytes": 0, "inbytes": 8, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::bcat::detail::ipc::IBcatService>,void>,unsigned long)", "pid": True, "outinterfaces": ["nn::bcat::detail::ipc::IBcatService"], "name": "CreateBcatService"},
"2": {"inbytes": 8, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::bcat::detail::ipc::IDeliveryCacheStorageService>,void>,nn::ApplicationId)", "outbytes": 0, "name": "CreateDeliveryCacheStorageServiceWithApplicationId", "outinterfaces": ["nn::bcat::detail::ipc::IDeliveryCacheStorageService"]}
},
"nn::pcv::detail::IPcvService": {
"24": {"inbytes": 4, "args": "(nn::sf::OutArray<nn::pcv::ModuleState> const&,nn::sf::Out<int,void>,int)", "outbytes": 4, "buffers": [10], "name": "GetModuleStateTable"},
"25": {"inbytes": 4, "args": "(nn::sf::OutArray<nn::pcv::PowerDomainState> const&,nn::sf::Out<int,void>,int)", "outbytes": 4, "buffers": [10], "name": "GetPowerDomainStateTable"},
"26": {"inbytes": 4, "args": "(nn::sf::OutArray<unsigned int> const&,nn::sf::Out<int,void>,int)", "outbytes": 4, "buffers": [10], "name": "GetFuseInfo"},
"20": {"inbytes": 8, "args": "(nn::pcv::PowerControlTarget,int)", "outbytes": 0, "name": "ChangeVoltage"},
"21": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetPowerClockInfoEvent"},
"22": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>)", "outbytes": 4, "name": "GetOscillatorClock"},
"23": {"inbytes": 8, "args": "(nn::sf::OutArray<unsigned int> const&,nn::sf::OutArray<int> const&,nn::sf::Out<int,void>,int,int)", "outbytes": 4, "buffers": [10, 10], "name": "GetDvfsTable"},
"1": {"inbytes": 8, "args": "(int,bool)", "outbytes": 0, "name": "SetClockEnabled"},
"0": {"inbytes": 8, "args": "(int,bool)", "outbytes": 0, "name": "SetPowerEnabled"},
"3": {"inbytes": 4, "args": "(nn::sf::Out<unsigned int,void>,int)", "outbytes": 4, "name": "GetClockRate"},
"2": {"inbytes": 8, "args": "(int,unsigned int)", "outbytes": 0, "name": "SetClockRate"},
"5": {"inbytes": 8, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<unsigned int> const&,nn::sf::Out<int,void>,int,int)", "outbytes": 8, "buffers": [10], "name": "GetPossibleClockRates"},
"4": {"inbytes": 4, "args": "(nn::sf::Out<nn::pcv::ModuleState,void>,int)", "outbytes": 12, "name": "GetState"},
"7": {"inbytes": 8, "args": "(int,bool)", "outbytes": 0, "name": "SetReset"},
"6": {"inbytes": 8, "args": "(int,unsigned int)", "outbytes": 0, "name": "SetMinVClockRate"},
"9": {"inbytes": 4, "args": "(nn::sf::Out<bool,void>,int)", "outbytes": 1, "name": "GetVoltageEnabled"},
"8": {"inbytes": 8, "args": "(int,bool)", "outbytes": 0, "name": "SetVoltageEnabled"},
"11": {"inbytes": 8, "args": "(int,int)", "outbytes": 0, "name": "SetVoltageValue"},
"10": {"inbytes": 4, "args": "(nn::sf::Out<int,void>,nn::sf::Out<int,void>,nn::sf::Out<int,void>,int)", "outbytes": 12, "name": "GetVoltageRange"},
"13": {"inbytes": 4, "args": "(nn::sf::OutArray<nn::pcv::TemperatureThreshold> const&,nn::sf::Out<int,void>,int)", "outbytes": 4, "buffers": [10], "name": "GetTemperatureThresholds"},
"12": {"inbytes": 4, "args": "(nn::sf::Out<int,void>,int)", "outbytes": 4, "name": "GetVoltageValue"},
"15": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Initialize"},
"14": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "SetTemperature"},
"17": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Finalize"},
"16": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsInitialized"},
"19": {"inbytes": 4, "args": "(nn::pcv::PowerControlTarget)", "outbytes": 0, "name": "PowerOff"},
"18": {"inbytes": 8, "args": "(nn::pcv::PowerControlTarget,int)", "outbytes": 0, "name": "PowerOn"}
},
"nn::lm::ILogService": {
"0": {"inbytes": 8, "pid": True, "outbytes": 0, "outinterfaces": ["nn::lm::ILogger"]}
},
"nn::fssrv::sf::IFileSystemProxyForLoader": {
"1": {"inbytes": 8, "outbytes": 1},
"0": {"inbytes": 8, "outbytes": 0, "buffers": [25], "outinterfaces": ["nn::fssrv::sf::IFileSystem"]}
},
"nn::codec::detail::IHardwareOpusDecoder": {
"1": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"0": {"inbytes": 0, "outbytes": 8, "buffers": [6, 5]},
"3": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"2": {"inbytes": 0, "outbytes": 8, "buffers": [6, 5]}
},
"nn::btm::IBtmSystem": {
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::btm::IBtmSystemCore"]}
},
"nn::ssl::sf::ISslService": {
"1": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>)", "outbytes": 4, "name": "GetContextCount"},
"0": {"outbytes": 0, "inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::ssl::sf::ISslContext>,void>,nn::ssl::sf::SslVersion,unsigned long)", "pid": True, "outinterfaces": ["nn::ssl::sf::ISslContext"], "name": "CreateContext"},
"3": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::InBuffer const&)", "outbytes": 4, "buffers": [5], "name": "GetCertificateBufSize"},
"2": {"inbytes": 0, "args": "(nn::sf::OutBuffer const&,nn::sf::Out<unsigned int,void>,nn::sf::InBuffer const&)", "outbytes": 4, "buffers": [6, 5], "name": "GetCertificates"},
"5": {"inbytes": 4, "args": "(unsigned int)", "outbytes": 0, "name": "SetInterfaceVersion"},
"4": {"inbytes": 8, "args": "(nn::sf::OutBuffer const&,nn::sf::InBuffer const&,unsigned long)", "outbytes": 0, "buffers": [6, 5], "name": "DebugIoctl"}
},
"nn::wlan::detail::ILocalGetActionFrame": {
"0": {"inbytes": 4, "outbytes": 12, "buffers": [6]}
},
"nn::arp::detail::IRegistrar": {
"1": {"inbytes": 16, "outbytes": 0},
"0": {"inbytes": 8, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0, "buffers": [21]}
},
"nn::erpt::sf::ISession": {
"1": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::erpt::sf::IManager"]},
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::erpt::sf::IReport"]}
},
"nn::audio::detail::IAudioRendererManagerForDebugger": {
"1": {"inbytes": 8, "outbytes": 0},
"0": {"inbytes": 8, "outbytes": 0}
},
"nn::audio::detail::IAudioRendererManager": {
"1": {"inbytes": 52, "outbytes": 8},
"0": {"inbytes": 72, "inhandles": [1, 1], "pid": True, "outbytes": 0, "outinterfaces": ["nn::audio::detail::IAudioRenderer"]},
"3": {"inbytes": 80, "inhandles": [1], "pid": True, "outbytes": 0, "outinterfaces": ["nn::audio::detail::IAudioRenderer"]},
"2": {"inbytes": 8, "outbytes": 0, "outinterfaces": ["nn::audio::detail::IAudioDevice"]}
},
"nn::sm::detail::IUserInterface": {
"1": {"inbytes": 8, "outhandles": [2], "outbytes": 0},
"0": {"inbytes": 8, "pid": True, "outbytes": 0},
"3": {"inbytes": 8, "outbytes": 0},
"2": {"inbytes": 16, "outhandles": [2], "outbytes": 0}
},
"nn::usb::pd::detail::IPdSession": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 4},
"2": {"inbytes": 0, "outbytes": 20},
"5": {"inbytes": 0, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 0},
"6": {"inbytes": 1, "outbytes": 0}
},
"nn::nfp::detail::IDebug": {
"308": {"inbytes": 8, "outhandles": [1], "outbytes": 0},
"309": {"inbytes": 0, "outbytes": 4},
"313": {"inbytes": 8, "outbytes": 0},
"312": {"inbytes": 8, "outbytes": 0},
"311": {"inbytes": 8, "outbytes": 4},
"310": {"inbytes": 8, "outbytes": 4},
"314": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"24": {"inbytes": 12, "outbytes": 0, "buffers": [5]},
"20": {"inbytes": 8, "outbytes": 4},
"21": {"inbytes": 8, "outbytes": 4},
"22": {"inbytes": 8, "outbytes": 4},
"23": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 16, "pid": True, "outbytes": 0, "buffers": [5]},
"3": {"inbytes": 8, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 4, "buffers": [10]},
"5": {"inbytes": 16, "outbytes": 0},
"4": {"inbytes": 8, "outbytes": 0},
"7": {"inbytes": 12, "outbytes": 0},
"6": {"inbytes": 8, "outbytes": 0},
"9": {"inbytes": 8, "outbytes": 0, "buffers": [5]},
"8": {"inbytes": 8, "outbytes": 4, "buffers": [6]},
"201": {"inbytes": 8, "outbytes": 0, "buffers": [25]},
"200": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"203": {"inbytes": 12, "outbytes": 0},
"202": {"inbytes": 8, "outbytes": 0},
"205": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"204": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"206": {"inbytes": 12, "outbytes": 0, "buffers": [5]},
"300": {"inbytes": 16, "pid": True, "outbytes": 0, "buffers": [5]},
"301": {"inbytes": 0, "outbytes": 0},
"302": {"inbytes": 0, "outbytes": 4, "buffers": [10]},
"303": {"inbytes": 12, "outbytes": 0},
"304": {"inbytes": 8, "outbytes": 0},
"305": {"inbytes": 16, "outbytes": 4, "buffers": [6, 5]},
"306": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"307": {"inbytes": 8, "outhandles": [1], "outbytes": 0},
"102": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"103": {"inbytes": 8, "outbytes": 0, "buffers": [25]},
"100": {"inbytes": 8, "outbytes": 0},
"101": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"106": {"inbytes": 8, "outbytes": 1},
"104": {"inbytes": 8, "outbytes": 0},
"105": {"inbytes": 8, "outbytes": 0},
"11": {"inbytes": 8, "outbytes": 0},
"10": {"inbytes": 8, "outbytes": 0},
"13": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"12": {"inbytes": 12, "outbytes": 0, "buffers": [5]},
"15": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"14": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"17": {"inbytes": 8, "outhandles": [1], "outbytes": 0},
"16": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"19": {"inbytes": 0, "outbytes": 4},
"18": {"inbytes": 8, "outhandles": [1], "outbytes": 0}
},
"nn::account::nas::IAuthorizationRequest": {
"10": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>)", "outbytes": 0, "name": "InvokeWithoutInteractionAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"20": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "GetAuthorizationCode"},
"21": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "GetIdToken"},
"22": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::nas::State,void>)", "outbytes": 0, "buffers": [26], "name": "GetState"},
"19": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsAuthorized"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::detail::Uuid,void>)", "outbytes": 16, "name": "GetSessionId"}
},
"nn::apm::ISystemManager": {
"1": {"inbytes": 4, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,nn::apm::EventTarget)", "name": "GetPerformanceEvent"},
"0": {"inbytes": 4, "args": "(nn::apm::PerformanceMode)", "outbytes": 0, "name": "RequestPerformanceMode"},
"3": {"inbytes": 0, "args": "(nn::sf::Out<nn::apm::ThrottlingState,void>)", "outbytes": 40, "name": "GetLastThrottlingState"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::apm::ThrottlingState,void>)", "outbytes": 40, "name": "GetThrottlingState"},
"4": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ClearLastThrottlingState"}
},
"nn::npns::INpnsSystem": {
"115": {"inbytes": 0, "outbytes": 0, "buffers": [10, 10]},
"114": {"inbytes": 0, "outbytes": 0, "buffers": [9, 9]},
"111": {"inbytes": 0, "outbytes": 0, "buffers": [10]},
"113": {"inbytes": 0, "outbytes": 0},
"112": {"inbytes": 0, "outbytes": 0},
"24": {"inbytes": 24, "outbytes": 0},
"25": {"inbytes": 40, "outbytes": 1},
"21": {"inbytes": 16, "outbytes": 40},
"22": {"inbytes": 24, "outbytes": 40},
"23": {"inbytes": 16, "outbytes": 0},
"1": {"inbytes": 0, "outbytes": 0},
"3": {"inbytes": 2, "outbytes": 0, "buffers": [6]},
"2": {"inbytes": 8, "outbytes": 0},
"5": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"4": {"inbytes": 2, "outbytes": 0, "buffers": [6]},
"7": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"6": {"inbytes": 0, "outbytes": 0},
"201": {"inbytes": 16, "outbytes": 0},
"202": {"inbytes": 4, "outbytes": 0},
"102": {"inbytes": 0, "outbytes": 0},
"103": {"inbytes": 0, "outbytes": 4},
"101": {"inbytes": 0, "outbytes": 0},
"104": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"105": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"11": {"inbytes": 0, "outbytes": 0, "buffers": [9]},
"13": {"inbytes": 0, "outbytes": 1, "buffers": [9]},
"12": {"inbytes": 0, "outbytes": 0, "buffers": [9]},
"32": {"inbytes": 16, "outbytes": 0},
"31": {"inbytes": 16, "outbytes": 0}
},
"nn::ns::detail::IFactoryResetInterface": {
"102": {"inbytes": 0, "outbytes": 0},
"100": {"inbytes": 0, "outbytes": 0},
"101": {"inbytes": 0, "outbytes": 0}
},
"nn::hid::IAppletResource": {
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetSharedMemoryHandle"}
},
"nn::nfp::detail::ISystem": {
"20": {"inbytes": 8, "outbytes": 4},
"21": {"inbytes": 8, "outbytes": 4},
"23": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 16, "pid": True, "outbytes": 0, "buffers": [5]},
"3": {"inbytes": 8, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 4, "buffers": [10]},
"5": {"inbytes": 16, "outbytes": 0},
"4": {"inbytes": 8, "outbytes": 0},
"6": {"inbytes": 8, "outbytes": 0},
"102": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"103": {"inbytes": 8, "outbytes": 0, "buffers": [25]},
"100": {"inbytes": 8, "outbytes": 0},
"101": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"106": {"inbytes": 8, "outbytes": 1},
"104": {"inbytes": 8, "outbytes": 0},
"105": {"inbytes": 8, "outbytes": 0},
"11": {"inbytes": 8, "outbytes": 0},
"10": {"inbytes": 8, "outbytes": 0},
"13": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"15": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"14": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"17": {"inbytes": 8, "outhandles": [1], "outbytes": 0},
"16": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"19": {"inbytes": 0, "outbytes": 4},
"18": {"inbytes": 8, "outhandles": [1], "outbytes": 0}
},
"nn::account::profile::IProfileEditor": {
"11": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "LoadImage"},
"10": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>)", "outbytes": 4, "name": "GetImageSize"},
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::profile::ProfileBase,void>)", "outbytes": 56, "name": "GetBase"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::account::profile::ProfileBase,void>,nn::sf::Out<nn::account::profile::UserData,void>)", "outbytes": 56, "buffers": [26], "name": "Get"},
"100": {"inbytes": 56, "args": "(nn::account::profile::ProfileBase const&,nn::account::profile::UserData const&)", "outbytes": 0, "buffers": [25], "name": "Store"},
"101": {"inbytes": 56, "args": "(nn::account::profile::ProfileBase const&,nn::account::profile::UserData const&,nn::sf::InBuffer const&)", "outbytes": 0, "buffers": [25, 5], "name": "StoreWithImage"}
},
"nn::audio::detail::IFinalOutputRecorderManagerForDebugger": {
"1": {"inbytes": 8, "outbytes": 0},
"0": {"inbytes": 8, "outbytes": 0}
},
"nn::ns::detail::IDevelopInterface": {
"1": {"inbytes": 8, "outbytes": 0},
"0": {"inbytes": 24, "outbytes": 8},
"2": {"inbytes": 8, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 16},
"4": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"7": {"inbytes": 0, "outbytes": 16, "buffers": [5]},
"6": {"inbytes": 0, "outbytes": 0},
"9": {"inbytes": 16, "outbytes": 8},
"8": {"inbytes": 16, "outbytes": 8}
},
"nn::friends::detail::ipc::IFriendService": {
"20801": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "SyncUserSetting"},
"20700": {"inbytes": 24, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::friends::detail::PlayHistoryImpl> const&,nn::account::Uid const&,int)", "outbytes": 4, "buffers": [6], "name": "GetPlayHistoryList"},
"21000": {"inbytes": 24, "args": "(nn::sf::Out<nn::friends::ExternalApplicationCatalog,void>,nn::friends::ExternalApplicationCatalogId const&,nn::settings::LanguageCode)", "outbytes": 0, "buffers": [26], "name": "GetExternalApplicationCatalog"},
"20401": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "SyncBlockedUserList"},
"20400": {"inbytes": 24, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::friends::detail::BlockedUserImpl> const&,nn::account::Uid const&,int)", "outbytes": 4, "buffers": [6], "name": "GetBlockedUserList"},
"10211": {"outbytes": 0, "inbytes": 128, "args": "(nn::account::Uid const&,nn::friends::FacedFriendRequestRegistrationKey const&,nn::account::Nickname const&,nn::sf::InBuffer const&,nn::friends::InAppScreenName const&,nn::friends::InAppScreenName const&,unsigned long)", "pid": True, "buffers": [25, 25, 5], "name": "AddFacedFriendRequestForApplication"},
"20500": {"inbytes": 16, "args": "(nn::sf::OutArray<nn::friends::detail::ProfileExtraImpl> const&,nn::account::Uid const&,nn::sf::InArray<nn::account::NetworkServiceAccountId> const&)", "outbytes": 0, "buffers": [6, 9], "name": "GetProfileExtraList"},
"20501": {"inbytes": 24, "args": "(nn::sf::Out<nn::friends::Relationship,void>,nn::account::Uid const&,nn::account::NetworkServiceAccountId)", "outbytes": 8, "name": "GetRelationship"},
"10101": {"outbytes": 4, "inbytes": 48, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::friends::detail::FriendImpl> const&,nn::account::Uid const&,int,nn::friends::detail::ipc::SizedFriendFilter const&,unsigned long)", "pid": True, "buffers": [6], "name": "GetFriendList"},
"30810": {"inbytes": 24, "args": "(nn::account::Uid const&,int)", "outbytes": 0, "name": "ChangePresencePermission"},
"30812": {"inbytes": 24, "args": "(nn::account::Uid const&,int)", "outbytes": 0, "name": "ChangePlayLogPermission"},
"30402": {"inbytes": 24, "args": "(nn::account::Uid const&,nn::account::NetworkServiceAccountId)", "outbytes": 0, "name": "UnblockUser"},
"30121": {"inbytes": 32, "args": "(nn::account::Uid const&,nn::account::NetworkServiceAccountId,bool)", "outbytes": 0, "name": "ChangeFriendOnlineNotificationFlag"},
"30400": {"inbytes": 32, "args": "(nn::account::Uid const&,nn::account::NetworkServiceAccountId,int)", "outbytes": 0, "name": "BlockUser"},
"30401": {"inbytes": 48, "args": "(nn::account::Uid const&,nn::account::NetworkServiceAccountId,int,nn::friends::ApplicationInfo const&,nn::friends::InAppScreenName const&)", "outbytes": 0, "buffers": [25], "name": "BlockUserWithApplicationInfo"},
"10610": {"outbytes": 0, "inbytes": 24, "args": "(nn::account::Uid const&,nn::friends::detail::UserPresenceImpl const&,unsigned long)", "pid": True, "buffers": [25], "name": "UpdateUserPresence"},
"30811": {"inbytes": 24, "args": "(nn::account::Uid const&,bool)", "outbytes": 0, "name": "ChangeFriendRequestReception"},
"30120": {"inbytes": 32, "args": "(nn::account::Uid const&,nn::account::NetworkServiceAccountId,bool)", "outbytes": 0, "name": "ChangeFriendFavoriteFlag"},
"10100": {"outbytes": 4, "inbytes": 48, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::account::NetworkServiceAccountId> const&,nn::account::Uid const&,int,nn::friends::detail::ipc::SizedFriendFilter const&,unsigned long)", "pid": True, "buffers": [10], "name": "GetFriendListIds"},
"1": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Cancel"},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetCompletionEvent"},
"10600": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "DeclareOpenOnlinePlaySession"},
"10601": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "DeclareCloseOnlinePlaySession"},
"20100": {"inbytes": 40, "args": "(nn::sf::Out<int,void>,nn::account::Uid const&,nn::friends::detail::ipc::SizedFriendFilter const&,unsigned long)", "pid": True, "outbytes": 4, "name": "GetFriendCount"},
"30212": {"inbytes": 24, "args": "(nn::account::Uid const&,nn::account::NetworkServiceAccountId)", "outbytes": 0, "name": "CancelFacedFriendRequest"},
"30110": {"inbytes": 24, "args": "(nn::account::Uid const&,nn::account::NetworkServiceAccountId)", "outbytes": 0, "name": "DropFriendNewlyFlag"},
"30500": {"inbytes": 48, "args": "(nn::sf::Out<nn::friends::detail::ProfileExtraImpl,void>,nn::account::Uid const&,nn::friends::FriendCode const&)", "outbytes": 0, "buffers": [26], "name": "GetProfileExtraFromFriendCode"},
"30211": {"inbytes": 120, "args": "(nn::account::Uid const&,nn::friends::FacedFriendRequestRegistrationKey const&,nn::account::Nickname const&,nn::sf::InBuffer const&)", "outbytes": 0, "buffers": [5], "name": "AddFacedFriendRequest"},
"30830": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "ClearPlayLog"},
"10400": {"inbytes": 24, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::account::NetworkServiceAccountId> const&,nn::account::Uid const&,int)", "outbytes": 4, "buffers": [10], "name": "GetBlockedUserListIds"},
"20600": {"inbytes": 16, "args": "(nn::sf::Out<nn::friends::detail::UserPresenceViewImpl,void>,nn::account::Uid const&)", "outbytes": 0, "buffers": [26], "name": "GetUserPresenceView"},
"30210": {"inbytes": 16, "args": "(nn::sf::Out<nn::friends::FacedFriendRequestRegistrationKey,void>,nn::account::Uid const&)", "outbytes": 64, "name": "GetFacedFriendRequestRegistrationKey"},
"30820": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "IssueFriendCode"},
"20900": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "RequestListSummaryOverlayNotification"},
"30213": {"inbytes": 24, "args": "(nn::sf::Out<int,void>,nn::account::Uid const&,nn::account::NetworkServiceAccountId,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "GetFacedFriendRequestProfileImage"},
"10702": {"outbytes": 0, "inbytes": 24, "args": "(nn::account::Uid const&,nn::friends::PlayHistoryRegistrationKey const&,nn::friends::InAppScreenName const&,nn::friends::InAppScreenName const&,unsigned long)", "pid": True, "buffers": [25, 25, 25], "name": "AddPlayHistory"},
"10701": {"inbytes": 16, "args": "(nn::sf::Out<nn::friends::PlayHistoryRegistrationKey,void>,nn::account::NetworkServiceAccountId,bool)", "outbytes": 0, "buffers": [26], "name": "GetPlayHistoryRegistrationKeyWithNetworkServiceAccountId"},
"10700": {"inbytes": 24, "args": "(nn::sf::Out<nn::friends::PlayHistoryRegistrationKey,void>,nn::account::Uid const&,bool)", "outbytes": 0, "buffers": [26], "name": "GetPlayHistoryRegistrationKey"},
"30217": {"inbytes": 128, "args": "(nn::account::Uid const&,nn::account::NetworkServiceAccountId,int,nn::friends::MiiName const&,nn::friends::MiiImageUrlParam const&,nn::friends::MiiName const&,nn::friends::MiiImageUrlParam const&)", "outbytes": 0, "name": "SendFriendRequestWithNintendoNetworkIdInfo"},
"30216": {"inbytes": 24, "args": "(nn::account::Uid const&,nn::account::NetworkServiceAccountId)", "outbytes": 0, "name": "ResendFacedFriendRequest"},
"30215": {"inbytes": 48, "args": "(nn::account::Uid const&,nn::account::NetworkServiceAccountId,int,nn::friends::ExternalApplicationCatalogId const&,nn::friends::InAppScreenName const&,nn::friends::InAppScreenName const&)", "outbytes": 0, "buffers": [25, 25], "name": "SendFriendRequestWithExternalApplicationCatalogId"},
"30214": {"inbytes": 0, "args": "(nn::sf::Out<int,void>,nn::sf::InArray<char> const&,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [9, 6], "name": "GetFacedFriendRequestProfileImageFromPath"},
"20110": {"inbytes": 24, "args": "(nn::sf::Out<nn::friends::detail::FriendSettingImpl,void>,nn::account::Uid const&,nn::account::NetworkServiceAccountId)", "outbytes": 0, "buffers": [26], "name": "LoadFriendSetting"},
"49900": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "DeleteNetworkServiceAccountCache"},
"10200": {"outbytes": 0, "inbytes": 32, "args": "(nn::account::Uid const&,nn::account::NetworkServiceAccountId,nn::friends::InAppScreenName const&,nn::friends::InAppScreenName const&,unsigned long)", "pid": True, "buffers": [25, 25], "name": "SendFriendRequestForApplication"},
"10500": {"inbytes": 16, "args": "(nn::sf::OutArray<nn::friends::detail::ProfileImpl> const&,nn::account::Uid const&,nn::sf::InArray<nn::account::NetworkServiceAccountId> const&)", "outbytes": 0, "buffers": [6, 9], "name": "GetProfileList"},
"20104": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "RequestSyncFriendList"},
"20102": {"inbytes": 24, "args": "(nn::sf::Out<nn::friends::detail::FriendDetailedInfoImpl,void>,nn::account::Uid const&,nn::account::NetworkServiceAccountId)", "outbytes": 0, "buffers": [26], "name": "GetFriendDetailedInfo"},
"20103": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "SyncFriendList"},
"10110": {"inbytes": 24, "args": "(nn::sf::Out<int,void>,nn::account::Uid const&,nn::account::NetworkServiceAccountId,nn::sf::OutBuffer const&)", "outbytes": 4, "buffers": [6], "name": "GetFriendProfileImage"},
"20101": {"inbytes": 16, "args": "(nn::sf::Out<int,void>,nn::account::Uid const&)", "outbytes": 4, "name": "GetNewlyFriendCount"},
"20701": {"inbytes": 16, "args": "(nn::sf::Out<nn::friends::PlayHistoryStatistics,void>,nn::account::Uid const&)", "outbytes": 16, "name": "GetPlayHistoryStatistics"},
"11000": {"inbytes": 164, "args": "(nn::sf::Out<nn::friends::Url,void>,nn::friends::Url const&,int)", "outbytes": 160, "name": "GetProfileImageUrl"},
"20201": {"inbytes": 24, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::friends::detail::FriendRequestImpl> const&,nn::account::Uid const&,int,int)", "outbytes": 4, "buffers": [6], "name": "GetFriendRequestList"},
"20200": {"inbytes": 16, "args": "(nn::sf::Out<int,void>,nn::sf::Out<int,void>,nn::account::Uid const&)", "outbytes": 8, "name": "GetReceivedFriendRequestCount"},
"10102": {"outbytes": 0, "inbytes": 24, "args": "(nn::sf::OutArray<nn::friends::detail::FriendImpl> const&,nn::account::Uid const&,nn::sf::InArray<nn::account::NetworkServiceAccountId> const&,unsigned long)", "pid": True, "buffers": [6, 9], "name": "UpdateFriendInfo"},
"30700": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "DeletePlayHistory"},
"20300": {"inbytes": 24, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::friends::detail::FriendCandidateImpl> const&,nn::account::Uid const&,int)", "outbytes": 4, "buffers": [6], "name": "GetFriendCandidateList"},
"20301": {"inbytes": 24, "args": "(nn::sf::Out<nn::friends::NintendoNetworkIdUserInfo,void>,nn::sf::Out<int,void>,nn::sf::OutArray<nn::friends::detail::NintendoNetworkIdFriendImpl> const&,nn::account::Uid const&,int)", "outbytes": 4, "buffers": [26, 6], "name": "GetNintendoNetworkIdInfo"},
"30204": {"inbytes": 24, "args": "(nn::account::Uid const&,nn::friends::RequestId)", "outbytes": 0, "name": "RejectFriendRequest"},
"30205": {"inbytes": 24, "args": "(nn::account::Uid const&,nn::friends::RequestId)", "outbytes": 0, "name": "ReadFriendRequest"},
"30200": {"inbytes": 32, "args": "(nn::account::Uid const&,nn::account::NetworkServiceAccountId,int)", "outbytes": 0, "name": "SendFriendRequest"},
"30201": {"inbytes": 48, "args": "(nn::account::Uid const&,nn::account::NetworkServiceAccountId,int,nn::friends::ApplicationInfo const&,nn::friends::InAppScreenName const&,nn::friends::InAppScreenName const&)", "outbytes": 0, "buffers": [25, 25], "name": "SendFriendRequestWithApplicationInfo"},
"30202": {"inbytes": 24, "args": "(nn::account::Uid const&,nn::friends::RequestId)", "outbytes": 0, "name": "CancelFriendRequest"},
"30203": {"inbytes": 24, "args": "(nn::account::Uid const&,nn::friends::RequestId)", "outbytes": 0, "name": "AcceptFriendRequest"},
"20800": {"inbytes": 16, "args": "(nn::sf::Out<nn::friends::detail::UserSettingImpl,void>,nn::account::Uid const&)", "outbytes": 0, "buffers": [26], "name": "LoadUserSetting"},
"30101": {"inbytes": 24, "args": "(nn::account::Uid const&,nn::account::NetworkServiceAccountId)", "outbytes": 0, "name": "DeleteFriend"},
"30100": {"inbytes": 16, "args": "(nn::account::Uid const&)", "outbytes": 0, "name": "DropFriendNewlyFlags"}
},
"nn::account::IBaasAccessTokenAccessor": {
"1": {"inbytes": 16, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&,nn::account::Uid const&)", "outbytes": 4, "buffers": [6], "name": "LoadCache"},
"0": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,nn::account::Uid const&)", "outbytes": 0, "name": "EnsureCacheAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"2": {"inbytes": 16, "args": "(nn::sf::Out<unsigned long,void>,nn::account::Uid const&)", "outbytes": 8, "name": "GetDeviceAccountId"},
"51": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,nn::account::Uid const&)", "outbytes": 0, "name": "UnregisterNotificationTokenAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]},
"50": {"inbytes": 56, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::account::detail::IAsyncContext>,void>,nn::account::Uid const&,nn::npns::NotificationToken const&)", "outbytes": 0, "name": "RegisterNotificationTokenAsync", "outinterfaces": ["nn::account::detail::IAsyncContext"]}
},
"nn::socket::sf::IClient": {
"24": {"inbytes": 4, "outbytes": 8, "buffers": [33]},
"25": {"inbytes": 4, "outbytes": 8, "buffers": [34]},
"26": {"inbytes": 4, "outbytes": 8},
"27": {"inbytes": 16, "outbytes": 8},
"20": {"inbytes": 12, "outbytes": 8},
"21": {"inbytes": 12, "outbytes": 8, "buffers": [33]},
"22": {"inbytes": 8, "outbytes": 8},
"23": {"inbytes": 4, "outbytes": 8},
"28": {"inbytes": 8, "pid": True, "outbytes": 8, "buffers": [34]},
"29": {"inbytes": 32, "outbytes": 8, "buffers": [34]},
"1": {"inbytes": 8, "pid": True, "outbytes": 0},
"0": {"inbytes": 48, "inhandles": [1], "pid": True, "outbytes": 4},
"3": {"inbytes": 12, "outbytes": 8},
"2": {"inbytes": 12, "outbytes": 8},
"5": {"inbytes": 32, "outbytes": 8, "buffers": [33, 33, 33, 34, 34, 34]},
"4": {"inbytes": 4, "outbytes": 8, "buffers": [33]},
"7": {"inbytes": 0, "outbytes": 12, "buffers": [33, 34, 33]},
"6": {"inbytes": 8, "outbytes": 8, "buffers": [33, 34]},
"9": {"inbytes": 8, "outbytes": 12, "buffers": [34, 34]},
"8": {"inbytes": 8, "outbytes": 8, "buffers": [34]},
"11": {"inbytes": 8, "outbytes": 8, "buffers": [33, 33]},
"10": {"inbytes": 8, "outbytes": 8, "buffers": [33]},
"13": {"inbytes": 4, "outbytes": 8, "buffers": [33]},
"12": {"inbytes": 4, "outbytes": 12, "buffers": [34]},
"15": {"inbytes": 4, "outbytes": 12, "buffers": [34]},
"14": {"inbytes": 4, "outbytes": 8, "buffers": [33]},
"17": {"inbytes": 12, "outbytes": 12, "buffers": [34]},
"16": {"inbytes": 4, "outbytes": 12, "buffers": [34]},
"19": {"inbytes": 12, "outbytes": 8, "buffers": [33, 33, 33, 33, 34, 34, 34, 34]},
"18": {"inbytes": 8, "outbytes": 8},
"30": {"inbytes": 12, "outbytes": 8, "buffers": [33, 33]}
},
"nn::friends::detail::ipc::INotificationService": {
"1": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Clear"},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetEvent"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::friends::detail::ipc::SizedNotificationInfo,void>)", "outbytes": 16, "name": "Pop"}
},
"nn::ts::server::IMeasurementServer": {
"1": {"inbytes": 1, "outbytes": 4},
"0": {"inbytes": 1, "outbytes": 8},
"3": {"inbytes": 1, "outbytes": 4},
"2": {"inbytes": 2, "outbytes": 0}
},
"nn::audio::detail::IAudioDebugManager": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 16, "inhandles": [1], "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0}
},
"nn::apm::IManagerPrivileged": {
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::apm::ISession>,void>)", "outbytes": 0, "name": "OpenSession", "outinterfaces": ["nn::apm::ISession"]}
},
"nn::pwm::IManager": {
"1": {"inbytes": 4, "outbytes": 0, "outinterfaces": ["nn::pwm::IChannelSession"]},
"0": {"inbytes": 4, "outbytes": 0, "outinterfaces": ["nn::pwm::IChannelSession"]}
},
"nn::ahid::ICtrlSession": {
"11": {"inbytes": 0, "outbytes": 0},
"10": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"12": {"inbytes": 8, "outbytes": 4, "buffers": [5]},
"1": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"0": {"inbytes": 1, "outbytes": 0, "buffers": [6]},
"3": {"inbytes": 2, "outbytes": 0, "buffers": [5]},
"2": {"inbytes": 2, "outbytes": 0, "buffers": [6]},
"5": {"inbytes": 2, "outbytes": 0},
"4": {"inbytes": 1, "outbytes": 0, "buffers": [6]},
"7": {"inbytes": 1, "outbytes": 0},
"6": {"inbytes": 0, "outbytes": 0, "buffers": [6]},
"9": {"inbytes": 6, "outbytes": 0, "buffers": [5]},
"8": {"inbytes": 6, "outbytes": 0, "buffers": [6]}
},
"nn::am::service::IApplicationAccessor": {
"25": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Terminate"},
"123": {"inbytes": 0, "args": "(nn::sf::OutBuffer const&)", "outbytes": 0, "buffers": [6], "name": "GetApplicationLaunchProperty"},
"20": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "RequestExit"},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetAppletStateChangedEvent"},
"10": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Start"},
"30": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "GetResult"},
"120": {"inbytes": 0, "args": "(nn::sf::Out<nn::ncm::ApplicationId,void>)", "outbytes": 8, "name": "GetApplicationId"},
"121": {"inbytes": 4, "args": "(unsigned int,nn::sf::SharedPointer<nn::am::service::IStorage>)", "outbytes": 0, "name": "PushLaunchParameter", "ininterfaces": [None]},
"122": {"inbytes": 0, "args": "(nn::sf::OutBuffer const&)", "outbytes": 0, "buffers": [6], "name": "GetApplicationControlProperty"},
"1": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsCompleted"},
"111": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "AreAnyLibraryAppletsLeft"},
"110": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "TerminateAllLibraryApplets"},
"112": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IAppletAccessor>,void>)", "outbytes": 0, "name": "GetCurrentLibraryApplet", "outinterfaces": ["nn::am::service::IAppletAccessor"]},
"101": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "RequestForApplicationToGetForeground"}
},
"nn::socket::resolver::IResolver": {
"1": {"inbytes": 4, "outbytes": 0, "buffers": [6]},
"0": {"inbytes": 4, "outbytes": 0, "buffers": [5]},
"3": {"inbytes": 24, "pid": True, "outbytes": 12, "buffers": [5, 6]},
"2": {"inbytes": 16, "pid": True, "outbytes": 12, "buffers": [5, 6]},
"5": {"inbytes": 4, "outbytes": 0, "buffers": [6]},
"4": {"inbytes": 4, "outbytes": 0, "buffers": [6]},
"7": {"inbytes": 16, "pid": True, "outbytes": 8, "buffers": [5, 6, 6]},
"6": {"inbytes": 16, "pid": True, "outbytes": 12, "buffers": [5, 5, 5, 6]},
"9": {"inbytes": 16, "pid": True, "outbytes": 0},
"8": {"inbytes": 8, "pid": True, "outbytes": 4}
},
"nn::news::detail::ipc::INewlyArrivedEventHolder": {
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0}
},
"nn::pdm::detail::IQueryService": {
"10": {"inbytes": 4, "outbytes": 4, "buffers": [6]},
"1": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"0": {"inbytes": 4, "outbytes": 4, "buffers": [6]},
"3": {"inbytes": 8, "outbytes": 4, "buffers": [6]},
"2": {"inbytes": 16, "outbytes": 4, "buffers": [6]},
"5": {"inbytes": 24, "outbytes": 40},
"4": {"inbytes": 8, "outbytes": 40},
"7": {"inbytes": 0, "outbytes": 4, "buffers": [6, 5]},
"6": {"inbytes": 16, "outbytes": 40},
"9": {"inbytes": 0, "outbytes": 12},
"8": {"inbytes": 4, "outbytes": 4, "buffers": [6]}
},
"nn::ns::detail::IDocumentInterface": {
"21": {"inbytes": 16, "outbytes": 0, "buffers": [22]},
"23": {"inbytes": 16, "outbytes": 0}
},
"nn::audio::detail::IAudioInManager": {
"1": {"outbytes": 16, "inbytes": 16, "inhandles": [1], "pid": True, "outinterfaces": ["nn::audio::detail::IAudioIn"], "buffers": [5, 6]},
"0": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"3": {"outbytes": 16, "inbytes": 16, "inhandles": [1], "pid": True, "outinterfaces": ["nn::audio::detail::IAudioIn"], "buffers": [33, 34]},
"2": {"inbytes": 0, "outbytes": 4, "buffers": [34]},
"4": {"inbytes": 0, "outbytes": 4, "buffers": [34]}
},
"nn::irsensor::IIrSensorSystemServer": {
"502": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "outbytes": 0, "name": "UnregisterAppletResourceUserId"},
"503": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,bool)", "outbytes": 0, "name": "EnableAppletToGetInput"},
"500": {"inbytes": 8, "args": "(nn::applet::AppletResourceUserId)", "outbytes": 0, "name": "SetAppletResourceUserId"},
"501": {"inbytes": 16, "args": "(nn::applet::AppletResourceUserId,bool)", "outbytes": 0, "name": "RegisterAppletResourceUserId"}
},
"nn::pwm::IChannelSession": {
"1": {"inbytes": 0, "outbytes": 8},
"0": {"inbytes": 8, "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 4},
"2": {"inbytes": 4, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 1},
"4": {"inbytes": 1, "outbytes": 0}
},
"nn::nfp::detail::IUser": {
"24": {"inbytes": 12, "outbytes": 0, "buffers": [5]},
"20": {"inbytes": 8, "outbytes": 4},
"21": {"inbytes": 8, "outbytes": 4},
"22": {"inbytes": 8, "outbytes": 4},
"23": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 16, "pid": True, "outbytes": 0, "buffers": [5]},
"3": {"inbytes": 8, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 4, "buffers": [10]},
"5": {"inbytes": 16, "outbytes": 0},
"4": {"inbytes": 8, "outbytes": 0},
"7": {"inbytes": 12, "outbytes": 0},
"6": {"inbytes": 8, "outbytes": 0},
"9": {"inbytes": 8, "outbytes": 0, "buffers": [5]},
"8": {"inbytes": 8, "outbytes": 4, "buffers": [6]},
"11": {"inbytes": 8, "outbytes": 0},
"10": {"inbytes": 8, "outbytes": 0},
"13": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"12": {"inbytes": 12, "outbytes": 0, "buffers": [5]},
"15": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"14": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"17": {"inbytes": 8, "outhandles": [1], "outbytes": 0},
"16": {"inbytes": 8, "outbytes": 0, "buffers": [26]},
"19": {"inbytes": 0, "outbytes": 4},
"18": {"inbytes": 8, "outhandles": [1], "outbytes": 0}
},
"nn::am::service::IApplicationProxy": {
"11": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletCreator>,void>)", "outbytes": 0, "name": "GetLibraryAppletCreator", "outinterfaces": ["nn::am::service::ILibraryAppletCreator"]},
"10": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IProcessWindingController>,void>)", "outbytes": 0, "name": "GetProcessWindingController", "outinterfaces": ["nn::am::service::IProcessWindingController"]},
"20": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationFunctions>,void>)", "outbytes": 0, "name": "GetApplicationFunctions", "outinterfaces": ["nn::am::service::IApplicationFunctions"]},
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ISelfController>,void>)", "outbytes": 0, "name": "GetSelfController", "outinterfaces": ["nn::am::service::ISelfController"]},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ICommonStateGetter>,void>)", "outbytes": 0, "name": "GetCommonStateGetter", "outinterfaces": ["nn::am::service::ICommonStateGetter"]},
"3": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IAudioController>,void>)", "outbytes": 0, "name": "GetAudioController", "outinterfaces": ["nn::am::service::IAudioController"]},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IWindowController>,void>)", "outbytes": 0, "name": "GetWindowController", "outinterfaces": ["nn::am::service::IWindowController"]},
"4": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDisplayController>,void>)", "outbytes": 0, "name": "GetDisplayController", "outinterfaces": ["nn::am::service::IDisplayController"]},
"1000": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IDebugFunctions>,void>)", "outbytes": 0, "name": "GetDebugFunctions", "outinterfaces": ["nn::am::service::IDebugFunctions"]}
},
"nn::capsrv::sf::IScreenShotApplicationService": {
"201": {"outbytes": 32, "inbytes": 16, "args": "(nn::sf::Out<nn::capsrv::ApplicationAlbumEntry,void>,nn::sf::InBuffer const&,unsigned int,nn::applet::AppletResourceUserId,unsigned int)", "pid": True, "buffers": [69], "name": "SaveScreenShot"},
"203": {"outbytes": 32, "inbytes": 80, "args": "(nn::sf::Out<nn::capsrv::ApplicationAlbumEntry,void>,nn::sf::InBuffer const&,nn::capsrv::detail::ScreenShotAttributeEx0 const&,nn::applet::AppletResourceUserId,unsigned int)", "pid": True, "buffers": [69], "name": "SaveScreenShotEx0"}
},
"nn::nfp::detail::IUserManager": {
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::nfp::detail::IUser"]}
},
"nn::bgtc::IStateControlService": {
"1": {"inbytes": 0, "outbytes": 4},
"3": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"5": {"inbytes": 1, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 0}
},
"nn::wlan::detail::ISocketGetFrame": {
"0": {"inbytes": 4, "outbytes": 4, "buffers": [6]}
},
"nn::audio::detail::IAudioRendererManagerForApplet": {
"1": {"inbytes": 16, "outhandles": [1], "outbytes": 0},
"0": {"inbytes": 16, "outhandles": [1], "outbytes": 0},
"3": {"inbytes": 24, "outbytes": 0},
"2": {"inbytes": 8, "outbytes": 4},
"5": {"inbytes": 8, "outbytes": 0},
"4": {"inbytes": 8, "outbytes": 0}
},
"nn::ns::detail::IGameCardStopper": {},
"nn::visrv::sf::IManagerRootService": {
"3": {"inbytes": 12, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::visrv::sf::IApplicationDisplayService>,void>,unsigned int,nn::vi::ProxyName)", "outbytes": 0, "name": "GetDisplayServiceWithProxyNameExchange", "outinterfaces": ["nn::visrv::sf::IApplicationDisplayService"]},
"2": {"inbytes": 4, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::visrv::sf::IApplicationDisplayService>,void>,unsigned int)", "outbytes": 0, "name": "GetDisplayService", "outinterfaces": ["nn::visrv::sf::IApplicationDisplayService"]}
},
"nn::fatalsrv::IPrivateService": {
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0}
},
"nn::ns::detail::IAsyncResult": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0}
},
"nn::fatalsrv::IService": {
"1": {"inbytes": 16, "pid": True, "outbytes": 0},
"0": {"inbytes": 16, "pid": True, "outbytes": 0},
"2": {"inbytes": 16, "pid": True, "outbytes": 0, "buffers": [21]}
},
"nn::ldn::detail::IUserServiceCreator": {
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::ldn::detail::IUserLocalCommunicationService"]}
},
"nn::pcie::detail::IManager": {
"1": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"0": {"outinterfaces": ["nn::pcie::detail::ISession"], "inhandles": [1], "outbytes": 0, "inbytes": 24, "outhandles": [1]}
},
"nn::audio::detail::IAudioInManagerForApplet": {
"1": {"inbytes": 16, "outhandles": [1], "outbytes": 0},
"0": {"inbytes": 16, "outhandles": [1], "outbytes": 0},
"3": {"inbytes": 24, "outbytes": 0},
"2": {"inbytes": 8, "outbytes": 4}
},
"nn::nsd::detail::IManager": {
"11": {"inbytes": 0, "outbytes": 0, "buffers": [22]},
"10": {"inbytes": 0, "outbytes": 0, "buffers": [22]},
"13": {"inbytes": 4, "outbytes": 0},
"12": {"inbytes": 0, "outbytes": 16},
"20": {"inbytes": 0, "outbytes": 0, "buffers": [22, 21]},
"14": {"inbytes": 4, "outbytes": 0, "buffers": [5, 6]},
"31": {"inbytes": 0, "outbytes": 4, "buffers": [22, 21]},
"30": {"inbytes": 0, "outbytes": 0, "buffers": [22, 21]},
"42": {"inbytes": 0, "outbytes": 0, "buffers": [22]},
"43": {"inbytes": 0, "outbytes": 4, "buffers": [22]},
"40": {"inbytes": 0, "outbytes": 0, "buffers": [22]},
"41": {"inbytes": 0, "outbytes": 4, "buffers": [22]},
"60": {"inbytes": 0, "outbytes": 0, "buffers": [22]},
"61": {"inbytes": 0, "outbytes": 0, "buffers": [21]},
"62": {"inbytes": 0, "outbytes": 0},
"50": {"inbytes": 0, "outbytes": 0, "buffers": [22]},
"21": {"inbytes": 0, "outbytes": 4, "buffers": [22, 21]}
},
"nn::am::service::IProcessWindingController": {
"11": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILibraryAppletAccessor>,void>)", "outbytes": 0, "name": "OpenCallingLibraryApplet", "outinterfaces": ["nn::am::service::ILibraryAppletAccessor"]},
"21": {"inbytes": 0, "args": "(nn::sf::SharedPointer<nn::am::service::IStorage>)", "outbytes": 0, "name": "PushContext", "ininterfaces": [None]},
"22": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>)", "outbytes": 0, "name": "PopContext", "outinterfaces": ["nn::am::service::IStorage"]},
"23": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "CancelWindingReservation"},
"30": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "WindAndDoReserved"},
"40": {"inbytes": 0, "args": "(nn::sf::SharedPointer<nn::am::service::ILibraryAppletAccessor>)", "outbytes": 0, "name": "ReserveToStartAndWaitAndUnwindThis", "ininterfaces": [None]},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::am::service::AppletProcessLaunchReason,void>)", "outbytes": 4, "name": "GetLaunchReason"}
},
"nn::pinmux::ISession": {
"1": {"inbytes": 0, "outbytes": 4},
"0": {"inbytes": 4, "outbytes": 0},
"2": {"inbytes": 4, "outbytes": 0}
},
"nn::news::detail::ipc::INewsService": {
"30400": {"inbytes": 0, "outbytes": 8, "buffers": [6, 5]},
"90100": {"inbytes": 0, "outbytes": 8, "buffers": [6]},
"30200": {"inbytes": 0, "outbytes": 1},
"20100": {"inbytes": 8, "outbytes": 0, "buffers": [9]},
"40100": {"inbytes": 4, "outbytes": 0, "buffers": [9]},
"40101": {"inbytes": 8, "outbytes": 0},
"10100": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"30101": {"inbytes": 4, "outbytes": 4, "buffers": [6]},
"30100": {"inbytes": 0, "outbytes": 4, "buffers": [9]}
},
"nn::am::service::IStorageAccessor": {
"11": {"inbytes": 8, "args": "(long,nn::sf::OutBuffer const&)", "outbytes": 0, "buffers": [34], "name": "Read"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<long,void>)", "outbytes": 8, "name": "GetSize"},
"10": {"inbytes": 8, "args": "(long,nn::sf::InBuffer const&)", "outbytes": 0, "buffers": [33], "name": "Write"}
},
"nn::fssrv::sf::IDeviceOperator": {
"216": {"inbytes": 0, "outbytes": 16},
"217": {"inbytes": 0, "outbytes": 64},
"214": {"inbytes": 8, "outbytes": 0, "buffers": [6]},
"215": {"inbytes": 0, "outbytes": 0},
"212": {"inbytes": 16, "outbytes": 0, "buffers": [6, 5]},
"213": {"inbytes": 8, "outbytes": 0, "buffers": [5]},
"210": {"inbytes": 1, "outbytes": 0},
"211": {"inbytes": 16, "outbytes": 0, "buffers": [6]},
"218": {"inbytes": 8, "outbytes": 0, "buffers": [6]},
"114": {"inbytes": 8, "outbytes": 0, "buffers": [6]},
"111": {"inbytes": 4, "outbytes": 8},
"110": {"inbytes": 4, "outbytes": 0},
"113": {"inbytes": 8, "outbytes": 24, "buffers": [6]},
"112": {"inbytes": 0, "outbytes": 4},
"1": {"inbytes": 0, "outbytes": 8},
"0": {"inbytes": 0, "outbytes": 1},
"3": {"inbytes": 0, "outbytes": 8},
"2": {"inbytes": 8, "outbytes": 0, "buffers": [6]},
"5": {"inbytes": 8, "outbytes": 24, "buffers": [6]},
"4": {"inbytes": 0, "outbytes": 8},
"301": {"inbytes": 0, "outbytes": 4},
"201": {"inbytes": 16, "outbytes": 0},
"200": {"inbytes": 0, "outbytes": 1},
"203": {"inbytes": 4, "outbytes": 16},
"202": {"inbytes": 0, "outbytes": 4},
"205": {"inbytes": 4, "outbytes": 1},
"204": {"inbytes": 0, "outbytes": 0},
"207": {"inbytes": 16, "outbytes": 0, "buffers": [6, 5]},
"206": {"inbytes": 16, "outbytes": 0, "buffers": [6]},
"300": {"inbytes": 4, "outbytes": 0},
"208": {"inbytes": 8, "outbytes": 0, "buffers": [6]},
"209": {"inbytes": 16, "outbytes": 0, "buffers": [6]},
"100": {"inbytes": 8, "outbytes": 0, "buffers": [6]},
"101": {"inbytes": 0, "outbytes": 8}
},
"nn::timesrv::detail::service::ITimeZoneService": {
"201": {"inbytes": 8, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::time::PosixTime> const&,nn::time::CalendarTime,nn::time::TimeZoneRule const&)", "outbytes": 4, "buffers": [21, 10], "name": "ToPosixTime"},
"202": {"inbytes": 8, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::time::PosixTime> const&,nn::time::CalendarTime)", "outbytes": 4, "buffers": [10], "name": "ToPosixTimeWithMyRule"},
"1": {"inbytes": 36, "args": "(nn::time::LocationName const&)", "outbytes": 0, "name": "SetDeviceLocationName"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::time::LocationName,void>)", "outbytes": 36, "name": "GetDeviceLocationName"},
"3": {"inbytes": 4, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::time::LocationName> const&,int)", "outbytes": 4, "buffers": [6], "name": "LoadLocationNameList"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetTotalLocationNameCount"},
"5": {"inbytes": 0, "args": "(nn::sf::Out<nn::time::TimeZoneRuleVersion,void>)", "outbytes": 16, "name": "GetTimeZoneRuleVersion"},
"4": {"inbytes": 36, "args": "(nn::sf::Out<nn::time::TimeZoneRule,void>,nn::time::LocationName const&)", "outbytes": 0, "buffers": [22], "name": "LoadTimeZoneRule"},
"100": {"inbytes": 8, "args": "(nn::sf::Out<nn::time::CalendarTime,void>,nn::sf::Out<nn::time::sf::CalendarAdditionalInfo,void>,nn::time::PosixTime,nn::time::TimeZoneRule const&)", "outbytes": 32, "buffers": [21], "name": "ToCalendarTime"},
"101": {"inbytes": 8, "args": "(nn::sf::Out<nn::time::CalendarTime,void>,nn::sf::Out<nn::time::sf::CalendarAdditionalInfo,void>,nn::time::PosixTime)", "outbytes": 32, "name": "ToCalendarTimeWithMyRule"}
},
"nn::audio::detail::IAudioIn": {
"10": {"inbytes": 8, "inhandles": [1], "outbytes": 0, "buffers": [33]},
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 4},
"3": {"inbytes": 8, "outbytes": 0, "buffers": [5]},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 4, "buffers": [6]},
"4": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"7": {"inbytes": 8, "inhandles": [1], "outbytes": 0, "buffers": [5]},
"6": {"inbytes": 8, "outbytes": 1},
"9": {"inbytes": 0, "outbytes": 4, "buffers": [34]},
"8": {"inbytes": 8, "outbytes": 0, "buffers": [33]}
},
"nn::account::detail::INotifier": {
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetSystemEvent"}
},
"nn::nifm::detail::IRequest": {
"24": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "RegisterSocketDescriptor"},
"25": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "UnregisterSocketDescriptor"},
"20": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>)", "outbytes": 4, "name": "GetRevision"},
"21": {"inbytes": 4, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>,nn::sf::OutBuffer const&,unsigned int)", "outbytes": 12, "buffers": [6], "name": "GetAppletInfo"},
"22": {"inbytes": 0, "args": "(nn::sf::Out<nn::nifm::AdditionalInfo,void>,nn::sf::Out<unsigned int,void>)", "outbytes": 4, "buffers": [22], "name": "GetAdditionalInfo"},
"23": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetKeptInSleep"},
"1": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "GetResult"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetRequestState"},
"3": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Cancel"},
"2": {"inbytes": 0, "outhandles": [1, 1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>,nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetSystemEventReadableHandles"},
"5": {"inbytes": 36, "args": "(nn::nifm::Requirement const&)", "outbytes": 0, "name": "SetRequirement"},
"4": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Submit"},
"6": {"inbytes": 4, "args": "(int)", "outbytes": 0, "name": "SetRequirementPreset"},
"9": {"inbytes": 16, "args": "(nn::util::Uuid const&)", "outbytes": 0, "name": "SetNetworkProfileId"},
"8": {"inbytes": 1, "args": "(unsigned char)", "outbytes": 0, "name": "SetPriority"},
"11": {"inbytes": 1, "args": "(signed char)", "outbytes": 0, "name": "SetConnectionConfirmationOption"},
"10": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetRejectable"},
"13": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetInstant"},
"12": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetPersistent"},
"15": {"inbytes": 1, "args": "(unsigned char)", "outbytes": 0, "name": "SetRawPriority"},
"14": {"inbytes": 2, "args": "(bool,unsigned char)", "outbytes": 0, "name": "SetSustainable"},
"17": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetSharable"},
"16": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetGreedy"},
"19": {"inbytes": 0, "args": "(nn::sf::Out<nn::nifm::Requirement,void>)", "outbytes": 36, "name": "GetRequirement"},
"18": {"inbytes": 4, "args": "(unsigned int)", "outbytes": 0, "name": "SetRequirementByRevision"}
},
"nn::nfc::detail::IUser": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 16, "pid": True, "outbytes": 0, "buffers": [5]},
"3": {"inbytes": 0, "outbytes": 1},
"2": {"inbytes": 0, "outbytes": 4}
},
"nn::tc::IManager": {
"1": {"inbytes": 4, "outhandles": [1], "outbytes": 0},
"0": {"inbytes": 4, "outbytes": 0},
"3": {"inbytes": 4, "outbytes": 0},
"2": {"inbytes": 4, "outbytes": 1},
"5": {"inbytes": 8, "outbytes": 0},
"4": {"inbytes": 4, "outbytes": 0},
"7": {"inbytes": 0, "outbytes": 0},
"6": {"inbytes": 0, "outbytes": 0},
"8": {"inbytes": 0, "outbytes": 1}
},
"nn::am::service::ICommonStateGetter": {
"60": {"inbytes": 0, "args": "(nn::sf::Out<int,void>,nn::sf::Out<int,void>)", "outbytes": 8, "name": "GetDefaultDisplayResolution"},
"61": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetDefaultDisplayResolutionChangeEvent"},
"20": {"inbytes": 0, "args": "(nn::sf::SharedPointer<nn::am::service::IStorage>)", "outbytes": 0, "name": "PushToGeneralChannel", "ininterfaces": [None]},
"40": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>)", "outbytes": 16, "name": "GetCradleFwVersion"},
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::am::AppletMessage,void>)", "outbytes": 4, "name": "ReceiveMessage"},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetEventHandle"},
"3": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "AllowToEnterSleep"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::am::service::AppletKind,void>)", "outbytes": 8, "name": "GetThisAppletKind"},
"5": {"inbytes": 0, "args": "(nn::sf::Out<unsigned char,void>)", "outbytes": 1, "name": "GetOperationMode"},
"4": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "DisallowToEnterSleep"},
"7": {"inbytes": 0, "args": "(nn::sf::Out<unsigned char,void>)", "outbytes": 1, "name": "GetCradleStatus"},
"6": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>)", "outbytes": 4, "name": "GetPerformanceMode"},
"9": {"inbytes": 0, "args": "(nn::sf::Out<unsigned char,void>)", "outbytes": 1, "name": "GetCurrentFocusState"},
"8": {"inbytes": 0, "args": "(nn::sf::Out<unsigned char,void>)", "outbytes": 1, "name": "GetBootMode"},
"11": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ReleaseSleepLock"},
"10": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "RequestToAcquireSleepLock"},
"13": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetAcquiredSleepLockEvent"},
"12": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ReleaseSleepLockTransiently"},
"55": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsInControllerFirmwareUpdateSection"},
"31": {"inbytes": 4, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILockAccessor>,void>,int)", "outbytes": 0, "name": "GetReaderLockAccessorEx", "outinterfaces": ["nn::am::service::ILockAccessor"]},
"30": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILockAccessor>,void>)", "outbytes": 0, "name": "GetHomeButtonReaderLockAccessor", "outinterfaces": ["nn::am::service::ILockAccessor"]},
"51": {"inbytes": 1, "args": "(bool)", "outbytes": 0, "name": "SetVrModeEnabled"},
"50": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "IsVrModeEnabled"}
},
"nn::hid::IActiveVibrationDeviceList": {
"0": {"inbytes": 4, "args": "(nn::hid::VibrationDeviceHandle)", "outbytes": 0, "name": "ActivateVibrationDevice"}
},
"nn::bsdsocket::cfg::ServerInterface": {
"11": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"10": {"inbytes": 0, "outbytes": 0},
"12": {"inbytes": 0, "outbytes": 0},
"1": {"inbytes": 44, "outhandles": [1], "outbytes": 0, "buffers": [5]},
"0": {"inbytes": 44, "outbytes": 0, "buffers": [5]},
"3": {"inbytes": 4, "outbytes": 0, "buffers": [5]},
"2": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"5": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"4": {"inbytes": 0, "outbytes": 0, "buffers": [5, 6]},
"7": {"inbytes": 4, "outbytes": 0},
"6": {"inbytes": 4, "outbytes": 0, "buffers": [5]},
"9": {"inbytes": 0, "outbytes": 0, "buffers": [6, 5]},
"8": {"inbytes": 4, "outbytes": 0, "buffers": [6]}
},
"nn::nifm::detail::INetworkProfile": {
"1": {"inbytes": 16, "args": "(nn::sf::Out<nn::util::Uuid,void>,nn::util::Uuid const&)", "outbytes": 16, "name": "PersistOld"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::util::Uuid,void>,nn::nifm::detail::sf::NetworkProfileData const&)", "outbytes": 16, "buffers": [25], "name": "Update"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::util::Uuid,void>)", "outbytes": 16, "name": "Persist"}
},
"nn::wlan::detail::ILocalManager": {
"42": {"inbytes": 4, "outbytes": 0},
"29": {"inbytes": 4, "outbytes": 0},
"24": {"inbytes": 4, "outbytes": 4, "buffers": [5]},
"25": {"inbytes": 4, "outbytes": 0},
"26": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"27": {"inbytes": 4, "outbytes": 0},
"20": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"21": {"inbytes": 0, "outbytes": 0, "buffers": [22]},
"22": {"inbytes": 0, "outbytes": 4},
"23": {"inbytes": 0, "outbytes": 80},
"44": {"inbytes": 4, "outbytes": 0},
"28": {"inbytes": 4, "outbytes": 4, "buffers": [9]},
"43": {"inbytes": 0, "outbytes": 4},
"40": {"inbytes": 8, "outbytes": 0},
"41": {"inbytes": 4, "outbytes": 4},
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 0},
"7": {"inbytes": 128, "outbytes": 0},
"6": {"inbytes": 0, "outbytes": 6},
"9": {"inbytes": 0, "outbytes": 0, "buffers": [21]},
"8": {"inbytes": 0, "outbytes": 0},
"13": {"inbytes": 128, "outbytes": 0},
"12": {"inbytes": 0, "outbytes": 0},
"11": {"inbytes": 128, "outbytes": 0},
"10": {"inbytes": 0, "outbytes": 0},
"39": {"inbytes": 4, "outbytes": 0},
"38": {"inbytes": 4, "outbytes": 4, "buffers": [9]},
"15": {"inbytes": 16, "outbytes": 0},
"14": {"inbytes": 0, "outbytes": 0},
"17": {"inbytes": 4, "outhandles": [1], "outbytes": 0},
"16": {"inbytes": 4, "outbytes": 0},
"19": {"inbytes": 0, "outbytes": 0, "buffers": [22]},
"18": {"inbytes": 0, "outbytes": 60},
"31": {"inbytes": 2, "outbytes": 4},
"30": {"inbytes": 8, "outbytes": 0},
"37": {"inbytes": 0, "outbytes": 0},
"36": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"35": {"inbytes": 16, "outbytes": 0, "buffers": [5]},
"34": {"inbytes": 0, "outbytes": 0, "buffers": [25, 6]},
"33": {"inbytes": 4, "outbytes": 0, "buffers": [25]},
"32": {"inbytes": 4, "outbytes": 0, "buffers": [25]}
},
"nn::psm::IPsmSession": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"3": {"inbytes": 1, "outbytes": 0},
"2": {"inbytes": 1, "outbytes": 0},
"4": {"inbytes": 1, "outbytes": 0}
},
"nn::ovln::ISender": {
"1": {"inbytes": 0, "outbytes": 4},
"0": {"inbytes": 136, "outbytes": 0}
},
"nn::usb::ds::IDsEndpoint": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 16, "outbytes": 4},
"3": {"inbytes": 0, "outbytes": 132},
"2": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"5": {"inbytes": 1, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 0}
},
"nns::nvdrv::INvDrvServices": {
"11": {"inbytes": 8, "outbytes": 4, "buffers": [33, 34, 33]},
"10": {"inbytes": 4, "inhandles": [1], "outbytes": 4},
"13": {"inbytes": 8, "outbytes": 0},
"12": {"inbytes": 8, "outbytes": 4, "buffers": [33, 34, 34]},
"1": {"inbytes": 8, "outbytes": 4, "buffers": [33, 34]},
"0": {"inbytes": 0, "outbytes": 8, "buffers": [5]},
"3": {"inbytes": 4, "inhandles": [1, 1], "outbytes": 4},
"2": {"inbytes": 4, "outbytes": 4},
"5": {"inbytes": 8, "inhandles": [1], "outbytes": 4},
"4": {"inbytes": 8, "outhandles": [1], "outbytes": 4},
"7": {"inbytes": 8, "outbytes": 4},
"6": {"inbytes": 0, "outbytes": 36},
"9": {"inbytes": 0, "outbytes": 0},
"8": {"inbytes": 8, "pid": True, "outbytes": 4}
},
"nn::am::service::ILibraryAppletSelfAccessor": {
"11": {"inbytes": 0, "args": "(nn::sf::Out<nn::am::service::LibraryAppletInfo,void>)", "outbytes": 8, "name": "GetLibraryAppletInfo"},
"10": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "ExitProcessAndReturn"},
"13": {"inbytes": 0, "args": "(nn::sf::Out<bool,void>)", "outbytes": 1, "name": "CanUseApplicationCore"},
"12": {"inbytes": 0, "args": "(nn::sf::Out<nn::am::service::AppletIdentityInfo,void>)", "outbytes": 16, "name": "GetMainAppletIdentityInfo"},
"15": {"inbytes": 0, "args": "(nn::sf::Out<nn::ns::ApplicationControlProperty,void>)", "outbytes": 0, "buffers": [22], "name": "GetMainAppletApplicationControlProperty"},
"14": {"inbytes": 0, "args": "(nn::sf::Out<nn::am::service::AppletIdentityInfo,void>)", "outbytes": 16, "name": "GetCallerAppletIdentityInfo"},
"17": {"inbytes": 0, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::am::service::AppletIdentityInfo> const&)", "outbytes": 4, "buffers": [6], "name": "GetCallerAppletIdentityInfoStack"},
"16": {"inbytes": 0, "args": "(nn::sf::Out<nn::ncm::StorageId,void>)", "outbytes": 1, "name": "GetMainAppletStorageId"},
"31": {"inbytes": 0, "args": "(nn::sf::SharedPointer<nn::am::service::IStorage>)", "outbytes": 0, "name": "UnpopExtraStorage", "ininterfaces": [None]},
"30": {"inbytes": 0, "args": "(nn::sf::SharedPointer<nn::am::service::IStorage>)", "outbytes": 0, "name": "UnpopInData", "ininterfaces": [None]},
"50": {"inbytes": 8, "args": "(nn::err::ErrorCode)", "outbytes": 0, "name": "ReportVisibleError"},
"40": {"inbytes": 0, "args": "(nn::sf::Out<unsigned long,void>)", "outbytes": 8, "name": "GetIndirectLayerProducerHandle"},
"1": {"inbytes": 0, "args": "(nn::sf::SharedPointer<nn::am::service::IStorage>)", "outbytes": 0, "name": "PushOutData", "ininterfaces": [None]},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>)", "outbytes": 0, "name": "PopInData", "outinterfaces": ["nn::am::service::IStorage"]},
"3": {"inbytes": 0, "args": "(nn::sf::SharedPointer<nn::am::service::IStorage>)", "outbytes": 0, "name": "PushInteractiveOutData", "ininterfaces": [None]},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>)", "outbytes": 0, "name": "PopInteractiveInData", "outinterfaces": ["nn::am::service::IStorage"]},
"5": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetPopInDataEvent"},
"25": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetPopExtraStorageEvent"},
"6": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetPopInteractiveInDataEvent"},
"20": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>)", "outbytes": 0, "name": "PopExtraStorage", "outinterfaces": ["nn::am::service::IStorage"]}
},
"nn::nfc::detail::ISystem": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 16, "pid": True, "outbytes": 0, "buffers": [5]},
"3": {"inbytes": 0, "outbytes": 1},
"2": {"inbytes": 0, "outbytes": 4},
"100": {"inbytes": 1, "outbytes": 0}
},
"nn::nfp::detail::ISystemManager": {
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::nfp::detail::ISystem"]}
},
"nn::capsrv::sf::IScreenShotService": {
"201": {"inbytes": 16, "pid": True, "outbytes": 32, "buffers": [69]},
"203": {"inbytes": 80, "pid": True, "outbytes": 32, "buffers": [69]},
"202": {"inbytes": 56, "outbytes": 32, "buffers": [69, 69]},
"204": {"inbytes": 120, "outbytes": 32, "buffers": [69, 69]}
},
"nn::ovln::ISenderService": {
"0": {"inbytes": 24, "outbytes": 0, "outinterfaces": ["nn::ovln::ISender"]}
},
"nn::audio::detail::IAudioInManagerForDebugger": {
"1": {"inbytes": 8, "outbytes": 0},
"0": {"inbytes": 8, "outbytes": 0}
},
"nn::audio::detail::IFinalOutputRecorderManager": {
"0": {"inbytes": 16, "inhandles": [1], "outbytes": 16, "outinterfaces": ["nn::audio::detail::IFinalOutputRecorder"]}
},
"nn::tma::ISocket": {
"11": {"inbytes": 8, "outhandles": [1], "outbytes": 4},
"10": {"inbytes": 4, "outbytes": 72, "outinterfaces": [None]},
"13": {"inbytes": 24, "inhandles": [1], "outbytes": 4, "outhandles": [1]},
"12": {"inbytes": 4, "outbytes": 16, "buffers": [34]},
"15": {"inbytes": 16, "inhandles": [1], "outbytes": 4, "buffers": [33, 33], "outhandles": [1]},
"14": {"inbytes": 4, "outhandles": [1], "outbytes": 4, "buffers": [33]},
"16": {"inbytes": 4, "outbytes": 16},
"1": {"inbytes": 66, "outbytes": 8},
"0": {"inbytes": 0, "outbytes": 8},
"3": {"inbytes": 4, "outbytes": 8},
"2": {"inbytes": 66, "outbytes": 8},
"5": {"inbytes": 4, "outbytes": 16, "buffers": [34]},
"4": {"inbytes": 0, "outbytes": 72, "outinterfaces": [None]},
"7": {"inbytes": 4, "outbytes": 8},
"6": {"inbytes": 4, "outbytes": 16, "buffers": [33]},
"9": {"inbytes": 0, "outhandles": [1], "outbytes": 4},
"8": {"inbytes": 8, "outbytes": 8}
},
"nn::ns::detail::IRequestServerStopper": {},
"nn::capsrv::sf::IScreenShotControlService": {
"1201": {"inbytes": 16, "outbytes": 24},
"1203": {"inbytes": 8, "outbytes": 8, "buffers": [6]},
"1202": {"inbytes": 0, "outbytes": 0},
"1": {"inbytes": 40, "outbytes": 0, "buffers": [70]},
"1011": {"inbytes": 8, "outbytes": 0},
"2": {"inbytes": 48, "outbytes": 0, "buffers": [70]},
"1012": {"inbytes": 8, "outbytes": 0},
"1003": {"inbytes": 88, "outbytes": 0},
"1002": {"inbytes": 24, "outbytes": 0},
"1001": {"inbytes": 16, "outbytes": 0}
},
"nn::news::detail::ipc::INewsDatabaseService": {
"1": {"inbytes": 0, "outbytes": 4, "buffers": [9]},
"0": {"inbytes": 4, "outbytes": 4, "buffers": [6, 9, 9]},
"3": {"inbytes": 4, "outbytes": 0, "buffers": [9, 9]},
"2": {"inbytes": 1, "outbytes": 4, "buffers": [9, 9]},
"5": {"inbytes": 0, "outbytes": 0, "buffers": [9, 9, 9]},
"4": {"inbytes": 4, "outbytes": 0, "buffers": [9, 9]}
},
"nn::fgm::sf::IDebugger": {
"1": {"inbytes": 0, "args": "(nn::sf::OutBuffer const&,nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>,nn::sf::Out<unsigned int,void>)", "outbytes": 12, "buffers": [6], "name": "Read"},
"0": {"args": "(nn::sf::Out<nn::sf::NativeHandle,void>,nn::sf::NativeHandle&&,unsigned long)", "outbytes": 0, "inbytes": 8, "inhandles": [1], "outhandles": [1], "name": "Initialize"},
"2": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "Cancel"}
},
"nn::ns::detail::IVulnerabilityManagerInterface": {
"1200": {"inbytes": 0, "outbytes": 1}
},
"nn::arp::detail::IReader": {
"1": {"inbytes": 8, "outbytes": 16},
"0": {"inbytes": 8, "outbytes": 16},
"3": {"inbytes": 8, "outbytes": 0, "buffers": [22]},
"2": {"inbytes": 8, "outbytes": 0, "buffers": [22]}
},
"nn::ahid::hdr::ISession": {
"1": {"inbytes": 4, "outbytes": 4, "buffers": [6, 5]},
"0": {"inbytes": 0, "outbytes": 4},
"3": {"inbytes": 0, "outbytes": 4, "buffers": [5]},
"2": {"inbytes": 4, "outbytes": 0, "buffers": [6]},
"4": {"inbytes": 4, "outbytes": 0}
},
"nn::am::service::IHomeMenuFunctions": {
"11": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "LockForeground"},
"10": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "RequestToGetForeground"},
"12": {"inbytes": 0, "args": "(void)", "outbytes": 0, "name": "UnlockForeground"},
"20": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IStorage>,void>)", "outbytes": 0, "name": "PopFromGeneralChannel", "outinterfaces": ["nn::am::service::IStorage"]},
"21": {"inbytes": 0, "outhandles": [1], "outbytes": 0, "args": "(nn::sf::Out<nn::sf::NativeHandle,void>)", "name": "GetPopFromGeneralChannelEvent"},
"31": {"inbytes": 4, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILockAccessor>,void>,int)", "outbytes": 0, "name": "GetWriterLockAccessorEx", "outinterfaces": ["nn::am::service::ILockAccessor"]},
"30": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::ILockAccessor>,void>)", "outbytes": 0, "name": "GetHomeButtonWriterLockAccessor", "outinterfaces": ["nn::am::service::ILockAccessor"]}
},
"nn::nifm::detail::IStaticService": {
"5": {"outbytes": 0, "inbytes": 8, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::nifm::detail::IGeneralService>,void>,unsigned long)", "pid": True, "outinterfaces": ["nn::nifm::detail::IGeneralService"], "name": "CreateGeneralService"},
"4": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::nifm::detail::IGeneralService>,void>)", "outbytes": 0, "name": "CreateGeneralServiceOld", "outinterfaces": ["nn::nifm::detail::IGeneralService"]}
},
"nn::pl::detail::ISharedFontManager": {
"1": {"inbytes": 4, "outbytes": 4},
"0": {"inbytes": 4, "outbytes": 0},
"3": {"inbytes": 4, "outbytes": 4},
"2": {"inbytes": 4, "outbytes": 4},
"5": {"inbytes": 8, "outbytes": 8, "buffers": [6, 6, 6]},
"4": {"inbytes": 0, "outhandles": [1], "outbytes": 0}
},
"nn::apm::IManager": {
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::apm::PerformanceMode,void>)", "outbytes": 4, "name": "GetPerformanceMode"},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::apm::ISession>,void>)", "outbytes": 0, "name": "OpenSession", "outinterfaces": ["nn::apm::ISession"]}
},
"nn::psm::IPsmServer": {
"11": {"inbytes": 0, "outbytes": 0},
"10": {"inbytes": 0, "outbytes": 0},
"13": {"inbytes": 0, "outbytes": 8},
"12": {"inbytes": 0, "outbytes": 4},
"15": {"inbytes": 0, "outbytes": 8},
"14": {"inbytes": 0, "outbytes": 1},
"17": {"inbytes": 0, "outbytes": 64},
"16": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"18": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"1": {"inbytes": 0, "outbytes": 4},
"0": {"inbytes": 0, "outbytes": 4},
"3": {"inbytes": 0, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 1},
"7": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::psm::IPsmSession"]},
"6": {"inbytes": 0, "outbytes": 0},
"9": {"inbytes": 0, "outbytes": 0},
"8": {"inbytes": 0, "outbytes": 0}
},
"nn::audio::detail::IFinalOutputRecorder": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 4},
"3": {"inbytes": 8, "outbytes": 0, "buffers": [5]},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 16, "buffers": [6]},
"4": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"7": {"inbytes": 8, "outbytes": 8},
"6": {"inbytes": 8, "outbytes": 1},
"9": {"inbytes": 0, "outbytes": 16, "buffers": [34]},
"8": {"inbytes": 8, "outbytes": 0, "buffers": [33]}
},
"nn::bcat::detail::ipc::IDeliveryCacheStorageService": {
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::bcat::detail::ipc::IDeliveryCacheDirectoryService>,void>)", "outbytes": 0, "name": "CreateDirectoryService", "outinterfaces": ["nn::bcat::detail::ipc::IDeliveryCacheDirectoryService"]},
"0": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::bcat::detail::ipc::IDeliveryCacheFileService>,void>)", "outbytes": 0, "name": "CreateFileService", "outinterfaces": ["nn::bcat::detail::ipc::IDeliveryCacheFileService"]},
"10": {"inbytes": 0, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::bcat::DirectoryName> const&)", "outbytes": 4, "buffers": [6], "name": "EnumerateDeliveryCacheDirectory"}
},
"nn::fssrv::sf::IFileSystemProxy": {
"605": {"inbytes": 0, "outbytes": 0},
"604": {"inbytes": 8, "outbytes": 0},
"607": {"inbytes": 32, "outbytes": 0},
"620": {"inbytes": 16, "outbytes": 0},
"601": {"inbytes": 16, "outbytes": 8},
"600": {"inbytes": 8, "outbytes": 0},
"603": {"inbytes": 8, "outbytes": 0},
"602": {"inbytes": 8, "outbytes": 0, "buffers": [6]},
"609": {"inbytes": 0, "outbytes": 16, "buffers": [25]},
"608": {"inbytes": 0, "outbytes": 0},
"60": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::ISaveDataInfoReader"]},
"61": {"inbytes": 1, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::ISaveDataInfoReader"]},
"606": {"inbytes": 16, "outbytes": 16},
"110": {"inbytes": 4, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IFileSystem"]},
"80": {"inbytes": 72, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IFile"]},
"800": {"inbytes": 0, "outbytes": 128},
"24": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"25": {"inbytes": 16, "outbytes": 0},
"26": {"inbytes": 0, "outbytes": 0},
"27": {"inbytes": 0, "outbytes": 1},
"21": {"inbytes": 8, "outbytes": 0},
"22": {"inbytes": 144, "outbytes": 0},
"23": {"inbytes": 128, "outbytes": 0},
"1": {"inbytes": 8, "pid": True, "outbytes": 0},
"2": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IFileSystem"]},
"7": {"inbytes": 16, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IFileSystem"]},
"400": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IDeviceOperator"]},
"9": {"inbytes": 8, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IFileSystem"]},
"8": {"inbytes": 16, "outbytes": 0, "buffers": [25], "outinterfaces": ["nn::fssrv::sf::IFileSystem"]},
"500": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IEventNotifier"]},
"501": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IEventNotifier"]},
"201": {"inbytes": 8, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IStorage"]},
"200": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IStorage"]},
"203": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IStorage"]},
"202": {"inbytes": 16, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IStorage"]},
"610": {"inbytes": 0, "outbytes": 24, "buffers": [25]},
"57": {"inbytes": 16, "outbytes": 0, "buffers": [6]},
"100": {"inbytes": 4, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IFileSystem"]},
"11": {"inbytes": 4, "outbytes": 0, "buffers": [25], "outinterfaces": ["nn::fssrv::sf::IFileSystem"]},
"13": {"inbytes": 0, "outbytes": 0},
"12": {"inbytes": 4, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IStorage"]},
"59": {"inbytes": 16, "outbytes": 0, "buffers": [5]},
"58": {"inbytes": 8, "outbytes": 0, "buffers": [6]},
"17": {"inbytes": 0, "outbytes": 0, "buffers": [25], "outinterfaces": ["nn::fssrv::sf::IFileSystem"]},
"19": {"inbytes": 0, "outbytes": 0},
"18": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IFileSystem"]},
"31": {"inbytes": 8, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IFileSystem"]},
"30": {"inbytes": 8, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IStorage"]},
"51": {"inbytes": 72, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IFileSystem"]},
"53": {"inbytes": 72, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IFileSystem"]},
"52": {"inbytes": 72, "outbytes": 0, "outinterfaces": ["nn::fssrv::sf::IFileSystem"]},
"32": {"inbytes": 32, "outbytes": 0},
"1006": {"inbytes": 0, "outbytes": 0, "buffers": [5]},
"1005": {"inbytes": 0, "outbytes": 4},
"1004": {"inbytes": 4, "outbytes": 0},
"1003": {"inbytes": 0, "outbytes": 0},
"1002": {"inbytes": 0, "outbytes": 0, "buffers": [25]},
"1001": {"inbytes": 16, "outbytes": 0},
"1000": {"inbytes": 4, "outbytes": 0, "buffers": [25]}
},
"nn::bcat::detail::ipc::IDeliveryCacheDirectoryService": {
"1": {"inbytes": 0, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::bcat::DeliveryCacheDirectoryEntry> const&)", "outbytes": 4, "buffers": [6], "name": "Read"},
"0": {"inbytes": 32, "args": "(nn::bcat::DirectoryName const&)", "outbytes": 0, "name": "Open"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<int,void>)", "outbytes": 4, "name": "GetCount"}
},
"nn::nfc::mifare::detail::IUserManager": {
"0": {"inbytes": 0, "outbytes": 0, "outinterfaces": ["nn::nfc::mifare::detail::IUser"]}
},
"nn::spl::detail::IRandomInterface": {
"0": {"inbytes": 0, "outbytes": 0, "buffers": [6]}
},
"nn::capsrv::sf::IAlbumControlService": {
"2201": {"inbytes": 24, "outbytes": 0, "buffers": [69]},
"2301": {"inbytes": 24, "outbytes": 0, "buffers": [69]},
"2002": {"inbytes": 1, "outbytes": 0},
"2001": {"inbytes": 1, "outbytes": 0},
"2014": {"inbytes": 8, "outbytes": 0},
"2102": {"inbytes": 40, "outbytes": 32},
"2101": {"inbytes": 16, "outbytes": 24},
"2011": {"inbytes": 16, "outbytes": 0},
"2013": {"inbytes": 8, "outbytes": 8},
"2012": {"inbytes": 16, "outbytes": 0}
},
"nn::am::service::IApplicationCreator": {
"1": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationAccessor>,void>)", "outbytes": 0, "name": "PopLaunchRequestedApplication", "outinterfaces": ["nn::am::service::IApplicationAccessor"]},
"0": {"inbytes": 8, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationAccessor>,void>,nn::ncm::ApplicationId)", "outbytes": 0, "name": "CreateApplication", "outinterfaces": ["nn::am::service::IApplicationAccessor"]},
"100": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationAccessor>,void>)", "outbytes": 0, "name": "PopFloatingApplicationForDevelopment", "outinterfaces": ["nn::am::service::IApplicationAccessor"]},
"10": {"inbytes": 8, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::am::service::IApplicationAccessor>,void>,nn::ncm::SystemApplicationId)", "outbytes": 0, "name": "CreateSystemApplication", "outinterfaces": ["nn::am::service::IApplicationAccessor"]}
},
"nn::btm::IBtmSystemCore": {
"1": {"inbytes": 0, "outbytes": 0},
"0": {"inbytes": 0, "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 1},
"2": {"inbytes": 0, "outbytes": 0},
"5": {"inbytes": 0, "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 0},
"7": {"inbytes": 0, "outhandles": [1], "outbytes": 1},
"6": {"inbytes": 0, "outbytes": 1},
"9": {"inbytes": 0, "outbytes": 1},
"8": {"inbytes": 0, "outhandles": [1], "outbytes": 1}
},
"nn::visrv::sf::IApplicationRootService": {
"0": {"inbytes": 4, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::visrv::sf::IApplicationDisplayService>,void>,unsigned int)", "outbytes": 0, "name": "GetDisplayService", "outinterfaces": ["nn::visrv::sf::IApplicationDisplayService"]}
},
"nn::ssl::sf::ISslContext": {
"11": {"inbytes": 8, "args": "(unsigned long)", "outbytes": 0, "name": "RemoveCrl"},
"10": {"inbytes": 0, "args": "(nn::sf::Out<unsigned long,void>,nn::sf::InBuffer const&)", "outbytes": 8, "buffers": [5], "name": "ImportCrl"},
"1": {"inbytes": 4, "args": "(nn::sf::Out<int,void>,nn::ssl::sf::ContextOption)", "outbytes": 4, "name": "GetOption"},
"0": {"inbytes": 8, "args": "(nn::ssl::sf::ContextOption,int)", "outbytes": 0, "name": "SetOption"},
"3": {"inbytes": 0, "args": "(nn::sf::Out<unsigned int,void>)", "outbytes": 4, "name": "GetConnectionCount"},
"2": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::ssl::sf::ISslConnection>,void>)", "outbytes": 0, "name": "CreateConnection", "outinterfaces": ["nn::ssl::sf::ISslConnection"]},
"5": {"inbytes": 0, "args": "(nn::sf::Out<unsigned long,void>,nn::sf::InBuffer const&,nn::sf::InBuffer const&)", "outbytes": 8, "buffers": [5, 5], "name": "ImportClientPki"},
"4": {"inbytes": 4, "args": "(nn::sf::Out<unsigned long,void>,nn::sf::InBuffer const&,nn::ssl::sf::CertificateFormat)", "outbytes": 8, "buffers": [5], "name": "ImportServerPki"},
"7": {"inbytes": 8, "args": "(unsigned long)", "outbytes": 0, "name": "RemoveClientPki"},
"6": {"inbytes": 8, "args": "(unsigned long)", "outbytes": 0, "name": "RemoveServerPki"},
"9": {"inbytes": 0, "args": "(nn::sf::InBuffer const&)", "outbytes": 0, "buffers": [5], "name": "AddPolicyOid"},
"8": {"inbytes": 4, "args": "(nn::sf::Out<unsigned long,void>,nn::ssl::sf::InternalPki)", "outbytes": 8, "name": "RegisterInternalPki"}
},
"nn::bcat::detail::ipc::IBcatService": {
"90100": {"inbytes": 0, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::bcat::TaskInfo> const&)", "outbytes": 4, "buffers": [6], "name": "EnumerateBackgroundDeliveryTask"},
"30203": {"inbytes": 8, "args": "(nn::ApplicationId)", "outbytes": 0, "name": "UnblockDeliveryTask"},
"90200": {"inbytes": 8, "args": "(nn::sf::Out<unsigned long,void>,nn::sf::OutBuffer const&,nn::ApplicationId)", "outbytes": 8, "buffers": [6], "name": "GetDeliveryList"},
"30200": {"inbytes": 16, "args": "(nn::ApplicationId,unsigned int)", "outbytes": 0, "name": "RegisterBackgroundDeliveryTask"},
"30201": {"inbytes": 8, "args": "(nn::ApplicationId)", "outbytes": 0, "name": "UnregisterBackgroundDeliveryTask"},
"30202": {"inbytes": 8, "args": "(nn::ApplicationId)", "outbytes": 0, "name": "BlockDeliveryTask"},
"90300": {"inbytes": 0, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<nn::bcat::PushNotificationLog> const&)", "outbytes": 4, "buffers": [6], "name": "GetPushNotificationLog"},
"90201": {"inbytes": 8, "args": "(nn::ApplicationId)", "outbytes": 0, "name": "ClearDeliveryCacheStorage"},
"10100": {"inbytes": 0, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::bcat::detail::ipc::IDeliveryCacheProgressService>,void>)", "outbytes": 0, "name": "RequestSyncDeliveryCache", "outinterfaces": ["nn::bcat::detail::ipc::IDeliveryCacheProgressService"]},
"20100": {"inbytes": 16, "args": "(nn::sf::Out<nn::sf::SharedPointer<nn::bcat::detail::ipc::IDeliveryCacheProgressService>,void>,nn::ApplicationId,unsigned int)", "outbytes": 0, "name": "RequestSyncDeliveryCacheWithApplicationId", "outinterfaces": ["nn::bcat::detail::ipc::IDeliveryCacheProgressService"]},
"30100": {"inbytes": 8, "args": "(nn::ApplicationId,nn::sf::InArray<char> const&)", "outbytes": 0, "buffers": [9], "name": "SetPassphrase"}
},
"nn::aocsrv::detail::IAddOnContentManager": {
"1": {"inbytes": 16, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<int> const&,int,int,nn::ncm::ApplicationId)", "outbytes": 4, "buffers": [6], "name": "ListAddOnContentByApplicationId"},
"0": {"inbytes": 8, "args": "(nn::sf::Out<int,void>,nn::ncm::ApplicationId)", "outbytes": 4, "name": "CountAddOnContentByApplicationId"},
"3": {"outbytes": 4, "inbytes": 16, "args": "(nn::sf::Out<int,void>,nn::sf::OutArray<int> const&,unsigned long,int,int)", "pid": True, "buffers": [6], "name": "ListAddOnContent"},
"2": {"inbytes": 8, "args": "(nn::sf::Out<int,void>,unsigned long)", "pid": True, "outbytes": 4, "name": "CountAddOnContent"},
"5": {"inbytes": 8, "args": "(nn::sf::Out<unsigned long,void>,unsigned long)", "pid": True, "outbytes": 8, "name": "GetAddOnContentBaseId"},
"4": {"inbytes": 8, "args": "(nn::sf::Out<unsigned long,void>,nn::ncm::ApplicationId)", "outbytes": 8, "name": "GetAddOnContentBaseIdByApplicationId"},
"7": {"inbytes": 16, "args": "(int,unsigned long)", "pid": True, "outbytes": 0, "name": "PrepareAddOnContent"},
"6": {"inbytes": 16, "args": "(int,nn::ncm::ApplicationId)", "outbytes": 0, "name": "PrepareAddOnContentByApplicationId"}
},
"nn::ldn::detail::IUserLocalCommunicationService": {
"400": {"inbytes": 8, "pid": True, "outbytes": 0},
"1": {"inbytes": 0, "outbytes": 0, "buffers": [26]},
"0": {"inbytes": 0, "outbytes": 4},
"3": {"inbytes": 0, "outbytes": 2},
"2": {"inbytes": 0, "outbytes": 8},
"5": {"inbytes": 0, "outbytes": 32},
"4": {"inbytes": 0, "outbytes": 32},
"401": {"inbytes": 0, "outbytes": 0},
"301": {"inbytes": 0, "outbytes": 0},
"201": {"inbytes": 0, "outbytes": 0},
"200": {"inbytes": 0, "outbytes": 0},
"203": {"inbytes": 184, "outbytes": 0, "buffers": [9]},
"202": {"inbytes": 152, "outbytes": 0},
"205": {"inbytes": 4, "outbytes": 0},
"204": {"inbytes": 0, "outbytes": 0},
"207": {"inbytes": 1, "outbytes": 0},
"206": {"inbytes": 0, "outbytes": 0, "buffers": [33]},
"300": {"inbytes": 0, "outbytes": 0},
"208": {"inbytes": 6, "outbytes": 0},
"302": {"inbytes": 124, "outbytes": 0, "buffers": [25]},
"303": {"inbytes": 192, "outbytes": 0},
"304": {"inbytes": 0, "outbytes": 0},
"209": {"inbytes": 0, "outbytes": 0},
"102": {"inbytes": 104, "outbytes": 2, "buffers": [34]},
"103": {"inbytes": 104, "outbytes": 2, "buffers": [34]},
"100": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"101": {"inbytes": 0, "outbytes": 0, "buffers": [26, 10]}
},
"nn::ovln::IReceiver": {
"1": {"inbytes": 16, "outbytes": 0},
"0": {"inbytes": 16, "outbytes": 0},
"3": {"inbytes": 0, "outbytes": 128},
"2": {"inbytes": 0, "outhandles": [1], "outbytes": 0},
"4": {"inbytes": 0, "outbytes": 136}
},
"nn::ro::detail::IDebugMonitorInterface": {
"0": {"inbytes": 8, "outbytes": 4, "buffers": [6]}
}
}
clientInfo = (
('nn::account::IAccountServiceForAdministrator', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::account::IAccountServiceForAdministrator', 1, '0x10 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForAdministrator', 2, '0 bytes in - 0 bytes out - Buffer<0,0xA,0>'),
('nn::account::IAccountServiceForAdministrator', 3, '0 bytes in - 0 bytes out - Buffer<0,0xA,0>'),
('nn::account::IAccountServiceForAdministrator', 4, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::account::IAccountServiceForAdministrator', 5, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForAdministrator', 6, '0x10 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForAdministrator', 50, '8 bytes in - 1 bytes out - takes pid - OutRaw<1,1,0>, InRaw<8,8,0>'),
('nn::account::IAccountServiceForAdministrator', 51, '1 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<1,1,0>'),
('nn::account::IAccountServiceForAdministrator', 100, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::IAccountServiceForAdministrator', 101, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::IAccountServiceForAdministrator', 102, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForAdministrator', 103, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::IAccountServiceForAdministrator', 104, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::IAccountServiceForAdministrator', 110, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>, Buffer<0,5,0>'),
('nn::account::IAccountServiceForAdministrator', 111, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::account::IAccountServiceForAdministrator', 112, '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::account::IAccountServiceForAdministrator', 190, '0x10 bytes in - 0x10 bytes out - OutRaw<8,8,8>, OutRaw<4,4,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForAdministrator', 200, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::account::IAccountServiceForAdministrator', 201, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForAdministrator', 202, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForAdministrator', 203, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForAdministrator', 204, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<4,4,0>'),
('nn::account::IAccountServiceForAdministrator', 205, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForAdministrator', 206, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForAdministrator', 210, '4 bytes in - 0 bytes out - OutObject<0,0>, InHandle<0,1>, InRaw<4,4,0>'),
('nn::account::IAccountServiceForAdministrator', 230, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::IAccountServiceForAdministrator', 250, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForAdministrator', 290, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,4,0>'),
('nn::account::IAccountServiceForAdministrator', 291, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,4,0>'),
('nn::account::IAccountServiceForAdministrator', 299, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::IAccountServiceForAdministrator', 997, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForAdministrator', 998, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForAdministrator', 999, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForApplication', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::account::IAccountServiceForApplication', 1, '0x10 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForApplication', 2, '0 bytes in - 0 bytes out - Buffer<0,0xA,0>'),
('nn::account::IAccountServiceForApplication', 3, '0 bytes in - 0 bytes out - Buffer<0,0xA,0>'),
('nn::account::IAccountServiceForApplication', 4, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::account::IAccountServiceForApplication', 5, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForApplication', 6, '0x10 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForApplication', 50, '8 bytes in - 1 bytes out - takes pid - OutRaw<1,1,0>, InRaw<8,8,0>'),
('nn::account::IAccountServiceForApplication', 51, '1 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<1,1,0>'),
('nn::account::IAccountServiceForApplication', 100, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::account::IAccountServiceForApplication', 101, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForApplication', 102, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::IAccountServiceForApplication', 110, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>, Buffer<0,5,0>'),
('nn::account::IAccountServiceForApplication', 111, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForApplication', 120, '4 bytes in - 0 bytes out - OutObject<0,0>, InHandle<0,1>, InRaw<4,4,0>'),
('nn::account::IAccountServiceForSystemService', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::account::IAccountServiceForSystemService', 1, '0x10 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForSystemService', 2, '0 bytes in - 0 bytes out - Buffer<0,0xA,0>'),
('nn::account::IAccountServiceForSystemService', 3, '0 bytes in - 0 bytes out - Buffer<0,0xA,0>'),
('nn::account::IAccountServiceForSystemService', 4, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::account::IAccountServiceForSystemService', 5, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForSystemService', 6, '0x10 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForSystemService', 50, '8 bytes in - 1 bytes out - takes pid - OutRaw<1,1,0>, InRaw<8,8,0>'),
('nn::account::IAccountServiceForSystemService', 51, '1 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<1,1,0>'),
('nn::account::IAccountServiceForSystemService', 100, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::IAccountServiceForSystemService', 101, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::IAccountServiceForSystemService', 102, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForSystemService', 103, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::IAccountServiceForSystemService', 104, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::IAccountServiceForSystemService', 110, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>, Buffer<0,5,0>'),
('nn::account::IAccountServiceForSystemService', 111, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::account::IAccountServiceForSystemService', 112, '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::account::IAccountServiceForSystemService', 190, '0x10 bytes in - 0x10 bytes out - OutRaw<8,8,8>, OutRaw<4,4,0>, InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForSystemService', 997, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForSystemService', 998, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::account::IAccountServiceForSystemService', 999, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::account::IBaasAccessTokenAccessor', 0, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>'),
('nn::account::IBaasAccessTokenAccessor', 1, '0x10 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,0>'),
('nn::account::IBaasAccessTokenAccessor', 2, '0x10 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<0x10,8,0>'),
('nn::account::IBaasAccessTokenAccessor', 50, '0x38 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0x28>, InRaw<0x28,1,0>'),
('nn::account::IBaasAccessTokenAccessor', 51, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>'),
('nn::account::baas::IAdministrator', 0, '0 bytes in - 0 bytes out'),
('nn::account::baas::IAdministrator', 1, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::account::baas::IAdministrator', 2, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::baas::IAdministrator', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::account::baas::IAdministrator', 100, '8 bytes in - 0 bytes out - takes pid - Buffer<0,0x19,0x10>, InRaw<8,8,0>'),
('nn::account::baas::IAdministrator', 120, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::account::baas::IAdministrator', 130, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0x1A,0x24F>, Buffer<1,6,0>'),
('nn::account::baas::IAdministrator', 131, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::baas::IAdministrator', 132, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, OutObject<0,0>, InRaw<4,4,0>'),
('nn::account::baas::IAdministrator', 150, '4 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x108>, Buffer<1,0x19,0x200>, InHandle<0,1>, InRaw<4,4,0>'),
('nn::account::baas::IAdministrator', 200, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::account::baas::IAdministrator', 201, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::baas::IAdministrator', 202, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::baas::IAdministrator', 203, '0 bytes in - 0 bytes out'),
('nn::account::baas::IAdministrator', 220, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::baas::IAdministrator', 221, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::baas::IAdministrator', 222, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, OutObject<0,0>, InRaw<4,4,0>'),
('nn::account::baas::IAdministrator', 250, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::account::baas::IAdministrator', 251, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::baas::IAdministrator', 252, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,4,0>'),
('nn::account::baas::IAdministrator', 255, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::baas::IAdministrator', 256, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,4,0>'),
('nn::account::baas::IAdministrator', 260, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::baas::IAdministrator', 261, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,4,0>'),
('nn::account::baas::IAdministrator', 280, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,4,0>'),
('nn::account::baas::IAdministrator', 997, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::baas::IAdministrator', 998, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::account::baas::IFloatingRegistrationRequest', 0, '0 bytes in - 0x10 bytes out - OutRaw<0x10,4,0>'),
('nn::account::baas::IFloatingRegistrationRequest', 12, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::account::baas::IFloatingRegistrationRequest', 13, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::account::baas::IFloatingRegistrationRequest', 14, '0 bytes in - 0 bytes out - Buffer<0,0xA,0>'),
('nn::account::baas::IFloatingRegistrationRequest', 15, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::account::baas::IFloatingRegistrationRequest', 21, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::account::baas::IFloatingRegistrationRequest', 100, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, OutObject<0,0>'),
('nn::account::baas::IFloatingRegistrationRequest', 101, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>'),
('nn::account::baas::IFloatingRegistrationRequest', 110, '8 bytes in - 0 bytes out - takes pid - Buffer<0,0x19,0x10>, InRaw<8,8,0>'),
('nn::account::baas::IFloatingRegistrationRequest', 111, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::baas::IGuestLoginRequest', 0, '0 bytes in - 0x10 bytes out - OutRaw<0x10,4,0>'),
('nn::account::baas::IGuestLoginRequest', 12, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::account::baas::IGuestLoginRequest', 13, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::account::baas::IGuestLoginRequest', 14, '0 bytes in - 0 bytes out - Buffer<0,0xA,0>'),
('nn::account::baas::IGuestLoginRequest', 15, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::account::baas::IGuestLoginRequest', 21, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::account::baas::IManagerForApplication', 0, '0 bytes in - 0 bytes out'),
('nn::account::baas::IManagerForApplication', 1, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::account::baas::IManagerForApplication', 2, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::baas::IManagerForApplication', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::account::baas::IManagerForApplication', 130, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0x1A,0x68>, Buffer<1,6,0>'),
('nn::account::baas::IManagerForApplication', 150, '4 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x200>, InHandle<0,1>, InRaw<4,4,0>'),
('nn::account::baas::IManagerForSystemService', 0, '0 bytes in - 0 bytes out'),
('nn::account::baas::IManagerForSystemService', 1, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::account::baas::IManagerForSystemService', 2, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::baas::IManagerForSystemService', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::account::baas::IManagerForSystemService', 100, '8 bytes in - 0 bytes out - takes pid - Buffer<0,0x19,0x10>, InRaw<8,8,0>'),
('nn::account::baas::IManagerForSystemService', 120, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::account::baas::IManagerForSystemService', 130, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0x1A,0x24F>, Buffer<1,6,0>'),
('nn::account::baas::IManagerForSystemService', 131, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::baas::IManagerForSystemService', 132, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, OutObject<0,0>, InRaw<4,4,0>'),
('nn::account::baas::IManagerForSystemService', 150, '4 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x108>, Buffer<1,0x19,0x200>, InHandle<0,1>, InRaw<4,4,0>'),
('nn::account::detail::IAsyncContext', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::account::detail::IAsyncContext', 1, '0 bytes in - 0 bytes out'),
('nn::account::detail::IAsyncContext', 2, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::account::detail::IAsyncContext', 3, '0 bytes in - 0 bytes out'),
('nn::account::detail::INotifier', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::account::detail::ISessionObject', 999, '0 bytes in - 0 bytes out'),
('nn::account::http::IOAuthProcedure', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::http::IOAuthProcedure', 1, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x1000>, Buffer<1,0x1A,0x100>'),
('nn::account::http::IOAuthProcedure', 2, '0 bytes in - 0 bytes out - Buffer<0,9,0>'),
('nn::account::http::IOAuthProcedure', 3, '0 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,9,0>'),
('nn::account::http::IOAuthProcedure', 10, '0 bytes in - 0x10 bytes out - OutRaw<0x10,4,0>'),
('nn::account::nas::IAuthorizationRequest', 0, '0 bytes in - 0x10 bytes out - OutRaw<0x10,4,0>'),
('nn::account::nas::IAuthorizationRequest', 10, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::nas::IAuthorizationRequest', 19, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::account::nas::IAuthorizationRequest', 20, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::account::nas::IAuthorizationRequest', 21, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::account::nas::IAuthorizationRequest', 22, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x80>'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 1, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x1000>, Buffer<1,0x1A,0x100>'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 2, '0 bytes in - 0 bytes out - Buffer<0,9,0>'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 3, '0 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,9,0>'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 10, '0 bytes in - 0x10 bytes out - OutRaw<0x10,4,0>'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 100, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 101, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 102, '0 bytes in - 0 bytes out - Buffer<0,0xA,0>'),
('nn::account::nas::IOAuthProcedureForExternalNsa', 103, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 1, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x1000>, Buffer<1,0x1A,0x100>'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 2, '0 bytes in - 0 bytes out - Buffer<0,9,0>'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 3, '0 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,9,0>'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 10, '0 bytes in - 0x10 bytes out - OutRaw<0x10,4,0>'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 100, '4 bytes in - 0 bytes out - Buffer<0,0x1A,0x1000>, Buffer<1,0x1A,0x100>, InRaw<4,4,0>'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 101, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::account::nas::IOAuthProcedureForNintendoAccountLinkage', 199, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x1000>'),
('nn::account::profile::IProfile', 0, '0 bytes in - 0x38 bytes out - OutRaw<0x38,8,0>, Buffer<0,0x1A,0x80>'),
('nn::account::profile::IProfile', 1, '0 bytes in - 0x38 bytes out - OutRaw<0x38,8,0>'),
('nn::account::profile::IProfile', 10, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::account::profile::IProfile', 11, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::account::profile::IProfileEditor', 0, '0 bytes in - 0x38 bytes out - OutRaw<0x38,8,0>, Buffer<0,0x1A,0x80>'),
('nn::account::profile::IProfileEditor', 1, '0 bytes in - 0x38 bytes out - OutRaw<0x38,8,0>'),
('nn::account::profile::IProfileEditor', 10, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::account::profile::IProfileEditor', 11, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::account::profile::IProfileEditor', 100, '0x38 bytes in - 0 bytes out - InRaw<0x38,8,0>, Buffer<0,0x19,0x80>'),
('nn::account::profile::IProfileEditor', 101, '0x38 bytes in - 0 bytes out - InRaw<0x38,8,0>, Buffer<0,0x19,0x80>, Buffer<1,5,0>'),
('nn::am::service::IAllSystemAppletProxiesService', 100, '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>, InHandle<0,1>'),
('nn::am::service::IAllSystemAppletProxiesService', 200, '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>, InHandle<0,1>'),
('nn::am::service::IAllSystemAppletProxiesService', 201, '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>, InHandle<0,1>, Buffer<0,0x15,0x80>'),
('nn::am::service::IAllSystemAppletProxiesService', 300, '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>, InHandle<0,1>'),
('nn::am::service::IAllSystemAppletProxiesService', 350, '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>, InHandle<0,1>'),
('nn::am::service::IAllSystemAppletProxiesService', 400, '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>'),
('nn::am::service::IAppletAccessor', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::IAppletAccessor', 1, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::IAppletAccessor', 10, '0 bytes in - 0 bytes out'),
('nn::am::service::IAppletAccessor', 20, '0 bytes in - 0 bytes out'),
('nn::am::service::IAppletAccessor', 25, '0 bytes in - 0 bytes out'),
('nn::am::service::IAppletAccessor', 30, '0 bytes in - 0 bytes out'),
('nn::am::service::IApplicationAccessor', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::IApplicationAccessor', 1, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::IApplicationAccessor', 10, '0 bytes in - 0 bytes out'),
('nn::am::service::IApplicationAccessor', 20, '0 bytes in - 0 bytes out'),
('nn::am::service::IApplicationAccessor', 25, '0 bytes in - 0 bytes out'),
('nn::am::service::IApplicationAccessor', 30, '0 bytes in - 0 bytes out'),
('nn::am::service::IApplicationAccessor', 101, '0 bytes in - 0 bytes out'),
('nn::am::service::IApplicationAccessor', 110, '0 bytes in - 0 bytes out'),
('nn::am::service::IApplicationAccessor', 111, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::IApplicationAccessor', 112, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IApplicationAccessor', 120, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::am::service::IApplicationAccessor', 121, '4 bytes in - 0 bytes out - InRaw<4,4,0>, InObject<0,0>'),
('nn::am::service::IApplicationAccessor', 122, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::am::service::IApplicationAccessor', 123, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::am::service::IApplicationCreator', 0, '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,0>'),
('nn::am::service::IApplicationCreator', 1, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IApplicationCreator', 10, '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,0>'),
('nn::am::service::IApplicationCreator', 100, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IApplicationFunctions', 1, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::am::service::IApplicationFunctions', 10, '8 bytes in - 0 bytes out - InRaw<8,8,0>, InObject<0,0>'),
('nn::am::service::IApplicationFunctions', 11, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InObject<0,0>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::am::service::IApplicationFunctions', 20, '0x10 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<0x10,8,0>'),
('nn::am::service::IApplicationFunctions', 21, '0 bytes in - 8 bytes out - OutRaw<8,1,0>'),
('nn::am::service::IApplicationFunctions', 22, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::am::service::IApplicationFunctions', 23, '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>'),
('nn::am::service::IApplicationFunctions', 24, '0 bytes in - 2 bytes out - OutRaw<1,1,0>, OutRaw<1,1,1>'),
('nn::am::service::IApplicationFunctions', 25, '0x28 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<1,1,0>, InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<8,8,0x20>'),
('nn::am::service::IApplicationFunctions', 26, '0x18 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>, InRaw<1,1,0>, InRaw<0x10,8,8>'),
('nn::am::service::IApplicationFunctions', 30, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::am::service::IApplicationFunctions', 31, '0 bytes in - 0 bytes out'),
('nn::am::service::IApplicationFunctions', 32, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::am::service::IApplicationFunctions', 33, '0 bytes in - 0 bytes out'),
('nn::am::service::IApplicationFunctions', 40, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::IApplicationFunctions', 50, '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>'),
('nn::am::service::IApplicationFunctions', 60, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::am::service::IApplicationFunctions', 65, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::IApplicationFunctions', 66, '8 bytes in - 0 bytes out - InHandle<0,1>, InRaw<8,8,0>'),
('nn::am::service::IApplicationFunctions', 67, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::am::service::IApplicationFunctions', 70, '0 bytes in - 0 bytes out'),
('nn::am::service::IApplicationFunctions', 71, '0 bytes in - 0 bytes out'),
('nn::am::service::IApplicationProxy', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IApplicationProxy', 1, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IApplicationProxy', 2, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IApplicationProxy', 3, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IApplicationProxy', 4, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IApplicationProxy', 10, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IApplicationProxy', 11, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IApplicationProxy', 20, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IApplicationProxy', 1000, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IApplicationProxyService', 0, '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>, InHandle<0,1>'),
('nn::am::service::IAudioController', 0, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::am::service::IAudioController', 1, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::am::service::IAudioController', 2, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::am::service::IAudioController', 3, '0x10 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<8,8,8>'),
('nn::am::service::IAudioController', 4, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::am::service::ICommonStateGetter', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::ICommonStateGetter', 1, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::am::service::ICommonStateGetter', 2, '0 bytes in - 8 bytes out - OutRaw<8,4,0>'),
('nn::am::service::ICommonStateGetter', 3, '0 bytes in - 0 bytes out'),
('nn::am::service::ICommonStateGetter', 4, '0 bytes in - 0 bytes out'),
('nn::am::service::ICommonStateGetter', 5, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::ICommonStateGetter', 6, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::am::service::ICommonStateGetter', 7, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::ICommonStateGetter', 8, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::ICommonStateGetter', 9, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::ICommonStateGetter', 10, '0 bytes in - 0 bytes out'),
('nn::am::service::ICommonStateGetter', 11, '0 bytes in - 0 bytes out'),
('nn::am::service::ICommonStateGetter', 12, '0 bytes in - 0 bytes out'),
('nn::am::service::ICommonStateGetter', 13, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::ICommonStateGetter', 20, '0 bytes in - 0 bytes out - InObject<0,0>'),
('nn::am::service::ICommonStateGetter', 30, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ICommonStateGetter', 31, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::am::service::ICommonStateGetter', 40, '0 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, OutRaw<4,4,8>, OutRaw<4,4,0xC>'),
('nn::am::service::ICommonStateGetter', 50, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::ICommonStateGetter', 51, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::am::service::ICommonStateGetter', 55, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::ICommonStateGetter', 60, '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>'),
('nn::am::service::ICommonStateGetter', 61, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::IDebugFunctions', 0, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::am::service::IDebugFunctions', 1, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IDebugFunctions', 10, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::am::service::IDebugFunctions', 20, '0 bytes in - 0 bytes out'),
('nn::am::service::IDisplayController', 0, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::am::service::IDisplayController', 1, '0 bytes in - 0 bytes out'),
('nn::am::service::IDisplayController', 2, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::am::service::IDisplayController', 3, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::am::service::IDisplayController', 4, '0 bytes in - 0 bytes out'),
('nn::am::service::IDisplayController', 5, '0 bytes in - 1 bytes out - OutRaw<1,1,0>, Buffer<0,6,0>'),
('nn::am::service::IDisplayController', 6, '0 bytes in - 1 bytes out - OutRaw<1,1,0>, Buffer<0,6,0>'),
('nn::am::service::IDisplayController', 7, '0 bytes in - 1 bytes out - OutRaw<1,1,0>, Buffer<0,6,0>'),
('nn::am::service::IDisplayController', 8, '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>'),
('nn::am::service::IDisplayController', 10, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::IDisplayController', 11, '0 bytes in - 0 bytes out'),
('nn::am::service::IDisplayController', 12, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::IDisplayController', 13, '0 bytes in - 0 bytes out'),
('nn::am::service::IDisplayController', 14, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::IDisplayController', 15, '0 bytes in - 0 bytes out'),
('nn::am::service::IDisplayController', 16, '0 bytes in - 1 bytes out - OutRaw<1,1,0>, OutHandle<0,1>'),
('nn::am::service::IDisplayController', 17, '0 bytes in - 1 bytes out - OutRaw<1,1,0>, OutHandle<0,1>'),
('nn::am::service::IDisplayController', 18, '0 bytes in - 1 bytes out - OutRaw<1,1,0>, OutHandle<0,1>'),
('nn::am::service::IDisplayController', 20, '0xC bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>, InRaw<4,4,8>'),
('nn::am::service::IDisplayController', 21, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::am::service::IGlobalStateController', 0, '0 bytes in - 0 bytes out'),
('nn::am::service::IGlobalStateController', 1, '0 bytes in - 0 bytes out'),
('nn::am::service::IGlobalStateController', 2, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::am::service::IGlobalStateController', 3, '0 bytes in - 0 bytes out'),
('nn::am::service::IGlobalStateController', 4, '0 bytes in - 0 bytes out'),
('nn::am::service::IGlobalStateController', 10, '0 bytes in - 0 bytes out'),
('nn::am::service::IGlobalStateController', 11, '0 bytes in - 0 bytes out'),
('nn::am::service::IGlobalStateController', 12, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::am::service::IGlobalStateController', 13, '0 bytes in - 0 bytes out'),
('nn::am::service::IGlobalStateController', 14, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::IHomeMenuFunctions', 10, '0 bytes in - 0 bytes out'),
('nn::am::service::IHomeMenuFunctions', 11, '0 bytes in - 0 bytes out'),
('nn::am::service::IHomeMenuFunctions', 12, '0 bytes in - 0 bytes out'),
('nn::am::service::IHomeMenuFunctions', 20, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IHomeMenuFunctions', 21, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::IHomeMenuFunctions', 30, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IHomeMenuFunctions', 31, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::am::service::ILibraryAppletAccessor', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::ILibraryAppletAccessor', 1, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::ILibraryAppletAccessor', 10, '0 bytes in - 0 bytes out'),
('nn::am::service::ILibraryAppletAccessor', 20, '0 bytes in - 0 bytes out'),
('nn::am::service::ILibraryAppletAccessor', 25, '0 bytes in - 0 bytes out'),
('nn::am::service::ILibraryAppletAccessor', 30, '0 bytes in - 0 bytes out'),
('nn::am::service::ILibraryAppletAccessor', 50, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::am::service::ILibraryAppletAccessor', 100, '0 bytes in - 0 bytes out - InObject<0,0>'),
('nn::am::service::ILibraryAppletAccessor', 101, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ILibraryAppletAccessor', 102, '0 bytes in - 0 bytes out - InObject<0,0>'),
('nn::am::service::ILibraryAppletAccessor', 103, '0 bytes in - 0 bytes out - InObject<0,0>'),
('nn::am::service::ILibraryAppletAccessor', 104, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ILibraryAppletAccessor', 105, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::ILibraryAppletAccessor', 106, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::ILibraryAppletAccessor', 110, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::ILibraryAppletAccessor', 120, '0 bytes in - 8 bytes out - OutRaw<8,4,0>'),
('nn::am::service::ILibraryAppletAccessor', 150, '0 bytes in - 0 bytes out'),
('nn::am::service::ILibraryAppletAccessor', 160, '8 bytes in - 8 bytes out - takes pid - OutRaw<8,8,0>, InRaw<8,8,0>'),
('nn::am::service::ILibraryAppletCreator', 0, '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::am::service::ILibraryAppletCreator', 1, '0 bytes in - 0 bytes out'),
('nn::am::service::ILibraryAppletCreator', 2, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::ILibraryAppletCreator', 10, '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,0>'),
('nn::am::service::ILibraryAppletCreator', 11, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InHandle<0,1>, InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::am::service::ILibraryAppletCreator', 12, '8 bytes in - 0 bytes out - OutObject<0,0>, InHandle<0,1>, InRaw<8,8,0>'),
('nn::am::service::ILibraryAppletProxy', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ILibraryAppletProxy', 1, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ILibraryAppletProxy', 2, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ILibraryAppletProxy', 3, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ILibraryAppletProxy', 4, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ILibraryAppletProxy', 10, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ILibraryAppletProxy', 11, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ILibraryAppletProxy', 20, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ILibraryAppletProxy', 1000, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ILibraryAppletSelfAccessor', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ILibraryAppletSelfAccessor', 1, '0 bytes in - 0 bytes out - InObject<0,0>'),
('nn::am::service::ILibraryAppletSelfAccessor', 2, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ILibraryAppletSelfAccessor', 3, '0 bytes in - 0 bytes out - InObject<0,0>'),
('nn::am::service::ILibraryAppletSelfAccessor', 5, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::ILibraryAppletSelfAccessor', 6, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::ILibraryAppletSelfAccessor', 10, '0 bytes in - 0 bytes out'),
('nn::am::service::ILibraryAppletSelfAccessor', 11, '0 bytes in - 8 bytes out - OutRaw<8,4,0>'),
('nn::am::service::ILibraryAppletSelfAccessor', 12, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::am::service::ILibraryAppletSelfAccessor', 13, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::ILibraryAppletSelfAccessor', 14, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::am::service::ILibraryAppletSelfAccessor', 15, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x4000>'),
('nn::am::service::ILibraryAppletSelfAccessor', 16, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::ILibraryAppletSelfAccessor', 17, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::am::service::ILibraryAppletSelfAccessor', 20, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ILibraryAppletSelfAccessor', 25, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::ILibraryAppletSelfAccessor', 30, '0 bytes in - 0 bytes out - InObject<0,0>'),
('nn::am::service::ILibraryAppletSelfAccessor', 31, '0 bytes in - 0 bytes out - InObject<0,0>'),
('nn::am::service::ILibraryAppletSelfAccessor', 40, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::am::service::ILibraryAppletSelfAccessor', 50, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::am::service::ILockAccessor', 1, '1 bytes in - 1 bytes out - OutRaw<1,1,0>, OutHandle<0,1>, InRaw<1,1,0>'),
('nn::am::service::ILockAccessor', 2, '0 bytes in - 0 bytes out'),
('nn::am::service::ILockAccessor', 3, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::IOverlayAppletProxy', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IOverlayAppletProxy', 1, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IOverlayAppletProxy', 2, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IOverlayAppletProxy', 3, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IOverlayAppletProxy', 4, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IOverlayAppletProxy', 10, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IOverlayAppletProxy', 11, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IOverlayAppletProxy', 20, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IOverlayAppletProxy', 1000, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IOverlayFunctions', 0, '0 bytes in - 0 bytes out'),
('nn::am::service::IOverlayFunctions', 1, '0 bytes in - 0 bytes out'),
('nn::am::service::IOverlayFunctions', 2, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::am::service::IOverlayFunctions', 3, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::am::service::IOverlayFunctions', 4, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::am::service::IOverlayFunctions', 5, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::am::service::IOverlayFunctions', 6, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::am::service::IProcessWindingController', 0, '0 bytes in - 4 bytes out - OutRaw<4,1,0>'),
('nn::am::service::IProcessWindingController', 11, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IProcessWindingController', 21, '0 bytes in - 0 bytes out - InObject<0,0>'),
('nn::am::service::IProcessWindingController', 22, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::IProcessWindingController', 23, '0 bytes in - 0 bytes out'),
('nn::am::service::IProcessWindingController', 30, '0 bytes in - 0 bytes out'),
('nn::am::service::IProcessWindingController', 40, '0 bytes in - 0 bytes out - InObject<0,0>'),
('nn::am::service::ISelfController', 0, '0 bytes in - 0 bytes out'),
('nn::am::service::ISelfController', 1, '0 bytes in - 0 bytes out'),
('nn::am::service::ISelfController', 2, '0 bytes in - 0 bytes out'),
('nn::am::service::ISelfController', 3, '0 bytes in - 0 bytes out'),
('nn::am::service::ISelfController', 4, '0 bytes in - 0 bytes out'),
('nn::am::service::ISelfController', 9, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::am::service::ISelfController', 10, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::am::service::ISelfController', 11, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::am::service::ISelfController', 12, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::am::service::ISelfController', 13, '3 bytes in - 0 bytes out - InRaw<1,1,0>, InRaw<1,1,1>, InRaw<1,1,2>'),
('nn::am::service::ISelfController', 14, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::am::service::ISelfController', 15, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::am::service::ISelfController', 16, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::am::service::ISelfController', 17, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::am::service::ISelfController', 18, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::am::service::ISelfController', 19, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::am::service::ISelfController', 40, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::am::service::ISelfController', 50, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::am::service::ISelfController', 51, '0 bytes in - 0 bytes out'),
('nn::am::service::ISelfController', 60, '0x10 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>, InRaw<4,4,0xC>'),
('nn::am::service::ISelfController', 61, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::am::service::ISelfController', 62, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::am::service::ISelfController', 63, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::am::service::ISelfController', 64, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::am::service::ISelfController', 65, '0 bytes in - 0 bytes out'),
('nn::am::service::ISelfController', 66, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::am::service::ISelfController', 67, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::am::service::IStorageAccessor', 0, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::am::service::IStorageAccessor', 10, '8 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,0x21,0>'),
('nn::am::service::IStorageAccessor', 11, '8 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,0x22,0>'),
('nn::am::service::ISystemAppletProxy', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ISystemAppletProxy', 1, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ISystemAppletProxy', 2, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ISystemAppletProxy', 3, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ISystemAppletProxy', 4, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ISystemAppletProxy', 10, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ISystemAppletProxy', 11, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ISystemAppletProxy', 20, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ISystemAppletProxy', 21, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ISystemAppletProxy', 22, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ISystemAppletProxy', 1000, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::am::service::ITransferStorageAccessor', 0, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::am::service::ITransferStorageAccessor', 1, '0 bytes in - 8 bytes out - OutHandle<0,1>, OutRaw<8,8,0>'),
('nn::am::service::IWindowController', 0, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::am::service::IWindowController', 1, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::am::service::IWindowController', 10, '0 bytes in - 0 bytes out'),
('nn::am::service::IWindowController', 11, '0 bytes in - 0 bytes out'),
('nn::am::service::IWindowController', 12, '0 bytes in - 0 bytes out'),
('nn::aocsrv::detail::IAddOnContentManager', 0, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>'),
('nn::aocsrv::detail::IAddOnContentManager', 1, '0x10 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<8,8,8>'),
('nn::aocsrv::detail::IAddOnContentManager', 2, '8 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, InRaw<8,8,0>'),
('nn::aocsrv::detail::IAddOnContentManager', 3, '0x10 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::aocsrv::detail::IAddOnContentManager', 4, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>'),
('nn::aocsrv::detail::IAddOnContentManager', 5, '8 bytes in - 8 bytes out - takes pid - OutRaw<8,8,0>, InRaw<8,8,0>'),
('nn::aocsrv::detail::IAddOnContentManager', 6, '0x10 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<8,8,8>'),
('nn::aocsrv::detail::IAddOnContentManager', 7, '0x10 bytes in - 0 bytes out - takes pid - InRaw<4,4,0>, InRaw<8,8,8>'),
('nn::apm::IManager', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::apm::IManager', 1, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::apm::IManagerPrivileged', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::apm::ISession', 0, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::apm::ISession', 1, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::apm::ISystemManager', 0, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::apm::ISystemManager', 1, '4 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<4,4,0>'),
('nn::apm::ISystemManager', 2, '0 bytes in - 0x28 bytes out - OutRaw<0x28,8,0>'),
('nn::apm::ISystemManager', 3, '0 bytes in - 0x28 bytes out - OutRaw<0x28,8,0>'),
('nn::apm::ISystemManager', 4, '0 bytes in - 0 bytes out'),
('nn::arp::detail::IReader', 0, ''),
('nn::arp::detail::IReader', 1, ''),
('nn::arp::detail::IReader', 2, ''),
('nn::arp::detail::IReader', 3, ''),
('nn::arp::detail::IRegistrar', 0, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::arp::detail::IRegistrar', 1, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::arp::detail::IRegistrar', 2, ''),
('nn::arp::detail::IWriter', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::arp::detail::IWriter', 1, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::audio::detail::IAudioDebugManager', 0, '0x10 bytes in - 0 bytes out - InHandle<0,1>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::audio::detail::IAudioDebugManager', 1, '0 bytes in - 0 bytes out'),
('nn::audio::detail::IAudioDebugManager', 2, '0 bytes in - 0 bytes out'),
('nn::audio::detail::IAudioDebugManager', 3, '0 bytes in - 0 bytes out'),
('nn::audio::detail::IAudioDevice', 0, '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>'),
('nn::audio::detail::IAudioDevice', 1, '4 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<4,4,0>'),
('nn::audio::detail::IAudioDevice', 2, '0 bytes in - 4 bytes out - Buffer<0,5,0>, OutRaw<4,4,0>'),
('nn::audio::detail::IAudioDevice', 3, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::audio::detail::IAudioDevice', 4, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::audio::detail::IAudioDevice', 5, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::audio::detail::IAudioDevice', 6, '0 bytes in - 4 bytes out - Buffer<0,0x22,0>, OutRaw<4,4,0>'),
('nn::audio::detail::IAudioDevice', 7, '4 bytes in - 0 bytes out - Buffer<0,0x21,0>, InRaw<4,4,0>'),
('nn::audio::detail::IAudioDevice', 8, '0 bytes in - 4 bytes out - Buffer<0,0x21,0>, OutRaw<4,4,0>'),
('nn::audio::detail::IAudioDevice', 10, '0 bytes in - 0 bytes out - Buffer<0,0x22,0>'),
('nn::audio::detail::IAudioDevice', 11, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::audio::detail::IAudioDevice', 12, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::audio::detail::IAudioIn', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::audio::detail::IAudioIn', 1, '0 bytes in - 0 bytes out'),
('nn::audio::detail::IAudioIn', 2, '0 bytes in - 0 bytes out'),
('nn::audio::detail::IAudioIn', 3, '8 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<8,8,0>'),
('nn::audio::detail::IAudioIn', 4, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::audio::detail::IAudioIn', 5, '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>'),
('nn::audio::detail::IAudioIn', 6, '8 bytes in - 1 bytes out - InRaw<8,8,0>, OutRaw<1,1,0>'),
('nn::audio::detail::IAudioIn', 7, '8 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<8,8,0>, InHandle<0,1>'),
('nn::audio::detail::IAudioIn', 8, '8 bytes in - 0 bytes out - Buffer<0,0x21,0>, InRaw<8,8,0>'),
('nn::audio::detail::IAudioIn', 9, '0 bytes in - 4 bytes out - Buffer<0,0x22,0>, OutRaw<4,4,0>'),
('nn::audio::detail::IAudioIn', 10, '8 bytes in - 0 bytes out - Buffer<0,0x21,0>, InRaw<8,8,0>, InHandle<0,1>'),
('nn::audio::detail::IAudioInManager', 0, '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>'),
('nn::audio::detail::IAudioInManager', 1, '0x10 bytes in - 0x10 bytes out - takes pid - OutObject<0,0>, Buffer<0,5,0>, InRaw<8,4,0>, InHandle<0,1>, OutRaw<0x10,4,0>, Buffer<1,6,0>, InRaw<8,8,8>'),
('nn::audio::detail::IAudioInManager', 2, '0 bytes in - 4 bytes out - Buffer<0,0x22,0>, OutRaw<4,4,0>'),
('nn::audio::detail::IAudioInManager', 3, '0x10 bytes in - 0x10 bytes out - takes pid - OutObject<0,0>, Buffer<0,0x21,0>, InRaw<8,4,0>, InHandle<0,1>, OutRaw<0x10,4,0>, Buffer<1,0x22,0>, InRaw<8,8,8>'),
('nn::audio::detail::IAudioInManager', 4, '0 bytes in - 4 bytes out - Buffer<0,0x22,0>, OutRaw<4,4,0>'),
('nn::audio::detail::IAudioInManagerForApplet', 0, '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::audio::detail::IAudioInManagerForApplet', 1, '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::audio::detail::IAudioInManagerForApplet', 2, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>'),
('nn::audio::detail::IAudioInManagerForApplet', 3, '0x18 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<8,8,0x10>'),
('nn::audio::detail::IAudioInManagerForDebugger', 0, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::audio::detail::IAudioInManagerForDebugger', 1, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::audio::detail::IAudioOut', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::audio::detail::IAudioOut', 1, '0 bytes in - 0 bytes out'),
('nn::audio::detail::IAudioOut', 2, '0 bytes in - 0 bytes out'),
('nn::audio::detail::IAudioOut', 3, '8 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<8,8,0>'),
('nn::audio::detail::IAudioOut', 4, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::audio::detail::IAudioOut', 5, '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>'),
('nn::audio::detail::IAudioOut', 6, '8 bytes in - 1 bytes out - InRaw<8,8,0>, OutRaw<1,1,0>'),
('nn::audio::detail::IAudioOut', 7, '8 bytes in - 0 bytes out - Buffer<0,0x21,0>, InRaw<8,8,0>'),
('nn::audio::detail::IAudioOut', 8, '0 bytes in - 4 bytes out - Buffer<0,0x22,0>, OutRaw<4,4,0>'),
('nn::audio::detail::IAudioOutManager', 0, '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>'),
('nn::audio::detail::IAudioOutManager', 1, '0x10 bytes in - 0x10 bytes out - takes pid - OutObject<0,0>, Buffer<0,5,0>, InRaw<8,4,0>, InHandle<0,1>, OutRaw<0x10,4,0>, Buffer<1,6,0>, InRaw<8,8,8>'),
('nn::audio::detail::IAudioOutManager', 2, '0 bytes in - 4 bytes out - Buffer<0,0x22,0>, OutRaw<4,4,0>'),
('nn::audio::detail::IAudioOutManager', 3, '0x10 bytes in - 0x10 bytes out - takes pid - OutObject<0,0>, Buffer<0,0x21,0>, InRaw<8,4,0>, InHandle<0,1>, OutRaw<0x10,4,0>, Buffer<1,0x22,0>, InRaw<8,8,8>'),
('nn::audio::detail::IAudioOutManagerForApplet', 0, '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::audio::detail::IAudioOutManagerForApplet', 1, '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::audio::detail::IAudioOutManagerForApplet', 2, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>'),
('nn::audio::detail::IAudioOutManagerForApplet', 3, '0x18 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<8,8,0x10>'),
('nn::audio::detail::IAudioOutManagerForDebugger', 0, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::audio::detail::IAudioOutManagerForDebugger', 1, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::audio::detail::IAudioRenderer', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::audio::detail::IAudioRenderer', 1, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::audio::detail::IAudioRenderer', 2, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::audio::detail::IAudioRenderer', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::audio::detail::IAudioRenderer', 4, '0 bytes in - 0 bytes out - Buffer<0,6,0>, Buffer<1,6,0>, Buffer<2,5,0>'),
('nn::audio::detail::IAudioRenderer', 5, '0 bytes in - 0 bytes out'),
('nn::audio::detail::IAudioRenderer', 6, '0 bytes in - 0 bytes out'),
('nn::audio::detail::IAudioRenderer', 7, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::audio::detail::IAudioRenderer', 8, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::audio::detail::IAudioRenderer', 9, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::audio::detail::IAudioRenderer', 10, '0 bytes in - 0 bytes out - Buffer<0,0x22,0>, Buffer<1,0x22,0>, Buffer<2,0x21,0>'),
('nn::audio::detail::IAudioRenderer', 11, '0 bytes in - 0 bytes out'),
('nn::audio::detail::IAudioRendererManager', 0, '0x48 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<0x34,4,0>, InHandle<0,1>, InHandle<1,1>, InRaw<8,8,0x38>, InRaw<8,8,0x40>'),
('nn::audio::detail::IAudioRendererManager', 1, '0x34 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<0x34,4,0>'),
('nn::audio::detail::IAudioRendererManager', 2, '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,0>'),
('nn::audio::detail::IAudioRendererManager', 3, '0x50 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<0x34,4,0>, InRaw<8,8,0x38>, InHandle<0,1>, InRaw<8,8,0x40>, InRaw<8,8,0x48>'),
('nn::audio::detail::IAudioRendererManagerForApplet', 0, '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::audio::detail::IAudioRendererManagerForApplet', 1, '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::audio::detail::IAudioRendererManagerForApplet', 2, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>'),
('nn::audio::detail::IAudioRendererManagerForApplet', 3, '0x18 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<8,8,0x10>'),
('nn::audio::detail::IAudioRendererManagerForApplet', 4, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::audio::detail::IAudioRendererManagerForApplet', 5, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::audio::detail::IAudioRendererManagerForDebugger', 0, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::audio::detail::IAudioRendererManagerForDebugger', 1, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::audio::detail::IFinalOutputRecorder', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::audio::detail::IFinalOutputRecorder', 1, '0 bytes in - 0 bytes out'),
('nn::audio::detail::IFinalOutputRecorder', 2, '0 bytes in - 0 bytes out'),
('nn::audio::detail::IFinalOutputRecorder', 3, '8 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<8,8,0>'),
('nn::audio::detail::IFinalOutputRecorder', 4, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::audio::detail::IFinalOutputRecorder', 5, '0 bytes in - 0x10 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, OutRaw<8,8,8>'),
('nn::audio::detail::IFinalOutputRecorder', 6, '8 bytes in - 1 bytes out - InRaw<8,8,0>, OutRaw<1,1,0>'),
('nn::audio::detail::IFinalOutputRecorder', 7, '8 bytes in - 8 bytes out - InRaw<8,8,0>, OutRaw<8,8,0>'),
('nn::audio::detail::IFinalOutputRecorder', 8, '8 bytes in - 0 bytes out - Buffer<0,0x21,0>, InRaw<8,8,0>'),
('nn::audio::detail::IFinalOutputRecorder', 9, '0 bytes in - 0x10 bytes out - Buffer<0,0x22,0>, OutRaw<4,4,0>, OutRaw<8,8,8>'),
('nn::audio::detail::IFinalOutputRecorderManager', 0, '0x10 bytes in - 0x10 bytes out - OutObject<0,0>, InRaw<8,4,0>, InHandle<0,1>, OutRaw<0x10,4,0>, InRaw<8,8,8>'),
('nn::audio::detail::IFinalOutputRecorderManagerForApplet', 0, '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::audio::detail::IFinalOutputRecorderManagerForApplet', 1, '0x10 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::audio::detail::IFinalOutputRecorderManagerForDebugger', 0, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::audio::detail::IFinalOutputRecorderManagerForDebugger', 1, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::audioctrl::detail::IAudioController', 0, '4 bytes in - 4 bytes out - InRaw<4,4,0>, OutRaw<4,4,0>'),
('nn::audioctrl::detail::IAudioController', 1, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::audioctrl::detail::IAudioController', 2, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::audioctrl::detail::IAudioController', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::audioctrl::detail::IAudioController', 4, ''),
('nn::audioctrl::detail::IAudioController', 5, '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>'),
('nn::audioctrl::detail::IAudioController', 6, ''),
('nn::audioctrl::detail::IAudioController', 7, ''),
('nn::audioctrl::detail::IAudioController', 8, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::audioctrl::detail::IAudioController', 9, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::audioctrl::detail::IAudioController', 10, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::audioctrl::detail::IAudioController', 11, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::audioctrl::detail::IAudioController', 12, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::audioctrl::detail::IAudioController', 13, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::audioctrl::detail::IAudioController', 14, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::audioctrl::detail::IAudioController', 15, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::audioctrl::detail::IAudioController', 16, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::audioctrl::detail::IAudioController', 17, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::audioctrl::detail::IAudioController', 18, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::audioctrl::detail::IAudioController', 19, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::audioctrl::detail::IAudioController', 20, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::audioctrl::detail::IAudioController', 21, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::audioctrl::detail::IAudioController', 22, '0 bytes in - 0 bytes out'),
('nn::bcat::detail::ipc::IBcatService', 10100, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::bcat::detail::ipc::IBcatService', 20100, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::bcat::detail::ipc::IBcatService', 30100, '8 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,9,0>'),
('nn::bcat::detail::ipc::IBcatService', 30200, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::bcat::detail::ipc::IBcatService', 30201, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::bcat::detail::ipc::IBcatService', 30202, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::bcat::detail::ipc::IBcatService', 30203, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::bcat::detail::ipc::IBcatService', 90100, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::bcat::detail::ipc::IBcatService', 90200, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>, InRaw<8,8,0>'),
('nn::bcat::detail::ipc::IBcatService', 90201, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::bcat::detail::ipc::IBcatService', 90300, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::bcat::detail::ipc::IDeliveryCacheDirectoryService', 0, '0x20 bytes in - 0 bytes out - InRaw<0x20,1,0>'),
('nn::bcat::detail::ipc::IDeliveryCacheDirectoryService', 1, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::bcat::detail::ipc::IDeliveryCacheDirectoryService', 2, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::bcat::detail::ipc::IDeliveryCacheFileService', 0, '0x40 bytes in - 0 bytes out - InRaw<0x20,1,0>, InRaw<0x20,1,0x20>'),
('nn::bcat::detail::ipc::IDeliveryCacheFileService', 1, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>, Buffer<0,6,0>'),
('nn::bcat::detail::ipc::IDeliveryCacheFileService', 2, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::bcat::detail::ipc::IDeliveryCacheFileService', 3, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::bcat::detail::ipc::IDeliveryCacheProgressService', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::bcat::detail::ipc::IDeliveryCacheProgressService', 1, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x200>'),
('nn::bcat::detail::ipc::IDeliveryCacheStorageService', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::bcat::detail::ipc::IDeliveryCacheStorageService', 1, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::bcat::detail::ipc::IDeliveryCacheStorageService', 10, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::bcat::detail::ipc::IServiceCreator', 0, '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>'),
('nn::bcat::detail::ipc::IServiceCreator', 1, '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>'),
('nn::bcat::detail::ipc::IServiceCreator', 2, '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,0>'),
('nn::bgtc::IStateControlService', 1, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::bgtc::IStateControlService', 2, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::bgtc::IStateControlService', 3, '0 bytes in - 0 bytes out'),
('nn::bgtc::IStateControlService', 4, '0 bytes in - 0 bytes out'),
('nn::bgtc::IStateControlService', 5, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::bgtc::ITaskService', 1, '0 bytes in - 0 bytes out'),
('nn::bgtc::ITaskService', 2, '0 bytes in - 0 bytes out'),
('nn::bgtc::ITaskService', 3, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::bgtc::ITaskService', 4, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::bgtc::ITaskService', 5, ''),
('nn::bgtc::ITaskService', 6, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::bgtc::ITaskService', 11, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::bgtc::ITaskService', 12, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::bgtc::ITaskService', 13, '0 bytes in - 0 bytes out'),
('nn::bgtc::ITaskService', 14, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::bgtc::ITaskService', 15, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::bgtc::ITaskService', 101, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::bgtc::ITaskService', 102, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::bgtc::ITaskService', 103, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::bluetooth::IBluetoothDriver', 0, '0 bytes in - 0 bytes out'),
('nn::bluetooth::IBluetoothDriver', 1, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::bluetooth::IBluetoothDriver', 2, '0 bytes in - 0 bytes out'),
('nn::bluetooth::IBluetoothDriver', 3, '0 bytes in - 0 bytes out'),
('nn::bluetooth::IBluetoothDriver', 4, '0 bytes in - 0 bytes out'),
('nn::bluetooth::IBluetoothDriver', 5, ''),
('nn::bluetooth::IBluetoothDriver', 6, ''),
('nn::bluetooth::IBluetoothDriver', 7, ''),
('nn::bluetooth::IBluetoothDriver', 8, '0 bytes in - 0 bytes out'),
('nn::bluetooth::IBluetoothDriver', 9, '0 bytes in - 0 bytes out'),
('nn::bluetooth::IBluetoothDriver', 10, ''),
('nn::bluetooth::IBluetoothDriver', 11, '6 bytes in - 0 bytes out - InRaw<6,1,0>'),
('nn::bluetooth::IBluetoothDriver', 12, '6 bytes in - 0 bytes out - InRaw<6,1,0>'),
('nn::bluetooth::IBluetoothDriver', 13, ''),
('nn::bluetooth::IBluetoothDriver', 14, ''),
('nn::bluetooth::IBluetoothDriver', 15, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>'),
('nn::bluetooth::IBluetoothDriver', 16, ''),
('nn::bluetooth::IBluetoothDriver', 17, '6 bytes in - 0 bytes out - InRaw<6,1,0>'),
('nn::bluetooth::IBluetoothDriver', 18, '6 bytes in - 0 bytes out - InRaw<6,1,0>'),
('nn::bluetooth::IBluetoothDriver', 19, ''),
('nn::bluetooth::IBluetoothDriver', 20, ''),
('nn::bluetooth::IBluetoothDriver', 21, ''),
('nn::bluetooth::IBluetoothDriver', 22, ''),
('nn::bluetooth::IBluetoothDriver', 23, '6 bytes in - 0 bytes out - InRaw<6,1,0>'),
('nn::bluetooth::IBluetoothDriver', 24, ''),
('nn::bluetooth::IBluetoothDriver', 25, ''),
('nn::bluetooth::IBluetoothDriver', 26, '0 bytes in - 0 bytes out'),
('nn::bluetooth::IBluetoothDriver', 27, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>'),
('nn::bluetooth::IBluetoothDriver', 28, ''),
('nn::bluetooth::IBluetoothDriver', 29, ''),
('nn::bluetooth::IBluetoothDriver', 30, ''),
('nn::bluetooth::IBluetoothDriver', 31, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::bluetooth::IBluetoothDriver', 32, '0 bytes in - 0 bytes out'),
('nn::bluetooth::IBluetoothDriver', 33, '0 bytes in - 0 bytes out'),
('nn::bluetooth::IBluetoothDriver', 34, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::bluetooth::IBluetoothDriver', 35, ''),
('nn::bluetooth::IBluetoothDriver', 36, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::bluetooth::IBluetoothDriver', 37, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>'),
('nn::bluetooth::IBluetoothDriver', 38, ''),
('nn::bluetooth::IBluetoothDriver', 39, '0 bytes in - 0 bytes out'),
('nn::bluetooth::IBluetoothDriver', 40, ''),
('nn::bluetooth::IBluetoothDriver', 41, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::bluetooth::IBluetoothDriver', 42, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::bluetooth::IBluetoothDriver', 43, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::bluetooth::IBluetoothDriver', 44, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::bpc::IBoardPowerControlManager', 0, '0 bytes in - 0 bytes out'),
('nn::bpc::IBoardPowerControlManager', 1, '0 bytes in - 0 bytes out'),
('nn::bpc::IBoardPowerControlManager', 2, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::bpc::IBoardPowerControlManager', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::bpc::IBoardPowerControlManager', 4, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::bpc::IBoardPowerControlManager', 5, '4 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<4,4,0>'),
('nn::bpc::IBoardPowerControlManager', 6, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::bpc::IBoardPowerControlManager', 7, '4 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<4,4,0>'),
('nn::bpc::IBoardPowerControlManager', 8, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>'),
('nn::bpc::IBoardPowerControlManager', 9, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::bpc::IBoardPowerControlManager', 10, ''),
('nn::bpc::IBoardPowerControlManager', 11, ''),
('nn::bpc::IBoardPowerControlManager', 12, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::bpc::IBoardPowerControlManager', 13, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::bpc::IRtcManager', 0, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::bpc::IRtcManager', 1, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::bpc::IRtcManager', 2, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::bpc::IRtcManager', 3, '0 bytes in - 0 bytes out'),
('nn::bpc::IRtcManager', 4, '0 bytes in - 0 bytes out'),
('nn::bsdsocket::cfg::ServerInterface', 0, ''),
('nn::bsdsocket::cfg::ServerInterface', 1, ''),
('nn::bsdsocket::cfg::ServerInterface', 2, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::bsdsocket::cfg::ServerInterface', 3, '4 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<4,4,0>'),
('nn::bsdsocket::cfg::ServerInterface', 4, ''),
('nn::bsdsocket::cfg::ServerInterface', 5, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::bsdsocket::cfg::ServerInterface', 6, ''),
('nn::bsdsocket::cfg::ServerInterface', 7, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::bsdsocket::cfg::ServerInterface', 8, ''),
('nn::bsdsocket::cfg::ServerInterface', 9, ''),
('nn::bsdsocket::cfg::ServerInterface', 10, '0 bytes in - 0 bytes out'),
('nn::bsdsocket::cfg::ServerInterface', 11, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::bsdsocket::cfg::ServerInterface', 12, '0 bytes in - 0 bytes out'),
('nn::btm::IBtm', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::btm::IBtm', 1, ''),
('nn::btm::IBtm', 2, ''),
('nn::btm::IBtm', 3, ''),
('nn::btm::IBtm', 4, ''),
('nn::btm::IBtm', 5, ''),
('nn::btm::IBtm', 6, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::btm::IBtm', 7, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::btm::IBtm', 8, ''),
('nn::btm::IBtm', 9, ''),
('nn::btm::IBtm', 10, ''),
('nn::btm::IBtm', 11, '6 bytes in - 0 bytes out - InRaw<6,1,0>'),
('nn::btm::IBtm', 12, '6 bytes in - 0 bytes out - InRaw<6,1,0>'),
('nn::btm::IBtm', 13, '6 bytes in - 0 bytes out - InRaw<6,1,0>'),
('nn::btm::IBtm', 14, '0 bytes in - 0 bytes out'),
('nn::btm::IBtm', 15, '0 bytes in - 0 bytes out'),
('nn::btm::IBtm', 16, '6 bytes in - 0 bytes out - InRaw<6,1,0>'),
('nn::btm::IBtm', 17, ''),
('nn::btm::IBtm', 18, ''),
('nn::btm::IBtmSystem', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::btm::IBtmSystemCore', 0, '0 bytes in - 0 bytes out'),
('nn::btm::IBtmSystemCore', 1, '0 bytes in - 0 bytes out'),
('nn::btm::IBtmSystemCore', 2, '0 bytes in - 0 bytes out'),
('nn::btm::IBtmSystemCore', 3, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::btm::IBtmSystemCore', 4, '0 bytes in - 0 bytes out'),
('nn::btm::IBtmSystemCore', 5, '0 bytes in - 0 bytes out'),
('nn::btm::IBtmSystemCore', 6, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::btm::IBtmSystemCore', 7, ''),
('nn::btm::IBtmSystemCore', 8, ''),
('nn::btm::IBtmSystemCore', 9, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::capsrv::sf::IAlbumAccessorService', 0, ''),
('nn::capsrv::sf::IAlbumAccessorService', 1, ''),
('nn::capsrv::sf::IAlbumAccessorService', 2, ''),
('nn::capsrv::sf::IAlbumAccessorService', 3, ''),
('nn::capsrv::sf::IAlbumAccessorService', 4, ''),
('nn::capsrv::sf::IAlbumAccessorService', 5, ''),
('nn::capsrv::sf::IAlbumAccessorService', 6, ''),
('nn::capsrv::sf::IAlbumAccessorService', 7, ''),
('nn::capsrv::sf::IAlbumAccessorService', 8, ''),
('nn::capsrv::sf::IAlbumAccessorService', 9, ''),
('nn::capsrv::sf::IAlbumAccessorService', 10, ''),
('nn::capsrv::sf::IAlbumAccessorService', 11, ''),
('nn::capsrv::sf::IAlbumAccessorService', 12, ''),
('nn::capsrv::sf::IAlbumAccessorService', 13, ''),
('nn::capsrv::sf::IAlbumAccessorService', 14, ''),
('nn::capsrv::sf::IAlbumAccessorService', 301, ''),
('nn::capsrv::sf::IAlbumAccessorService', 401, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::capsrv::sf::IAlbumAccessorService', 501, ''),
('nn::capsrv::sf::IAlbumAccessorService', 1001, ''),
('nn::capsrv::sf::IAlbumAccessorService', 1002, ''),
('nn::capsrv::sf::IAlbumAccessorService', 8001, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::capsrv::sf::IAlbumAccessorService', 8002, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::capsrv::sf::IAlbumAccessorService', 8011, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::capsrv::sf::IAlbumAccessorService', 8012, ''),
('nn::capsrv::sf::IAlbumAccessorService', 8021, ''),
('nn::capsrv::sf::IAlbumAccessorService', 10011, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::capsrv::sf::IAlbumControlService', 2001, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::capsrv::sf::IAlbumControlService', 2002, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::capsrv::sf::IAlbumControlService', 2011, '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::capsrv::sf::IAlbumControlService', 2012, '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::capsrv::sf::IAlbumControlService', 2013, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>'),
('nn::capsrv::sf::IAlbumControlService', 2014, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::capsrv::sf::IAlbumControlService', 2101, ''),
('nn::capsrv::sf::IAlbumControlService', 2102, ''),
('nn::capsrv::sf::IAlbumControlService', 2201, ''),
('nn::capsrv::sf::IAlbumControlService', 2301, ''),
('nn::capsrv::sf::IScreenShotApplicationService', 201, '0x10 bytes in - 0x20 bytes out - takes pid - OutRaw<0x20,1,0>, Buffer<0,0x45,0>, InRaw<4,4,0>, InRaw<8,8,8>, InRaw<4,4,4>'),
('nn::capsrv::sf::IScreenShotApplicationService', 203, '0x50 bytes in - 0x20 bytes out - takes pid - OutRaw<0x20,1,0>, Buffer<0,0x45,0>, InRaw<0x40,4,0>, InRaw<8,8,0x48>, InRaw<4,4,0x40>'),
('nn::capsrv::sf::IScreenShotControlService', 1, ''),
('nn::capsrv::sf::IScreenShotControlService', 2, ''),
('nn::capsrv::sf::IScreenShotControlService', 1001, '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::capsrv::sf::IScreenShotControlService', 1002, '0x18 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>, InRaw<8,8,0x10>'),
('nn::capsrv::sf::IScreenShotControlService', 1003, ''),
('nn::capsrv::sf::IScreenShotControlService', 1011, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::capsrv::sf::IScreenShotControlService', 1012, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::capsrv::sf::IScreenShotControlService', 1201, ''),
('nn::capsrv::sf::IScreenShotControlService', 1202, '0 bytes in - 0 bytes out'),
('nn::capsrv::sf::IScreenShotControlService', 1203, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>, InRaw<8,8,0>'),
('nn::capsrv::sf::IScreenShotService', 201, ''),
('nn::capsrv::sf::IScreenShotService', 202, ''),
('nn::capsrv::sf::IScreenShotService', 203, ''),
('nn::capsrv::sf::IScreenShotService', 204, ''),
('nn::cec::ICecManager', 0, ''),
('nn::cec::ICecManager', 1, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::cec::ICecManager', 2, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::cec::ICecManager', 3, ''),
('nn::cec::ICecManager', 4, ''),
('nn::cec::ICecManager', 5, ''),
('nn::cec::ICecManager', 6, ''),
('nn::codec::detail::IHardwareOpusDecoder', 0, '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<0,6,0>, Buffer<1,5,0>'),
('nn::codec::detail::IHardwareOpusDecoder', 1, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::codec::detail::IHardwareOpusDecoder', 2, '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<0,6,0>, Buffer<1,5,0>'),
('nn::codec::detail::IHardwareOpusDecoder', 3, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::codec::detail::IHardwareOpusDecoderManager', 0, '0xC bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,4,0>, InHandle<0,1>, InRaw<4,4,8>'),
('nn::codec::detail::IHardwareOpusDecoderManager', 1, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>'),
('nn::codec::detail::IHardwareOpusDecoderManager', 2, '4 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x110>, InHandle<0,1>, InRaw<4,4,0>'),
('nn::codec::detail::IHardwareOpusDecoderManager', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0x19,0x110>'),
('nn::erpt::sf::IContext', 0, ''),
('nn::erpt::sf::IContext', 1, ''),
('nn::erpt::sf::IContext', 2, ''),
('nn::erpt::sf::IContext', 3, '0 bytes in - 0 bytes out'),
('nn::erpt::sf::IContext', 4, '0 bytes in - 0 bytes out'),
('nn::erpt::sf::IContext', 5, '0 bytes in - 0 bytes out'),
('nn::erpt::sf::IManager', 0, ''),
('nn::erpt::sf::IManager', 1, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::erpt::sf::IReport', 0, ''),
('nn::erpt::sf::IReport', 1, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::erpt::sf::IReport', 2, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::erpt::sf::IReport', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::erpt::sf::IReport', 4, '0 bytes in - 0 bytes out'),
('nn::erpt::sf::IReport', 5, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::erpt::sf::ISession', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::erpt::sf::ISession', 1, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::es::IETicketService', 1, ''),
('nn::es::IETicketService', 2, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::es::IETicketService', 3, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::es::IETicketService', 4, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::es::IETicketService', 5, '0 bytes in - 0 bytes out'),
('nn::es::IETicketService', 6, '0 bytes in - 0 bytes out'),
('nn::es::IETicketService', 7, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::es::IETicketService', 8, ''),
('nn::es::IETicketService', 9, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::es::IETicketService', 10, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::es::IETicketService', 11, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::es::IETicketService', 12, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::es::IETicketService', 13, ''),
('nn::es::IETicketService', 14, ''),
('nn::es::IETicketService', 15, ''),
('nn::es::IETicketService', 16, ''),
('nn::es::IETicketService', 17, ''),
('nn::es::IETicketService', 18, ''),
('nn::es::IETicketService', 19, ''),
('nn::es::IETicketService', 20, ''),
('nn::es::IETicketService', 21, ''),
('nn::eth::sf::IEthInterface', 0, ''),
('nn::eth::sf::IEthInterface', 1, '0 bytes in - 0 bytes out'),
('nn::eth::sf::IEthInterface', 2, '0 bytes in - 0 bytes out'),
('nn::eth::sf::IEthInterface', 3, ''),
('nn::eth::sf::IEthInterface', 4, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::eth::sf::IEthInterface', 5, ''),
('nn::eth::sf::IEthInterfaceGroup', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::eth::sf::IEthInterfaceGroup', 1, '0 bytes in - 0 bytes out'),
('nn::eth::sf::IEthInterfaceGroup', 2, '0 bytes in - 0 bytes out'),
('nn::eth::sf::IEthInterfaceGroup', 3, ''),
('nn::eth::sf::IEthInterfaceGroup', 4, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::eupld::sf::IControl', 0, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::eupld::sf::IControl', 1, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::eupld::sf::IControl', 2, ''),
('nn::eupld::sf::IControl', 3, ''),
('nn::eupld::sf::IRequest', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::eupld::sf::IRequest', 1, '0 bytes in - 0 bytes out'),
('nn::eupld::sf::IRequest', 2, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::eupld::sf::IRequest', 3, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::eupld::sf::IRequest', 4, '0 bytes in - 0 bytes out'),
('nn::eupld::sf::IRequest', 5, '0 bytes in - 0 bytes out'),
('nn::fan::detail::IController', 0, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::fan::detail::IController', 1, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::fan::detail::IController', 2, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::fan::detail::IController', 3, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::fan::detail::IController', 4, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::fan::detail::IController', 5, '0 bytes in - 0 bytes out'),
('nn::fan::detail::IController', 6, '0 bytes in - 0 bytes out'),
('nn::fan::detail::IController', 7, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::fan::detail::IManager', 0, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::fatalsrv::IPrivateService', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::fatalsrv::IService', 0, ''),
('nn::fatalsrv::IService', 1, ''),
('nn::fatalsrv::IService', 2, ''),
('nn::fgm::sf::IDebugger', 0, '8 bytes in - 0 bytes out - OutHandle<0,1>, InHandle<0,1>, InRaw<8,8,0>'),
('nn::fgm::sf::IDebugger', 1, '0 bytes in - 0xC bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, OutRaw<4,4,4>, OutRaw<4,4,8>'),
('nn::fgm::sf::IDebugger', 2, '0 bytes in - 0 bytes out'),
('nn::fgm::sf::IRequest', 0, '0x10 bytes in - 0 bytes out - takes pid - OutHandle<0,1>, InRaw<4,4,0>, InRaw<8,8,8>'),
('nn::fgm::sf::IRequest', 1, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::fgm::sf::IRequest', 2, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::fgm::sf::IRequest', 3, '0 bytes in - 0 bytes out'),
('nn::fgm::sf::ISession', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::friends::detail::ipc::IFriendService', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::friends::detail::ipc::IFriendService', 1, '0 bytes in - 0 bytes out'),
('nn::friends::detail::ipc::IFriendService', 10100, '0x30 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, Buffer<0,0xA,0>, InRaw<0x10,8,8>, InRaw<4,4,0>, InRaw<0x10,8,0x18>, InRaw<8,8,0x28>'),
('nn::friends::detail::ipc::IFriendService', 10101, '0x30 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,8>, InRaw<4,4,0>, InRaw<0x10,8,0x18>, InRaw<8,8,0x28>'),
('nn::friends::detail::ipc::IFriendService', 10102, '0x18 bytes in - 0 bytes out - takes pid - Buffer<0,6,0>, InRaw<0x10,8,0>, Buffer<1,9,0>, InRaw<8,8,0x10>'),
('nn::friends::detail::ipc::IFriendService', 10110, '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<0x10,8,0>, InRaw<8,8,0x10>, Buffer<0,6,0>'),
('nn::friends::detail::ipc::IFriendService', 10200, '0x20 bytes in - 0 bytes out - takes pid - InRaw<0x10,8,0>, InRaw<8,8,0x10>, Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>, InRaw<8,8,0x18>'),
('nn::friends::detail::ipc::IFriendService', 10211, '0x80 bytes in - 0 bytes out - takes pid - InRaw<0x10,8,0x68>, InRaw<0x40,1,0>, InRaw<0x21,1,0x40>, Buffer<2,5,0>, Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>, InRaw<8,8,0x78>'),
('nn::friends::detail::ipc::IFriendService', 10400, '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>, InRaw<0x10,8,8>, InRaw<4,4,0>'),
('nn::friends::detail::ipc::IFriendService', 10500, '0x10 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<0x10,8,0>, Buffer<1,9,0>'),
('nn::friends::detail::ipc::IFriendService', 10600, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 10601, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 10610, '0x18 bytes in - 0 bytes out - takes pid - InRaw<0x10,8,0>, Buffer<0,0x19,0xE0>, InRaw<8,8,0x10>'),
('nn::friends::detail::ipc::IFriendService', 10700, '0x18 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<0x10,8,8>, InRaw<1,1,0>'),
('nn::friends::detail::ipc::IFriendService', 10701, '0x10 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::friends::detail::ipc::IFriendService', 10702, '0x18 bytes in - 0 bytes out - takes pid - InRaw<0x10,8,0>, Buffer<0,0x19,0x40>, Buffer<1,0x19,0x48>, Buffer<2,0x19,0x48>, InRaw<8,8,0x10>'),
('nn::friends::detail::ipc::IFriendService', 11000, '0xA4 bytes in - 0xA0 bytes out - OutRaw<0xA0,1,0>, InRaw<0xA0,1,0>, InRaw<4,4,0xA0>'),
('nn::friends::detail::ipc::IFriendService', 20100, '0x28 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, InRaw<0x10,8,0>, InRaw<0x10,8,0x10>, InRaw<8,8,0x20>'),
('nn::friends::detail::ipc::IFriendService', 20101, '0x10 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 20102, '0x18 bytes in - 0 bytes out - Buffer<0,0x1A,0x800>, InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::friends::detail::ipc::IFriendService', 20103, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 20104, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 20110, '0x18 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::friends::detail::ipc::IFriendService', 20200, '0x10 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 20201, '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,8>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::friends::detail::ipc::IFriendService', 20300, '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,8>, InRaw<4,4,0>'),
('nn::friends::detail::ipc::IFriendService', 20301, '0x18 bytes in - 4 bytes out - Buffer<0,0x1A,0x38>, OutRaw<4,4,0>, Buffer<1,6,0>, InRaw<0x10,8,8>, InRaw<4,4,0>'),
('nn::friends::detail::ipc::IFriendService', 20400, '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,8>, InRaw<4,4,0>'),
('nn::friends::detail::ipc::IFriendService', 20401, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 20500, '0x10 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<0x10,8,0>, Buffer<1,9,0>'),
('nn::friends::detail::ipc::IFriendService', 20501, '0x18 bytes in - 8 bytes out - OutRaw<8,1,0>, InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::friends::detail::ipc::IFriendService', 20600, '0x10 bytes in - 0 bytes out - Buffer<0,0x1A,0xE0>, InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 20700, '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<0x10,8,8>, InRaw<4,4,0>'),
('nn::friends::detail::ipc::IFriendService', 20701, '0x10 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 20800, '0x10 bytes in - 0 bytes out - Buffer<0,0x1A,0x800>, InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 20801, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 20900, '0 bytes in - 0 bytes out'),
('nn::friends::detail::ipc::IFriendService', 21000, '0x18 bytes in - 0 bytes out - Buffer<0,0x1A,0x4B8>, InRaw<0x10,8,8>, InRaw<8,1,0>'),
('nn::friends::detail::ipc::IFriendService', 30100, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 30101, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::friends::detail::ipc::IFriendService', 30110, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::friends::detail::ipc::IFriendService', 30120, '0x20 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<1,1,0>'),
('nn::friends::detail::ipc::IFriendService', 30121, '0x20 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<1,1,0>'),
('nn::friends::detail::ipc::IFriendService', 30200, '0x20 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<4,4,0>'),
('nn::friends::detail::ipc::IFriendService', 30201, '0x30 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<4,4,0>, InRaw<0x10,8,0x20>, Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>'),
('nn::friends::detail::ipc::IFriendService', 30202, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::friends::detail::ipc::IFriendService', 30203, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::friends::detail::ipc::IFriendService', 30204, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::friends::detail::ipc::IFriendService', 30205, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::friends::detail::ipc::IFriendService', 30210, '0x10 bytes in - 0x40 bytes out - OutRaw<0x40,1,0>, InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 30211, '0x78 bytes in - 0 bytes out - InRaw<0x10,8,0x68>, InRaw<0x40,1,0>, InRaw<0x21,1,0x40>, Buffer<0,5,0>'),
('nn::friends::detail::ipc::IFriendService', 30212, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::friends::detail::ipc::IFriendService', 30213, '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<0x10,8,0>, InRaw<8,8,0x10>, Buffer<0,6,0>'),
('nn::friends::detail::ipc::IFriendService', 30214, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,9,0>, Buffer<1,6,0>'),
('nn::friends::detail::ipc::IFriendService', 30215, '0x30 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<4,4,0>, InRaw<0x10,8,0x20>, Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>'),
('nn::friends::detail::ipc::IFriendService', 30216, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::friends::detail::ipc::IFriendService', 30217, '0x80 bytes in - 0 bytes out - InRaw<0x10,8,0x68>, InRaw<8,8,0x78>, InRaw<4,4,0x60>, InRaw<0x20,1,0>, InRaw<0x10,1,0x20>, InRaw<0x20,1,0x30>, InRaw<0x10,1,0x50>'),
('nn::friends::detail::ipc::IFriendService', 30400, '0x20 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<4,4,0>'),
('nn::friends::detail::ipc::IFriendService', 30401, '0x30 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<8,8,0x18>, InRaw<4,4,0>, InRaw<0x10,8,0x20>, Buffer<0,0x19,0x48>'),
('nn::friends::detail::ipc::IFriendService', 30402, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<8,8,0x10>'),
('nn::friends::detail::ipc::IFriendService', 30500, '0x30 bytes in - 0 bytes out - Buffer<0,0x1A,0x400>, InRaw<0x10,8,0x20>, InRaw<0x20,1,0>'),
('nn::friends::detail::ipc::IFriendService', 30700, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 30810, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<4,4,0>'),
('nn::friends::detail::ipc::IFriendService', 30811, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<1,1,0>'),
('nn::friends::detail::ipc::IFriendService', 30812, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,8>, InRaw<4,4,0>'),
('nn::friends::detail::ipc::IFriendService', 30820, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 30830, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IFriendService', 49900, '0x10 bytes in - 0 bytes out - InRaw<0x10,8,0>'),
('nn::friends::detail::ipc::INotificationService', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::friends::detail::ipc::INotificationService', 1, '0 bytes in - 0 bytes out'),
('nn::friends::detail::ipc::INotificationService', 2, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::friends::detail::ipc::IServiceCreator', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::friends::detail::ipc::IServiceCreator', 1, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<0x10,8,0>'),
('nn::fssrv::sf::IDeviceOperator', 0, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::fssrv::sf::IDeviceOperator', 1, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::fssrv::sf::IDeviceOperator', 2, '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>'),
('nn::fssrv::sf::IDeviceOperator', 3, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::fssrv::sf::IDeviceOperator', 4, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::fssrv::sf::IDeviceOperator', 5, '8 bytes in - 0x18 bytes out - OutRaw<0x10,4,0>, OutRaw<8,8,0x10>, Buffer<0,6,0>, InRaw<8,8,0>'),
('nn::fssrv::sf::IDeviceOperator', 100, '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>'),
('nn::fssrv::sf::IDeviceOperator', 101, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::fssrv::sf::IDeviceOperator', 110, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::fssrv::sf::IDeviceOperator', 111, '4 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<4,4,0>'),
('nn::fssrv::sf::IDeviceOperator', 112, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::fssrv::sf::IDeviceOperator', 113, '8 bytes in - 0x18 bytes out - OutRaw<0x10,4,0>, OutRaw<8,8,0x10>, Buffer<0,6,0>, InRaw<8,8,0>'),
('nn::fssrv::sf::IDeviceOperator', 114, '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>'),
('nn::fssrv::sf::IDeviceOperator', 200, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::fssrv::sf::IDeviceOperator', 201, '0x10 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<8,8,8>'),
('nn::fssrv::sf::IDeviceOperator', 202, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::fssrv::sf::IDeviceOperator', 203, '4 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, InRaw<4,4,0>'),
('nn::fssrv::sf::IDeviceOperator', 204, '0 bytes in - 0 bytes out'),
('nn::fssrv::sf::IDeviceOperator', 205, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>'),
('nn::fssrv::sf::IDeviceOperator', 206, '0x10 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::fssrv::sf::IDeviceOperator', 207, '0x10 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>, Buffer<1,5,0>, InRaw<8,8,8>'),
('nn::fssrv::sf::IDeviceOperator', 208, '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>'),
('nn::fssrv::sf::IDeviceOperator', 209, '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,6,0>, InRaw<8,8,8>'),
('nn::fssrv::sf::IDeviceOperator', 210, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::fssrv::sf::IDeviceOperator', 211, '0x10 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::fssrv::sf::IDeviceOperator', 212, '0x10 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>, Buffer<1,5,0>, InRaw<8,8,8>'),
('nn::fssrv::sf::IDeviceOperator', 213, '8 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<8,8,0>'),
('nn::fssrv::sf::IDeviceOperator', 214, '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>'),
('nn::fssrv::sf::IDeviceOperator', 215, '0 bytes in - 0 bytes out'),
('nn::fssrv::sf::IDeviceOperator', 216, '0 bytes in - 0x10 bytes out - OutRaw<0x10,2,0>'),
('nn::fssrv::sf::IDeviceOperator', 217, '0 bytes in - 0x40 bytes out - OutRaw<0x40,4,0>'),
('nn::fssrv::sf::IDeviceOperator', 218, '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>'),
('nn::fssrv::sf::IDeviceOperator', 300, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::fssrv::sf::IDeviceOperator', 301, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::fssrv::sf::IDirectory', 0, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>'),
('nn::fssrv::sf::IDirectory', 1, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::fssrv::sf::IEventNotifier', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::fssrv::sf::IFile', 0, '0x18 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,0x46,0>, InRaw<8,8,0x10>, InRaw<4,4,0>'),
('nn::fssrv::sf::IFile', 1, '0x18 bytes in - 0 bytes out - InRaw<8,8,8>, Buffer<0,0x45,0>, InRaw<8,8,0x10>, InRaw<4,4,0>'),
('nn::fssrv::sf::IFile', 2, '0 bytes in - 0 bytes out'),
('nn::fssrv::sf::IFile', 3, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::fssrv::sf::IFile', 4, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::fssrv::sf::IFileSystem', 0, '0x10 bytes in - 0 bytes out - Buffer<0,0x19,0x301>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::fssrv::sf::IFileSystem', 1, '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>'),
('nn::fssrv::sf::IFileSystem', 2, '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>'),
('nn::fssrv::sf::IFileSystem', 3, '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>'),
('nn::fssrv::sf::IFileSystem', 4, '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>'),
('nn::fssrv::sf::IFileSystem', 5, '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>, Buffer<1,0x19,0x301>'),
('nn::fssrv::sf::IFileSystem', 6, '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>, Buffer<1,0x19,0x301>'),
('nn::fssrv::sf::IFileSystem', 7, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0x19,0x301>'),
('nn::fssrv::sf::IFileSystem', 8, '4 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x301>, InRaw<4,4,0>'),
('nn::fssrv::sf::IFileSystem', 9, '4 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x301>, InRaw<4,4,0>'),
('nn::fssrv::sf::IFileSystem', 10, '0 bytes in - 0 bytes out'),
('nn::fssrv::sf::IFileSystem', 11, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0x19,0x301>'),
('nn::fssrv::sf::IFileSystem', 12, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0x19,0x301>'),
('nn::fssrv::sf::IFileSystem', 13, '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>'),
('nn::fssrv::sf::IFileSystem', 14, '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>, Buffer<0,0x19,0x301>'),
('nn::fssrv::sf::IFileSystemProxy', 1, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::fssrv::sf::IFileSystemProxy', 2, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::fssrv::sf::IFileSystemProxy', 7, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::fssrv::sf::IFileSystemProxy', 8, '0x10 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x301>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::fssrv::sf::IFileSystemProxy', 9, '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,0>'),
('nn::fssrv::sf::IFileSystemProxy', 11, '4 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x301>, InRaw<4,4,0>'),
('nn::fssrv::sf::IFileSystemProxy', 12, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::fssrv::sf::IFileSystemProxy', 13, '0 bytes in - 0 bytes out'),
('nn::fssrv::sf::IFileSystemProxy', 17, '0 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x301>'),
('nn::fssrv::sf::IFileSystemProxy', 18, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::fssrv::sf::IFileSystemProxy', 19, '0 bytes in - 0 bytes out'),
('nn::fssrv::sf::IFileSystemProxy', 21, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::fssrv::sf::IFileSystemProxy', 22, '0x90 bytes in - 0 bytes out - InRaw<0x40,8,0>, InRaw<0x40,8,0x40>, InRaw<0x10,4,0x80>'),
('nn::fssrv::sf::IFileSystemProxy', 23, '0x80 bytes in - 0 bytes out - InRaw<0x40,8,0>, InRaw<0x40,8,0x40>'),
('nn::fssrv::sf::IFileSystemProxy', 24, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::fssrv::sf::IFileSystemProxy', 25, '0x10 bytes in - 0 bytes out - InRaw<1,1,0>, InRaw<8,8,8>'),
('nn::fssrv::sf::IFileSystemProxy', 26, '0 bytes in - 0 bytes out'),
('nn::fssrv::sf::IFileSystemProxy', 27, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::fssrv::sf::IFileSystemProxy', 30, '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::fssrv::sf::IFileSystemProxy', 31, '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::fssrv::sf::IFileSystemProxy', 32, '0x20 bytes in - 0 bytes out - InRaw<1,1,0>, InRaw<8,8,8>, InRaw<8,8,0x10>, InRaw<8,8,0x18>'),
('nn::fssrv::sf::IFileSystemProxy', 51, '0x48 bytes in - 0 bytes out - OutObject<0,0>, InRaw<1,1,0>, InRaw<0x40,8,8>'),
('nn::fssrv::sf::IFileSystemProxy', 52, '0x48 bytes in - 0 bytes out - OutObject<0,0>, InRaw<1,1,0>, InRaw<0x40,8,8>'),
('nn::fssrv::sf::IFileSystemProxy', 53, '0x48 bytes in - 0 bytes out - OutObject<0,0>, InRaw<1,1,0>, InRaw<0x40,8,8>'),
('nn::fssrv::sf::IFileSystemProxy', 57, '0x10 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<1,1,0>, InRaw<8,8,8>'),
('nn::fssrv::sf::IFileSystemProxy', 58, '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,8,0>'),
('nn::fssrv::sf::IFileSystemProxy', 59, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>, Buffer<0,5,0>'),
('nn::fssrv::sf::IFileSystemProxy', 60, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::fssrv::sf::IFileSystemProxy', 61, '1 bytes in - 0 bytes out - OutObject<0,0>, InRaw<1,1,0>'),
('nn::fssrv::sf::IFileSystemProxy', 80, '0x48 bytes in - 0 bytes out - OutObject<0,0>, InRaw<1,1,0>, InRaw<0x40,8,8>, InRaw<4,4,4>'),
('nn::fssrv::sf::IFileSystemProxy', 100, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::fssrv::sf::IFileSystemProxy', 110, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::fssrv::sf::IFileSystemProxy', 200, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::fssrv::sf::IFileSystemProxy', 201, '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,0>'),
('nn::fssrv::sf::IFileSystemProxy', 202, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::fssrv::sf::IFileSystemProxy', 203, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::fssrv::sf::IFileSystemProxy', 400, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::fssrv::sf::IFileSystemProxy', 500, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::fssrv::sf::IFileSystemProxy', 501, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::fssrv::sf::IFileSystemProxy', 600, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::fssrv::sf::IFileSystemProxy', 601, '0x10 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::fssrv::sf::IFileSystemProxy', 602, '8 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,6,0>'),
('nn::fssrv::sf::IFileSystemProxy', 603, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::fssrv::sf::IFileSystemProxy', 604, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::fssrv::sf::IFileSystemProxy', 605, '0 bytes in - 0 bytes out'),
('nn::fssrv::sf::IFileSystemProxy', 606, '0x10 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::fssrv::sf::IFileSystemProxy', 607, '0x20 bytes in - 0 bytes out - InRaw<0x10,8,0>, InRaw<0x10,1,0x10>'),
('nn::fssrv::sf::IFileSystemProxy', 608, '0 bytes in - 0 bytes out'),
('nn::fssrv::sf::IFileSystemProxy', 609, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, Buffer<0,0x19,0x301>'),
('nn::fssrv::sf::IFileSystemProxy', 610, '0 bytes in - 0x18 bytes out - OutRaw<0x10,8,8>, OutRaw<1,1,0>, Buffer<0,0x19,0x301>'),
('nn::fssrv::sf::IFileSystemProxy', 620, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::fssrv::sf::IFileSystemProxy', 800, '0 bytes in - 0x80 bytes out - OutRaw<0x80,4,0>'),
('nn::fssrv::sf::IFileSystemProxy', 1000, '4 bytes in - 0 bytes out - InRaw<4,4,0>, Buffer<0,0x19,0x301>'),
('nn::fssrv::sf::IFileSystemProxy', 1001, '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::fssrv::sf::IFileSystemProxy', 1002, '0 bytes in - 0 bytes out - Buffer<0,0x19,0x301>'),
('nn::fssrv::sf::IFileSystemProxy', 1003, '0 bytes in - 0 bytes out'),
('nn::fssrv::sf::IFileSystemProxy', 1004, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::fssrv::sf::IFileSystemProxy', 1005, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::fssrv::sf::IFileSystemProxy', 1006, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::fssrv::sf::IFileSystemProxyForLoader', 0, '8 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x301>, InRaw<8,8,0>'),
('nn::fssrv::sf::IFileSystemProxyForLoader', 1, '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,8,0>'),
('nn::fssrv::sf::IProgramRegistry', 0, '0x28 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<8,8,0x10>, InRaw<1,1,0>, Buffer<0,5,0>, InRaw<8,8,0x18>, Buffer<1,5,0>, InRaw<8,8,0x20>'),
('nn::fssrv::sf::IProgramRegistry', 1, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::fssrv::sf::IProgramRegistry', 256, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::fssrv::sf::ISaveDataInfoReader', 0, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>'),
('nn::fssrv::sf::IStorage', 0, '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,0x46,0>, InRaw<8,8,8>'),
('nn::fssrv::sf::IStorage', 1, '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,0x45,0>, InRaw<8,8,8>'),
('nn::fssrv::sf::IStorage', 2, '0 bytes in - 0 bytes out'),
('nn::fssrv::sf::IStorage', 3, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::fssrv::sf::IStorage', 4, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::gpio::IManager', 0, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::gpio::IManager', 1, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::gpio::IManager', 2, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::gpio::IManager', 3, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>'),
('nn::gpio::IManager', 4, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::gpio::IManager', 5, '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>'),
('nn::gpio::IManager', 6, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::gpio::IPadSession', 0, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::gpio::IPadSession', 1, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::gpio::IPadSession', 2, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::gpio::IPadSession', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::gpio::IPadSession', 4, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::gpio::IPadSession', 5, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::gpio::IPadSession', 6, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::gpio::IPadSession', 7, '0 bytes in - 0 bytes out'),
('nn::gpio::IPadSession', 8, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::gpio::IPadSession', 9, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::gpio::IPadSession', 10, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::gpio::IPadSession', 11, '0 bytes in - 0 bytes out'),
('nn::gpio::IPadSession', 12, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::gpio::IPadSession', 13, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::gpio::IPadSession', 14, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::gpio::IPadSession', 15, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::hid::IActiveVibrationDeviceList', 0, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IAppletResource', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::hid::IHidDebugServer', 0, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 1, '0x18 bytes in - 0 bytes out - InRaw<0x18,4,0>'),
('nn::hid::IHidDebugServer', 2, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 10, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 11, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::hid::IHidDebugServer', 12, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 20, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 21, '0x1C bytes in - 0 bytes out - InRaw<0x1C,4,0>'),
('nn::hid::IHidDebugServer', 22, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 30, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 31, '0x28 bytes in - 0 bytes out - InRaw<0x28,8,0>'),
('nn::hid::IHidDebugServer', 32, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 50, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IHidDebugServer', 51, '0x20 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<0x1C,4,4>'),
('nn::hid::IHidDebugServer', 52, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IHidDebugServer', 60, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IHidDebugServer', 91, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 110, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 111, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::hid::IHidDebugServer', 112, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 120, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 121, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::hid::IHidDebugServer', 122, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 123, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 130, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 131, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::hid::IHidDebugServer', 132, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 133, '0x18 bytes in - 0 bytes out - takes pid - InRaw<4,4,0>, InRaw<8,8,0x10>, InRaw<4,4,4>, InRaw<4,4,8>'),
('nn::hid::IHidDebugServer', 134, '0x10 bytes in - 8 bytes out - takes pid - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<8,8,8>'),
('nn::hid::IHidDebugServer', 135, '0x18 bytes in - 0 bytes out - takes pid - InRaw<4,4,0>, InRaw<8,8,0x10>, InRaw<4,4,4>, InRaw<4,4,8>'),
('nn::hid::IHidDebugServer', 136, '0x10 bytes in - 8 bytes out - takes pid - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<8,8,8>'),
('nn::hid::IHidDebugServer', 140, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 201, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 202, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 203, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::hid::IHidDebugServer', 204, '0 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>'),
('nn::hid::IHidDebugServer', 205, '8 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::hid::IHidDebugServer', 206, '8 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::hid::IHidDebugServer', 207, '0 bytes in - 0 bytes out'),
('nn::hid::IHidDebugServer', 208, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::hid::IHidDebugServer', 209, '8 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<8,8,0>'),
('nn::hid::IHidDebugServer', 221, '0x10 bytes in - 0 bytes out - InRaw<4,1,0>, InRaw<4,1,4>, InRaw<8,8,8>'),
('nn::hid::IHidServer', 0, '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>'),
('nn::hid::IHidServer', 1, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidServer', 11, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidServer', 21, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidServer', 31, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidServer', 40, '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>'),
('nn::hid::IHidServer', 41, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::hid::IHidServer', 51, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 55, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>'),
('nn::hid::IHidServer', 56, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IHidServer', 58, '4 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 59, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>'),
('nn::hid::IHidServer', 60, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IHidServer', 61, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IHidServer', 62, '4 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 63, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IHidServer', 64, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IHidServer', 65, '4 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 66, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 67, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 68, '0x10 bytes in - 1 bytes out - takes pid - OutRaw<1,1,0>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 69, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,4>, InRaw<1,1,0>'),
('nn::hid::IHidServer', 70, '0x18 bytes in - 0 bytes out - takes pid - InRaw<8,8,0x10>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>'),
('nn::hid::IHidServer', 71, '0x10 bytes in - 8 bytes out - takes pid - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 72, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 73, '0x18 bytes in - 0 bytes out - takes pid - InRaw<8,8,0x10>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>'),
('nn::hid::IHidServer', 74, '0x10 bytes in - 8 bytes out - takes pid - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 75, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 76, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::hid::IHidServer', 77, '0x10 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 78, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 79, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::hid::IHidServer', 80, '0x10 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 81, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 82, '0x10 bytes in - 1 bytes out - takes pid - OutRaw<1,1,0>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 91, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 100, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 101, '8 bytes in - 4 bytes out - takes pid - InRaw<8,8,0>, OutRaw<4,4,0>'),
('nn::hid::IHidServer', 102, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, Buffer<0,9,0>'),
('nn::hid::IHidServer', 103, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidServer', 104, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidServer', 106, '0x18 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, OutHandle<0,1>, InRaw<4,4,0>, InRaw<8,8,0x10>'),
('nn::hid::IHidServer', 107, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 108, '4 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 120, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::hid::IHidServer', 121, '8 bytes in - 8 bytes out - takes pid - InRaw<8,8,0>, OutRaw<8,8,0>'),
('nn::hid::IHidServer', 122, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 123, '0x18 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<8,8,0x10>'),
('nn::hid::IHidServer', 124, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 125, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::hid::IHidServer', 126, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidServer', 127, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidServer', 128, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::hid::IHidServer', 129, '8 bytes in - 8 bytes out - takes pid - InRaw<8,8,0>, OutRaw<8,8,0>'),
('nn::hid::IHidServer', 130, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::hid::IHidServer', 131, '0x10 bytes in - 1 bytes out - takes pid - OutRaw<1,1,0>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 132, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,4>, InRaw<1,1,0>'),
('nn::hid::IHidServer', 200, '4 bytes in - 8 bytes out - OutRaw<8,4,0>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 201, '0x20 bytes in - 0 bytes out - takes pid - InRaw<8,8,0x18>, InRaw<4,4,0>, InRaw<0x10,4,4>'),
('nn::hid::IHidServer', 202, '0x10 bytes in - 0x10 bytes out - takes pid - OutRaw<0x10,4,0>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 203, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::hid::IHidServer', 204, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::hid::IHidServer', 205, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::hid::IHidServer', 206, '8 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,9,0>, Buffer<1,9,0>'),
('nn::hid::IHidServer', 300, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidServer', 301, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 302, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 400, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::hid::IHidServer', 401, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::hid::IHidServer', 402, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>'),
('nn::hid::IHidServer', 1000, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::hid::IHidServer', 1001, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 31, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IHidSystemServer', 101, '8 bytes in - 0 bytes out - takes pid - OutHandle<0,1>, InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 111, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 121, '8 bytes in - 0 bytes out - takes pid - OutHandle<0,1>, InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 131, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 141, '8 bytes in - 0 bytes out - takes pid - OutHandle<0,1>, InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 151, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 210, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::hid::IHidSystemServer', 211, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>'),
('nn::hid::IHidSystemServer', 212, '4 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<4,4,0>'),
('nn::hid::IHidSystemServer', 213, '0x10 bytes in - 0 bytes out - takes pid - InRaw<4,4,4>, InRaw<1,1,0>, InRaw<8,8,8>'),
('nn::hid::IHidSystemServer', 230, '4 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<4,4,0>'),
('nn::hid::IHidSystemServer', 231, '0x10 bytes in - 0 bytes out - takes pid - InRaw<4,4,4>, InRaw<1,1,0>, InRaw<8,8,8>'),
('nn::hid::IHidSystemServer', 301, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IHidSystemServer', 303, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 304, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 305, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 306, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::hid::IHidSystemServer', 307, '4 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>, InRaw<4,4,0>'),
('nn::hid::IHidSystemServer', 311, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::hid::IHidSystemServer', 321, '4 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>, InRaw<4,4,0>'),
('nn::hid::IHidSystemServer', 322, '0x10 bytes in - 8 bytes out - takes pid - InRaw<4,4,0>, OutRaw<8,8,0>, InRaw<8,8,8>'),
('nn::hid::IHidSystemServer', 323, '0x10 bytes in - 8 bytes out - takes pid - InRaw<4,4,0>, OutRaw<8,8,0>, InRaw<8,8,8>'),
('nn::hid::IHidSystemServer', 500, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 501, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::hid::IHidSystemServer', 502, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 503, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::hid::IHidSystemServer', 504, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::hid::IHidSystemServer', 505, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::hid::IHidSystemServer', 510, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IHidSystemServer', 511, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::hid::IHidSystemServer', 512, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 513, '0 bytes in - 0 bytes out'),
('nn::hid::IHidSystemServer', 520, '0 bytes in - 0 bytes out'),
('nn::hid::IHidSystemServer', 521, '0 bytes in - 0 bytes out'),
('nn::hid::IHidSystemServer', 540, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::hid::IHidSystemServer', 541, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>'),
('nn::hid::IHidSystemServer', 542, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::hid::IHidSystemServer', 543, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>'),
('nn::hid::IHidSystemServer', 544, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::hid::IHidSystemServer', 545, '6 bytes in - 0 bytes out - InRaw<6,1,0>'),
('nn::hid::IHidSystemServer', 546, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::hid::IHidSystemServer', 547, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 700, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::hid::IHidSystemServer', 702, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::hid::IHidSystemServer', 703, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>'),
('nn::hid::IHidSystemServer', 751, '8 bytes in - 0 bytes out - takes pid - OutHandle<0,1>, InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 800, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0xA,0>, InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 801, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>'),
('nn::hid::IHidSystemServer', 802, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IHidSystemServer', 803, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IHidSystemServer', 804, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IHidSystemServer', 805, '8 bytes in - 6 bytes out - OutRaw<6,1,0>, InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 806, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 821, '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::hid::IHidSystemServer', 822, '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::hid::IHidSystemServer', 823, '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::hid::IHidSystemServer', 824, '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::hid::IHidSystemServer', 850, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::hid::IHidSystemServer', 851, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::hid::IHidSystemServer', 852, '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 900, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 901, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::hid::IHidSystemServer', 1000, '0 bytes in - 0 bytes out'),
('nn::hid::IHidSystemServer', 1001, '8 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 1002, '8 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 1003, '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 1004, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 1005, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>'),
('nn::hid::IHidSystemServer', 1006, '0 bytes in - 0 bytes out'),
('nn::hid::IHidSystemServer', 1007, '8 bytes in - 4 bytes out - OutRaw<4,1,0>, InRaw<8,8,0>'),
('nn::hid::IHidTemporaryServer', 0, '0x10 bytes in - 0x18 bytes out - takes pid - OutRaw<0x18,2,0>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::htc::tenv::IService', 0, '0x40 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>, InRaw<0x40,1,0>'),
('nn::htc::tenv::IService', 1, '0x40 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<0x40,1,0>'),
('nn::htc::tenv::IService', 2, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::htc::tenv::IServiceManager', 0, '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>'),
('nn::i2c::IManager', 0, '0x10 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,4>, InRaw<2,2,0>, InRaw<4,4,8>, InRaw<4,4,0xC>'),
('nn::i2c::IManager', 1, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::i2c::IManager', 2, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>'),
('nn::i2c::IManager', 3, '0x10 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,4>, InRaw<2,2,0>, InRaw<4,4,8>, InRaw<4,4,0xC>'),
('nn::i2c::ISession', 0, '4 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<4,4,0>'),
('nn::i2c::ISession', 1, '4 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<4,4,0>'),
('nn::i2c::ISession', 2, '0 bytes in - 0 bytes out - Buffer<0,6,0>, Buffer<1,9,0>'),
('nn::i2c::ISession', 10, '4 bytes in - 0 bytes out - Buffer<0,0x21,0>, InRaw<4,4,0>'),
('nn::i2c::ISession', 11, '4 bytes in - 0 bytes out - Buffer<0,0x22,0>, InRaw<4,4,0>'),
('nn::i2c::ISession', 12, '0 bytes in - 0 bytes out - Buffer<0,0x22,0>, Buffer<1,9,0>'),
('nn::idle::detail::IPolicyManagerSystem', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::idle::detail::IPolicyManagerSystem', 1, '0 bytes in - 0 bytes out'),
('nn::idle::detail::IPolicyManagerSystem', 2, '0 bytes in - 0 bytes out'),
('nn::idle::detail::IPolicyManagerSystem', 3, ''),
('nn::idle::detail::IPolicyManagerSystem', 4, '0 bytes in - 0 bytes out'),
('nn::idle::detail::IPolicyManagerSystem', 5, '0 bytes in - 0 bytes out'),
('nn::irsensor::IIrSensorServer', 302, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::irsensor::IIrSensorServer', 303, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::irsensor::IIrSensorServer', 304, '8 bytes in - 0 bytes out - takes pid - OutHandle<0,1>, InRaw<8,8,0>'),
('nn::irsensor::IIrSensorServer', 305, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::irsensor::IIrSensorServer', 306, '0x30 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<0x20,8,0x10>'),
('nn::irsensor::IIrSensorServer', 307, '0x38 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<0x28,8,0x10>'),
('nn::irsensor::IIrSensorServer', 308, '0x30 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<0x18,8,0x10>, InHandle<0,1>, InRaw<8,8,0x28>'),
('nn::irsensor::IIrSensorServer', 309, '0x10 bytes in - 0x10 bytes out - takes pid - InRaw<8,8,8>, OutRaw<0x10,8,0>, Buffer<0,6,0>, InRaw<4,4,0>'),
('nn::irsensor::IIrSensorServer', 310, '0x18 bytes in - 0 bytes out - takes pid - InRaw<8,8,0x10>, InRaw<4,4,0>, InRaw<8,2,4>'),
('nn::irsensor::IIrSensorServer', 311, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::irsensor::IIrSensorServer', 312, '0x18 bytes in - 0 bytes out - takes pid - InRaw<8,8,0x10>, InRaw<4,4,0>, InRaw<0xC,2,4>'),
('nn::irsensor::IIrSensorServer', 313, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::irsensor::IIrSensorServer', 314, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,2,4>'),
('nn::irsensor::IIrSensorSystemServer', 500, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::irsensor::IIrSensorSystemServer', 501, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::irsensor::IIrSensorSystemServer', 502, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::irsensor::IIrSensorSystemServer', 503, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::lbl::detail::ILblController', 0, '0 bytes in - 0 bytes out'),
('nn::lbl::detail::ILblController', 1, '0 bytes in - 0 bytes out'),
('nn::lbl::detail::ILblController', 2, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::lbl::detail::ILblController', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::lbl::detail::ILblController', 4, '0 bytes in - 0 bytes out'),
('nn::lbl::detail::ILblController', 5, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::lbl::detail::ILblController', 6, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::lbl::detail::ILblController', 7, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::lbl::detail::ILblController', 8, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::lbl::detail::ILblController', 9, '0 bytes in - 0 bytes out'),
('nn::lbl::detail::ILblController', 10, '0 bytes in - 0 bytes out'),
('nn::lbl::detail::ILblController', 11, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::lbl::detail::ILblController', 12, '0 bytes in - 0 bytes out'),
('nn::lbl::detail::ILblController', 13, '0 bytes in - 0 bytes out'),
('nn::lbl::detail::ILblController', 14, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::lbl::detail::ILblController', 15, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::lbl::detail::ILblController', 16, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::lbl::detail::ILblController', 17, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::lbl::detail::ILblController', 18, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::lbl::detail::ILblController', 19, '0xC bytes in - 0 bytes out - InRaw<0xC,4,0>'),
('nn::lbl::detail::ILblController', 20, '0 bytes in - 0xC bytes out - OutRaw<0xC,4,0>'),
('nn::lbl::detail::ILblController', 21, '0xC bytes in - 0 bytes out - InRaw<0xC,4,0>'),
('nn::lbl::detail::ILblController', 22, '0 bytes in - 0xC bytes out - OutRaw<0xC,4,0>'),
('nn::lbl::detail::ILblController', 23, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::lbl::detail::ILblController', 24, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::lbl::detail::ILblController', 25, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::lbl::detail::ILblController', 26, '0 bytes in - 0 bytes out'),
('nn::lbl::detail::ILblController', 27, '0 bytes in - 0 bytes out'),
('nn::lbl::detail::ILblController', 28, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::ldn::detail::IMonitorService', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::ldn::detail::IMonitorService', 1, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x480>'),
('nn::ldn::detail::IMonitorService', 2, '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>'),
('nn::ldn::detail::IMonitorService', 3, '0 bytes in - 2 bytes out - OutRaw<2,2,0>'),
('nn::ldn::detail::IMonitorService', 4, '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>'),
('nn::ldn::detail::IMonitorService', 5, '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>'),
('nn::ldn::detail::IMonitorService', 100, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::IMonitorService', 101, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::IMonitorServiceCreator', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 1, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x480>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 2, '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 3, '0 bytes in - 2 bytes out - OutRaw<2,2,0>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 4, '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 5, '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 100, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 101, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x480>, Buffer<1,0xA,0>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 102, '0x68 bytes in - 2 bytes out - Buffer<0,0x22,0>, OutRaw<2,2,0>, InRaw<0x60,8,8>, InRaw<2,2,0>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 103, '0x68 bytes in - 2 bytes out - Buffer<0,0x22,0>, OutRaw<2,2,0>, InRaw<0x60,8,8>, InRaw<2,2,0>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 200, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::ISystemLocalCommunicationService', 201, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::ISystemLocalCommunicationService', 202, '0x98 bytes in - 0 bytes out - InRaw<0x20,8,0x78>, InRaw<0x44,2,0>, InRaw<0x30,1,0x44>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 203, '0xB8 bytes in - 0 bytes out - InRaw<0x20,8,0x98>, InRaw<0x44,2,0>, InRaw<0x20,1,0x44>, InRaw<0x30,1,0x64>, Buffer<0,9,0>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 204, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::ISystemLocalCommunicationService', 205, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 206, '0 bytes in - 0 bytes out - Buffer<0,0x21,0>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 207, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 208, '6 bytes in - 0 bytes out - InRaw<6,1,0>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 209, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::ISystemLocalCommunicationService', 300, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::ISystemLocalCommunicationService', 301, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::ISystemLocalCommunicationService', 302, '0x7C bytes in - 0 bytes out - Buffer<0,0x19,0x480>, InRaw<0x44,2,0>, InRaw<0x30,1,0x44>, InRaw<4,4,0x74>, InRaw<4,4,0x78>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 303, '0xC0 bytes in - 0 bytes out - InRaw<0x20,8,0xA0>, InRaw<0x44,2,0>, InRaw<0x20,1,0x44>, InRaw<0x30,1,0x64>, InRaw<4,4,0x94>, InRaw<4,4,0x98>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 304, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::ISystemLocalCommunicationService', 400, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::ldn::detail::ISystemLocalCommunicationService', 401, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::ISystemServiceCreator', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::ldn::detail::IUserLocalCommunicationService', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::ldn::detail::IUserLocalCommunicationService', 1, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x480>'),
('nn::ldn::detail::IUserLocalCommunicationService', 2, '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>'),
('nn::ldn::detail::IUserLocalCommunicationService', 3, '0 bytes in - 2 bytes out - OutRaw<2,2,0>'),
('nn::ldn::detail::IUserLocalCommunicationService', 4, '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>'),
('nn::ldn::detail::IUserLocalCommunicationService', 5, '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>'),
('nn::ldn::detail::IUserLocalCommunicationService', 100, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::ldn::detail::IUserLocalCommunicationService', 101, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x480>, Buffer<1,0xA,0>'),
('nn::ldn::detail::IUserLocalCommunicationService', 102, '0x68 bytes in - 2 bytes out - Buffer<0,0x22,0>, OutRaw<2,2,0>, InRaw<0x60,8,8>, InRaw<2,2,0>'),
('nn::ldn::detail::IUserLocalCommunicationService', 103, '0x68 bytes in - 2 bytes out - Buffer<0,0x22,0>, OutRaw<2,2,0>, InRaw<0x60,8,8>, InRaw<2,2,0>'),
('nn::ldn::detail::IUserLocalCommunicationService', 200, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::IUserLocalCommunicationService', 201, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::IUserLocalCommunicationService', 202, '0x98 bytes in - 0 bytes out - InRaw<0x20,8,0x78>, InRaw<0x44,2,0>, InRaw<0x30,1,0x44>'),
('nn::ldn::detail::IUserLocalCommunicationService', 203, '0xB8 bytes in - 0 bytes out - InRaw<0x20,8,0x98>, InRaw<0x44,2,0>, InRaw<0x20,1,0x44>, InRaw<0x30,1,0x64>, Buffer<0,9,0>'),
('nn::ldn::detail::IUserLocalCommunicationService', 204, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::IUserLocalCommunicationService', 205, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::ldn::detail::IUserLocalCommunicationService', 206, '0 bytes in - 0 bytes out - Buffer<0,0x21,0>'),
('nn::ldn::detail::IUserLocalCommunicationService', 207, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::ldn::detail::IUserLocalCommunicationService', 208, '6 bytes in - 0 bytes out - InRaw<6,1,0>'),
('nn::ldn::detail::IUserLocalCommunicationService', 209, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::IUserLocalCommunicationService', 300, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::IUserLocalCommunicationService', 301, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::IUserLocalCommunicationService', 302, '0x7C bytes in - 0 bytes out - Buffer<0,0x19,0x480>, InRaw<0x44,2,0>, InRaw<0x30,1,0x44>, InRaw<4,4,0x74>, InRaw<4,4,0x78>'),
('nn::ldn::detail::IUserLocalCommunicationService', 303, '0xC0 bytes in - 0 bytes out - InRaw<0x20,8,0xA0>, InRaw<0x44,2,0>, InRaw<0x20,1,0x44>, InRaw<0x30,1,0x64>, InRaw<4,4,0x94>, InRaw<4,4,0x98>'),
('nn::ldn::detail::IUserLocalCommunicationService', 304, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::IUserLocalCommunicationService', 400, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::ldn::detail::IUserLocalCommunicationService', 401, '0 bytes in - 0 bytes out'),
('nn::ldn::detail::IUserServiceCreator', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::ldr::detail::IShellInterface', 0, ''),
('nn::ldr::detail::IShellInterface', 1, '0 bytes in - 0 bytes out'),
('nn::lm::ILogService', 0, '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>'),
('nn::lm::ILogger', 0, '0 bytes in - 0 bytes out - Buffer<0,0x21,0>'),
('nn::lm::ILogger', 1, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::lr::ILocationResolverManager', 0, ''),
('nn::lr::ILocationResolverManager', 1, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::lr::ILocationResolverManager', 2, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::lr::ILocationResolverManager', 3, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::lr::ILocationResolver', 0, ''),
('nn::lr::ILocationResolver', 1, ''),
('nn::lr::ILocationResolver', 2, ''),
('nn::lr::ILocationResolver', 3, ''),
('nn::lr::ILocationResolver', 4, ''),
('nn::lr::ILocationResolver', 5, ''),
('nn::lr::ILocationResolver', 6, ''),
('nn::lr::ILocationResolver', 7, ''),
('nn::lr::ILocationResolver', 8, ''),
('nn::lr::ILocationResolver', 9, '0 bytes in - 0 bytes out'),
('nn::lr::IRegisteredLocationResolver', 0, ''),
('nn::lr::IRegisteredLocationResolver', 1, ''),
('nn::lr::IRegisteredLocationResolver', 2, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::lr::IRegisteredLocationResolver', 3, ''),
('nn::lr::IRegisteredLocationResolver', 4, ''),
('nn::lr::IRegisteredLocationResolver', 5, ''),
('nn::lr::IRegisteredLocationResolver', 6, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::lr::IRegisteredLocationResolver', 7, ''),
('nn::lr::IAddOnContentLocationResolver', 0, ''),
('nn::lr::IAddOnContentLocationResolver', 1, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::lr::IAddOnContentLocationResolver', 2, '0 bytes in - 0 bytes out'),
('nn::mii::detail::IDatabaseService', 0, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>'),
('nn::mii::detail::IDatabaseService', 1, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::mii::detail::IDatabaseService', 2, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::mii::detail::IDatabaseService', 3, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<4,4,0>'),
('nn::mii::detail::IDatabaseService', 4, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<4,4,0>'),
('nn::mii::detail::IDatabaseService', 5, '0x5C bytes in - 0x58 bytes out - OutRaw<0x58,4,0>, InRaw<0x58,4,0>, InRaw<4,4,0x58>'),
('nn::mii::detail::IDatabaseService', 6, '0xC bytes in - 0x58 bytes out - OutRaw<0x58,4,0>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>'),
('nn::mii::detail::IDatabaseService', 7, '4 bytes in - 0x58 bytes out - OutRaw<0x58,4,0>, InRaw<4,4,0>'),
('nn::mii::detail::IDatabaseService', 8, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<4,4,0>'),
('nn::mii::detail::IDatabaseService', 9, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<4,4,0>'),
('nn::mii::detail::IDatabaseService', 10, '0x48 bytes in - 0x44 bytes out - OutRaw<0x44,4,0>, InRaw<0x44,4,0>, InRaw<4,4,0x44>'),
('nn::mii::detail::IDatabaseService', 11, '0x11 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<0x10,1,0>, InRaw<1,1,0x10>'),
('nn::mii::detail::IDatabaseService', 12, '0x14 bytes in - 0 bytes out - InRaw<4,4,0x10>, InRaw<0x10,1,0>'),
('nn::mii::detail::IDatabaseService', 13, '0x44 bytes in - 0 bytes out - InRaw<0x44,4,0>'),
('nn::mii::detail::IDatabaseService', 14, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::mii::detail::IDatabaseService', 15, '0 bytes in - 0 bytes out'),
('nn::mii::detail::IDatabaseService', 16, '0 bytes in - 0 bytes out'),
('nn::mii::detail::IDatabaseService', 17, '0 bytes in - 0 bytes out'),
('nn::mii::detail::IDatabaseService', 18, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::mii::detail::IDatabaseService', 19, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::mii::detail::IDatabaseService', 20, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::mii::detail::IDatabaseService', 21, '0x58 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<0x58,4,0>'),
('nn::mii::detail::IStaticService', 0, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::mmnv::IRequest', 0, '0xC bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>'),
('nn::mmnv::IRequest', 1, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::mmnv::IRequest', 2, '0xC bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>'),
('nn::mmnv::IRequest', 3, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::mmnv::IRequest', 4, ''),
('nn::mmnv::IRequest', 5, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::mmnv::IRequest', 6, '0xC bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>'),
('nn::mmnv::IRequest', 7, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::ncm::IContentManager', 0, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::ncm::IContentManager', 1, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::ncm::IContentManager', 2, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::ncm::IContentManager', 3, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::ncm::IContentManager', 4, ''),
('nn::ncm::IContentManager', 5, ''),
('nn::ncm::IContentManager', 8, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::ncm::IContentManager', 9, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::ncm::IContentManager', 10, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::ncm::IContentManager', 11, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::ncm::IContentManager', 12, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::ncm::IContentMetaDatabase', 0, ''),
('nn::ncm::IContentMetaDatabase', 1, ''),
('nn::ncm::IContentMetaDatabase', 2, ''),
('nn::ncm::IContentMetaDatabase', 3, ''),
('nn::ncm::IContentMetaDatabase', 4, ''),
('nn::ncm::IContentMetaDatabase', 5, ''),
('nn::ncm::IContentMetaDatabase', 6, ''),
('nn::ncm::IContentMetaDatabase', 7, ''),
('nn::ncm::IContentMetaDatabase', 8, ''),
('nn::ncm::IContentMetaDatabase', 9, ''),
('nn::ncm::IContentMetaDatabase', 10, ''),
('nn::ncm::IContentMetaDatabase', 11, ''),
('nn::ncm::IContentMetaDatabase', 12, ''),
('nn::ncm::IContentMetaDatabase', 13, '0 bytes in - 0 bytes out'),
('nn::ncm::IContentMetaDatabase', 14, ''),
('nn::ncm::IContentMetaDatabase', 15, '0 bytes in - 0 bytes out'),
('nn::ncm::IContentMetaDatabase', 16, ''),
('nn::ncm::IContentMetaDatabase', 17, ''),
('nn::ncm::IContentMetaDatabase', 18, ''),
('nn::ncm::IContentMetaDatabase', 19, ''),
('nn::ncm::IContentStorage', 0, '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>'),
('nn::ncm::IContentStorage', 1, ''),
('nn::ncm::IContentStorage', 2, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::ncm::IContentStorage', 3, ''),
('nn::ncm::IContentStorage', 4, ''),
('nn::ncm::IContentStorage', 5, ''),
('nn::ncm::IContentStorage', 6, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::ncm::IContentStorage', 7, ''),
('nn::ncm::IContentStorage', 8, ''),
('nn::ncm::IContentStorage', 9, ''),
('nn::ncm::IContentStorage', 10, '0 bytes in - 0 bytes out'),
('nn::ncm::IContentStorage', 11, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::ncm::IContentStorage', 12, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::ncm::IContentStorage', 13, ''),
('nn::ncm::IContentStorage', 14, ''),
('nn::ncm::IContentStorage', 15, '0 bytes in - 0 bytes out'),
('nn::ncm::IContentStorage', 16, ''),
('nn::ncm::IContentStorage', 17, ''),
('nn::ncm::IContentStorage', 18, ''),
('nn::ncm::IContentStorage', 19, ''),
('nn::ncm::IContentStorage', 20, ''),
('nn::ncm::IContentStorage', 21, ''),
('nn::ncm::IContentStorage', 22, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::ncm::IContentStorage', 23, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::ncm::IContentStorage', 24, '0 bytes in - 0 bytes out'),
('nn::news::detail::ipc::INewlyArrivedEventHolder', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::news::detail::ipc::INewsDataService', 0, '0 bytes in - 0 bytes out - Buffer<0,9,0>'),
('nn::news::detail::ipc::INewsDataService', 1, ''),
('nn::news::detail::ipc::INewsDataService', 2, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>, Buffer<0,6,0>'),
('nn::news::detail::ipc::INewsDataService', 3, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::news::detail::ipc::INewsDatabaseService', 0, ''),
('nn::news::detail::ipc::INewsDatabaseService', 1, ''),
('nn::news::detail::ipc::INewsDatabaseService', 2, ''),
('nn::news::detail::ipc::INewsDatabaseService', 3, ''),
('nn::news::detail::ipc::INewsDatabaseService', 4, ''),
('nn::news::detail::ipc::INewsDatabaseService', 5, ''),
('nn::news::detail::ipc::INewsService', 10100, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::news::detail::ipc::INewsService', 20100, '8 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,9,0>'),
('nn::news::detail::ipc::INewsService', 30100, ''),
('nn::news::detail::ipc::INewsService', 30101, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<4,4,0>'),
('nn::news::detail::ipc::INewsService', 30200, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::news::detail::ipc::INewsService', 30300, '0 bytes in - 0 bytes out - Buffer<0,9,0>'),
('nn::news::detail::ipc::INewsService', 30400, ''),
('nn::news::detail::ipc::INewsService', 40100, ''),
('nn::news::detail::ipc::INewsService', 40101, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::news::detail::ipc::INewsService', 40200, '0 bytes in - 0 bytes out'),
('nn::news::detail::ipc::INewsService', 40201, '0 bytes in - 0 bytes out'),
('nn::news::detail::ipc::INewsService', 90100, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>'),
('nn::news::detail::ipc::IOverwriteEventHolder', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::news::detail::ipc::IServiceCreator', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::news::detail::ipc::IServiceCreator', 1, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::news::detail::ipc::IServiceCreator', 2, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::news::detail::ipc::IServiceCreator', 3, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::news::detail::ipc::IServiceCreator', 4, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::nfc::am::detail::IAm', 0, '0 bytes in - 0 bytes out'),
('nn::nfc::am::detail::IAm', 1, '0 bytes in - 0 bytes out'),
('nn::nfc::am::detail::IAm', 2, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::nfc::am::detail::IAmManager', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::nfc::detail::ISystem', 0, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,5,0>'),
('nn::nfc::detail::ISystem', 1, '0 bytes in - 0 bytes out'),
('nn::nfc::detail::ISystem', 2, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::nfc::detail::ISystem', 3, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::nfc::detail::ISystem', 100, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::nfc::detail::ISystemManager', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::nfc::detail::IUser', 0, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,5,0>'),
('nn::nfc::detail::IUser', 1, '0 bytes in - 0 bytes out'),
('nn::nfc::detail::IUser', 2, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::nfc::detail::IUser', 3, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::nfc::detail::IUserManager', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::nfc::mifare::detail::IUser', 0, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,5,0>'),
('nn::nfc::mifare::detail::IUser', 1, '0 bytes in - 0 bytes out'),
('nn::nfc::mifare::detail::IUser', 2, '0 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>'),
('nn::nfc::mifare::detail::IUser', 3, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfc::mifare::detail::IUser', 4, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfc::mifare::detail::IUser', 5, '8 bytes in - 0 bytes out - Buffer<0,6,0>, InRaw<8,4,0>, Buffer<1,5,0>'),
('nn::nfc::mifare::detail::IUser', 6, '8 bytes in - 0 bytes out - InRaw<8,4,0>, Buffer<0,5,0>'),
('nn::nfc::mifare::detail::IUser', 7, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x58>, InRaw<8,4,0>'),
('nn::nfc::mifare::detail::IUser', 8, '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>'),
('nn::nfc::mifare::detail::IUser', 9, '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>'),
('nn::nfc::mifare::detail::IUser', 10, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::nfc::mifare::detail::IUser', 11, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>'),
('nn::nfc::mifare::detail::IUser', 12, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>'),
('nn::nfc::mifare::detail::IUser', 13, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::nfc::mifare::detail::IUserManager', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::nfp::detail::IDebug', 0, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,5,0>'),
('nn::nfp::detail::IDebug', 1, '0 bytes in - 0 bytes out'),
('nn::nfp::detail::IDebug', 2, '0 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>'),
('nn::nfp::detail::IDebug', 3, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 4, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 5, '0x10 bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>, InRaw<4,4,0xC>'),
('nn::nfp::detail::IDebug', 6, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 7, '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>'),
('nn::nfp::detail::IDebug', 8, '8 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 9, '8 bytes in - 0 bytes out - InRaw<8,4,0>, Buffer<0,5,0>'),
('nn::nfp::detail::IDebug', 10, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 11, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 12, '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>, Buffer<0,5,0>'),
('nn::nfp::detail::IDebug', 13, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x58>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 14, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 15, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 16, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 17, '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 18, '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 19, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::nfp::detail::IDebug', 20, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 21, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 22, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 23, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::nfp::detail::IDebug', 24, '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>, Buffer<0,5,0>'),
('nn::nfp::detail::IDebug', 100, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 101, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 102, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 103, '8 bytes in - 0 bytes out - InRaw<8,4,0>, Buffer<0,0x19,0x100>'),
('nn::nfp::detail::IDebug', 104, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 105, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 106, '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 200, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x298>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 201, '8 bytes in - 0 bytes out - InRaw<8,4,0>, Buffer<0,0x19,0x298>'),
('nn::nfp::detail::IDebug', 202, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 203, '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>'),
('nn::nfp::detail::IDebug', 204, '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>'),
('nn::nfp::detail::IDebug', 205, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::nfp::detail::IDebug', 206, '0xC bytes in - 0 bytes out - InRaw<8,4,0>, Buffer<0,5,0>, InRaw<4,4,8>'),
('nn::nfp::detail::IDebug', 300, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,5,0>'),
('nn::nfp::detail::IDebug', 301, '0 bytes in - 0 bytes out'),
('nn::nfp::detail::IDebug', 302, '0 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>'),
('nn::nfp::detail::IDebug', 303, '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>'),
('nn::nfp::detail::IDebug', 304, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 305, '0x10 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, InRaw<8,4,0>, Buffer<1,5,0>, InRaw<8,8,8>'),
('nn::nfp::detail::IDebug', 306, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x58>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 307, '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 308, '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 309, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::nfp::detail::IDebug', 310, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 311, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 312, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 313, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IDebug', 314, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::nfp::detail::IDebugManager', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::nfp::detail::ISystem', 0, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,5,0>'),
('nn::nfp::detail::ISystem', 1, '0 bytes in - 0 bytes out'),
('nn::nfp::detail::ISystem', 2, '0 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>'),
('nn::nfp::detail::ISystem', 3, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 4, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 5, '0x10 bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>, InRaw<4,4,0xC>'),
('nn::nfp::detail::ISystem', 6, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 10, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 11, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 13, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x58>, InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 14, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>, InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 15, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 16, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 17, '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 18, '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 19, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::nfp::detail::ISystem', 20, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 21, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 23, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::nfp::detail::ISystem', 100, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 101, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 102, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>, InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 103, '8 bytes in - 0 bytes out - InRaw<8,4,0>, Buffer<0,0x19,0x100>'),
('nn::nfp::detail::ISystem', 104, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 105, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::ISystem', 106, '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,4,0>'),
('nn::nfp::detail::ISystemManager', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::nfp::detail::IUser', 0, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, Buffer<0,5,0>'),
('nn::nfp::detail::IUser', 1, '0 bytes in - 0 bytes out'),
('nn::nfp::detail::IUser', 2, '0 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>'),
('nn::nfp::detail::IUser', 3, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IUser', 4, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IUser', 5, '0x10 bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>, InRaw<4,4,0xC>'),
('nn::nfp::detail::IUser', 6, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IUser', 7, '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>'),
('nn::nfp::detail::IUser', 8, '8 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, InRaw<8,4,0>'),
('nn::nfp::detail::IUser', 9, '8 bytes in - 0 bytes out - InRaw<8,4,0>, Buffer<0,5,0>'),
('nn::nfp::detail::IUser', 10, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IUser', 11, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::nfp::detail::IUser', 12, '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>, Buffer<0,5,0>'),
('nn::nfp::detail::IUser', 13, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x58>, InRaw<8,4,0>'),
('nn::nfp::detail::IUser', 14, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>, InRaw<8,4,0>'),
('nn::nfp::detail::IUser', 15, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>'),
('nn::nfp::detail::IUser', 16, '8 bytes in - 0 bytes out - Buffer<0,0x1A,0x40>, InRaw<8,4,0>'),
('nn::nfp::detail::IUser', 17, '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>'),
('nn::nfp::detail::IUser', 18, '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,4,0>'),
('nn::nfp::detail::IUser', 19, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::nfp::detail::IUser', 20, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>'),
('nn::nfp::detail::IUser', 21, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>'),
('nn::nfp::detail::IUser', 22, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,4,0>'),
('nn::nfp::detail::IUser', 23, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::nfp::detail::IUser', 24, '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>, Buffer<0,5,0>'),
('nn::nfp::detail::IUserManager', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::nifm::detail::IGeneralService', 1, '0 bytes in - 0 bytes out - Buffer<0,0x1A,4>'),
('nn::nifm::detail::IGeneralService', 2, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::nifm::detail::IGeneralService', 4, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::nifm::detail::IGeneralService', 5, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x17C>'),
('nn::nifm::detail::IGeneralService', 6, '4 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::nifm::detail::IGeneralService', 7, '1 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, InRaw<1,1,0>'),
('nn::nifm::detail::IGeneralService', 8, '0x10 bytes in - 0 bytes out - Buffer<0,0x1A,0x17C>, InRaw<0x10,1,0>'),
('nn::nifm::detail::IGeneralService', 9, '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, Buffer<0,0x19,0x17C>'),
('nn::nifm::detail::IGeneralService', 10, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::nifm::detail::IGeneralService', 11, '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>'),
('nn::nifm::detail::IGeneralService', 12, '0 bytes in - 4 bytes out - OutRaw<4,1,0>'),
('nn::nifm::detail::IGeneralService', 13, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x34>'),
('nn::nifm::detail::IGeneralService', 14, '0 bytes in - 0x10 bytes out - OutObject<0,0>, OutRaw<0x10,1,0>, Buffer<0,0x19,0x17C>'),
('nn::nifm::detail::IGeneralService', 15, '0 bytes in - 0x16 bytes out - OutRaw<0xD,1,0>, OutRaw<9,1,0xD>'),
('nn::nifm::detail::IGeneralService', 16, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::nifm::detail::IGeneralService', 17, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::nifm::detail::IGeneralService', 18, '0 bytes in - 3 bytes out - OutRaw<3,1,0>'),
('nn::nifm::detail::IGeneralService', 19, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::nifm::detail::IGeneralService', 20, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::nifm::detail::IGeneralService', 21, '0 bytes in - 1 bytes out - OutRaw<1,1,0>, Buffer<0,0x19,4>'),
('nn::nifm::detail::IGeneralService', 22, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::nifm::detail::IGeneralService', 23, '0 bytes in - 0 bytes out'),
('nn::nifm::detail::IGeneralService', 24, '0 bytes in - 0 bytes out'),
('nn::nifm::detail::IGeneralService', 25, '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>'),
('nn::nifm::detail::IGeneralService', 26, '0 bytes in - 0 bytes out - Buffer<0,0x19,4>'),
('nn::nifm::detail::IGeneralService', 27, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0xC2>'),
('nn::nifm::detail::IGeneralService', 28, '0 bytes in - 0 bytes out - Buffer<0,0x19,0xC2>'),
('nn::nifm::detail::IGeneralService', 29, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::nifm::detail::IGeneralService', 30, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::nifm::detail::IGeneralService', 31, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::nifm::detail::IGeneralService', 32, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x20C>'),
('nn::nifm::detail::IGeneralService', 33, '0 bytes in - 0 bytes out'),
('nn::nifm::detail::INetworkProfile', 0, '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, Buffer<0,0x19,0x17C>'),
('nn::nifm::detail::INetworkProfile', 1, '0x10 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>, InRaw<0x10,1,0>'),
('nn::nifm::detail::INetworkProfile', 2, '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>'),
('nn::nifm::detail::IRequest', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::nifm::detail::IRequest', 1, '0 bytes in - 0 bytes out'),
('nn::nifm::detail::IRequest', 2, '0 bytes in - 0 bytes out - OutHandle<0,1>, OutHandle<1,1>'),
('nn::nifm::detail::IRequest', 3, '0 bytes in - 0 bytes out'),
('nn::nifm::detail::IRequest', 4, '0 bytes in - 0 bytes out'),
('nn::nifm::detail::IRequest', 5, '0x24 bytes in - 0 bytes out - InRaw<0x24,4,0>'),
('nn::nifm::detail::IRequest', 6, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::nifm::detail::IRequest', 8, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::nifm::detail::IRequest', 9, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::nifm::detail::IRequest', 10, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::nifm::detail::IRequest', 11, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::nifm::detail::IRequest', 12, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::nifm::detail::IRequest', 13, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::nifm::detail::IRequest', 14, '2 bytes in - 0 bytes out - InRaw<1,1,0>, InRaw<1,1,1>'),
('nn::nifm::detail::IRequest', 15, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::nifm::detail::IRequest', 16, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::nifm::detail::IRequest', 17, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::nifm::detail::IRequest', 18, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::nifm::detail::IRequest', 19, '0 bytes in - 0x24 bytes out - OutRaw<0x24,4,0>'),
('nn::nifm::detail::IRequest', 20, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::nifm::detail::IRequest', 21, '4 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, OutRaw<4,4,8>, Buffer<0,6,0>, InRaw<4,4,0>'),
('nn::nifm::detail::IRequest', 22, '0 bytes in - 4 bytes out - Buffer<0,0x16,0x410>, OutRaw<4,4,0>'),
('nn::nifm::detail::IRequest', 23, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::nifm::detail::IRequest', 24, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::nifm::detail::IRequest', 25, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::nifm::detail::IScanRequest', 0, '0 bytes in - 0 bytes out'),
('nn::nifm::detail::IScanRequest', 1, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::nifm::detail::IScanRequest', 2, '0 bytes in - 0 bytes out'),
('nn::nifm::detail::IScanRequest', 3, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::nifm::detail::IStaticService', 4, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::nifm::detail::IStaticService', 5, '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>'),
('nn::nim::detail::IAsyncData', 0, '0 bytes in - 0 bytes out'),
('nn::nim::detail::IAsyncData', 1, '0 bytes in - 0 bytes out'),
('nn::nim::detail::IAsyncData', 2, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::nim::detail::IAsyncData', 3, ''),
('nn::nim::detail::IAsyncData', 4, ''),
('nn::nim::detail::IAsyncProgressResult', 0, '0 bytes in - 0 bytes out'),
('nn::nim::detail::IAsyncProgressResult', 1, '0 bytes in - 0 bytes out'),
('nn::nim::detail::IAsyncProgressResult', 2, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::nim::detail::IAsyncResult', 0, '0 bytes in - 0 bytes out'),
('nn::nim::detail::IAsyncResult', 1, '0 bytes in - 0 bytes out'),
('nn::nim::detail::IAsyncValue', 0, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::nim::detail::IAsyncValue', 1, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::nim::detail::IAsyncValue', 2, '0 bytes in - 0 bytes out'),
('nn::nim::detail::INetworkInstallManager', 0, ''),
('nn::nim::detail::INetworkInstallManager', 1, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::nim::detail::INetworkInstallManager', 2, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::nim::detail::INetworkInstallManager', 3, ''),
('nn::nim::detail::INetworkInstallManager', 4, ''),
('nn::nim::detail::INetworkInstallManager', 5, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::nim::detail::INetworkInstallManager', 6, ''),
('nn::nim::detail::INetworkInstallManager', 7, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::nim::detail::INetworkInstallManager', 8, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::nim::detail::INetworkInstallManager', 9, ''),
('nn::nim::detail::INetworkInstallManager', 10, ''),
('nn::nim::detail::INetworkInstallManager', 11, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::nim::detail::INetworkInstallManager', 12, ''),
('nn::nim::detail::INetworkInstallManager', 14, ''),
('nn::nim::detail::INetworkInstallManager', 15, ''),
('nn::nim::detail::INetworkInstallManager', 16, ''),
('nn::nim::detail::INetworkInstallManager', 17, ''),
('nn::nim::detail::INetworkInstallManager', 18, ''),
('nn::nim::detail::INetworkInstallManager', 19, ''),
('nn::nim::detail::INetworkInstallManager', 20, ''),
('nn::nim::detail::INetworkInstallManager', 21, ''),
('nn::nim::detail::INetworkInstallManager', 22, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::nim::detail::INetworkInstallManager', 23, ''),
('nn::nim::detail::INetworkInstallManager', 24, ''),
('nn::nim::detail::INetworkInstallManager', 25, ''),
('nn::nim::detail::INetworkInstallManager', 26, ''),
('nn::nim::detail::INetworkInstallManager', 27, ''),
('nn::nim::detail::INetworkInstallManager', 28, ''),
('nn::nim::detail::INetworkInstallManager', 29, ''),
('nn::nim::detail::INetworkInstallManager', 30, ''),
('nn::nim::detail::INetworkInstallManager', 31, ''),
('nn::nim::detail::INetworkInstallManager', 32, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::nim::detail::INetworkInstallManager', 33, ''),
('nn::nim::detail::INetworkInstallManager', 34, ''),
('nn::nim::detail::INetworkInstallManager', 35, ''),
('nn::nim::detail::INetworkInstallManager', 36, ''),
('nn::nim::detail::INetworkInstallManager', 37, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::nim::detail::INetworkInstallManager', 38, ''),
('nn::nim::detail::INetworkInstallManager', 39, '0 bytes in - 0 bytes out'),
('nn::nim::detail::INetworkInstallManager', 40, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::nim::detail::INetworkInstallManager', 41, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::nim::detail::INetworkInstallManager', 42, ''),
('nn::nim::detail::INetworkInstallManager', 43, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::nim::detail::INetworkInstallManager', 44, ''),
('nn::nim::detail::INetworkInstallManager', 45, ''),
('nn::nim::detail::INetworkInstallManager', 46, '0 bytes in - 0 bytes out'),
('nn::nim::detail::IShopServiceManager', 0, ''),
('nn::nim::detail::IShopServiceManager', 1, ''),
('nn::nim::detail::IShopServiceManager', 100, ''),
('nn::nim::detail::IShopServiceManager', 101, ''),
('nn::nim::detail::IShopServiceManager', 102, ''),
('nn::nim::detail::IShopServiceManager', 103, '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>'),
('nn::nim::detail::IShopServiceManager', 104, ''),
('nn::nim::detail::IShopServiceManager', 105, ''),
('nn::nim::detail::IShopServiceManager', 106, ''),
('nn::nim::detail::IShopServiceManager', 107, '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,8,0>'),
('nn::nim::detail::IShopServiceManager', 200, ''),
('nn::nim::detail::IShopServiceManager', 300, ''),
('nn::nim::detail::IShopServiceManager', 301, ''),
('nn::nim::detail::IShopServiceManager', 302, ''),
('nn::nim::detail::IShopServiceManager', 303, ''),
('nn::nim::detail::IShopServiceManager', 400, ''),
('nn::nim::detail::IShopServiceManager', 500, ''),
('nn::nim::detail::IShopServiceManager', 501, ''),
('nn::npns::INpnsSystem', 1, '0 bytes in - 0 bytes out'),
('nn::npns::INpnsSystem', 2, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::npns::INpnsSystem', 3, ''),
('nn::npns::INpnsSystem', 4, ''),
('nn::npns::INpnsSystem', 5, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::npns::INpnsSystem', 6, '0 bytes in - 0 bytes out'),
('nn::npns::INpnsSystem', 7, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::npns::INpnsSystem', 11, ''),
('nn::npns::INpnsSystem', 12, ''),
('nn::npns::INpnsSystem', 13, ''),
('nn::npns::INpnsSystem', 21, ''),
('nn::npns::INpnsSystem', 22, ''),
('nn::npns::INpnsSystem', 23, ''),
('nn::npns::INpnsSystem', 24, ''),
('nn::npns::INpnsSystem', 25, ''),
('nn::npns::INpnsSystem', 31, ''),
('nn::npns::INpnsSystem', 32, ''),
('nn::npns::INpnsSystem', 101, '0 bytes in - 0 bytes out'),
('nn::npns::INpnsSystem', 102, '0 bytes in - 0 bytes out'),
('nn::npns::INpnsSystem', 103, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::npns::INpnsSystem', 104, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::npns::INpnsSystem', 105, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::npns::INpnsSystem', 111, ''),
('nn::npns::INpnsSystem', 112, '0 bytes in - 0 bytes out'),
('nn::npns::INpnsSystem', 113, '0 bytes in - 0 bytes out'),
('nn::npns::INpnsSystem', 114, ''),
('nn::npns::INpnsSystem', 115, ''),
('nn::npns::INpnsSystem', 201, ''),
('nn::npns::INpnsSystem', 202, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::npns::INpnsUser', 1, '0 bytes in - 0 bytes out'),
('nn::npns::INpnsUser', 2, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::npns::INpnsUser', 3, ''),
('nn::npns::INpnsUser', 4, ''),
('nn::npns::INpnsUser', 5, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::npns::INpnsUser', 7, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::npns::INpnsUser', 21, ''),
('nn::npns::INpnsUser', 23, ''),
('nn::npns::INpnsUser', 25, ''),
('nn::npns::INpnsUser', 101, '0 bytes in - 0 bytes out'),
('nn::npns::INpnsUser', 102, '0 bytes in - 0 bytes out'),
('nn::npns::INpnsUser', 103, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::npns::INpnsUser', 104, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::npns::INpnsUser', 111, ''),
('nn::ns::detail::IAccountProxyInterface', 0, ''),
('nn::ns::detail::IApplicationManagerInterface', 0, ''),
('nn::ns::detail::IApplicationManagerInterface', 1, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 2, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::ns::detail::IApplicationManagerInterface', 3, ''),
('nn::ns::detail::IApplicationManagerInterface', 4, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 5, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 6, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::ns::detail::IApplicationManagerInterface', 7, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 8, ''),
('nn::ns::detail::IApplicationManagerInterface', 9, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::ns::detail::IApplicationManagerInterface', 11, ''),
('nn::ns::detail::IApplicationManagerInterface', 16, ''),
('nn::ns::detail::IApplicationManagerInterface', 17, ''),
('nn::ns::detail::IApplicationManagerInterface', 19, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 21, ''),
('nn::ns::detail::IApplicationManagerInterface', 22, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 23, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::ns::detail::IApplicationManagerInterface', 26, ''),
('nn::ns::detail::IApplicationManagerInterface', 27, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 30, ''),
('nn::ns::detail::IApplicationManagerInterface', 31, ''),
('nn::ns::detail::IApplicationManagerInterface', 32, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 33, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 35, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::ns::detail::IApplicationManagerInterface', 36, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::ns::detail::IApplicationManagerInterface', 37, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::ns::detail::IApplicationManagerInterface', 38, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 39, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 40, ''),
('nn::ns::detail::IApplicationManagerInterface', 41, ''),
('nn::ns::detail::IApplicationManagerInterface', 42, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 43, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 44, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::ns::detail::IApplicationManagerInterface', 45, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::ns::detail::IApplicationManagerInterface', 46, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 47, ''),
('nn::ns::detail::IApplicationManagerInterface', 48, ''),
('nn::ns::detail::IApplicationManagerInterface', 49, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::ns::detail::IApplicationManagerInterface', 52, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::ns::detail::IApplicationManagerInterface', 53, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 54, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 55, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>'),
('nn::ns::detail::IApplicationManagerInterface', 56, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::ns::detail::IApplicationManagerInterface', 57, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 58, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 59, ''),
('nn::ns::detail::IApplicationManagerInterface', 60, ''),
('nn::ns::detail::IApplicationManagerInterface', 61, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 62, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::ns::detail::IApplicationManagerInterface', 63, '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 64, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 65, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::ns::detail::IApplicationManagerInterface', 66, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 67, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 68, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 69, ''),
('nn::ns::detail::IApplicationManagerInterface', 70, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 71, ''),
('nn::ns::detail::IApplicationManagerInterface', 80, ''),
('nn::ns::detail::IApplicationManagerInterface', 81, ''),
('nn::ns::detail::IApplicationManagerInterface', 82, ''),
('nn::ns::detail::IApplicationManagerInterface', 100, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 101, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 102, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 200, ''),
('nn::ns::detail::IApplicationManagerInterface', 201, ''),
('nn::ns::detail::IApplicationManagerInterface', 210, ''),
('nn::ns::detail::IApplicationManagerInterface', 220, ''),
('nn::ns::detail::IApplicationManagerInterface', 300, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::ns::detail::IApplicationManagerInterface', 301, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::ns::detail::IApplicationManagerInterface', 302, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 303, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 304, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 305, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 306, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 307, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 400, ''),
('nn::ns::detail::IApplicationManagerInterface', 401, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 402, ''),
('nn::ns::detail::IApplicationManagerInterface', 403, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::ns::detail::IApplicationManagerInterface', 404, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 405, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::ns::detail::IApplicationManagerInterface', 502, ''),
('nn::ns::detail::IApplicationManagerInterface', 503, ''),
('nn::ns::detail::IApplicationManagerInterface', 504, ''),
('nn::ns::detail::IApplicationManagerInterface', 505, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::ns::detail::IApplicationManagerInterface', 506, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::ns::detail::IApplicationManagerInterface', 507, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 508, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 600, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 601, ''),
('nn::ns::detail::IApplicationManagerInterface', 602, ''),
('nn::ns::detail::IApplicationManagerInterface', 603, ''),
('nn::ns::detail::IApplicationManagerInterface', 604, '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::ns::detail::IApplicationManagerInterface', 605, ''),
('nn::ns::detail::IApplicationManagerInterface', 606, ''),
('nn::ns::detail::IApplicationManagerInterface', 700, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::ns::detail::IApplicationManagerInterface', 701, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 702, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 703, ''),
('nn::ns::detail::IApplicationManagerInterface', 704, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::ns::detail::IApplicationManagerInterface', 705, ''),
('nn::ns::detail::IApplicationManagerInterface', 800, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 801, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::ns::detail::IApplicationManagerInterface', 802, ''),
('nn::ns::detail::IApplicationManagerInterface', 900, ''),
('nn::ns::detail::IApplicationManagerInterface', 901, ''),
('nn::ns::detail::IApplicationManagerInterface', 902, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 903, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 904, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 905, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::ns::detail::IApplicationManagerInterface', 906, ''),
('nn::ns::detail::IApplicationManagerInterface', 907, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 908, ''),
('nn::ns::detail::IApplicationManagerInterface', 909, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 1000, ''),
('nn::ns::detail::IApplicationManagerInterface', 1001, ''),
('nn::ns::detail::IApplicationManagerInterface', 1002, ''),
('nn::ns::detail::IApplicationManagerInterface', 1200, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::ns::detail::IApplicationManagerInterface', 1300, '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 1301, ''),
('nn::ns::detail::IApplicationManagerInterface', 1302, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 1303, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 1304, ''),
('nn::ns::detail::IApplicationManagerInterface', 1400, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 1500, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 1501, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::ns::detail::IApplicationManagerInterface', 1502, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 1504, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 1505, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 1600, '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>'),
('nn::ns::detail::IApplicationManagerInterface', 1601, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IApplicationManagerInterface', 1700, ''),
('nn::ns::detail::IApplicationManagerInterface', 1701, ''),
('nn::ns::detail::IApplicationManagerInterface', 1702, '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 1800, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::ns::detail::IApplicationManagerInterface', 1801, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::ns::detail::IApplicationManagerInterface', 1802, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::ns::detail::IApplicationManagerInterface', 1803, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::ns::detail::IApplicationManagerInterface', 1900, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>'),
('nn::ns::detail::IAsyncResult', 0, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IAsyncResult', 1, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IAsyncValue', 0, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::ns::detail::IAsyncValue', 1, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::ns::detail::IAsyncValue', 2, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IContentManagementInterface', 11, ''),
('nn::ns::detail::IContentManagementInterface', 43, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IContentManagementInterface', 47, ''),
('nn::ns::detail::IContentManagementInterface', 48, ''),
('nn::ns::detail::IContentManagementInterface', 600, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>'),
('nn::ns::detail::IContentManagementInterface', 601, ''),
('nn::ns::detail::IContentManagementInterface', 605, ''),
('nn::ns::detail::IContentManagementInterface', 607, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::ns::detail::IDevelopInterface', 0, ''),
('nn::ns::detail::IDevelopInterface', 1, ''),
('nn::ns::detail::IDevelopInterface', 2, ''),
('nn::ns::detail::IDevelopInterface', 4, ''),
('nn::ns::detail::IDevelopInterface', 5, ''),
('nn::ns::detail::IDevelopInterface', 6, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IDevelopInterface', 7, ''),
('nn::ns::detail::IDevelopInterface', 8, ''),
('nn::ns::detail::IDevelopInterface', 9, ''),
('nn::ns::detail::IDocumentInterface', 21, ''),
('nn::ns::detail::IDocumentInterface', 23, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::ns::detail::IDownloadTaskInterface', 701, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IDownloadTaskInterface', 702, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IDownloadTaskInterface', 703, ''),
('nn::ns::detail::IDownloadTaskInterface', 704, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::ns::detail::IDownloadTaskInterface', 705, ''),
('nn::ns::detail::IFactoryResetInterface', 100, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IFactoryResetInterface', 101, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IFactoryResetInterface', 102, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IProgressAsyncResult', 0, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IProgressAsyncResult', 1, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IProgressAsyncResult', 2, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::ns::detail::IProgressAsyncResult', 3, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IProgressMonitorForDeleteUserSaveDataAll', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::ns::detail::IProgressMonitorForDeleteUserSaveDataAll', 1, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::ns::detail::IProgressMonitorForDeleteUserSaveDataAll', 2, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IProgressMonitorForDeleteUserSaveDataAll', 10, '0 bytes in - 0x28 bytes out - OutRaw<0x28,8,0>'),
('nn::ns::detail::IServiceGetterInterface', 7994, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::ns::detail::IServiceGetterInterface', 7995, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::ns::detail::IServiceGetterInterface', 7996, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::ns::detail::IServiceGetterInterface', 7997, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::ns::detail::IServiceGetterInterface', 7998, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::ns::detail::IServiceGetterInterface', 7999, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::ns::detail::ISystemUpdateControl', 0, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::ns::detail::ISystemUpdateControl', 1, ''),
('nn::ns::detail::ISystemUpdateControl', 2, ''),
('nn::ns::detail::ISystemUpdateControl', 3, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::ns::detail::ISystemUpdateControl', 4, '0 bytes in - 0 bytes out'),
('nn::ns::detail::ISystemUpdateControl', 5, ''),
('nn::ns::detail::ISystemUpdateControl', 6, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::ns::detail::ISystemUpdateControl', 7, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::ns::detail::ISystemUpdateControl', 8, '0 bytes in - 0 bytes out'),
('nn::ns::detail::ISystemUpdateControl', 9, ''),
('nn::ns::detail::ISystemUpdateControl', 10, ''),
('nn::ns::detail::ISystemUpdateControl', 11, ''),
('nn::ns::detail::ISystemUpdateControl', 12, ''),
('nn::ns::detail::ISystemUpdateControl', 13, ''),
('nn::ns::detail::ISystemUpdateInterface', 0, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::ns::detail::ISystemUpdateInterface', 1, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::ns::detail::ISystemUpdateInterface', 2, '0 bytes in - 0 bytes out'),
('nn::ns::detail::ISystemUpdateInterface', 3, '0 bytes in - 0 bytes out'),
('nn::ns::detail::ISystemUpdateInterface', 4, '0 bytes in - 0 bytes out'),
('nn::ns::detail::ISystemUpdateInterface', 5, ''),
('nn::ns::detail::ISystemUpdateInterface', 6, '0 bytes in - 0 bytes out'),
('nn::ns::detail::ISystemUpdateInterface', 9, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::ns::detail::ISystemUpdateInterface', 10, '0 bytes in - 0 bytes out'),
('nn::ns::detail::ISystemUpdateInterface', 11, '0 bytes in - 0 bytes out'),
('nn::ns::detail::ISystemUpdateInterface', 12, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::ns::detail::ISystemUpdateInterface', 13, '0 bytes in - 0 bytes out'),
('nn::ns::detail::ISystemUpdateInterface', 14, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::ns::detail::ISystemUpdateInterface', 15, '0 bytes in - 0 bytes out'),
('nn::ns::detail::IVulnerabilityManagerInterface', 1200, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::nsd::detail::IManager', 10, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x100>'),
('nn::nsd::detail::IManager', 11, '0 bytes in - 0 bytes out - Buffer<0,0x16,8>'),
('nn::nsd::detail::IManager', 12, '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>'),
('nn::nsd::detail::IManager', 13, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::nsd::detail::IManager', 14, '4 bytes in - 0 bytes out - Buffer<0,5,0>, Buffer<1,6,0>, InRaw<4,4,0>'),
('nn::nsd::detail::IManager', 20, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x100>, Buffer<1,0x15,0x100>'),
('nn::nsd::detail::IManager', 21, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0x16,0x100>, Buffer<1,0x15,0x100>'),
('nn::nsd::detail::IManager', 30, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x108>, Buffer<1,0x15,0x10>'),
('nn::nsd::detail::IManager', 31, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0x16,0x108>, Buffer<1,0x15,0x10>'),
('nn::nsd::detail::IManager', 40, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x100>'),
('nn::nsd::detail::IManager', 41, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0x16,0x100>'),
('nn::nsd::detail::IManager', 42, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x100>'),
('nn::nsd::detail::IManager', 43, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0x16,0x100>'),
('nn::nsd::detail::IManager', 50, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x12BF0>'),
('nn::nsd::detail::IManager', 60, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x12BF0>'),
('nn::nsd::detail::IManager', 61, '0 bytes in - 0 bytes out - Buffer<0,0x15,0x12BF0>'),
('nn::nsd::detail::IManager', 62, '0 bytes in - 0 bytes out'),
('nn::ntc::detail::service::IEnsureNetworkClockAvailabilityService', 0, '0 bytes in - 0 bytes out'),
('nn::ntc::detail::service::IEnsureNetworkClockAvailabilityService', 1, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::ntc::detail::service::IEnsureNetworkClockAvailabilityService', 2, '0 bytes in - 0 bytes out'),
('nn::ntc::detail::service::IEnsureNetworkClockAvailabilityService', 3, '0 bytes in - 0 bytes out'),
('nn::ntc::detail::service::IEnsureNetworkClockAvailabilityService', 4, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::ntc::detail::service::IEnsureNetworkClockAvailabilityService', 5, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::ntc::detail::service::IStaticService', 0, '8 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::ntc::detail::service::IStaticService', 100, '0 bytes in - 0 bytes out'),
('nn::ntc::detail::service::IStaticService', 101, '0 bytes in - 0 bytes out'),
('nn::omm::detail::IOperationModeManager', 0, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::omm::detail::IOperationModeManager', 1, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::omm::detail::IOperationModeManager', 2, '0 bytes in - 0 bytes out'),
('nn::omm::detail::IOperationModeManager', 3, '0 bytes in - 0 bytes out'),
('nn::omm::detail::IOperationModeManager', 4, ''),
('nn::omm::detail::IOperationModeManager', 5, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::omm::detail::IOperationModeManager', 6, '0 bytes in - 0 bytes out'),
('nn::omm::detail::IOperationModeManager', 7, '0 bytes in - 0 bytes out'),
('nn::omm::detail::IOperationModeManager', 8, ''),
('nn::omm::detail::IOperationModeManager', 9, '0 bytes in - 0 bytes out'),
('nn::omm::detail::IOperationModeManager', 10, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::omm::detail::IOperationModeManager', 11, ''),
('nn::omm::detail::IOperationModeManager', 12, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::omm::detail::IOperationModeManager', 13, '0 bytes in - 0 bytes out'),
('nn::omm::detail::IOperationModeManager', 14, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::ovln::IReceiver', 0, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::ovln::IReceiver', 1, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::ovln::IReceiver', 2, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::ovln::IReceiver', 3, ''),
('nn::ovln::IReceiver', 4, ''),
('nn::ovln::IReceiverService', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::ovln::ISender', 0, ''),
('nn::ovln::ISender', 1, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::ovln::ISenderService', 0, ''),
('nn::pcie::detail::IManager', 0, ''),
('nn::pcie::detail::IManager', 1, ''),
('nn::pcie::detail::ISession', 0, ''),
('nn::pcie::detail::ISession', 1, ''),
('nn::pcie::detail::ISession', 2, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::pcie::detail::ISession', 3, ''),
('nn::pcie::detail::ISession', 4, ''),
('nn::pcie::detail::ISession', 5, ''),
('nn::pcie::detail::ISession', 6, ''),
('nn::pcie::detail::ISession', 7, ''),
('nn::pcie::detail::ISession', 8, ''),
('nn::pcie::detail::ISession', 9, ''),
('nn::pcie::detail::ISession', 10, ''),
('nn::pcie::detail::ISession', 11, ''),
('nn::pcie::detail::ISession', 12, ''),
('nn::pcie::detail::ISession', 13, ''),
('nn::pcie::detail::ISession', 14, ''),
('nn::pcie::detail::ISession', 15, ''),
('nn::pcie::detail::ISession', 16, '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>'),
('nn::pcie::detail::ISession', 17, ''),
('nn::pcie::detail::ISession', 18, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::pcie::detail::ISession', 19, ''),
('nn::pcie::detail::ISession', 20, '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>'),
('nn::pcie::detail::ISession', 21, '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1001, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1002, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, Buffer<0,9,0>, InRaw<1,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1003, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, Buffer<0,9,0>, InRaw<1,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1004, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1005, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1006, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1007, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1008, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1009, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1010, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1011, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1012, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1031, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1032, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1033, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1034, '4 bytes in - 3 bytes out - OutRaw<3,1,0>, InRaw<4,4,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1035, '0 bytes in - 3 bytes out - OutRaw<3,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1036, '3 bytes in - 0 bytes out - InRaw<3,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1037, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1038, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1039, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1042, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1043, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1044, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<4,4,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1045, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1046, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1047, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1201, '0 bytes in - 0 bytes out - Buffer<0,9,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1202, '0 bytes in - 0 bytes out - Buffer<0,9,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1203, '0 bytes in - 0 bytes out - Buffer<0,9,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1204, '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1205, '0x20 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<0x20,1,0>, Buffer<0,9,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1206, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1207, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::pctl::detail::ipc::IParentalControlService', 1403, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1406, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1411, '0x10 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<0x10,8,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1421, '0x10 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>, InRaw<0x10,8,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1424, '0x10 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<0x10,8,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1432, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::pctl::detail::ipc::IParentalControlService', 1451, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1452, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1453, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1454, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1455, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1456, '0 bytes in - 0x34 bytes out - OutRaw<0x34,2,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1457, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::pctl::detail::ipc::IParentalControlService', 1471, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1472, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1473, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::pctl::detail::ipc::IParentalControlService', 1474, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1601, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1602, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1603, '0 bytes in - 2 bytes out - OutRaw<1,1,0>, OutRaw<1,1,1>'),
('nn::pctl::detail::ipc::IParentalControlService', 1901, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1902, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1941, '0 bytes in - 0 bytes out'),
('nn::pctl::detail::ipc::IParentalControlService', 1951, '0x34 bytes in - 0 bytes out - InRaw<0x34,2,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 1952, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 2001, '0 bytes in - 8 bytes out - OutRaw<8,4,0>, OutHandle<0,1>, Buffer<0,9,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 2002, '8 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<8,4,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 2003, '0x10 bytes in - 8 bytes out - OutRaw<8,4,0>, OutHandle<0,1>, InRaw<0x10,8,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 2004, '8 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<8,4,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 2005, '0 bytes in - 8 bytes out - OutRaw<8,4,0>, OutHandle<0,1>'),
('nn::pctl::detail::ipc::IParentalControlService', 2006, '8 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>, InRaw<8,4,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 2007, '1 bytes in - 8 bytes out - OutRaw<8,4,0>, OutHandle<0,1>, InRaw<1,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 2008, '0xC bytes in - 0 bytes out - InRaw<8,4,4>, InRaw<1,1,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 2009, '0x10 bytes in - 0xC bytes out - OutRaw<8,4,0>, OutHandle<0,1>, OutRaw<4,4,8>, Buffer<0,6,0>, InRaw<0x10,8,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 2010, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<8,4,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 2011, '0x10 bytes in - 0xC bytes out - OutRaw<8,4,0>, OutHandle<0,1>, OutRaw<4,4,8>, Buffer<0,0xA,0>, InRaw<0x10,8,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 2012, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>, InRaw<8,4,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 2013, '0 bytes in - 8 bytes out - OutRaw<8,4,0>, OutHandle<0,1>'),
('nn::pctl::detail::ipc::IParentalControlService', 2014, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::pctl::detail::ipc::IParentalControlService', 2015, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,4,0>'),
('nn::pctl::detail::ipc::IParentalControlServiceFactory', 0, '8 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<8,8,0>'),
('nn::pcv::IArbitrationManager', 0, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::pcv::IImmediateManager', 0, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::pcv::detail::IPcvService', 0, '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>'),
('nn::pcv::detail::IPcvService', 1, '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>'),
('nn::pcv::detail::IPcvService', 2, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::pcv::detail::IPcvService', 3, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::pcv::detail::IPcvService', 4, '4 bytes in - 0xC bytes out - OutRaw<0xC,4,0>, InRaw<4,4,0>'),
('nn::pcv::detail::IPcvService', 5, '8 bytes in - 8 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::pcv::detail::IPcvService', 6, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::pcv::detail::IPcvService', 7, '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>'),
('nn::pcv::detail::IPcvService', 8, '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>'),
('nn::pcv::detail::IPcvService', 9, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>'),
('nn::pcv::detail::IPcvService', 10, '4 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, OutRaw<4,4,8>, InRaw<4,4,0>'),
('nn::pcv::detail::IPcvService', 11, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::pcv::detail::IPcvService', 12, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::pcv::detail::IPcvService', 13, '4 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::pcv::detail::IPcvService', 14, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::pcv::detail::IPcvService', 15, '0 bytes in - 0 bytes out'),
('nn::pcv::detail::IPcvService', 16, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::pcv::detail::IPcvService', 17, '0 bytes in - 0 bytes out'),
('nn::pcv::detail::IPcvService', 18, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::pcv::detail::IPcvService', 19, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::pcv::detail::IPcvService', 20, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::pcv::detail::IPcvService', 21, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::pcv::detail::IPcvService', 22, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::pcv::detail::IPcvService', 23, '8 bytes in - 4 bytes out - Buffer<0,0xA,0>, Buffer<1,0xA,0>, OutRaw<4,4,0>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::pcv::detail::IPcvService', 24, '4 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::pcv::detail::IPcvService', 25, '4 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::pcv::detail::IPcvService', 26, '4 bytes in - 4 bytes out - Buffer<0,0xA,0>, OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::pdm::detail::INotifyService', 0, ''),
('nn::pdm::detail::INotifyService', 2, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::pdm::detail::INotifyService', 3, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::pdm::detail::INotifyService', 4, '0 bytes in - 0 bytes out'),
('nn::pdm::detail::INotifyService', 5, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::pdm::detail::IQueryService', 0, ''),
('nn::pdm::detail::IQueryService', 1, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::pdm::detail::IQueryService', 2, ''),
('nn::pdm::detail::IQueryService', 3, ''),
('nn::pdm::detail::IQueryService', 4, ''),
('nn::pdm::detail::IQueryService', 5, ''),
('nn::pdm::detail::IQueryService', 6, ''),
('nn::pdm::detail::IQueryService', 7, ''),
('nn::pdm::detail::IQueryService', 8, ''),
('nn::pdm::detail::IQueryService', 9, ''),
('nn::pdm::detail::IQueryService', 10, ''),
('nn::pinmux::IManager', 0, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::pinmux::ISession', 0, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::pinmux::ISession', 1, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::pinmux::ISession', 2, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::pl::detail::ISharedFontManager', 0, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::pl::detail::ISharedFontManager', 1, '4 bytes in - 4 bytes out - InRaw<4,4,0>, OutRaw<4,4,0>'),
('nn::pl::detail::ISharedFontManager', 2, '4 bytes in - 4 bytes out - InRaw<4,4,0>, OutRaw<4,4,0>'),
('nn::pl::detail::ISharedFontManager', 3, '4 bytes in - 4 bytes out - InRaw<4,4,0>, OutRaw<4,4,0>'),
('nn::pl::detail::ISharedFontManager', 4, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::pl::detail::ISharedFontManager', 5, '8 bytes in - 8 bytes out - OutRaw<1,1,0>, OutRaw<4,4,4>, Buffer<0,6,0>, Buffer<1,6,0>, Buffer<2,6,0>, InRaw<8,1,0>'),
('nn::pm::detail::IBootModeInterface', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::pm::detail::IBootModeInterface', 1, '0 bytes in - 0 bytes out'),
('nn::pm::detail::IInformationInterface', 0, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>'),
('nn::pm::detail::IShellInterface', 0, ''),
('nn::pm::detail::IShellInterface', 1, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::pm::detail::IShellInterface', 2, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::pm::detail::IShellInterface', 3, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::pm::detail::IShellInterface', 4, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::pm::detail::IShellInterface', 5, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::pm::detail::IShellInterface', 6, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::pm::detail::IShellInterface', 7, '0 bytes in - 0 bytes out'),
('nn::pm::detail::IShellInterface', 8, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::prepo::detail::ipc::IPrepoService', 10100, '8 bytes in - 0 bytes out - takes pid - Buffer<0,9,0>, Buffer<1,5,0>, InRaw<8,8,0>'),
('nn::prepo::detail::ipc::IPrepoService', 10101, '0x18 bytes in - 0 bytes out - takes pid - InRaw<0x10,8,0>, Buffer<0,9,0>, Buffer<1,5,0>, InRaw<8,8,0x10>'),
('nn::prepo::detail::ipc::IPrepoService', 10200, '0 bytes in - 0 bytes out'),
('nn::prepo::detail::ipc::IPrepoService', 10300, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::prepo::detail::ipc::IPrepoService', 20100, '8 bytes in - 0 bytes out - Buffer<0,9,0>, InRaw<8,8,0>, Buffer<1,5,0>'),
('nn::prepo::detail::ipc::IPrepoService', 20101, '0x18 bytes in - 0 bytes out - InRaw<0x10,8,0>, Buffer<0,9,0>, InRaw<8,8,0x10>, Buffer<1,5,0>'),
('nn::prepo::detail::ipc::IPrepoService', 30100, '0 bytes in - 0 bytes out'),
('nn::prepo::detail::ipc::IPrepoService', 40100, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::prepo::detail::ipc::IPrepoService', 40101, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::prepo::detail::ipc::IPrepoService', 90100, '0 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>'),
('nn::psc::sf::IPmControl', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::psc::sf::IPmControl', 1, '0xC bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>'),
('nn::psc::sf::IPmControl', 2, '0 bytes in - 0 bytes out'),
('nn::psc::sf::IPmControl', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::psc::sf::IPmControl', 4, '0 bytes in - 0 bytes out'),
('nn::psc::sf::IPmControl', 5, '0 bytes in - 0 bytes out'),
('nn::psc::sf::IPmControl', 6, ''),
('nn::psc::sf::IPmModule', 0, ''),
('nn::psc::sf::IPmModule', 1, ''),
('nn::psc::sf::IPmModule', 2, '0 bytes in - 0 bytes out'),
('nn::psc::sf::IPmModule', 3, '0 bytes in - 0 bytes out'),
('nn::psc::sf::IPmService', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::psm::IPsmServer', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::psm::IPsmServer', 1, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::psm::IPsmServer', 2, '0 bytes in - 0 bytes out'),
('nn::psm::IPsmServer', 3, '0 bytes in - 0 bytes out'),
('nn::psm::IPsmServer', 4, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::psm::IPsmServer', 5, '0 bytes in - 0 bytes out'),
('nn::psm::IPsmServer', 6, '0 bytes in - 0 bytes out'),
('nn::psm::IPsmServer', 7, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::psm::IPsmServer', 8, '0 bytes in - 0 bytes out'),
('nn::psm::IPsmServer', 9, '0 bytes in - 0 bytes out'),
('nn::psm::IPsmServer', 10, '0 bytes in - 0 bytes out'),
('nn::psm::IPsmServer', 11, '0 bytes in - 0 bytes out'),
('nn::psm::IPsmServer', 12, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::psm::IPsmServer', 13, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::psm::IPsmServer', 14, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::psm::IPsmServer', 15, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::psm::IPsmServer', 16, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::psm::IPsmServer', 17, ''),
('nn::psm::IPsmServer', 18, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::psm::IPsmSession', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::psm::IPsmSession', 1, '0 bytes in - 0 bytes out'),
('nn::psm::IPsmSession', 2, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::psm::IPsmSession', 3, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::psm::IPsmSession', 4, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::pwm::IChannelSession', 0, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::pwm::IChannelSession', 1, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::pwm::IChannelSession', 2, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::pwm::IChannelSession', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::pwm::IChannelSession', 4, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::pwm::IChannelSession', 5, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::pwm::IManager', 0, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::pwm::IManager', 1, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::ro::detail::IRoInterface', 0, '0x28 bytes in - 8 bytes out - takes pid - OutRaw<8,8,0>, InRaw<8,8,0>, InRaw<8,8,8>, InRaw<8,8,0x10>, InRaw<8,8,0x18>, InRaw<8,8,0x20>'),
('nn::ro::detail::IRoInterface', 1, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::ro::detail::IRoInterface', 2, '0x18 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>, InRaw<8,8,0x10>'),
('nn::ro::detail::IRoInterface', 3, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::ro::detail::IRoInterface', 4, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>, InHandle<0,1>'),
('nn::sasbus::IManager', 0, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::sasbus::ISession', 0, ''),
('nn::sasbus::ISession', 1, ''),
('nn::sasbus::ISession', 2, ''),
('nn::sasbus::ISession', 3, '0 bytes in - 0 bytes out'),
('nn::settings::IFactorySettingsServer', 0, '0 bytes in - 6 bytes out - OutRaw<6,1,0>'),
('nn::settings::IFactorySettingsServer', 1, '0 bytes in - 0x1E bytes out - OutRaw<0x1E,1,0>'),
('nn::settings::IFactorySettingsServer', 2, '0 bytes in - 6 bytes out - OutRaw<6,2,0>'),
('nn::settings::IFactorySettingsServer', 3, '0 bytes in - 6 bytes out - OutRaw<6,2,0>'),
('nn::settings::IFactorySettingsServer', 4, '0 bytes in - 6 bytes out - OutRaw<6,2,0>'),
('nn::settings::IFactorySettingsServer', 5, '0 bytes in - 6 bytes out - OutRaw<6,2,0>'),
('nn::settings::IFactorySettingsServer', 6, '0 bytes in - 6 bytes out - OutRaw<6,1,0>'),
('nn::settings::IFactorySettingsServer', 7, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::settings::IFactorySettingsServer', 8, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>'),
('nn::settings::IFactorySettingsServer', 9, '0 bytes in - 0x18 bytes out - OutRaw<0x18,1,0>'),
('nn::settings::IFactorySettingsServer', 10, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::settings::IFactorySettingsServer', 11, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::settings::IFactorySettingsServer', 12, '0 bytes in - 0x18 bytes out - OutRaw<0x18,1,0>'),
('nn::settings::IFactorySettingsServer', 14, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x180>'),
('nn::settings::IFactorySettingsServer', 15, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x240>'),
('nn::settings::IFactorySettingsServer', 16, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x134>'),
('nn::settings::IFactorySettingsServer', 17, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x804>'),
('nn::settings::IFactorySettingsServer', 18, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x134>'),
('nn::settings::IFactorySettingsServer', 19, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x400>'),
('nn::settings::IFactorySettingsServer', 20, '0 bytes in - 0x54 bytes out - OutRaw<0x54,4,0>'),
('nn::settings::IFactorySettingsServer', 21, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x244>'),
('nn::settings::IFactorySettingsServer', 22, '0 bytes in - 0x5A bytes out - OutRaw<0x5A,2,0>'),
('nn::settings::IFirmwareDebugSettingsServer', 2, '0 bytes in - 0 bytes out - Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>, Buffer<2,5,0>'),
('nn::settings::IFirmwareDebugSettingsServer', 3, '0 bytes in - 0 bytes out - Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>'),
('nn::settings::IFirmwareDebugSettingsServer', 4, '0 bytes in - 0 bytes out - OutObject<0,0>, Buffer<0,0x19,0x48>'),
('nn::settings::ISettingsItemKeyIterator', 0, '0 bytes in - 0 bytes out'),
('nn::settings::ISettingsItemKeyIterator', 1, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::settings::ISettingsItemKeyIterator', 2, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>'),
('nn::settings::ISettingsServer', 0, '0 bytes in - 8 bytes out - OutRaw<8,1,0>'),
('nn::settings::ISettingsServer', 1, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>'),
('nn::settings::ISettingsServer', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::settings::ISettingsServer', 4, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 0, '8 bytes in - 0 bytes out - InRaw<8,1,0>'),
('nn::settings::ISystemSettingsServer', 1, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::settings::ISystemSettingsServer', 2, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::settings::ISystemSettingsServer', 3, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>'),
('nn::settings::ISystemSettingsServer', 4, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>'),
('nn::settings::ISystemSettingsServer', 7, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 8, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 9, '0 bytes in - 0x28 bytes out - OutRaw<0x28,4,0>'),
('nn::settings::ISystemSettingsServer', 10, '0x28 bytes in - 0 bytes out - InRaw<0x28,4,0>'),
('nn::settings::ISystemSettingsServer', 11, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::settings::ISystemSettingsServer', 12, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::settings::ISystemSettingsServer', 13, '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>'),
('nn::settings::ISystemSettingsServer', 14, '0x10 bytes in - 0 bytes out - InRaw<0x10,1,0>'),
('nn::settings::ISystemSettingsServer', 15, '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>'),
('nn::settings::ISystemSettingsServer', 16, '0x20 bytes in - 0 bytes out - InRaw<0x20,8,0>'),
('nn::settings::ISystemSettingsServer', 17, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 18, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 19, '4 bytes in - 8 bytes out - OutRaw<8,4,0>, InRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 20, '0xC bytes in - 0 bytes out - InRaw<8,4,0>, InRaw<4,4,8>'),
('nn::settings::ISystemSettingsServer', 21, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::settings::ISystemSettingsServer', 22, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::settings::ISystemSettingsServer', 23, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 24, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 25, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 26, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 27, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 28, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 29, '0 bytes in - 0x18 bytes out - OutRaw<0x18,4,0>'),
('nn::settings::ISystemSettingsServer', 30, '0x18 bytes in - 0 bytes out - InRaw<0x18,4,0>'),
('nn::settings::ISystemSettingsServer', 31, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::settings::ISystemSettingsServer', 32, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::settings::ISystemSettingsServer', 35, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 36, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 37, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>'),
('nn::settings::ISystemSettingsServer', 38, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<2,6,0>, Buffer<0,0x19,0x48>, Buffer<1,0x19,0x48>'),
('nn::settings::ISystemSettingsServer', 39, '0 bytes in - 0x20 bytes out - OutRaw<0x20,4,0>'),
('nn::settings::ISystemSettingsServer', 40, '0x20 bytes in - 0 bytes out - InRaw<0x20,4,0>'),
('nn::settings::ISystemSettingsServer', 41, '0 bytes in - 0 bytes out - Buffer<0,0x1A,0x100>'),
('nn::settings::ISystemSettingsServer', 42, '0 bytes in - 0 bytes out - Buffer<0,0x19,0x100>'),
('nn::settings::ISystemSettingsServer', 43, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 44, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::settings::ISystemSettingsServer', 45, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 46, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 47, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 48, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 49, '0 bytes in - 8 bytes out - OutRaw<8,4,0>'),
('nn::settings::ISystemSettingsServer', 50, '8 bytes in - 0 bytes out - InRaw<8,4,0>'),
('nn::settings::ISystemSettingsServer', 51, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::settings::ISystemSettingsServer', 52, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::settings::ISystemSettingsServer', 53, '0 bytes in - 0x24 bytes out - OutRaw<0x24,1,0>'),
('nn::settings::ISystemSettingsServer', 54, '0x24 bytes in - 0 bytes out - InRaw<0x24,1,0>'),
('nn::settings::ISystemSettingsServer', 55, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::settings::ISystemSettingsServer', 56, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>'),
('nn::settings::ISystemSettingsServer', 57, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 58, '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>'),
('nn::settings::ISystemSettingsServer', 59, '0x20 bytes in - 0 bytes out - InRaw<0x20,8,0>'),
('nn::settings::ISystemSettingsServer', 60, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 61, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 62, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 63, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 64, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 65, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 66, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 67, '0 bytes in - 0x18 bytes out - OutRaw<0x18,1,0>'),
('nn::settings::ISystemSettingsServer', 68, '0 bytes in - 0x18 bytes out - OutRaw<0x18,1,0>'),
('nn::settings::ISystemSettingsServer', 69, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 70, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 71, '0 bytes in - 0xC bytes out - OutRaw<0xC,4,0>'),
('nn::settings::ISystemSettingsServer', 72, '0xC bytes in - 0 bytes out - InRaw<0xC,4,0>'),
('nn::settings::ISystemSettingsServer', 73, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 74, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 75, '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>'),
('nn::settings::ISystemSettingsServer', 76, '0x20 bytes in - 0 bytes out - InRaw<0x20,8,0>'),
('nn::settings::ISystemSettingsServer', 77, '0 bytes in - 0 bytes out - Buffer<0,0x16,0x80>'),
('nn::settings::ISystemSettingsServer', 78, '0 bytes in - 0 bytes out - Buffer<0,0x15,0x80>'),
('nn::settings::ISystemSettingsServer', 79, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 80, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 81, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 82, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::settings::ISystemSettingsServer', 83, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::settings::ISystemSettingsServer', 84, '0 bytes in - 0x18 bytes out - OutRaw<0x18,1,0>'),
('nn::settings::ISystemSettingsServer', 85, '0x18 bytes in - 0 bytes out - InRaw<0x18,1,0>'),
('nn::settings::ISystemSettingsServer', 86, '0 bytes in - 0x18 bytes out - OutRaw<0x18,4,0>'),
('nn::settings::ISystemSettingsServer', 87, '0x18 bytes in - 0 bytes out - InRaw<0x18,4,0>'),
('nn::settings::ISystemSettingsServer', 88, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 89, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 90, '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>'),
('nn::settings::ISystemSettingsServer', 91, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::settings::ISystemSettingsServer', 92, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::settings::ISystemSettingsServer', 93, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::settings::ISystemSettingsServer', 94, '0 bytes in - 0x10 bytes out - OutRaw<0x10,8,0>'),
('nn::settings::ISystemSettingsServer', 95, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 96, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 97, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::settings::ISystemSettingsServer', 98, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::settings::ISystemSettingsServer', 99, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 100, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 101, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 102, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 103, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 104, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 105, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::settings::ISystemSettingsServer', 106, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::settings::ISystemSettingsServer', 107, '0 bytes in - 0x2C bytes out - OutRaw<0x2C,4,0>'),
('nn::settings::ISystemSettingsServer', 108, '0x2C bytes in - 0 bytes out - InRaw<0x2C,4,0>'),
('nn::settings::ISystemSettingsServer', 109, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 110, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 111, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 112, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 113, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 114, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 115, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 116, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 117, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 118, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 119, '1 bytes in - 3 bytes out - OutRaw<1,1,0>, OutRaw<1,1,1>, OutRaw<1,1,2>, InRaw<1,1,0>'),
('nn::settings::ISystemSettingsServer', 120, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::settings::ISystemSettingsServer', 121, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::sm::detail::IManagerInterface', 0, '8 bytes in - 0 bytes out - InRaw<8,8,0>, Buffer<0,5,0>, Buffer<1,5,0>'),
('nn::sm::detail::IManagerInterface', 1, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::sm::detail::IUserInterface', 0, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::sm::detail::IUserInterface', 1, '8 bytes in - 0 bytes out - OutHandle<0,2>, InRaw<8,1,0>'),
('nn::sm::detail::IUserInterface', 2, '0x10 bytes in - 0 bytes out - OutHandle<0,2>, InRaw<8,1,0>, InRaw<4,4,0xC>, InRaw<1,1,8>'),
('nn::sm::detail::IUserInterface', 3, '8 bytes in - 0 bytes out - InRaw<8,1,0>'),
('nn::socket::resolver::IResolver', 0, '4 bytes in - 0 bytes out - Buffer<0,5,0>, InRaw<4,4,0>'),
('nn::socket::resolver::IResolver', 1, '4 bytes in - 0 bytes out - InRaw<4,4,0>, Buffer<0,6,0>'),
('nn::socket::resolver::IResolver', 2, '0x10 bytes in - 0xC bytes out - takes pid - InRaw<4,4,4>, InRaw<8,8,8>, InRaw<1,1,0>, Buffer<0,5,0>, OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<1,6,0>, OutRaw<4,4,8>'),
('nn::socket::resolver::IResolver', 3, '0x18 bytes in - 0xC bytes out - takes pid - InRaw<4,4,0>, InRaw<8,8,0x10>, Buffer<0,5,0>, InRaw<4,4,4>, InRaw<4,4,8>, OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<1,6,0>, OutRaw<4,4,8>'),
('nn::socket::resolver::IResolver', 4, '4 bytes in - 0 bytes out - InRaw<4,4,0>, Buffer<0,6,0>'),
('nn::socket::resolver::IResolver', 5, '4 bytes in - 0 bytes out - InRaw<4,4,0>, Buffer<0,6,0>'),
('nn::socket::resolver::IResolver', 6, '0x10 bytes in - 0xC bytes out - takes pid - InRaw<4,4,4>, InRaw<8,8,8>, InRaw<1,1,0>, Buffer<0,5,0>, Buffer<1,5,0>, Buffer<2,5,0>, Buffer<3,6,0>, OutRaw<4,4,0>, OutRaw<4,4,4>, OutRaw<4,4,8>'),
('nn::socket::resolver::IResolver', 7, '0x10 bytes in - 8 bytes out - takes pid - InRaw<4,4,0>, InRaw<8,8,8>, Buffer<0,5,0>, Buffer<1,6,0>, Buffer<2,6,0>, InRaw<4,4,4>, OutRaw<4,4,0>, OutRaw<4,4,4>'),
('nn::socket::resolver::IResolver', 8, '8 bytes in - 4 bytes out - takes pid - InRaw<8,8,0>, OutRaw<4,4,0>'),
('nn::socket::resolver::IResolver', 9, '0x10 bytes in - 0 bytes out - takes pid - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::socket::sf::IClient', 0, '0x30 bytes in - 4 bytes out - takes pid - OutRaw<4,4,0>, InRaw<8,8,0x20>, InHandle<0,1>, InRaw<8,8,0x28>, InRaw<0x20,4,0>'),
('nn::socket::sf::IClient', 1, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::socket::sf::IClient', 2, '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>'),
('nn::socket::sf::IClient', 3, '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>'),
('nn::socket::sf::IClient', 4, '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<0,0x21,0>, InRaw<4,4,0>'),
('nn::socket::sf::IClient', 5, '0x20 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>, Buffer<1,0x21,0>, Buffer<2,0x21,0>, Buffer<3,0x22,0>, Buffer<4,0x22,0>, Buffer<5,0x22,0>, InRaw<0x18,8,8>'),
('nn::socket::sf::IClient', 6, '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<0,0x21,0>, Buffer<1,0x22,0>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::socket::sf::IClient', 7, '0 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<0,0x21,0>, Buffer<1,0x22,0>, OutRaw<4,4,8>, Buffer<2,0x21,0>'),
('nn::socket::sf::IClient', 8, '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, InRaw<4,4,4>'),
('nn::socket::sf::IClient', 9, '8 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, InRaw<4,4,4>, Buffer<1,0x22,0>, OutRaw<4,4,8>'),
('nn::socket::sf::IClient', 10, '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>, InRaw<4,4,4>'),
('nn::socket::sf::IClient', 11, '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>, InRaw<4,4,4>, Buffer<1,0x21,0>'),
('nn::socket::sf::IClient', 12, '4 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, OutRaw<4,4,8>'),
('nn::socket::sf::IClient', 13, '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>'),
('nn::socket::sf::IClient', 14, '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>'),
('nn::socket::sf::IClient', 15, '4 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, OutRaw<4,4,8>'),
('nn::socket::sf::IClient', 16, '4 bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, OutRaw<4,4,8>'),
('nn::socket::sf::IClient', 17, '0xC bytes in - 0xC bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>, Buffer<0,0x22,0>, OutRaw<4,4,8>'),
('nn::socket::sf::IClient', 18, '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::socket::sf::IClient', 19, '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, Buffer<0,0x21,0>, Buffer<1,0x21,0>, Buffer<2,0x21,0>, Buffer<3,0x21,0>, Buffer<4,0x22,0>, Buffer<5,0x22,0>, Buffer<6,0x22,0>, Buffer<7,0x22,0>, InRaw<4,4,8>'),
('nn::socket::sf::IClient', 20, '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>'),
('nn::socket::sf::IClient', 21, '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>, Buffer<0,0x21,0>'),
('nn::socket::sf::IClient', 22, '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::socket::sf::IClient', 23, '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>'),
('nn::socket::sf::IClient', 24, '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>'),
('nn::socket::sf::IClient', 25, '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>'),
('nn::socket::sf::IClient', 26, '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>'),
('nn::socket::sf::IClient', 27, '0x10 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<8,8,8>'),
('nn::socket::sf::IClient', 28, '8 bytes in - 8 bytes out - takes pid - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<8,8,0>, Buffer<0,0x22,0>'),
('nn::socket::sf::IClient', 29, '0x20 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x22,0>, InRaw<4,4,4>, InRaw<4,4,8>, InRaw<0x10,8,0x10>'),
('nn::socket::sf::IClient', 30, '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, Buffer<0,0x21,0>, InRaw<4,4,4>, Buffer<1,0x21,0>, InRaw<4,4,8>'),
('nn::spl::detail::IGeneralInterface', 0, '4 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<4,4,0>'),
('nn::spl::detail::IGeneralInterface', 1, ''),
('nn::spl::detail::IGeneralInterface', 2, ''),
('nn::spl::detail::IGeneralInterface', 3, ''),
('nn::spl::detail::IGeneralInterface', 4, ''),
('nn::spl::detail::IGeneralInterface', 5, ''),
('nn::spl::detail::IGeneralInterface', 7, ''),
('nn::spl::detail::IGeneralInterface', 9, ''),
('nn::spl::detail::IGeneralInterface', 10, ''),
('nn::spl::detail::IGeneralInterface', 11, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::spl::detail::IGeneralInterface', 12, ''),
('nn::spl::detail::IGeneralInterface', 13, ''),
('nn::spl::detail::IGeneralInterface', 14, ''),
('nn::spl::detail::IGeneralInterface', 15, ''),
('nn::spl::detail::IGeneralInterface', 16, ''),
('nn::spl::detail::IGeneralInterface', 17, ''),
('nn::spl::detail::IGeneralInterface', 18, ''),
('nn::spl::detail::IGeneralInterface', 19, ''),
('nn::spl::detail::IGeneralInterface', 20, ''),
('nn::spl::detail::IGeneralInterface', 21, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::spl::detail::IGeneralInterface', 22, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::spl::detail::IGeneralInterface', 23, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::spl::detail::IGeneralInterface', 24, ''),
('nn::spl::detail::IGeneralInterface', 25, ''),
('nn::spl::detail::IRandomInterface', 0, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::spsm::detail::IPowerStateInterface', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::spsm::detail::IPowerStateInterface', 1, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::spsm::detail::IPowerStateInterface', 2, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::spsm::detail::IPowerStateInterface', 3, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::spsm::detail::IPowerStateInterface', 4, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::spsm::detail::IPowerStateInterface', 5, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::spsm::detail::IPowerStateInterface', 6, ''),
('nn::spsm::detail::IPowerStateInterface', 7, '0 bytes in - 0 bytes out'),
('nn::spsm::detail::IPowerStateInterface', 8, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::spsm::detail::IPowerStateInterface', 9, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::spsm::detail::IPowerStateInterface', 10, '0 bytes in - 0 bytes out'),
('nn::spsm::detail::IPowerStateInterface', 11, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ssl::sf::ISslConnection', 0, '4 bytes in - 4 bytes out - InRaw<4,4,0>, OutRaw<4,4,0>'),
('nn::ssl::sf::ISslConnection', 1, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::ssl::sf::ISslConnection', 2, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::ssl::sf::ISslConnection', 3, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::ssl::sf::ISslConnection', 4, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::ssl::sf::ISslConnection', 5, '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>'),
('nn::ssl::sf::ISslConnection', 6, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::ssl::sf::ISslConnection', 7, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::ssl::sf::ISslConnection', 8, '0 bytes in - 0 bytes out'),
('nn::ssl::sf::ISslConnection', 9, '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, Buffer<0,6,0>'),
('nn::ssl::sf::ISslConnection', 10, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::ssl::sf::ISslConnection', 11, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,5,0>'),
('nn::ssl::sf::ISslConnection', 12, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::ssl::sf::ISslConnection', 13, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>'),
('nn::ssl::sf::ISslConnection', 14, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::ssl::sf::ISslConnection', 15, '0 bytes in - 0 bytes out'),
('nn::ssl::sf::ISslConnection', 16, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::ssl::sf::ISslConnection', 17, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::ssl::sf::ISslConnection', 18, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::ssl::sf::ISslConnection', 19, '0 bytes in - 0 bytes out'),
('nn::ssl::sf::ISslConnection', 20, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::ssl::sf::ISslConnection', 21, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::ssl::sf::ISslConnection', 22, '8 bytes in - 0 bytes out - InRaw<4,4,4>, InRaw<1,1,0>'),
('nn::ssl::sf::ISslConnection', 23, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>'),
('nn::ssl::sf::ISslConnection', 24, '0 bytes in - 8 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, OutRaw<4,4,4>'),
('nn::ssl::sf::ISslContext', 0, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::ssl::sf::ISslContext', 1, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::ssl::sf::ISslContext', 2, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::ssl::sf::ISslContext', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::ssl::sf::ISslContext', 4, '4 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,5,0>, InRaw<4,4,0>'),
('nn::ssl::sf::ISslContext', 5, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,5,0>, Buffer<1,5,0>'),
('nn::ssl::sf::ISslContext', 6, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ssl::sf::ISslContext', 7, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ssl::sf::ISslContext', 8, '4 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<4,4,0>'),
('nn::ssl::sf::ISslContext', 9, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::ssl::sf::ISslContext', 10, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,5,0>'),
('nn::ssl::sf::ISslContext', 11, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::ssl::sf::ISslService', 0, '0x10 bytes in - 0 bytes out - takes pid - OutObject<0,0>, InRaw<4,4,0>, InRaw<8,8,8>'),
('nn::ssl::sf::ISslService', 1, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::ssl::sf::ISslService', 2, '0 bytes in - 4 bytes out - Buffer<0,6,0>, OutRaw<4,4,0>, Buffer<1,5,0>'),
('nn::ssl::sf::ISslService', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,5,0>'),
('nn::ssl::sf::ISslService', 4, '8 bytes in - 0 bytes out - Buffer<0,6,0>, Buffer<1,5,0>, InRaw<8,8,0>'),
('nn::ssl::sf::ISslService', 5, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::tc::IManager', 0, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::tc::IManager', 1, '4 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<4,4,0>'),
('nn::tc::IManager', 2, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>'),
('nn::tc::IManager', 3, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::tc::IManager', 4, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::tc::IManager', 5, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::tc::IManager', 6, '0 bytes in - 0 bytes out'),
('nn::tc::IManager', 7, '0 bytes in - 0 bytes out'),
('nn::tc::IManager', 8, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::timesrv::detail::service::IStaticService', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::timesrv::detail::service::IStaticService', 1, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::timesrv::detail::service::IStaticService', 2, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::timesrv::detail::service::IStaticService', 3, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::timesrv::detail::service::IStaticService', 4, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::timesrv::detail::service::IStaticService', 100, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::timesrv::detail::service::IStaticService', 101, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::timesrv::detail::service::IStaticService', 200, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::timesrv::detail::service::ISteadyClock', 0, '0 bytes in - 0x18 bytes out - OutRaw<0x18,8,0>'),
('nn::timesrv::detail::service::ISteadyClock', 2, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::timesrv::detail::service::ISteadyClock', 3, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::timesrv::detail::service::ISteadyClock', 100, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::timesrv::detail::service::ISteadyClock', 101, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::timesrv::detail::service::ISteadyClock', 102, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::timesrv::detail::service::ISteadyClock', 200, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::timesrv::detail::service::ISteadyClock', 201, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::timesrv::detail::service::ISystemClock', 0, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::timesrv::detail::service::ISystemClock', 1, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::timesrv::detail::service::ISystemClock', 2, '0 bytes in - 0x20 bytes out - OutRaw<0x20,8,0>'),
('nn::timesrv::detail::service::ISystemClock', 3, '0x20 bytes in - 0 bytes out - InRaw<0x20,8,0>'),
('nn::timesrv::detail::service::ITimeZoneService', 0, '0 bytes in - 0x24 bytes out - OutRaw<0x24,1,0>'),
('nn::timesrv::detail::service::ITimeZoneService', 1, '0x24 bytes in - 0 bytes out - InRaw<0x24,1,0>'),
('nn::timesrv::detail::service::ITimeZoneService', 2, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::timesrv::detail::service::ITimeZoneService', 3, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, InRaw<4,4,0>'),
('nn::timesrv::detail::service::ITimeZoneService', 4, '0x24 bytes in - 0 bytes out - Buffer<0,0x16,0x4000>, InRaw<0x24,1,0>'),
('nn::timesrv::detail::service::ITimeZoneService', 5, '0 bytes in - 0x10 bytes out - OutRaw<0x10,1,0>'),
('nn::timesrv::detail::service::ITimeZoneService', 100, '8 bytes in - 0x20 bytes out - OutRaw<8,2,0>, OutRaw<0x18,4,8>, InRaw<8,8,0>, Buffer<0,0x15,0x4000>'),
('nn::timesrv::detail::service::ITimeZoneService', 101, '8 bytes in - 0x20 bytes out - OutRaw<8,2,0>, OutRaw<0x18,4,8>, InRaw<8,8,0>'),
('nn::timesrv::detail::service::ITimeZoneService', 201, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<1,0xA,0>, InRaw<8,2,0>, Buffer<0,0x15,0x4000>'),
('nn::timesrv::detail::service::ITimeZoneService', 202, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,0xA,0>, InRaw<8,2,0>'),
('nn::tma::IHtcManager', 0, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,6,0>, Buffer<1,5,0>'),
('nn::tma::IHtcManager', 1, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, Buffer<0,5,0>'),
('nn::tma::IHtcManager', 2, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::tma::IHtcManager', 3, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::tma::IHtcManager', 4, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::tma::IHtcManager', 5, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::tma::IHtcManager', 6, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::tma::IHtcManager', 7, '0 bytes in - 0 bytes out - Buffer<0,6,0>'),
('nn::tma::IHtcManager', 8, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::tma::IHtcsManager', 0, '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>'),
('nn::tma::IHtcsManager', 1, '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>'),
('nn::tma::IHtcsManager', 2, '0x48 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0x44>, InRaw<0x42,2,0>'),
('nn::tma::IHtcsManager', 3, '0x48 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0x44>, InRaw<0x42,2,0>'),
('nn::tma::IHtcsManager', 4, '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::tma::IHtcsManager', 5, '4 bytes in - 0x4C bytes out - OutRaw<4,4,0x44>, OutRaw<4,4,0x48>, OutRaw<0x42,2,0>, InRaw<4,4,0>'),
('nn::tma::IHtcsManager', 6, '8 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, Buffer<0,6,0>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::tma::IHtcsManager', 7, '8 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, InRaw<4,4,0>, Buffer<0,5,0>, InRaw<4,4,4>'),
('nn::tma::IHtcsManager', 8, '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::tma::IHtcsManager', 9, '0xC bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>'),
('nn::tma::IHtcsManager', 10, '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>'),
('nn::tma::IHtcsManager', 11, '0 bytes in - 0x20 bytes out - OutRaw<0x20,1,0>'),
('nn::tma::IHtcsManager', 12, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, OutObject<0,0>'),
('nn::tma::IHtcsManager', 13, '1 bytes in - 4 bytes out - OutRaw<4,4,0>, OutObject<0,0>, InRaw<1,1,0>'),
('nn::tma::IHtcsManager', 100, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::tma::IHtcsManager', 101, '8 bytes in - 0 bytes out - takes pid - InRaw<8,8,0>'),
('nn::tma::ISocket', 0, '0 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>'),
('nn::tma::ISocket', 1, '0x42 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<0x42,2,0>'),
('nn::tma::ISocket', 2, '0x42 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<0x42,2,0>'),
('nn::tma::ISocket', 3, '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>'),
('nn::tma::ISocket', 4, '0 bytes in - 0x48 bytes out - OutRaw<4,4,0x44>, OutObject<0,0>, OutRaw<0x42,2,0>'),
('nn::tma::ISocket', 5, '4 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, Buffer<0,0x22,0>, InRaw<4,4,0>'),
('nn::tma::ISocket', 6, '4 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, Buffer<0,0x21,0>, InRaw<4,4,0>'),
('nn::tma::ISocket', 7, '4 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>'),
('nn::tma::ISocket', 8, '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::tma::ISocket', 9, '0 bytes in - 4 bytes out - OutRaw<4,4,0>, OutHandle<0,1>'),
('nn::tma::ISocket', 10, '4 bytes in - 0x48 bytes out - OutRaw<4,4,0x44>, OutObject<0,0>, OutRaw<0x42,2,0>, InRaw<4,4,0>'),
('nn::tma::ISocket', 11, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, OutHandle<0,1>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::tma::ISocket', 12, '4 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, Buffer<0,0x22,0>, InRaw<4,4,0>'),
('nn::tma::ISocket', 13, '0x18 bytes in - 4 bytes out - OutRaw<4,4,0>, OutHandle<0,1>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<8,8,0x10>, InHandle<0,1>, InRaw<4,4,8>'),
('nn::tma::ISocket', 14, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, OutHandle<0,1>, Buffer<0,0x21,0>, InRaw<4,4,0>'),
('nn::tma::ISocket', 15, '0x10 bytes in - 4 bytes out - OutRaw<4,4,0>, OutHandle<0,1>, Buffer<0,0x21,0>, Buffer<1,0x21,0>, InHandle<0,1>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::tma::ISocket', 16, '4 bytes in - 0x10 bytes out - OutRaw<4,4,0>, OutRaw<8,8,8>, InRaw<4,4,0>'),
('nn::ts::server::IMeasurementServer', 0, ''),
('nn::ts::server::IMeasurementServer', 1, ''),
('nn::ts::server::IMeasurementServer', 2, ''),
('nn::ts::server::IMeasurementServer', 3, ''),
('nn::uart::IManager', 0, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>'),
('nn::uart::IManager', 1, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>'),
('nn::uart::IManager', 2, ''),
('nn::uart::IManager', 3, ''),
('nn::uart::IManager', 4, ''),
('nn::uart::IManager', 5, ''),
('nn::uart::IManager', 6, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::uart::IManager', 7, ''),
('nn::uart::IManager', 8, ''),
('nn::uart::IPortSession', 0, ''),
('nn::uart::IPortSession', 1, ''),
('nn::uart::IPortSession', 2, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::uart::IPortSession', 3, ''),
('nn::uart::IPortSession', 4, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::uart::IPortSession', 5, ''),
('nn::uart::IPortSession', 6, ''),
('nn::uart::IPortSession', 7, '4 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<4,4,0>'),
('nn::usb::hs::IClientEpSession', 0, '0 bytes in - 0 bytes out'),
('nn::usb::hs::IClientEpSession', 1, '0 bytes in - 0 bytes out'),
('nn::usb::hs::IClientEpSession', 2, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::usb::hs::IClientEpSession', 3, '0 bytes in - 0 bytes out'),
('nn::usb::hs::IClientEpSession', 4, ''),
('nn::usb::hs::IClientEpSession', 5, ''),
('nn::usb::hs::IClientEpSession', 6, ''),
('nn::usb::hs::IClientIfSession', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::usb::hs::IClientIfSession', 1, ''),
('nn::usb::hs::IClientIfSession', 2, ''),
('nn::usb::hs::IClientIfSession', 3, ''),
('nn::usb::hs::IClientIfSession', 4, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::usb::hs::IClientIfSession', 5, ''),
('nn::usb::hs::IClientIfSession', 6, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::usb::hs::IClientIfSession', 7, ''),
('nn::usb::hs::IClientIfSession', 8, '0 bytes in - 0 bytes out'),
('nn::usb::hs::IClientIfSession', 9, ''),
('nn::usb::hs::IClientRootSession', 0, ''),
('nn::usb::hs::IClientRootSession', 1, ''),
('nn::usb::hs::IClientRootSession', 2, ''),
('nn::usb::hs::IClientRootSession', 3, ''),
('nn::usb::hs::IClientRootSession', 4, ''),
('nn::usb::hs::IClientRootSession', 5, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::usb::hs::IClientRootSession', 6, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::usb::hs::IClientRootSession', 7, ''),
('nn::usb::pd::detail::IPdCradleManager', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::usb::pd::detail::IPdCradleSession', 0, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::usb::pd::detail::IPdCradleSession', 1, '4 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<4,4,0>'),
('nn::usb::pd::detail::IPdCradleSession', 2, '0 bytes in - 0 bytes out'),
('nn::usb::pd::detail::IPdCradleSession', 3, ''),
('nn::usb::pd::detail::IPdCradleSession', 4, ''),
('nn::usb::pd::detail::IPdCradleSession', 5, ''),
('nn::usb::pd::detail::IPdCradleSession', 6, ''),
('nn::usb::pd::detail::IPdCradleSession', 7, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::usb::pd::detail::IPdCradleSession', 8, '0 bytes in - 1 bytes out - OutRaw<1,1,0>'),
('nn::usb::pd::detail::IPdManager', 0, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::usb::pd::detail::IPdSession', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::usb::pd::detail::IPdSession', 1, '0 bytes in - 0 bytes out'),
('nn::usb::pd::detail::IPdSession', 2, ''),
('nn::usb::pd::detail::IPdSession', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::usb::pd::detail::IPdSession', 4, '0 bytes in - 0 bytes out'),
('nn::usb::pd::detail::IPdSession', 5, '0 bytes in - 0 bytes out'),
('nn::usb::pd::detail::IPdSession', 6, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::usb::pm::IPmService', 0, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::usb::pm::IPmService', 1, ''),
('nn::usb::pm::IPmService', 2, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::usb::pm::IPmService', 3, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::usb::pm::IPmService', 4, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::usb::pm::IPmService', 5, ''),
('nn::visrv::sf::IApplicationDisplayService', 100, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::visrv::sf::IApplicationDisplayService', 101, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::visrv::sf::IApplicationDisplayService', 102, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::visrv::sf::IApplicationDisplayService', 103, '0 bytes in - 0 bytes out - OutObject<0,0>'),
('nn::visrv::sf::IApplicationDisplayService', 1000, '0 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>'),
('nn::visrv::sf::IApplicationDisplayService', 1010, '0x40 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<0x40,1,0>'),
('nn::visrv::sf::IApplicationDisplayService', 1011, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::visrv::sf::IApplicationDisplayService', 1020, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::visrv::sf::IApplicationDisplayService', 1101, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::visrv::sf::IApplicationDisplayService', 1102, '8 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>, InRaw<8,8,0>'),
('nn::visrv::sf::IApplicationDisplayService', 2020, '0x50 bytes in - 8 bytes out - takes pid - OutRaw<8,8,0>, Buffer<0,6,0>, InRaw<8,8,0x40>, InRaw<0x40,1,0>, InRaw<8,8,0x48>'),
('nn::visrv::sf::IApplicationDisplayService', 2021, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::visrv::sf::IApplicationDisplayService', 2030, '0x10 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>, Buffer<0,6,0>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::visrv::sf::IApplicationDisplayService', 2031, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::visrv::sf::IApplicationDisplayService', 2101, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::visrv::sf::IApplicationDisplayService', 2450, '0x20 bytes in - 0x10 bytes out - takes pid - OutRaw<8,8,0>, OutRaw<8,8,8>, Buffer<0,0x46,0>, InRaw<8,8,0>, InRaw<8,8,8>, InRaw<8,8,0x10>, InRaw<8,8,0x18>'),
('nn::visrv::sf::IApplicationDisplayService', 2451, '0x30 bytes in - 0x10 bytes out - takes pid - OutRaw<8,8,0>, OutRaw<8,8,8>, Buffer<0,0x46,0>, InRaw<8,8,0x10>, InRaw<8,8,0x18>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>, InRaw<4,4,0xC>, InRaw<8,8,0x20>, InRaw<8,8,0x28>'),
('nn::visrv::sf::IApplicationDisplayService', 2460, '0x10 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>, InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::visrv::sf::IApplicationDisplayService', 5202, '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>'),
('nn::visrv::sf::IApplicationDisplayService', 5203, '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>'),
('nn::visrv::sf::IApplicationRootService', 0, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::visrv::sf::IManagerDisplayService', 1102, '8 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>, InRaw<8,8,0>'),
('nn::visrv::sf::IManagerDisplayService', 2010, '0x18 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,8>, InRaw<4,4,0>, InRaw<8,8,0x10>'),
('nn::visrv::sf::IManagerDisplayService', 2011, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::visrv::sf::IManagerDisplayService', 2050, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::visrv::sf::IManagerDisplayService', 2051, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::visrv::sf::IManagerDisplayService', 2052, '0x10 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::visrv::sf::IManagerDisplayService', 2053, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::visrv::sf::IManagerDisplayService', 2054, '0x10 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::visrv::sf::IManagerDisplayService', 2055, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::visrv::sf::IManagerDisplayService', 2300, '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>'),
('nn::visrv::sf::IManagerDisplayService', 2301, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::visrv::sf::IManagerDisplayService', 2302, '8 bytes in - 0 bytes out - OutHandle<0,1>, InRaw<8,8,0>'),
('nn::visrv::sf::IManagerDisplayService', 2402, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>'),
('nn::visrv::sf::IManagerDisplayService', 4201, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::visrv::sf::IManagerDisplayService', 4203, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::visrv::sf::IManagerDisplayService', 4205, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::visrv::sf::IManagerDisplayService', 6000, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::visrv::sf::IManagerDisplayService', 6001, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::visrv::sf::IManagerDisplayService', 6002, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::visrv::sf::IManagerDisplayService', 7000, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::visrv::sf::IManagerDisplayService', 8000, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::visrv::sf::IManagerDisplayService', 8100, '0x18 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>, InRaw<8,8,0x10>'),
('nn::visrv::sf::IManagerRootService', 2, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::visrv::sf::IManagerRootService', 3, '0xC bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,8>, InRaw<8,1,0>'),
('nn::visrv::sf::ISystemDisplayService', 1200, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 1202, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 1203, '8 bytes in - 8 bytes out - OutRaw<4,4,0>, OutRaw<4,4,4>, InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 1204, '0x18 bytes in - 0 bytes out - InRaw<8,8,0x10>, InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>, InRaw<4,4,0xC>'),
('nn::visrv::sf::ISystemDisplayService', 2201, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>, InRaw<4,4,4>'),
('nn::visrv::sf::ISystemDisplayService', 2203, '0x18 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>, InRaw<8,8,0x10>'),
('nn::visrv::sf::ISystemDisplayService', 2204, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 2205, '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::visrv::sf::ISystemDisplayService', 2207, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<1,1,0>'),
('nn::visrv::sf::ISystemDisplayService', 2209, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::visrv::sf::ISystemDisplayService', 2312, '0x10 bytes in - 0x10 bytes out - OutRaw<8,8,0>, OutRaw<8,8,8>, Buffer<0,6,0>, InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::visrv::sf::ISystemDisplayService', 2400, '0x10 bytes in - 8 bytes out - takes pid - OutRaw<8,8,0>, Buffer<0,6,0>, InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::visrv::sf::ISystemDisplayService', 2401, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 2402, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 3000, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>, InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 3001, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>, InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 3002, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, Buffer<0,6,0>, InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 3200, '8 bytes in - 0x10 bytes out - OutRaw<0x10,4,0>, InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 3201, '0x18 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<0x10,4,8>'),
('nn::visrv::sf::ISystemDisplayService', 3202, '8 bytes in - 8 bytes out - OutRaw<8,8,0>, InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 3203, '0x10 bytes in - 0 bytes out - InRaw<8,8,0>, InRaw<8,8,8>'),
('nn::visrv::sf::ISystemDisplayService', 3204, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 3205, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::visrv::sf::ISystemDisplayService', 3206, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 3207, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::visrv::sf::ISystemDisplayService', 3208, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 3209, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::visrv::sf::ISystemDisplayService', 3210, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 3211, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::visrv::sf::ISystemDisplayService', 3214, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 3215, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::visrv::sf::ISystemDisplayService', 3216, '8 bytes in - 4 bytes out - OutRaw<4,4,0>, InRaw<8,8,0>'),
('nn::visrv::sf::ISystemDisplayService', 3217, '0x10 bytes in - 0 bytes out - InRaw<8,8,8>, InRaw<4,4,0>'),
('nn::visrv::sf::ISystemRootService', 1, '4 bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,0>'),
('nn::visrv::sf::ISystemRootService', 3, '0xC bytes in - 0 bytes out - OutObject<0,0>, InRaw<4,4,8>, InRaw<8,1,0>'),
('nn::wlan::detail::IInfraManager', 0, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::IInfraManager', 1, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::IInfraManager', 2, ''),
('nn::wlan::detail::IInfraManager', 3, ''),
('nn::wlan::detail::IInfraManager', 4, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::IInfraManager', 5, ''),
('nn::wlan::detail::IInfraManager', 6, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::IInfraManager', 7, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::IInfraManager', 8, ''),
('nn::wlan::detail::IInfraManager', 9, ''),
('nn::wlan::detail::IInfraManager', 10, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::wlan::detail::IInfraManager', 11, ''),
('nn::wlan::detail::IInfraManager', 12, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::wlan::detail::IInfraManager', 13, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::wlan::detail::IInfraManager', 14, ''),
('nn::wlan::detail::IInfraManager', 15, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::IInfraManager', 16, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::IInfraManager', 17, ''),
('nn::wlan::detail::IInfraManager', 18, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::wlan::detail::IInfraManager', 19, ''),
('nn::wlan::detail::IInfraManager', 20, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::IInfraManager', 21, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::wlan::detail::IInfraManager', 22, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::wlan::detail::IInfraManager', 23, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::wlan::detail::IInfraManager', 24, ''),
('nn::wlan::detail::IInfraManager', 25, ''),
('nn::wlan::detail::ILocalGetActionFrame', 0, ''),
('nn::wlan::detail::ILocalGetFrame', 0, ''),
('nn::wlan::detail::ILocalManager', 0, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::ILocalManager', 1, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::ILocalManager', 2, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::ILocalManager', 3, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::ILocalManager', 4, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::ILocalManager', 5, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::ILocalManager', 6, ''),
('nn::wlan::detail::ILocalManager', 7, ''),
('nn::wlan::detail::ILocalManager', 8, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::ILocalManager', 9, ''),
('nn::wlan::detail::ILocalManager', 10, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::ILocalManager', 11, ''),
('nn::wlan::detail::ILocalManager', 12, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::ILocalManager', 13, ''),
('nn::wlan::detail::ILocalManager', 14, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::ILocalManager', 15, ''),
('nn::wlan::detail::ILocalManager', 16, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::wlan::detail::ILocalManager', 17, ''),
('nn::wlan::detail::ILocalManager', 18, ''),
('nn::wlan::detail::ILocalManager', 19, ''),
('nn::wlan::detail::ILocalManager', 20, '0 bytes in - 0 bytes out - OutHandle<0,1>'),
('nn::wlan::detail::ILocalManager', 21, ''),
('nn::wlan::detail::ILocalManager', 22, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::wlan::detail::ILocalManager', 23, ''),
('nn::wlan::detail::ILocalManager', 24, ''),
('nn::wlan::detail::ILocalManager', 25, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::wlan::detail::ILocalManager', 26, ''),
('nn::wlan::detail::ILocalManager', 27, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::wlan::detail::ILocalManager', 28, ''),
('nn::wlan::detail::ILocalManager', 29, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::wlan::detail::ILocalManager', 30, ''),
('nn::wlan::detail::ILocalManager', 31, ''),
('nn::wlan::detail::ILocalManager', 32, ''),
('nn::wlan::detail::ILocalManager', 33, ''),
('nn::wlan::detail::ILocalManager', 34, ''),
('nn::wlan::detail::ILocalManager', 35, ''),
('nn::wlan::detail::ILocalManager', 36, ''),
('nn::wlan::detail::ILocalManager', 37, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::ILocalManager', 38, ''),
('nn::wlan::detail::ILocalManager', 39, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::wlan::detail::ILocalManager', 40, ''),
('nn::wlan::detail::ILocalManager', 41, ''),
('nn::wlan::detail::ILocalManager', 42, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::wlan::detail::ILocalManager', 43, '0 bytes in - 4 bytes out - OutRaw<4,4,0>'),
('nn::wlan::detail::ILocalManager', 44, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::wlan::detail::ISocketGetFrame', 0, ''),
('nn::wlan::detail::ISocketManager', 0, '0 bytes in - 0 bytes out - Buffer<0,5,0>'),
('nn::wlan::detail::ISocketManager', 1, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::wlan::detail::ISocketManager', 2, ''),
('nn::wlan::detail::ISocketManager', 3, '4 bytes in - 0 bytes out - InRaw<4,4,0>'),
('nn::wlan::detail::ISocketManager', 4, ''),
('nn::wlan::detail::ISocketManager', 5, ''),
('nn::wlan::detail::ISocketManager', 6, ''),
('nn::wlan::detail::ISocketManager', 7, '1 bytes in - 0 bytes out - InRaw<1,1,0>'),
('nn::wlan::detail::ISocketManager', 8, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::wlan::detail::ISocketManager', 9, ''),
('nn::wlan::detail::ISocketManager', 10, '0 bytes in - 0 bytes out'),
('nn::wlan::detail::ISocketManager', 11, '0 bytes in - 0 bytes out'),
('nn::xcd::detail::ISystemServer', 0, '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,8,0>'),
('nn::xcd::detail::ISystemServer', 1, ''),
('nn::xcd::detail::ISystemServer', 2, '8 bytes in - 1 bytes out - OutRaw<1,1,0>, InRaw<8,8,0>'),
('nn::xcd::detail::ISystemServer', 3, ''),
('nn::xcd::detail::ISystemServer', 4, ''),
('nn::xcd::detail::ISystemServer', 5, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::xcd::detail::ISystemServer', 10, ''),
('nn::xcd::detail::ISystemServer', 11, ''),
('nn::xcd::detail::ISystemServer', 12, ''),
('nn::xcd::detail::ISystemServer', 13, '8 bytes in - 0 bytes out - InRaw<8,8,0>'),
('nn::xcd::detail::ISystemServer', 14, ''),
('nn::xcd::detail::ISystemServer', 15, ''),
('nn::xcd::detail::ISystemServer', 16, ''),
('nn::xcd::detail::ISystemServer', 17, ''),
('nn::xcd::detail::ISystemServer', 18, ''),
('nn::xcd::detail::ISystemServer', 19, ''),
('nn::xcd::detail::ISystemServer', 20, ''),
('nn::xcd::detail::ISystemServer', 101, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nn::xcd::detail::ISystemServer', 102, '0 bytes in - 8 bytes out - OutRaw<8,8,0>'),
('nns::hosbinder::IHOSBinderDriver', 0, '0xC bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>, Buffer<0,5,0>, Buffer<1,6,0>, InRaw<4,4,8>'),
('nns::hosbinder::IHOSBinderDriver', 1, '0xC bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>, InRaw<4,4,8>'),
('nns::hosbinder::IHOSBinderDriver', 2, '8 bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>, OutHandle<0,1>'),
('nns::hosbinder::IHOSBinderDriver', 3, '0xC bytes in - 0 bytes out - InRaw<4,4,0>, InRaw<4,4,4>, Buffer<0,0x21,0>, Buffer<1,0x22,0>, InRaw<4,4,8>'),
('nns::nvdrv::INvDrvServices', 0, ''),
('nns::nvdrv::INvDrvServices', 1, ''),
('nns::nvdrv::INvDrvServices', 2, ''),
('nns::nvdrv::INvDrvServices', 3, ''),
('nns::nvdrv::INvDrvServices', 4, ''),
('nns::nvdrv::INvDrvServices', 5, ''),
('nns::nvdrv::INvDrvServices', 6, ''),
('nns::nvdrv::INvDrvServices', 7, ''),
('nns::nvdrv::INvDrvServices', 8, ''),
('nns::nvdrv::INvDrvServices', 9, ''),
('nns::nvdrv::INvDrvServices', 10, ''),
('nns::nvdrv::INvDrvServices', 11, ''),
('nns::nvdrv::INvDrvServices', 12, ''),
('nns::nvdrv::INvDrvServices', 13, ''),
('nv::gemcontrol::INvGemControl', 0, ''),
('nv::gemcontrol::INvGemControl', 1, ''),
('nv::gemcontrol::INvGemControl', 2, ''),
('nv::gemcontrol::INvGemControl', 3, ''),
('nv::gemcontrol::INvGemControl', 4, ''),
('nv::gemcontrol::INvGemControl', 5, ''),
('nv::gemcontrol::INvGemControl', 6, ''),
('nv::gemcontrol::INvGemControl', 7, ''),
)
smapping = {
# builtins
'0100000000000000': {
'fsp-srv': 'nn::fssrv::sf::IFileSystemProxy',
'fsp-ldr': 'nn::fssrv::sf::IFileSystemProxyForLoader',
'fsp-pr': 'nn::fssrv::sf::IProgramRegistry',
},
'0100000000000001': {
'ldr:shel': 'nn::ldr::detail::IShellInterface',
'ldr:pm': 'nn::ldr::detail::IProcessManagerInterface',
'ldr:dmnt': 'nn::ldr::detail::IDebugMonitorInterface',
},
'0100000000000002': {
'lr': 'nn::lr::ILocationResolverManager',
'ncm': 'nn::ncm::IContentManager',
},
'0100000000000003': {
'pm:info': 'nn::pm::detail::IInformationInterface',
'pm:shell': 'nn::pm::detail::IShellInterface',
'pm:bm': 'nn::pm::detail::IBootModeInterface',
},
'0100000000000004': {
'sm:': 'nn::sm::detail::IUserInterface',
'sm:m': 'nn::sm::detail::IManagerInterface',
},
'0100000000000028': {
'spl:': 'nn::spl::detail::IGeneralInterface',
'csrng': 'nn::spl::detail::IRandomInterface',
},
# not builtins
'0100000000000006': { # usb
'usb:ds': 'nn::usb::ds::IDsService',
'usb:hs': 'nn::usb::hs::IClientRootSession',
'usb:pd': 'nn::usb::pd::detail::IPdManager',
'usb:pd:c': 'nn::usb::pd::detail::IPdCradleManager',
'usb:pm': 'nn::usb::pm::IPmService',
},
'0100000000000009': { # settings
'set': 'nn::settings::ISettingsServer',
'set:cal': 'nn::settings::IFactorySettingsServer',
'set:fd': 'nn::settings::IFirmwareDebugSettingsServer',
'set:sys': 'nn::settings::ISystemSettingsServer',
},
'010000000000000A': { # Bus
'gpio': 'nn::gpio::IManager',
'i2c': 'nn::i2c::IManager',
'i2c:pcv': 'nn::i2c::IManager',
'pinmux': 'nn::pinmux::IManager',
'pwm': 'nn::pwm::IManager',
'sasbus': 'nn::sasbus::IManager',
'uart': 'nn::uart::IManager',
},
'010000000000000B': { # bluetooth
'btdrv': 'nn::bluetooth::IBluetoothDriver',
},
'010000000000000C': { # bcat
'bcat:a': 'nn::bcat::detail::ipc::IServiceCreator',
'bcat:m': 'nn::bcat::detail::ipc::IServiceCreator',
'bcat:s': 'nn::bcat::detail::ipc::IServiceCreator',
'bcat:u': 'nn::bcat::detail::ipc::IServiceCreator',
'news:a': 'nn::news::detail::ipc::IServiceCreator',
'news:c': 'nn::news::detail::ipc::IServiceCreator',
'news:m': 'nn::news::detail::ipc::IServiceCreator',
'news:p': 'nn::news::detail::ipc::IServiceCreator',
'news:v': 'nn::news::detail::ipc::IServiceCreator',
'prepo:a': 'nn::prepo::detail::ipc::IPrepoService',
'prepo:m': 'nn::prepo::detail::ipc::IPrepoService',
'prepo:s': 'nn::prepo::detail::ipc::IPrepoService',
'prepo:u': 'nn::prepo::detail::ipc::IPrepoService',
},
'010000000000000E': { # friends
'friend:a': 'nn::friends::detail::ipc::IServiceCreator',
'friend:m': 'nn::friends::detail::ipc::IServiceCreator',
'friend:s': 'nn::friends::detail::ipc::IServiceCreator',
'friend:u': 'nn::friends::detail::ipc::IServiceCreator',
'friend:v': 'nn::friends::detail::ipc::IServiceCreator',
},
'010000000000000F': { # nifm
'nifm:a': 'nn::nifm::detail::IStaticService',
'nifm:s': 'nn::nifm::detail::IStaticService',
'nifm:u': 'nn::nifm::detail::IStaticService',
},
'0100000000000010': { # ptm
'fan': 'nn::fan::detail::IManager',
'psm': 'nn::psm::IPsmServer',
'tc': 'nn::tc::IManager',
'ts': 'nn::ts::server::IMeasurementServer',
},
'0100000000000012': { # bsdsocket
'bsd:s': 'nn::socket::sf::IClient', # ?
'bsd:u': 'nn::socket::sf::IClient', # ?
'bsdcfg': 'nn::bsdsocket::cfg::ServerInterface',
'ethc:c': 'nn::eth::sf::IEthInterface',
'ethc:i': 'nn::eth::sf::IEthInterfaceGroup',
'nsd:a': 'nn::nsd::detail::IManager', # ?
'nsd:u': 'nn::nsd::detail::IManager', # ?
'sfdnsres': 'nn::socket::resolver::IResolver',
},
'0100000000000013': { # hid
'ahid:cd': 'nn::ahid::IServerSession', # ?
'ahid:hdr': 'nn::ahid::hdr::ISession', # ?
'hid': 'nn::hid::IHidServer',
'hid:dbg': 'nn::hid::IHidDebugServer',
'hid:sys': 'nn::hid::IHidSystemServer',
'hid:tmp': 'nn::hid::IHidTemporaryServer',
'irs': 'nn::irsensor::IIrSensorServer',
'irs:sys': 'nn::irsensor::IIrSensorSystemServer',
'xcd:sys': 'nn::xcd::detail::ISystemServer',
},
'0100000000000014': { # audio
'audctl': 'nn::audioctrl::detail::IAudioController',
'audin:a': 'nn::audio::detail::IAudioInManagerForApplet',
'audin:d': 'nn::audio::detail::IAudioInManagerForDebugger',
'audin:u': 'nn::audio::detail::IAudioInManager',
'audout:a': 'nn::audio::detail::IAudioOutManagerForApplet',
'audout:d': 'nn::audio::detail::IAudioOutManagerForDebugger',
'audout:u': 'nn::audio::detail::IAudioOutManager',
'audrec:a': 'nn::audio::detail::IFinalOutputRecorderManagerForApplet',
'audrec:d': 'nn::audio::detail::IFinalOutputRecorderManagerForDebugger',
'audrec:u': 'nn::audio::detail::IFinalOutputRecorderManager',
'audren:a': 'nn::audio::detail::IAudioRendererManagerForApplet',
'audren:d': 'nn::audio::detail::IAudioRendererManagerForDebugger',
'audren:u': 'nn::audio::detail::IAudioRendererManager',
'hwopus': 'nn::codec::detail::IHardwareOpusDecoderManager',
},
'0100000000000015': { # LogManager.Prod
'lm': 'nn::lm::ILogService',
},
'0100000000000016': { # wlan
'wlan:inf': 'nn::wlan::detail::IInfraManager',
'wlan:lcl': 'nn::wlan::detail::ILocalManager',
'wlan:lg': 'nn::wlan::detail::ILocalGetFrame',
'wlan:lga': 'nn::wlan::detail::ILocalGetActionFrame',
'wlan:soc': 'nn::wlan::detail::ISocketManager',
'wlan:sg': 'nn::wlan::detail::ISocketGetFrame',
},
'0100000000000018': { # ldn
'ldn:m': 'nn::ldn::detail::IMonitorServiceCreator',
'ldn:s': 'nn::ldn::detail::ISystemServiceCreator',
'ldn:u': 'nn::ldn::detail::IUserServiceCreator',
},
'0100000000000019': { # nvservices
'nvdrv': 'nns::nvdrv::INvDrvServices',
'nvdrv:a': 'nns::nvdrv::INvDrvServices',
'nvdrv:s': 'nns::nvdrv::INvDrvServices',
'nvdrv:t': 'nns::nvdrv::INvDrvServices',
'nvdrvdbg': 'nns::nvdrv::INvDrvDebugFSServices',
'nvgem:c': 'nv::gemcontrol::INvGemControl',
'nvgem:cd': 'nv::gemcoredump::INvGemCoreDump',
},
'010000000000001A': { # pcv
'bpc': 'nn::bpc::IBoardPowerControlManager',
'bpc:r': 'nn::bpc::IRtcManager',
'pcv': 'nn::pcv::detail::IPcvService',
'pcv:arb': 'nn::pcv::IArbitrationManager',
'pcv:imm': 'nn::pcv::IImmediateManager',
'time:u': 'nn::timesrv::detail::service::IStaticService',
'time:a': 'nn::timesrv::detail::service::IStaticService',
'time:s': 'nn::timesrv::detail::service::IStaticService',
'time:r': 'nn::timesrv::detail::service::IStaticService',
},
'010000000000001B': { # ppc
'apm': 'nn::apm::IManager',
'apm:p': 'nn::apm::IManagerPrivileged',
'apm:sys': 'nn::apm::ISystemManager',
'fgm:0': 'nn::fgm::sf::ISession',
'fgm': 'nn::fgm::sf::ISession',
'fgm:9': 'nn::fgm::sf::ISession', # no nn::fgm::sf::IDebugger ?
},
'010000000000001C': { # nvnflinger
'dispdrv': 'nns::hosbinder::IHOSBinderDriver',
},
'010000000000001D': { # pcie.withoutHb
'pcie': 'nn::pcie::detail::IManager',
},
'010000000000001E': { # account
'acc:aa': 'nn::account::IBaasAccessTokenAccessor', # ?
'acc:su': 'nn::account::IAccountServiceForAdministrator', # ?
'acc:u1': 'nn::account::IAccountServiceForSystemService', # ?
'acc:u0': 'nn::account::IAccountServiceForApplication', # ?
},
'010000000000001F': { # ns
'aoc:u': 'nn::aocsrv::detail::IAddOnContentManager',
'ns:am2': 'nn::ns::detail::IServiceGetterInterface',
'ns:dev': 'nn::ns::detail::IDevelopInterface',
'ns:ec': 'nn::ns::detail::IServiceGetterInterface',
'ns:rid': 'nn::ns::detail::IServiceGetterInterface',
'ns:rt': 'nn::ns::detail::IServiceGetterInterface',
'ns:su': 'nn::ns::detail::ISystemUpdateInterface',
'ns:vm': 'nn::ns::detail::IVulnerabilityManagerInterface',
'ns:web': 'nn::ns::detail::IServiceGetterInterface',
'ovln:rcv': 'nn::ovln::IReceiverService',
'ovln:snd': 'nn::ovln::ISenderService',
},
'0100000000000020': { # nfc
'nfc:am': 'nn::nfc::am::detail::IAmManager',
'nfc:mf:u': 'nn::nfc::mifare::detail::IUserManager',
'nfc:sys': 'nn::nfc::detail::ISystemManager',
'nfc:user': 'nn::nfc::detail::IUserManager',
'nfp:dbg': 'nn::nfp::detail::IDebugManager',
'nfp:sys': 'nn::nfp::detail::ISystemManager',
'nfp:user': 'nn::nfp::detail::IUserManager',
},
'0100000000000021': { # psc
'psc:c': 'nn::psc::sf::IPmControl', # ?
'psc:m': 'nn::psc::sf::IPmService', # ?
},
'0100000000000022': { # capsrv
'caps:a': 'nn::capsrv::sf::IAlbumAccessorService',
'caps:c': 'nn::capsrv::sf::IAlbumControlService',
},
'0100000000000023': { # am
'appletAE': 'nn::am::service::IAllSystemAppletProxiesService',
'appletOE': 'nn::am::service::IApplicationProxyService',
'idle:sys': 'nn::idle::detail::IPolicyManagerSystem',
'omm': 'nn::omm::detail::IOperationModeManager',
'spsm': 'nn::spsm::detail::IPowerStateInterface',
},
'0100000000000024': { # ssl
'ssl': 'nn::ssl::sf::ISslService', # ?
},
'0100000000000025': { # nim
'nim': 'nn::nim::detail::INetworkInstallManager',
'nim:shp': 'nn::nim::detail::IShopServiceManager',
'ntc': 'nn::ntc::detail::service::IStaticService',
},
'0100000000000029': { # lbl
'lbl': 'nn::lbl::detail::ILblController',
},
'010000000000002A': { # btm
'btm': 'nn::btm::IBtm',
'btm:dbg': 'nn::btm::IBtmDebug',
'btm:sys': 'nn::btm::IBtmSystem',
},
'010000000000002B': { # erpt
'erpt:c': 'nn::erpt::sf::IContext',
'erpt:r': 'nn::erpt::sf::ISession',
},
'010000000000002D': { # vi
'caps:sc': 'nn::capsrv::sf::IScreenShotControlService',
'caps:ss': 'nn::capsrv::sf::IScreenShotService',
'caps:su': 'nn::capsrv::sf::IScreenShotApplicationService',
'cec-mgr': 'nn::cec::ICecManager',
'mm:u': 'nn::mmnv::IRequest',
'vi:m': 'nn::visrv::sf::IManagerRootService',
'vi:s': 'nn::visrv::sf::ISystemRootService',
'vi:u': 'nn::visrv::sf::IApplicationRootService',
},
'010000000000002E': { # pctl
'pctl': 'nn::pctl::detail::ipc::IParentalControlServiceFactory',
'pctl:a': 'nn::pctl::detail::ipc::IParentalControlServiceFactory',
'pctl:r': 'nn::pctl::detail::ipc::IParentalControlServiceFactory',
'pctl:s': 'nn::pctl::detail::ipc::IParentalControlServiceFactory',
},
'010000000000002F': { # npns
'npns:s': 'nn::npns::INpnsSystem',
'npns:u': 'nn::npns::INpnsUser',
},
'0100000000000030': { # eupld
'eupld:c': 'nn::eupld::sf::IControl',
'eupld:r': 'nn::eupld::sf::IRequest',
},
'0100000000000031': { # glue
'arp:r': 'nn::arp::detail::IReader',
'arp:w': 'nn::arp::detail::IWriter',
'bgtc:sc': 'nn::bgtc::IStateControlService',
'bgtc:t': 'nn::bgtc::ITaskService',
},
'0100000000000033': { # es
'es': 'nn::es::IETicketService',
},
'0100000000000034': { # fatal
'fatal:p': 'nn::fatalsrv::IPrivateService',
'fatal:u': 'nn::fatalsrv::IService',
},
'0100000000000037': { # ro
'ldr:ro': 'nn::ro::detail::IRoInterface',
'ro:dmnt': 'nn::ro::detail::IDebugMonitorInterface', # ?
},
'0100000000000039': { # sdb
'mii:e': 'nn::mii::detail::IStaticService',
'mii:u': 'nn::mii::detail::IStaticService',
'pdm:ntfy': 'nn::pdm::detail::INotifyService',
'pdm:qry': 'nn::pdm::detail::IQueryService',
'pl:u': 'nn::pl::detail::ISharedFontManager',
},
}
import hashlib, random, re
clsToInterface = {}
for x in smapping.values():
for k, v in x.items():
if v not in clsToInterface:
clsToInterface[v] = []
clsToInterface[v].append(k)
clses = {}
for cname, cmdid, name, io, params in info:
if cname not in clses:
clses[cname] = {}
#if params != '':
clses[cname][cmdid] = name, io, params
reformedServer = {}
reformedClient = {}
for cname, cmds in serverInfo.items():
if cname not in reformedServer:
reformedServer[cname] = {}
for cmdid, cmd in cmds.items():
cmdid = int(cmdid)
reformedServer[cname][cmdid] = cmd['name'] if 'name' in cmd else '', '', cmd['args'] if 'args' in cmd else ''
for cname, cmdid, io in clientInfo:
if cname not in reformedClient:
reformedClient[cname] = {}
reformedClient[cname][cmdid] = '', io, ''
mset = lambda x: set((cname, cmdid) for cname, cmds in x.items() for cmdid in cmds.keys())
allCmds = mset(reformedClient).union(mset(reformedServer))
for cname, cmdid in allCmds:
cdef = reformedClient[cname][cmdid] if cname in reformedClient and cmdid in reformedClient[cname] else None
sdef = reformedServer[cname][cmdid] if cname in reformedServer and cmdid in reformedServer[cname] else None
if cdef is not None and sdef is None:
idef = cdef
elif cdef is None and sdef is not None:
idef = sdef
else:
idef = sdef[0], cdef[1], sdef[2]
if idef[1] == '':
idef = idef[0], 'UNK bytes in - UNK bytes out', idef[2]
if cname not in clses:
clses[cname] = {}
if cmdid in clses[cname]:
cur = clses[cname][cmdid]
if cur == idef:
continue
cur = list(cur)
for i in xrange(3):
if len(cur[i]) < len(idef[i]):
cur[i] = idef[i]
clses[cname][cmdid] = tuple(cur)
else:
clses[cname][cmdid] = idef
def parseAnyInt(x):
return int(x[2:], 16) if x.startswith('0x') else int(x)
def emitInt(x):
return '0x%x' % x if x > 9 else str(x)
def csplit(inp):
def findMatch(i, ch):
while i < len(inp):
mch = inp[i]
if mch == ch:
return i
elif mch == '<':
i = findMatch(i + 1, '>')
elif mch == '(':
i = findMatch(i + 1, ')')
elif mch == '[':
i = findMatch(i + 1, ']')
i += 1
out = []
i = 0
last = 0
while i < len(inp):
mch = inp[i]
if mch == ',':
if i != last:
out.append(inp[last:i].strip(' ,'))
last = i
elif mch == '<':
i = findMatch(i + 1, '>')
elif mch == '(':
i = findMatch(i + 1, ')')
elif mch == '[':
i = findMatch(i + 1, ']')
i += 1
if last != i:
out.append(inp[last:i].strip(' ,'))
return out
def splitIOSpec(cs):
ins, outs = [], []
for elem in cs:
if elem.startswith('InRaw<'):
ins.append(elem)
elif elem.startswith('OutRaw<'):
outs.append(elem)
elif elem.startswith('Buffer<'):
btype = parseAnyInt(elem.split(',')[1])
if btype & 1:
ins.append(elem)
else:
assert btype & 2
outs.append(elem)
elif elem.startswith('InObject<'):
ins.append(elem)
elif elem.startswith('OutObject<'):
outs.append(elem)
elif elem.startswith('InHandle<'):
ins.append(elem)
elif elem.startswith('OutHandle<'):
outs.append(elem)
else:
print elem
assert False
return ins, outs
def splitIOParams(params):
ins, outs = [], []
for elem in params:
if elem.startswith('nn::sf::Out<nn::sf::SharedPointer<'):
outs.append(elem)
elif elem.startswith('nn::sf::Out<'):
outs.append(elem)
elif elem.startswith('nn::sf::OutBuffer'):
outs.append(elem)
elif elem.startswith('nn::sf::OutArray<'):
outs.append(elem)
elif elem.startswith('nn::sf::InBuffer'):
ins.append(elem)
elif elem.startswith('nn::sf::InArray<'):
ins.append(elem)
else:
assert not elem.startswith('nn::sf::Out') and not elem.startswith('nn::sf::In')
ins.append(elem)
return [x.replace(' ', ' ').replace(' &', '&') for x in ins], [x.replace(' ', ' ').replace(' &', '&') for x in outs]
def parseSpecType(type):
a, b = type[:-1].split('<')
return [a] + [parseAnyInt(x.strip()) for x in b.split(',')]
intTypes = {
'bool' : 'bool',
'unsigned char' : 'u8',
'char' : 'i8',
'signed char' : 'i8',
'int' : 'i32',
'unsigned int' : 'u32',
'long' : 'i64',
'unsigned long' : 'u64',
'float' : 'f32',
}
def remapProtoType(type, stype):
type = type.replace('const&', '')
if type.startswith('nn::sf::Out<'):
type = csplit(type.split('nn::sf::Out<', 1)[1])[0]
elif type.startswith('nn::sf::OutArray<'):
type = type.split('nn::sf::OutArray<', 1)[1].split('>', 1)[0] + '[]'
elif type.startswith('nn::sf::InArray<'):
type = type.split('nn::sf::InArray<', 1)[1].split('>', 1)[0] + '[]'
elif type.startswith('nn::sf::InBuffer'):
type = 'unknown'
type = type.strip()
if type.startswith('nn::sf::SharedPointer<'):
type = type.split('nn::sf::SharedPointer<', 1)[1].split('>', 1)[0]
elif type.startswith('nn::sf::NativeHandle'):
type = 'KObject'
elif type.startswith('nn::util::BitFlagSet<'):
type = csplit(type.split('nn::util::BitFlagSet<', 1)[1][:-1])[1]
type = type.strip()
if type in intTypes:
type = intTypes[type]
elif type.endswith('[]') and type[:-2] in intTypes:
type = intTypes[type[:-2]] + '[]'
stype = parseSpecType(stype)
if stype[0] == 'OutObject' or stype[0] == 'InObject':
return 'object', type
elif stype[0] == 'InRaw' or stype[0] == 'OutRaw':
_, size, alignment, offset = stype
return 'data', type, size, alignment, offset
elif stype[0] == 'Buffer':
if type.endswith('[]'):
type = type[:-2]
assert stype[3] == 0
return 'array', type, stype[2]
else:
type = 'unknown' if type == 'nn::sf::OutBuffer' else type
return 'buffer', type, stype[2], stype[3]
elif stype[0] == 'InHandle' or stype[0] == 'OutHandle':
assert type == 'KObject'
return 'handle',
defaultTypes = {
-1: 'unknown',
1: 'u8',
2: 'u16',
4: 'u32',
8: 'u64',
16: 'u128'
}
def emitDefaultOrBytes(size):
if size in defaultTypes:
return defaultTypes[size]
return 'bytes<%s>' % emitInt(size)
def generateType(stype):
stype = parseSpecType(stype)
if stype[0] == 'InHandle' or stype[0] == 'OutHandle':
return 'handle',
elif stype[0] == 'InObject' or stype[0] == 'OutObject':
return 'object', None
elif stype[0] == 'InRaw' or stype[0] == 'OutRaw':
_, size, alignment, offset = stype
return 'data', emitDefaultOrBytes(size), size, alignment, offset
elif stype[0] == 'Buffer':
return 'buffer', None, stype[2], stype[3]
dataSizes = {}
bufferTypes = set()
def defineSizes(types):
for elem in types:
if (elem[0] == 'buffer' or elem[0] == 'array') and elem[1] is not None:
bufferTypes.add(elem[1])
continue
elif elem[0] != 'data':
continue
elif elem[1] in dataSizes:
assert dataSizes[elem[1]] == elem[2]
continue
dataSizes[elem[1]] = elem[2]
def sortTyped(typed):
return sorted(typed, key=lambda x: dict(data=0, pid=1, handle=2, object=3, buffer=4, array=4)[x[0]])
def sortData(elems):
data = [elem for elem in elems if elem[0] == 'data']
data.sort(key=lambda x: x[4])
return data + elems[len(data):]
def filterAlignment(elems):
cur = 0
for i, elem in enumerate(elems):
if elem[0] != 'data':
break
_, type, size, alignment, offset = elem
calcAlign = min(size, 8)
before = cur
while cur % calcAlign:
cur += 1
if offset != cur:
cur = before
while cur % alignment:
cur += 1
elems[i] = 'data', type, size, alignment
else:
elems[i] = 'data', type, size, None
#assert offset == cur
cur += size
return elems
def parseFunc(cs, params, pid):
cs, params = csplit(cs), csplit(params[1:-1]) if params else []
assert not params or len(cs) == len(params)
si, so = splitIOSpec(cs)
if params:
pi, po = splitIOParams(params)
assert len(si) == len(pi) and len(so) == len(po)
pi, po = [remapProtoType(x, si[i]) for i, x in enumerate(pi)], [remapProtoType(x, so[i]) for i, x in enumerate(po)]
defineSizes(pi + po)
else:
pi, po = map(generateType, si), map(generateType, so)
if pid:
pi = [('pid', )] + pi
return filterAlignment(sortData(sortTyped(pi))), filterAlignment(sortData(sortTyped(po)))
ifaces = {}
for cname, functions in clses.items():
assert cname not in ifaces
ifaces[cname] = iface = {}
for cmdId, func in functions.items():
fname, spec, params = func
if fname == '':
fname = 'Unknown%i' % cmdId
spec = spec.split(' - ')
if len(spec) == 2 and spec[0] == 'UNK bytes in' and spec[1] == 'UNK bytes out':
iface[cmdId] = (fname, (), (), False)
elif len(spec) == 2 or (len(spec) == 3 and spec[2] == 'takes pid'):
assert spec[0] == '0 bytes in' and spec[1] == '0 bytes out'
iface[cmdId] = (fname, (['pid'], ) if len(spec) == 3 else (), (), True)
elif len(spec) == 3 or (len(spec) == 4 and spec[2] == 'takes pid'):
if spec[2] == 'takes pid':
pid = True
cs = spec[3]
else:
pid = False
cs = spec[2]
ins, outs = parseFunc(cs, params, pid)
iface[cmdId] = fname, ins, outs, True
for elem in bufferTypes:
if elem not in dataSizes:
dataSizes[elem] = -1
with file('ipcdefs/auto.id', 'w') as fp:
lastNs = -1
for name, size in sorted(dataSizes.items(), key=lambda x: x[0]):
if name not in intTypes.values() and name != 'void' and name != 'unknown':
ns = name.rsplit('::', 1)[0] if '::' in name else None
if ns != lastNs and lastNs != -1:
print >>fp
print >>fp, 'type %s = %s;' % (name, emitDefaultOrBytes(size))
lastNs = ns
print >>fp
print >>fp
def emitType(type):
if type[0] == 'data':
if type[3] is not None:
return 'align<%i, %s>' % (type[3], type[1])
return type[1] # XXX: Add alignment setup
elif type[0] == 'object':
return 'object<%s>' % (type[1] if type[1] else 'IUnknown')
elif type[0] == 'handle':
return 'KObject'
elif type[0] == 'array':
return 'array<%s, %s>' % (type[1], emitInt(type[2]))
elif type[0] == 'buffer':
return 'buffer<%s, %s, %s>' % (type[1] or 'unknown', emitInt(type[2]), emitInt(type[3]))
elif type[0] == 'pid':
return 'pid'
else:
print 'wtf?', type
def emitFunction(cmdId, fname, ins, outs, documented):
outstr = ''
if documented:
if len(outs) == 1:
outstr = ' -> %s' % emitType(outs[0])
elif len(outs):
outstr = ' -> (%s)' % ', '.join(emitType(x) for x in outs)
return '[%i] %s(%s)%s;' % (cmdId, fname, ', '.join(emitType(x) for x in ins), outstr)
else:
return '@undocumented\n\t[%i] %s();' % (cmdId, fname)
for cname, cmds in sorted(ifaces.items(), key=lambda x: x[0]):
print >>fp, 'interface %s%s {' % (cname, ' is ' + ', '.join(clsToInterface[cname]) if cname in clsToInterface else '')
for cmdId, (fname, ins, outs, documented) in sorted(cmds.items(), key=lambda x: x[0]):
print >>fp, '\t' + emitFunction(cmdId, fname, ins, outs, documented)
print >>fp, '}'
print >>fp
|
11511781 | class BaseStrategy(object):
def __init__(self, debug, type):
self.debug = debug.log
self.type = type
def on_tick(self, my_elevators, my_passengers, enemy_elevators, enemy_passengers):
pass |
11511782 | import copy
if __name__ == "__main__":
'''
ref. https://docs.python.org/3.6/library/copy.html
'''
origin_list = [1, 2, [3, 4]]
copy1 = copy.copy(origin_list) # shallow copy
copy2 = copy.deepcopy(origin_list) # deep (recursive) copy
print(copy1 == copy2)
print(copy1 is copy2)
origin_list[2][0] = "yoyo"
print('origin_list:', origin_list)
print('copy1:', copy1)
print('copy2:', copy2)
|
11511807 | from autologin_middleware import ExposeCookiesMiddleware
from scrapy.exceptions import NotConfigured
class CookiesMiddlewareIfNoSplash(ExposeCookiesMiddleware):
@classmethod
def from_crawler(cls, crawler):
if crawler.settings.get('SPLASH_URL'):
raise NotConfigured
return super().from_crawler(crawler)
|
11511836 | class MyConnMachineOut:
"""Implementation of the application data type MyConnMachineOut.
Generated by: EASy-Producer."""
cmdField: str
|
11511837 | import pytest
from ..control import Control
@pytest.mark.parametrize(
"test_input,expected",
[("AC-2", "AC-2"), ("AC-2 (1)", "AC-2 (1)"), ("AC-2(1)", "AC-2 (1)")],
)
def test_normalized_name(test_input, expected):
control = Control(test_input)
assert control.normalized_name() == expected
|
11511840 | cond1 = df['species'] == 'setosa'
cond2 = df['sepal length (cm)'] > 5.5
cond3 = df['petal length (cm)'] < 1.3
df[cond1 & (cond2 | cond3)] |
11511875 | import tensorflow as tf
'''
Two layers feed forward model
'''
class Feed_forward_two_layers:
def get_name(self):
return "feed_forward_two_layers"
def input_placeholders(self):
inputs_placeholder = tf.placeholder(tf.float32, shape=[None, 784], name="inputs")
labels_placeholder = tf.placeholder(tf.float32, shape=[None, 10], name="labels")
return inputs_placeholder, labels_placeholder
def inference(self, input):
with tf.name_scope("inference"):
middle = self._fully_connected(input, 784, 64)
logits = self._fully_connected(middle, 64, 10)
return logits
def loss(self, logits, labels):
with tf.name_scope("loss"):
labels = tf.to_int64(labels)
cross_entropy = tf.nn.softmax_cross_entropy_with_logits(labels=labels, logits=logits,
name="cross_entropy")
mean = tf.reduce_mean(cross_entropy, name="cross_entropy_mean")
tf.summary.scalar("loss", mean)
return mean
def training(self, loss, learning_rate):
with tf.name_scope("training"):
optimizer = tf.train.AdamOptimizer(learning_rate=learning_rate)
train_operation = optimizer.minimize(loss)
return train_operation
def evaluation(self, logits, labels):
with tf.name_scope("evaluation"):
labels = tf.to_int64(labels)
labels = tf.argmax(labels, 1)
correct = tf.nn.in_top_k(logits, labels, 1)
return tf.reduce_sum(tf.cast(correct, tf.int32))
def _fully_connected(self, input, size_in, size_out, name="fc"):
with tf.name_scope(name):
w = tf.Variable(tf.truncated_normal([size_in, size_out], stddev=0.1), name="W")
b = tf.Variable(tf.constant(0.1, shape=[size_out]), name="b")
act = tf.matmul(input, w) + b
return act
|
11511878 | from django.conf.urls import patterns, include, url
from django.contrib import admin
urlpatterns = patterns('',
# Examples:
# url(r'^$', 'activitytracker.views.home', name='home'),
# url(r'^blog/', include('blog.urls')),
url(r'^$', 'home.views.home', name='home'),
url(r'^registration/$', 'home.views.register', name='register'),
url(r'^login/$', 'home.views.user_login', name='user_login'),
url(r'^logout/$','django.contrib.auth.views.logout', {'next_page': '/'}),
url(r'^dashboard/$', 'accounts.views.dashboard_home', name='dashboard_home'),
url(r'^dashboard/activities/$', 'activities.views.activities_home', name='activities_home'),
url(r'^dashboard/activities/delete/(?P<id>\d+)/$', 'activities.views.activity_delete', name='activity_delete'),
url(r'^dashboard/activities-timeline/$', 'activities.views.activities_timeline', name='activities_timeline'),
url(r'^dashboard/activities-summary/$', 'activities.views.activities_summary', name='activities_summary'),
#monthly summary
url(r'^dashboard/monthly-summary/$', 'activities.views.monthly_summary', name='monthly_summary'),
#activities sync
url(r'^dashboard/activities-sync/$', 'activities.views.activities_sync', name='activities_sync'),
#visuals
url(r'^dashboard/activities-visuals/$', 'activities.views.activities_visuals', name='activities_visuals'),
url(r'^admin/', include(admin.site.urls)),
)
|
11511922 | from nspawn.wrapper.sudo import Sudo
def test_sudo():
sudo = Sudo()
result = sudo.execute_unit(['ls', '-las'])
# print(result.stdout)
# print(result.stderr)
def test_sudo_folder_check():
sudo = Sudo()
assert sudo.folder_check("/tmp") is True
def test_sudo_folder_assert():
sudo = Sudo()
sudo.folder_assert("/tmp")
def test_sudo_folder_transfer():
sudo = Sudo()
source = "/tmp/nspawn-tester-source"
target = "/tmp/nspawn-tester-target"
sudo.folder_ensure(source)
sudo.files_sync_full(source, target)
sudo.files_delete(source)
sudo.files_delete(target)
def test_sudo_file_save_load():
sudo = Sudo()
source = "abrakadabra"
file = "/tmp/test_sudo_file_save_load"
sudo.file_save(file, source)
target = sudo.file_load(file)
sudo.files_delete(file)
assert source == target
def test_sudo_xattr_get_set():
sudo = Sudo()
name = 'tester'
source = "abra '{' kadabra '}' abra"
file = "/var/test-sudo-xattr-get-set"
sudo.file_save(file, source)
sudo.xattr_set(file, name, source)
target = sudo.xattr_get(file, name)
sudo.files_delete(file)
assert source == target
def test_sudo_xattr_load_save():
sudo = Sudo()
assert sudo.xattr_space() == 'user.nspawn.'
assert sudo.xattr_regex() == '^user[.]nspawn[.]'
source = dict(
num1='1',
num2='2.0',
one="one ':' one ':' one",
two="two '{'} two [']' two",
any="hello '{'} (###) [']' kitty",
)
file = "/var/test-sudo-xattr-load-save"
sudo.file_save(file, "")
sudo.xattr_save(file, source)
target = sudo.xattr_load(file)
sudo.files_delete(file)
assert source == target
|
11511932 | from __future__ import absolute_import, division, print_function
__metaclass__ = type
from ansible.errors import AnsibleFilterError
from ansible.module_utils.common._collections_compat import Iterable
def users_groups(users, groups=None):
if not isinstance(users, Iterable):
raise AnsibleFilterError('Expected an iterable but was a %s' % type(users))
groups = groups or []
if not isinstance(groups, Iterable):
raise AnsibleFilterError('Expected a groups iterable but was a %s' % type(groups))
results = []
for user in users:
for group in groups:
if 'skipped' in group and group['skipped']:
continue
if group['item']['user'] == user['user']:
user['group'] = group['stdout']
break
results.append(user)
return results
class FilterModule(object):
''' Manala users groups filter '''
def filters(self):
filters = {
'users_groups': users_groups,
}
return filters
|
11511956 | import pymongo
import multiprocessing as mp
from pathlib import Path
from sc2reaper.sc2reaper import ingest as _ingest
from sc2reaper.sc2reaper import DB_NAME, address, port_num
from sc2reaper import utils
def ingest(path_to_replays, proc):
"""
Load a replay into a mongo database.
"""
# So that pysc2 runs:
from absl import flags
import sys
FLAGS = flags.FLAGS
flags.DEFINE_integer("proc", 1, "Amount of processors you want to devote.")
FLAGS(sys.argv)
path_to_replays = Path(path_to_replays)
if path_to_replays.name.endswith(".SC2Replay"):
# it's actually just a replay.
replay_files = [str(path_to_replays)]
else:
replay_files = [replay for replay in path_to_replays.glob("*.SC2Replay")]
# If the database already exists, we check if we have already
# processed some of the replays, and substract them from the
# set we want to process. That way, we don't process replays twice.
client = pymongo.MongoClient(address, port_num)
if DB_NAME in client.list_database_names():
db = client[DB_NAME]
replays = db["replays"]
parsed_files = set([
Path(doc['replay_name']) for doc in replays.find()
])
print(f"Found {len(parsed_files)} replays in the database already.")
replay_files = set(replay_files)
replay_files -= parsed_files
replay_files = list(replay_files)
client.close()
if len(replay_files) > 1:
replay_files_chunks = utils.split(replay_files, proc)
# Ingesting the replays
with mp.Pool(proc) as p:
p.map(_ingest, replay_files_chunks)
elif len(replay_files) == 1:
_ingest(replay_files)
else:
raise ValueError("Found no new replays in path. Do they end on SC2Replay?")
|
11512020 | from __future__ import annotations
import ast
import builtins
from typing import Optional, List, Union, TypeVar, cast
from stdlib_list import stdlib_list
from mr_proper.common_types import AnyFuncdef
from mr_proper.config import TARGET_PYTHON_VERSION
if False: # TYPE_CHECKING
from typing import Type
T = TypeVar('T', bound=ast.AST)
BUILTINS_LIST = {b for b in dir(builtins) if not b.startswith('_')}
STDLIB_MODULES_NAMES = stdlib_list(TARGET_PYTHON_VERSION)
def get_ast_tree(pyfilepath: str) -> Optional[ast.Module]:
with open(pyfilepath, 'r') as file_handler:
try:
file_content = file_handler.read()
except UnicodeDecodeError:
return None
try:
ast_tree = ast.parse(file_content)
except SyntaxError:
return None
set_parents(ast_tree)
return ast_tree
def set_parents(ast_tree: ast.AST) -> None:
for node in ast.walk(ast_tree):
for child in ast.iter_child_nodes(node):
child.parent = node # type: ignore
ast_tree.parent = None # type: ignore
def get_all_funcdefs_from(ast_tree: ast.AST) -> List[AnyFuncdef]:
return [n for n in ast.walk(ast_tree) if isinstance(n, (ast.FunctionDef, ast.AsyncFunctionDef))]
def get_nodes_from_funcdef_body(
funcdef: Union[ast.FunctionDef, ast.AsyncFunctionDef],
of_types: List[Type[T]],
) -> List[T]:
nodes: List[ast.AST] = []
for node in funcdef.body:
nodes += [n for n in ast.walk(node) if isinstance(n, tuple(of_types))]
return nodes # type: ignore
def is_imported_from_stdlib(name: str, file_ast_tree: ast.Module) -> Optional[bool]:
for import_node in get_all_global_import_nodes(file_ast_tree):
for full_import_path in get_full_import_pathes(import_node):
if full_import_path.split('.')[-1] == name:
base_module = full_import_path.split('.')[0]
return base_module in STDLIB_MODULES_NAMES
return None
def get_local_var_names_from_funcdef(funcdef_node: AnyFuncdef) -> List[str]:
local_vars_names: List[str] = []
for assign_node in get_nodes_from_funcdef_body(funcdef_node, [ast.Assign]):
for target in assign_node.targets:
local_vars_names += [n.id for n in ast.walk(target) if isinstance(n, ast.Name)]
for annassign_node in get_nodes_from_funcdef_body(funcdef_node, [ast.AnnAssign]):
if isinstance(annassign_node.target, ast.Name):
local_vars_names.append(annassign_node.target.id)
for comprehension in get_nodes_from_funcdef_body(funcdef_node, [ast.comprehension, ast.For]):
comprehension = cast(ast.comprehension, comprehension)
local_vars_names += get_local_var_names_from_loop(comprehension)
local_vars_names += {
n.name
for n in ast.walk(funcdef_node)
if isinstance(n, ast.ExceptHandler) and n.name
}
return sorted(set(local_vars_names))
def get_local_var_names_from_loop(loop_node: Union[ast.comprehension, ast.For]) -> List[str]:
if isinstance(loop_node.target, ast.Name):
return [loop_node.target.id]
elif isinstance(loop_node.target, ast.Tuple):
return [e.id for e in loop_node.target.elts if isinstance(e, ast.Name)]
return []
def get_all_global_import_nodes(file_ast_tree: ast.AST) -> List[Union[ast.ImportFrom, ast.Import]]:
nodes_with_local_scope = {ast.FunctionDef, ast.AsyncFunctionDef, ast.ClassDef}
import_nodes: List[Union[ast.ImportFrom, ast.Import]] = []
for node in getattr(file_ast_tree, 'body', []):
if isinstance(node, (ast.ImportFrom, ast.Import)):
import_nodes.append(node)
if hasattr(node, 'body') and not isinstance(node, tuple(nodes_with_local_scope)):
import_nodes += get_all_global_import_nodes(node)
return import_nodes
def get_full_import_pathes(import_node: Union[ast.ImportFrom, ast.Import]) -> List[str]:
if isinstance(import_node, ast.Import):
return [n.name for n in import_node.names]
elif isinstance(import_node, ast.ImportFrom):
return [f'{import_node.module}.{n.name}' for n in import_node.names]
|
11512088 | from gym.envs.registration import register
register(
id='Carla-v0',
entry_point='environment.carla_gym.envs:CarlaEnv',
) |
11512133 | from py3plex.core import random_generators
ER_multilayer = random_generators.random_multilayer_ER(200,
6,
0.09,
directed=True)
ER_multilayer.visualize_network(show=True, no_labels=True)
|
11512173 | import os
import torch
import argparse
import numpy as np
from collections import defaultdict
from mmcv import Config
from mmcv.runner import load_checkpoint, init_dist, get_dist_info
from mmcv.parallel import MMDistributedDataParallel
from mmdet.apis import set_random_seed, multi_gpu_test
from mmdet3d.models import build_model
from mmdet3d.datasets import build_dataloader, build_dataset
def parse_args():
parser = argparse.ArgumentParser(
description='MMDet test (and eval) a 5 models 5 times')
parser.add_argument('config', help='config file')
parser.add_argument('checkpoint', help='checkpoints directory')
parser.add_argument(
'--launcher',
choices=['none', 'pytorch', 'slurm', 'mpi'],
default='none',
help='job launcher')
parser.add_argument('--local_rank', type=int, default=0)
args = parser.parse_args()
if 'LOCAL_RANK' not in os.environ:
os.environ['LOCAL_RANK'] = str(args.local_rank)
return args
def main():
args = parse_args()
cfg = Config.fromfile(args.config)
init_dist(args.launcher, **cfg.dist_params)
checkpoints = tuple(filter(lambda x: x.endswith('.pth'), os.listdir(args.checkpoint)))
print('found checkpoints: ', checkpoints)
metrics = defaultdict(list)
model = build_model(cfg.model, test_cfg=cfg.get('test_cfg'))
model = MMDistributedDataParallel(
model.cuda(),
device_ids=[torch.cuda.current_device()],
broadcast_buffers=False)
for i, checkpoint in enumerate(checkpoints):
load_checkpoint(model, os.path.join(args.checkpoint, checkpoint), map_location='cpu')
for j in range(5):
set_random_seed(j * 111)
dataset = build_dataset(cfg.data.test)
data_loader = build_dataloader(
dataset,
samples_per_gpu=1,
workers_per_gpu=cfg.data.workers_per_gpu,
dist=True,
shuffle=False)
outputs = multi_gpu_test(model, data_loader)
if get_dist_info()[0] == 0:
for k, v in dataset.evaluate(outputs).items():
metrics[k].append(v)
if get_dist_info()[0] == 0:
for k in ('mAP_0.25', 'mAP_0.50'):
print(k, 'min, mean, max:', np.min(metrics[k]), np.mean(metrics[k]), np.max(metrics[k]))
if __name__ == '__main__':
main()
|
11512179 | import numpy as np
import random
import os
import numpy as np
import sys
from os import listdir
from os.path import isfile, join
from tqdm import tqdm
import pickle
import torch
import pandas as pd
from skimage import io, transform
import numpy as np
import matplotlib.pyplot as plt
from torch.utils.data import Dataset, DataLoader
from torchvision import transforms, utils
from math import floor, ceil
# Ignore warnings
import warnings
warnings.filterwarnings("ignore")
#from ssl.new_SSL_TS_RP import temporal_shuffling, relative_positioning
from eegssl.preprocessing.new_preprocess import preprocess
MINUTES_TO_SECONDS = 60
class EEG_SSL_Dataset(Dataset):
def __init__(self, T_pos, T_neg, anchor_windows_per_recording=2000,
samples_per_anchor_window=6,
raw_data_folder=None, preprocessed_file=None,
save_preprocessed_path=None, sampling_freq=100,
window_length=30, predict_delay=60):
"""
Takes in either a data folder or a preprocessed file
"""
self.T_pos = floor(T_pos * MINUTES_TO_SECONDS / window_length) # convert units from minutes to # of time windows
self.T_neg = ceil(T_neg * MINUTES_TO_SECONDS / window_length)
self.anchor_windows_per_recording = int(anchor_windows_per_recording)
self.window_length = window_length # in seconds
self.predict_delay = predict_delay
self.sampling_freq = sampling_freq
if ((raw_data_folder is None and preprocessed_file is None)
or (raw_data_folder is not None and preprocessed_file is not None)):
raise ValueError("Dataset requires a preprocessed_file or a raw_data_folder")
if raw_data_folder is not None:
self.files = [f for f in os.listdir(raw_data_folder) if f.endswith("PSG.edf")]
self.preprocessed = []
for f in tqdm(self.files):
full_path = os.path.join(raw_data_folder, f)
pp_file = preprocess(full_path)
self.preprocessed.append(pp_file)
if save_preprocessed_path is not None:
pickle.dump((self.preprocessed, self.files), open(save_preprocessed_path, 'wb'))
elif preprocessed_file is not None:
self.preprocessed, self.files = pickle.load(open(preprocessed_file, 'rb'))
self.num_files = len(self.files)
self.samples_per_anchor_window = samples_per_anchor_window
def __len__(self):
return self.num_files * self.anchor_windows_per_recording * self.samples_per_anchor_window
def __getitem__(self, idx):
file_idx = idx // (self.samples_per_anchor_window * self.anchor_windows_per_recording)
sample_idx = idx % self.samples_per_anchor_window
f = self.preprocessed[file_idx]
anchor_idx = np.random.randint(len(f))
### Sampling with the indexes
RP_sample, RP_label = self.relative_positioning(f, anchor_idx, sample_idx)
return RP_sample, RP_label
def sample_pos_idx(self, anchor_idx, recording_len):
"""
sample positive sample index uniformly in the union of 2 intervals
(anchor_idx-self.T_pos, anchor_idx) u (anchor_idx, anchor_idx+self.T_pos)
"""
# TODO: check off by 1 errors
left_interval_start = max(anchor_idx-self.T_pos + 1, 0) # (endpoint included)
right_interval_end = min(anchor_idx+self.T_pos, recording_len) # (endpoint not included)
random_idx = None
while random_idx is None or random_idx == anchor_idx:
random_idx = np.random.randint(left_interval_start, right_interval_end)
return random_idx
def sample_neg_idx(self, anchor_idx, recording_len):
"""
sample negative sample index uniformly in the union of 2 intervals
(0, anchor_idx-self.T_neg) U (anchor_idx+self.T_neg, recording_len)
"""
# TODO: check off by 1 errors
random_idx = np.random.randint(recording_len-2*self.T_neg)
if random_idx >= anchor_idx - self.T_neg:
random_idx += 2*self.T_neg
return random_idx
def relative_positioning(self, recording, anchor_idx, sample_idx):
""" Retrives a self-supervised (relative positioning) sample
Args:
recording - Numpy datset of time-series arrays
self.T_pos - positive context to sample from (in minutes)
self.T_neg - negative context to sample from (in minutes)
samples_per_anchor_window - int representing number of epochs to sample
Output:
RP_sample - Relative Positioning sample of dimensions (2, s, c)
2 - sample1 + sample2
s - # of eeg channels in each sample
c - Samples per channel = 30s * 100Hz
RP_labels - Relative Positioning label of dimensions (1)
for each y = {1: if |sample1-sample2| < self.T_pos and -1: if |sample1-sample2| > self.T_neg}
"""
anchor_window = recording[anchor_idx]
if sample_idx < self.samples_per_anchor_window / 2: # self.T_pos loop
pos_idx = self.sample_pos_idx(anchor_idx, len(recording))
pos_window = recording[pos_idx]
RP_sample = np.array([anchor_window, pos_window])
RP_label = np.array([1])
else: # Loop for self.T_neg
neg_idx = self.sample_neg_idx(anchor_idx, len(recording))
neg_window = recording[neg_idx]
RP_sample = np.array([anchor_window, neg_window])
RP_label = np.array([-1])
return RP_sample, RP_label |
11512188 | def parse_notifier_schema(schema):
return list(filter(lambda x: x != "message" and not schema["properties"][x].get("duplicate"), schema["properties"].keys()))
|
11512207 | import sys
import os
import unittest
import uuid
def _create_random_voice(app):
id = uuid.uuid4().hex[:3]
name = 'vn_' + uuid.uuid4().hex[:4]
lang = uuid.uuid4().hex[:2]
acc = uuid.uuid4().hex[:2]
gender = uuid.uuid4().hex[:5]
directory = uuid.uuid4().hex[:5]
with app.app_context():
from app.models.voice import Voice
voice = Voice.new_voice(id, name, lang, acc, gender, directory)
return (id, name, lang, acc, gender, directory)
class LanguagesTest(unittest.TestCase):
def setUp(self):
from integrationtest import setup_app
self.app, self.client, self.db = setup_app()
def tearDown(self):
# delete the database data
with self.app.app_context():
from app.models.voice import Voice
self.db.session.query(Voice).delete()
self.db.session.commit()
def test_languages_with_empty_db(self):
# act
resp = self.client.get('/languages')
# assert
self.assertEqual(resp.status_code, 204)
def test_languages_with_non_empty_db(self):
lang = _create_random_voice(self.app)[2]
# act
resp = self.client.get('/languages')
# assert
self.assertEqual(resp.status_code, 200)
self.assertIn('languages', resp.json)
self.assertEqual(lang, resp.json['languages'][0])
def test_accents_with_non_existing_language(self):
lang = uuid.uuid4().hex[:2]
# act
resp = self.client.get('/languages/'+lang+'/accents')
# assert
self.assertEqual(resp.status_code, 404)
self.assertIn('message', resp.json)
self.assertIn('Language could not be found', resp.json['message'])
def test_accents_with_existing_language(self):
lang, acc = _create_random_voice(self.app)[2:4]
# act
resp = self.client.get('/languages/'+lang+'/accents')
# assert
self.assertEqual(resp.status_code, 200)
self.assertIn('language', resp.json)
self.assertEqual(resp.json['language'], lang)
self.assertIn('accents', resp.json)
self.assertIn(acc, resp.json['accents'])
|
11512232 | import random
from selenium_ui.bamboo.pages.pages import Login, Logout, ProjectList, BuildList, PlanConfiguration, BuildActivity, \
PlanSummary, BuildSummary, BuildLogs, PlanHistory, JobConfiguration
from selenium_ui.conftest import print_timing
USERS = "users"
BUILD_PLANS = "build_plans"
def setup_run_data(datasets):
user = random.choice(datasets[USERS])
build_plan = random.choice(datasets[BUILD_PLANS])
datasets['username'] = user[0]
datasets['password'] = user[1]
datasets['build_plan_id'] = build_plan[1]
def login(webdriver, datasets):
setup_run_data(datasets)
login_page = Login(webdriver)
@print_timing("selenium_login")
def measure():
@print_timing("selenium_login:open_login_page")
def sub_measure():
login_page.go_to()
sub_measure()
login_page.set_credentials(username=datasets['username'], password=datasets['password'])
login_page.click_login_button()
measure()
def view_all_projects(webdriver, datasets):
@print_timing("selenium_view_all_projects")
def measure():
projects_page = ProjectList(webdriver)
projects_page.click_projects_button()
projects_page.wait_for_page_loaded()
measure()
def view_all_builds(webdriver, datasets):
@print_timing("selenium_view_all_builds")
def measure():
builds_page = BuildList(webdriver)
builds_page.click_all_builds_button()
builds_page.wait_for_page_loaded()
measure()
def config_plan(webdriver, datasets):
@print_timing("selenium_config_plan")
def measure():
config_page = PlanConfiguration(webdriver)
config_page.click_config_plan_button()
config_page.wait_for_page_loaded()
measure()
def builds_queue_page(webdriver, datasets):
@print_timing("selenium_view_build_activity")
def measure():
activity_page = BuildActivity(webdriver)
activity_page.open_build_dropdown()
activity_page.wait_for_page_loaded()
measure()
def view_plan_summary(webdriver, datasets):
plan_summary = PlanSummary(webdriver, build_plan_id=datasets['build_plan_id'])
@print_timing("selenium_view_plan_summary")
def measure():
plan_summary.go_to_summary_plan_page()
plan_summary.wait_for_page_loaded()
measure()
def view_build_summary(webdriver, datasets):
build_summary = BuildSummary(webdriver, build_plan_id=datasets['build_plan_id'])
@print_timing("selenium_view_build_summary")
def measure():
build_summary.go_to_build_summary_page()
build_summary.wait_for_page_loaded()
measure()
def view_plan_history_page(webdriver, datasets):
plan_history = PlanHistory(webdriver, build_plan_id=datasets['build_plan_id'])
@print_timing("selenium_view_plan_history")
def measure():
plan_history.go_to_plan_history_page()
plan_history.wait_for_page_loaded()
measure()
def view_build_logs(webdriver, datasets):
@print_timing("selenium_view_build_logs")
def measure():
view_logs = BuildLogs(webdriver)
view_logs.go_to_build_logs()
view_logs.wait_for_page_loaded()
measure()
def view_job_configuration(webdriver, datasets):
@print_timing("selenium_view_job_configuration")
def measure():
view_job_configuration_page = JobConfiguration(webdriver)
view_job_configuration_page.click_config_plan_button()
view_job_configuration_page.click_job_config_button()
view_job_configuration_page.wait_for_page_loaded()
measure()
def log_out(webdriver, datasets):
@print_timing("selenium_log_out")
def measure():
Logout(webdriver)
measure()
|
11512243 | import sys
import uuid
import time
import traceback
import queue
import json
import datetime
import mprpc
import logging
import socket
import dill
import pprint
import threading
import multiprocessing
import os
import common.LogBase
import common.get_rpyc
from WebMirror.JobUtils import buildjob
from common.util import rpc_serialize
from common.util import local_exec
from common.util.remote_base import RpcBaseClass
########################################################################################################################
#
# ## ## ### #### ## ## ###### ## ### ###### ######
# ### ### ## ## ## ### ## ## ## ## ## ## ## ## ## ##
# #### #### ## ## ## #### ## ## ## ## ## ## ##
# ## ### ## ## ## ## ## ## ## ## ## ## ## ###### ######
# ## ## ######### ## ## #### ## ## ######### ## ##
# ## ## ## ## ## ## ### ## ## ## ## ## ## ## ## ##
# ## ## ## ## #### ## ## ###### ######## ## ## ###### ######
#
########################################################################################################################
class RpcTimeoutError(RuntimeError):
pass
class RpcExceptionError(RuntimeError):
pass
# DO_LOCAL = True
DO_LOCAL = False
class RpcMixin():
def __init__(self, *args, **kwargs):
super().__init__(*args, **kwargs)
self.rpc_interfaces = {}
self.job_map = {}
self.job_counter = 0
self.rpc_timeout_s = 60 * 40
self.remote_log = logging.getLogger("Main.RPC.Remote")
self.check_open_rpc_interface()
self.log.info("RPC Interface initialized")
@property
def rpc_interface(self):
'''
Create a unique RPC interface per-thread, and
don't share them.
'''
threadName = threading.current_thread().name
procName = multiprocessing.current_process().name
thread_key = "{} - {}".format(threadName, procName)
if thread_key not in self.rpc_interfaces:
self.rpc_interfaces[thread_key] = common.get_rpyc.RemoteJobInterface("RWP-RPC-Fetcher")
return self.rpc_interfaces[thread_key]
def close_rpc_interface(self):
threadName = threading.current_thread().name
procName = multiprocessing.current_process().name
thread_key = "{} - {}".format(threadName, procName)
if thread_key in self.rpc_interfaces:
self.rpc_interfaces.pop(thread_key)
else:
self.log.warning("Closing RPC interface from a thread that hasn't opened it!")
def put_outbound_raw(self, raw_job):
# Recycle the rpc interface if it ded
errors = 0
while 1:
try:
self.rpc_interface.put_job(raw_job)
return
except TypeError:
self.check_open_rpc_interface()
except KeyError:
self.check_open_rpc_interface()
except BrokenPipeError:
self.check_open_rpc_interface()
except Exception as e:
self.check_open_rpc_interface()
errors += 1
if errors > 5:
raise e
def put_outbound_fetch_job(self, jobid, joburl):
self.log.info("Dispatching new fetch job")
raw_job = buildjob(
module = 'WebRequest',
call = 'getItem',
dispatchKey = "rwp-rpc-system",
jobid = jobid,
args = [joburl],
kwargs = {},
additionalData = {'mode' : 'fetch'},
postDelay = 0
)
self.put_outbound_raw(raw_job)
def put_outbound_callable(self, jobid, serialized, meta={}, call_kwargs={}, early_ack=False, job_unique_id=None):
self.log.info("Dispatching new callable job")
call_kwargs_out = {'code_struct' : serialized}
for key, value in call_kwargs.items():
call_kwargs_out[key] = value
raw_job = buildjob(
module = 'RemoteExec',
call = 'callCode',
dispatchKey = "rwp-rpc-system",
jobid = jobid,
kwargs = call_kwargs_out,
additionalData = meta,
postDelay = 0,
early_ack = early_ack,
serialize = self.pluginName,
unique_id = job_unique_id,
)
self.put_outbound_raw(raw_job)
def process_responses(self):
# Something in the RPC stuff is resulting in a typeerror I don't quite
# understand the source of. anyways, if that happens, just reset the RPC interface.
try:
return self.rpc_interface.get_job()
except queue.Empty:
return None
except TypeError:
self.check_open_rpc_interface()
return None
except socket.timeout:
self.check_open_rpc_interface()
return None
except KeyError:
self.check_open_rpc_interface()
return None
def check_open_rpc_interface(self):
try:
if self.rpc_interface.check_ok():
return
except Exception:
self.log.error("Failure when probing RPC interface")
for line in traceback.format_exc().split("\n"):
self.log.error(line)
try:
self.rpc_interface.close()
self.log.warning("Closed interface due to connection exception.")
except Exception:
self.log.error("Failure when closing errored RPC interface")
for line in traceback.format_exc().split("\n"):
self.log.error(line)
self.close_rpc_interface()
self.rpc_interface.check_ok()
def put_job(self, remote_cls, call_kwargs=None, meta=None, early_ack=False, job_unique_id=None):
if call_kwargs is None:
call_kwargs = {}
if not meta:
meta = {}
jid = str(uuid.uuid4())
if 'drain' in sys.argv:
print("Consuming replies only")
self.check_open_rpc_interface()
else:
scls = rpc_serialize.serialize_class(remote_cls)
# print("Putting job:", jid, call_kwargs)
self.put_outbound_callable(jid, scls, call_kwargs=call_kwargs, meta=meta, early_ack=early_ack, job_unique_id=job_unique_id)
return jid
def __blocking_dispatch_call_local(self, remote_cls, call_kwargs, meta=None, expect_partials=False):
self.log.info("Dispatching new callable job to local executor")
print("Kwargs:", call_kwargs)
scls = rpc_serialize.serialize_class(remote_cls)
call_kwargs_out = {'code_struct' : scls}
for key, value in call_kwargs.items():
call_kwargs_out[key] = value
# job = {
# 'call' : 'callCode',
# 'module' : 'RemoteExec',
# 'args' : (),
# 'kwargs' : call_kwargs_out,
# 'extradat' : meta,
# 'dispatch_key' : "rpc-system",
# 'response_routing_key' : 'response'
# }
print(local_exec)
print(dir(local_exec))
jid = self.job_counter
self.job_counter += 1
raw_job = buildjob(
module = 'RemoteExec',
call = 'callCode',
dispatchKey = "rwp-rpc-system",
jobid = jid,
kwargs = call_kwargs_out,
additionalData = meta,
postDelay = 0,
early_ack = False,
serialize = self.pluginName,
unique_id = None,
)
rpc_interface = common.get_rpyc.RemoteFetchInterface()
rpc_interface.check_ok()
ret = rpc_interface.dispatch_request(raw_job)
rpc_interface.close()
ret['jobid'] = jid
ret = self.process_response_items([jid], expect_partials, preload_rets=[ret])
if not expect_partials:
ret = next(ret)
return ret
def __blocking_dispatch_call_remote(self, remote_cls, call_kwargs, meta=None, expect_partials=False, job_unique_id=None):
jobid = self.put_job(remote_cls, call_kwargs, meta, job_unique_id=job_unique_id)
ret = self.process_response_items([jobid], expect_partials)
if not expect_partials:
ret = next(ret)
return ret
def blocking_dispatch_call(self, remote_cls, call_kwargs, meta=None, expect_partials=False, local=DO_LOCAL, job_unique_id=None):
if local:
return self.__blocking_dispatch_call_local(remote_cls=remote_cls, call_kwargs=call_kwargs, meta=meta, expect_partials=expect_partials)
else:
return self.__blocking_dispatch_call_remote(remote_cls=remote_cls, call_kwargs=call_kwargs, meta=meta, expect_partials=expect_partials, job_unique_id=job_unique_id)
def pprint_resp(self, resp):
if len(resp) == 2:
logmsg, response_data = resp
self.print_remote_log(logmsg)
for line in pprint.pformat(resp).split("\n"):
self.log.info(line)
if 'traceback' in resp:
if isinstance(resp['traceback'], str):
trace_arr = resp['traceback'].split("\n")
else:
trace_arr = resp['traceback']
for line in trace_arr:
self.log.error(line)
def print_remote_log(self, log_lines, debug=False):
calls = {
"[DEBUG] ->" : self.remote_log.debug if debug else None,
"[INFO] ->" : self.remote_log.info,
"[ERROR] ->" : self.remote_log.error,
"[CRITICAL] ->" : self.remote_log.critical,
"[WARNING] ->" : self.remote_log.warning,
}
for line in log_lines:
for key, log_call in calls.items():
if key in line and log_call:
log_call(line)
def process_response_items(self, jobids, preload_rets = [], timeout=None):
self.log.info("Waiting for remote response (preloaded: %s)", len(preload_rets) if preload_rets else "None")
if not timeout:
timeout = self.rpc_timeout_s
assert isinstance(jobids, list)
while timeout or preload_rets:
timeout -= 1
if preload_rets:
self.log.info("Have preloaded item. Using.")
ret = preload_rets.pop(0)
else:
ret = self.process_responses()
if ret:
if 'ret' in ret:
if len(ret['ret']) == 2:
self.print_remote_log(ret['ret'][0])
if 'partial' in ret and ret['partial']:
timeout = self.rpc_timeout_s
yield ret, ret['ret'][1]
else:
yield ret, ret['ret'][1]
if 'jobid' in ret and ret['jobid'] in jobids:
jobids.remove(ret['jobid'])
self.log.info("Last partial received for job %s, %s remaining.", ret['jobid'], len(jobids))
if not jobids:
return
else:
if 'jobid' in ret:
self.log.info("Received completed job response from a previous session (%s, waiting for %s, have: %s)?",
ret['jobid'], jobids, ret['jobid'] in jobids)
else:
self.log.error("Response that's not partial, and yet has no jobid?")
else:
self.pprint_resp(ret)
raise RuntimeError("Response not of length 2 (%s, %s)!" % (len(ret), len(ret['ret']) == 2))
else:
with open('rerr-{}.json'.format(time.time()), 'w', encoding='utf-8') as fp:
fp.write(json.dumps(ret, indent=4, sort_keys=True))
self.pprint_resp(ret)
self.log.error("RPC Call has no ret value. Probably encountered a remote exception: %s", ret)
time.sleep(1)
print("\r`fetch_and_flush` sleeping for {} ({} items remaining)\r".format(str((timeout)).rjust(7), len(jobids)), end='', flush=True)
raise RpcTimeoutError("No RPC Response within timeout period (%s sec)" % self.rpc_timeout_s)
class RpcTestClass(RpcBaseClass):
logname = "Main.RemoteExec.TestClass"
def _go(self, partial_resp_interface, lock_interface, param_1, param_2):
print("%s, %s" % (param_1, param_2))
self.log.info("%s, %s", param_1, param_2)
self.log.info("WG: %s", self.wg)
self.log.info("partial_resp_interface: %s", partial_resp_interface)
self.log.info("lock_interface: %s", lock_interface)
self.log.info("WG.twocaptcha_api_key: %s", self.wg.twocaptcha_api_key)
self.log.info("WG.anticaptcha_api_key: %s", self.wg.anticaptcha_api_key)
self.log.info("lock_interface dir: %s", dir(lock_interface))
self.log.info("lock_interface seen: %s", lock_interface.get_seen())
return None
class TestClass(common.LogBase.LoggerMixin, RpcMixin):
loggerPath = "Main.RPC-Test-Class"
pluginName = "RpcGet"
def test():
print("Test")
instance = TestClass()
print(instance)
instance.blocking_dispatch_call(remote_cls=RpcTestClass, call_kwargs={"param_1" : "Val 1", "param_2": "Val 2"})
if __name__ == '__main__':
import logSetup
logSetup.initLogging()
test()
|
11512256 | import numbers # import numbers.py file
class Block_type:
def __init__(self, texture_manager, name = "unknown", block_face_textures = {"all": "cobblestone"}):
self.name = name
# set our block type's vertex positions, texture coordinates, and indices to the default values in our numbers.py file
self.vertex_positions = numbers.vertex_positions
self.tex_coords = numbers.tex_coords.copy() # we need to create a copy of this, since we need to modify our texture coordinates in a different way for each block type (to have different textures per block)
self.indices = numbers.indices
def set_block_face(face, texture): # set a specific face of the block to a certain texture
for vertex in range(4):
self.tex_coords[face * 12 + vertex * 3 + 2] = texture
for face in block_face_textures: # go through all the block faces we specified a texture for
texture = block_face_textures[face] # get that face's texture
texture_manager.add_texture(texture) # add that texture to our texture manager (the texture manager will make sure it hasn't already been added itself)
texture_index = texture_manager.textures.index(texture) # find that texture's index (texture's Z component in our texture array) so that we can modify the texture coordinates of each face appropriately
if face == "all": # set the texture for all faces if "all" is specified
set_block_face(0, texture_index)
set_block_face(1, texture_index)
set_block_face(2, texture_index)
set_block_face(3, texture_index)
set_block_face(4, texture_index)
set_block_face(5, texture_index)
elif face == "sides": # set the texture for only the sides if "sides" is specified
set_block_face(0, texture_index)
set_block_face(1, texture_index)
set_block_face(4, texture_index)
set_block_face(5, texture_index)
else: # set the texture for only one of the sides if one of the sides is specified
set_block_face(["right", "left", "top", "bottom", "front", "back"].index(face), texture_index) |
11512318 | load(":wrapped_ctx.bzl", "repo_file", "repo_template")
def error(message):
return struct(value = None, error = message)
def success(value):
return struct(value = value, error = None)
def globvalue(values, exclude = None, exclude_directories = True):
keyword_arguments = {}
if exclude:
keyword_arguments["exclude"] = exclude
if not exclude_directories:
keyword_arguments["exclude_directories"] = exclude_directories
return struct(
context = "list",
function_name = "glob",
arguments = (values,),
keyword_arguments = keyword_arguments,
)
def _fmt_key(key, context):
if context == "list":
return repr(["%{" + key + "}"])
else:
return repr("%{" + key + "}")
def _fmt_args(values):
return ", ".join([repr(v) for v in values])
def _fmt_kwargs(values):
return ", ".join(["%s=%s" % (k, repr(v)) for k, v in values.items()])
def _fmt_value(value):
if type(value) == "struct" and hasattr(value, "function_name"):
args = []
if value.arguments:
args += [_fmt_args(value.arguments)]
if value.keyword_arguments:
args += [_fmt_kwargs(value.keyword_arguments)]
return "{}({})".format(value.function_name, ", ".join(args))
else:
return repr(value)
def _tmpl_entry(key, value):
context = getattr(value, "context", type(value))
return _fmt_key(key, context), _fmt_value(value)
def _tmpl_dict(values):
tmpl = {}
for item in values.items():
key, value = _tmpl_entry(*item)
tmpl[key] = value
return tmpl
def write_build(repo_ctx, name, includes, defines, linkopts, srcs = None):
if srcs == None:
srcs = ["empty.cc"]
# TODO(shahms): See if we can finally do away with this on OS X.
repo_file(repo_ctx, "empty.cc", "", False)
subs = _tmpl_dict({
"name": name,
"srcs": srcs,
"includes": includes,
"defines": defines,
"linkopts": linkopts,
})
repo_template(
repo_ctx,
"BUILD",
repo_ctx.attr.build_file_template,
subs,
)
|
11512323 | import os
os.environ['KMP_DUPLICATE_LIB_OK']='True'
os.environ["CUDA_VISIBLE_DEVICES"] = "0"
import cv2
import paddlehub as hub
import matplotlib.pyplot as plt
import matplotlib.image as mpimg
import numpy as np
import math
src_img = cv2.imread('./3.jpg')
shape = src_img.shape
ss = (round(shape[1]/3),round(shape[0]/3))
src_img = cv2.resize(src_img, ss, interpolation=cv2.INTER_AREA)
tmp_img = src_img.copy()
module = hub.Module(name="face_landmark_localization")
result = module.keypoint_detection(images=[src_img])
mask_img = src_img.copy()
tmp = np.array(result[0]['data'][0],dtype=np.int32)
lefteye = tuple([tmp[36][0], tmp[37][1]])
leftsize = tuple([tmp[39][0] - tmp[36][0], tmp[41][1] - tmp[37][1]])
righteye = tuple([tmp[42][0], tmp[43][1]])
leftsize = tuple([tmp[45][0] - tmp[42][0], tmp[47][1] - tmp[43][1]])
bounder_pairs =[[11,14],[14,17],[17,25],[25,20],[20,1],[1,4],[4, 7]]
shape = mask_img.shape
img_mask2 = np.zeros((shape[0], shape[1]), np.uint8)
for i ,(start, end) in enumerate(bounder_pairs,1):
cv2.line(mask_img, tuple(tmp[start - 1]), tuple(tmp[end - 1]), (0, 0, 255), 3)
cv2.line(img_mask2, tuple(tmp[start - 1]), tuple(tmp[end - 1]), i, 5)
img_mask2[:200,:100] = 20
print(img_mask2[199,99])
plt.figure(figsize=(10,10))
plt.imshow(img_mask2)
plt.axis('off')
plt.show()
plt.close()
mask_pairs = [1,4,7,9,11,14,17,25,20]
shape = mask_img.shape
mask_point = np.array([tmp[x - 1] for x in mask_pairs])
img_mask = np.zeros((shape[0], shape[1]), np.uint8)
cv2.fillPoly(img_mask, [mask_point], 1)
nouse_pairs = [[28,29],[30,31]]
for start, end in nouse_pairs:
cv2.line(mask_img, tuple(tmp[start - 1]), tuple(tmp[end - 1]), (0, 0, 255), 3)
mask_pairs = [[28,29,29,28],[30,31,31,30]]
mask_point = np.array([[tmp[y - 1][0] + (-2 if i > 1 else 2),tmp[y - 1][1]] for x in mask_pairs for i, y in enumerate(x,0)])
mask_point = np.reshape(mask_point, (2,4,2))
cv2.fillPoly(img_mask, mask_point, 0)
mouth_pairs =[
[49,50],[50,51],[51,52],[52,53],
[53,54],[54,55],[55,56],[56,57],
[57,58],[58,59],[59,60],[60,49]
]
for start, end in mouth_pairs:
cv2.line(mask_img, tuple(tmp[start - 1]), tuple(tmp[end - 1]), (0, 0, 255), 3)
mask_pairs = [49,50,51,52,53,54,55,56,57,58,59,60]
mask_point = np.array([tmp[x - 1] for x in mask_pairs])
cv2.fillPoly(img_mask, [mask_point], 0)
plt.figure(figsize=(10,10))
plt.imshow(img_mask)
plt.axis('off')
plt.show()
res_img_path = 'face_landmark.jpg'
cv2.imwrite(res_img_path, mask_img)
img = mpimg.imread(res_img_path)
# 展示预测68个关键点结果
plt.figure(figsize=(10,10))
plt.imshow(img)
plt.axis('off')
plt.show() |
11512353 | from __future__ import print_function
import time
import copy
from sys import getsizeof
from mpi4py import MPI
import numpy as np
import hdmedians as hd
from scipy import linalg as LA
from scipy import fftpack as FT
from scipy.optimize import lsq_linear
import torch
import sys
sys.path.append("..")
from nn_ops import NN_Trainer
from optim.sgd_modified import SGDModified
from compress_gradient import decompress
import c_coding
from util import *
STEP_START_ = 1
def accuracy(output, target, topk=(1,)):
"""Computes the precision@k for the specified values of k"""
maxk = max(topk)
batch_size = target.size(0)
_, pred = output.topk(maxk, 1, True, True)
pred = pred.t()
correct = pred.eq(target.view(1, -1).expand_as(pred))
res = []
for k in topk:
correct_k = correct[:k].view(-1).float().sum(0, keepdim=True)
res.append(correct_k.mul_(100.0 / batch_size))
return res
class GradientAccumulator(object):
'''a simple class to implement gradient aggregator like the `Conditional Accumulators` in tensorflow'''
def __init__(self, module, num_worker, mode='None'):
# we will update this counter dynamically during the training process
# the length of this counter should be number of fc layers in the network
# we used list to contain gradients of layers
self.gradient_aggregate_counter = []
self.model_index_range = []
self.gradient_aggregator = []
self._mode = mode
for param_idx, param in enumerate(module.parameters()):
tmp_aggregator = []
for worker_idx in range(num_worker):
if self._mode == 'None':
tmp_aggregator.append(np.zeros((param.size())))
elif self._mode == 'compress':
_shape = param.size()
if len(_shape) == 1:
tmp_aggregator.append(bytearray(getsizeof(np.zeros((_shape[0],)))*2))
else:
tmp_aggregator.append(bytearray(getsizeof(np.zeros(_shape))*2))
# initialize the gradient aggragator
self.gradient_aggregator.append(tmp_aggregator)
self.gradient_aggregate_counter.append(0)
self.model_index_range.append(param_idx)
def meset_everything(self):
self._meset_grad_counter()
self._meset_grad_aggregator()
def _meset_grad_counter(self):
self.gradient_aggregate_counter = [0 for _ in self.gradient_aggregate_counter]
def _meset_grad_aggregator(self):
'''
reset the buffers in grad accumulator, not sure if this is necessary
'''
if self._mode == 'compress':
pass
else:
for i, tmp_aggregator in enumerate(self.gradient_aggregator):
for j, buf in enumerate(tmp_aggregator):
self.gradient_aggregator[i][j] = np.zeros(self.gradient_aggregator[i][j].shape) |
11512376 | import IECore
import IECoreScene
class multiTypeObject( IECore.Op ) :
def __init__( self ) :
IECore.Op.__init__( self,
"Op that returns either a MeshPrimitive or a PointsPrimitive, depending on the input type.",
IECore.ObjectParameter(
name = "result",
description = "",
defaultValue = IECoreScene.Group(),
type = IECoreScene.TypeId.Primitive
)
)
self.parameters().addParameter(
IECore.ObjectParameter(
name = "input",
description = "An object parameter that accepts multiple types.",
defaultValue = IECore.V3fVectorData([]),
types = [ IECoreScene.TypeId.Primitive, IECore.TypeId.V3fVectorData ]
),
)
def doOperation( self, args ) :
obj = args['input']
if isinstance( obj, IECore.V3fVectorData ) :
return IECoreScene.PointsPrimitive( obj )
return obj
IECore.registerRunTimeTyped( multiTypeObject )
|
11512380 | from ..util.functions import weights_check
import torch
from torch import nn
def make_model(model_weights):
available_weights = ["SHB"]
if model_weights not in available_weights:
raise ValueError("Weights {} not available for CSRNet. Available weights: {}".format(model_weights,
available_weights))
weights_path = weights_check("SFANet", model_weights)
model = SFANet()
model.load_state_dict(torch.load(weights_path, map_location ='cpu')["model"])
return model
class SFANet(nn.Module):
def __init__(self):
super(SFANet, self).__init__()
self.vgg = VGG()
self.amp = BackEnd()
self.dmp = BackEnd()
self.conv_att = BaseConv(32, 1, 1, 1, activation=nn.Sigmoid(), use_bn=True)
self.conv_out = BaseConv(32, 1, 1, 1, activation=None, use_bn=False)
def get_name(self):
return "SFANet"
def forward(self, input):
input = self.vgg(input)
amp_out = self.amp(*input)
dmp_out = self.dmp(*input)
amp_out = self.conv_att(amp_out)
dmp_out = amp_out * dmp_out
dmp_out = self.conv_out(dmp_out)
return dmp_out#, amp_out
class VGG(nn.Module):
def __init__(self):
super(VGG, self).__init__()
self.pool = nn.MaxPool2d(2, 2)
self.conv1_1 = BaseConv(3, 64, 3, 1, activation=nn.ReLU(), use_bn=True)
self.conv1_2 = BaseConv(64, 64, 3, 1, activation=nn.ReLU(), use_bn=True)
self.conv2_1 = BaseConv(64, 128, 3, 1, activation=nn.ReLU(), use_bn=True)
self.conv2_2 = BaseConv(128, 128, 3, 1, activation=nn.ReLU(), use_bn=True)
self.conv3_1 = BaseConv(128, 256, 3, 1, activation=nn.ReLU(), use_bn=True)
self.conv3_2 = BaseConv(256, 256, 3, 1, activation=nn.ReLU(), use_bn=True)
self.conv3_3 = BaseConv(256, 256, 3, 1, activation=nn.ReLU(), use_bn=True)
self.conv4_1 = BaseConv(256, 512, 3, 1, activation=nn.ReLU(), use_bn=True)
self.conv4_2 = BaseConv(512, 512, 3, 1, activation=nn.ReLU(), use_bn=True)
self.conv4_3 = BaseConv(512, 512, 3, 1, activation=nn.ReLU(), use_bn=True)
self.conv5_1 = BaseConv(512, 512, 3, 1, activation=nn.ReLU(), use_bn=True)
self.conv5_2 = BaseConv(512, 512, 3, 1, activation=nn.ReLU(), use_bn=True)
self.conv5_3 = BaseConv(512, 512, 3, 1, activation=nn.ReLU(), use_bn=True)
def forward(self, input):
input = self.conv1_1(input)
input = self.conv1_2(input)
input = self.pool(input)
input = self.conv2_1(input)
conv2_2 = self.conv2_2(input)
input = self.pool(conv2_2)
input = self.conv3_1(input)
input = self.conv3_2(input)
conv3_3 = self.conv3_3(input)
input = self.pool(conv3_3)
input = self.conv4_1(input)
input = self.conv4_2(input)
conv4_3 = self.conv4_3(input)
input = self.pool(conv4_3)
input = self.conv5_1(input)
input = self.conv5_2(input)
conv5_3 = self.conv5_3(input)
return conv2_2, conv3_3, conv4_3, conv5_3
class BackEnd(nn.Module):
def __init__(self):
super(BackEnd, self).__init__()
self.upsample = nn.UpsamplingBilinear2d(scale_factor=2)
self.conv1 = BaseConv(1024, 256, 1, 1, activation=nn.ReLU(), use_bn=True)
self.conv2 = BaseConv(256, 256, 3, 1, activation=nn.ReLU(), use_bn=True)
self.conv3 = BaseConv(512, 128, 1, 1, activation=nn.ReLU(), use_bn=True)
self.conv4 = BaseConv(128, 128, 3, 1, activation=nn.ReLU(), use_bn=True)
self.conv5 = BaseConv(256, 64, 1, 1, activation=nn.ReLU(), use_bn=True)
self.conv6 = BaseConv(64, 64, 3, 1, activation=nn.ReLU(), use_bn=True)
self.conv7 = BaseConv(64, 32, 3, 1, activation=nn.ReLU(), use_bn=True)
def forward(self, *input):
conv2_2, conv3_3, conv4_3, conv5_3 = input
input = self.upsample(conv5_3)
input = torch.cat([input, conv4_3], 1)
input = self.conv1(input)
input = self.conv2(input)
input = self.upsample(input)
input = torch.cat([input, conv3_3], 1)
input = self.conv3(input)
input = self.conv4(input)
input = self.upsample(input)
input = torch.cat([input, conv2_2], 1)
input = self.conv5(input)
input = self.conv6(input)
input = self.conv7(input)
return input
class BaseConv(nn.Module):
def __init__(self, in_channels, out_channels, kernel, stride=1, activation=None, use_bn=False):
super(BaseConv, self).__init__()
self.use_bn = use_bn
self.activation = activation
self.conv = nn.Conv2d(in_channels, out_channels, kernel, stride, kernel // 2)
self.conv.weight.data.normal_(0, 0.01)
self.conv.bias.data.zero_()
self.bn = nn.BatchNorm2d(out_channels)
self.bn.weight.data.fill_(1)
self.bn.bias.data.zero_()
def forward(self, input):
input = self.conv(input)
if self.use_bn:
input = self.bn(input)
if self.activation:
input = self.activation(input)
return input
if __name__ == '__main__':
input = torch.randn(8, 3, 400, 400).cuda()
model = Model().cuda()
output, attention = model(input) |
11512428 | from pathlib import Path
from .app_settings import AppSettings
from .fsr_cfg import FsrSettings
from .globals import OPEN_VR_DLL
from .openvr_mod import OpenVRMod, OpenVRModType
class FsrMod(OpenVRMod):
TYPE = OpenVRModType.fsr
VAR_NAMES = {
'installed': 'fsrInstalled',
'version': 'fsrVersion',
'settings': 'settings',
}
def __init__(self, manifest: dict):
self.settings = FsrSettings()
self.settings.from_js_dict(manifest.get(self.VAR_NAMES['settings']))
fsr_mod_dll = Path(AppSettings.openvr_fsr_dir) / OPEN_VR_DLL
super(FsrMod, self).__init__(manifest, self.settings, fsr_mod_dll)
|
11512437 | from qgreenland.tasks.common.fetch import FetchCmrGranule
from qgreenland.tasks.common.misc import ExtractNcDataset
from qgreenland.tasks.common.raster import BuildRasterOverviews, WarpRaster
from qgreenland.util.luigi import LayerPipeline
class BedMachineDataset(LayerPipeline):
"""Dataproduct IDBMG4.
This is a NetCDF dataproduct with many distinct datasets representing
distinct measurements.
https://nsidc.org/data/IDBMG4
"""
def requires(self):
fetch_data = FetchCmrGranule(
dataset_cfg=self.cfg['dataset'],
source_cfg=self.cfg['source'],
) # ->
extract_nc_dataset = ExtractNcDataset(
requires_task=fetch_data,
layer_id=self.layer_id,
) # ->
warp_raster = WarpRaster(
requires_task=extract_nc_dataset,
layer_id=self.layer_id
) # ->
return BuildRasterOverviews(
requires_task=warp_raster,
layer_id=self.layer_id
)
|
11512444 | from .nbtransom import min_pretty, min_pretty_sub, get_var_name, find_cell, create_code_cell, create_data_cell, get_val, set_val, put_df, save_nb, open_nb
|
11512531 | import json
debug = False
filename = 'verisc-labels.json'
namespace = 'veris'
description = 'Vocabulary for Event Recording and Incident Sharing (VERIS)'
output = {}
output['namespace'] = namespace
output['description'] = description
output['version'] = 2
output['predicates'] = []
output['values'] = []
with open(filename) as fp:
t = json.load(fp)
def lookupPredicate(predicate=False):
if not predicate:
return False
for p in output['predicates']:
if p['value'] == predicate:
return True
def lookupValues(predicate=False):
if not predicate:
return {}
for p in output['values']:
if p['predicate'] == predicate:
return p
return {}
def machineTag(namespace=False, predicate=False, value=None, expanded=None):
if namespace is False or predicate is False:
return None
if value is None:
return ('{0}:{1}'.format(namespace, predicate))
else:
if not lookupPredicate(predicate=predicate):
x = {}
x['value'] = predicate
output['predicates'].append(x)
z = {}
z['value'] = value
z['expanded'] = expanded
predicate_entries = lookupValues(predicate)
if predicate_entries:
predicate_entries['entry'].append(z)
else:
y = {}
y['predicate'] = predicate
y['entry'] = []
y['entry'].append(z)
output['values'].append(y)
return ('{0}:{1}=\"{2}\"'.format(namespace, predicate, value))
prefix = []
top = []
def flatten(root, prefix_keys=True):
dicts = [([], root)]
ret = {}
seen = set()
for path, d in dicts:
if id(d) in seen:
continue
seen.add(id(d))
for k, v in sorted(d.items()):
new_path = path + [k]
prefix = ':'.join(new_path) if prefix_keys else k
if hasattr(v, 'items'):
dicts.append((new_path, v))
else:
p = ':'.join(prefix.rsplit(':')[:-1])
if debug:
print(namespace + ":" + p + "=" + v)
machineTag(namespace=namespace, predicate=p, value=prefix.split(':')[-1], expanded=v)
ret[prefix] = v
return ret
flatten(root=t)
print(json.dumps(output))
|
11512579 | import os
import datetime
import json
import magic
import shutil
from pathlib import Path
from scripts.artifact_report import ArtifactHtmlReport
from scripts.ilapfuncs import logfunc, tsv, timeline, kmlgen, is_platform_windows
def get_instagramDevicescam(files_found, report_folder, seeker, wrap_text):
for file_found in files_found:
file_found = str(file_found)
filename = os.path.basename(file_found)
if filename.startswith('camera_information.json'):
data_list =[]
with open(file_found, "rb") as fp:
deserialized = json.load(fp)
devices = (deserialized['devices_camera'])
for x in devices:
deviceid = (x['string_map_data']['Device ID'].get('value', ''))
compression = (x['string_map_data']['Compression'].get('value', ''))
ftversion = (x['string_map_data']['Face Tracker Version'].get('value', ''))
sdksup = (x['string_map_data']['Supported SDK Versions'].get('value', ''))
data_list.append((deviceid, compression, ftversion, sdksup))
if data_list:
report = ArtifactHtmlReport('Instagram Archive - Camera Info')
report.start_artifact_report(report_folder, 'Instagram Archive - Camera Info')
report.add_script()
data_headers = ('Device ID', 'Compression', 'Face Tracker Version', 'Supported SDK Versions')
report.write_artifact_data_table(data_headers, data_list, file_found)
report.end_artifact_report()
tsvname = f'Instagram Archive - Camera Info'
tsv(report_folder, data_headers, data_list, tsvname)
tlactivity = f'Instagram Archive - Camera Info'
timeline(report_folder, tlactivity, data_list, data_headers)
else:
logfunc('No Instagram Archive - Camera Info data available')
|
11512604 | from pandas_genomics.scalars import Variant
def test_create_variant():
variant = Variant("12", 112161652, "rs12462", ref="C", alt=["T"])
assert variant.alleles == ["C", "T"]
def test_methods():
variant = Variant("12", 112161652, "rs12462", ref="C", alt=["T"])
variant_also = Variant("12", 112161652, "rs12462", ref="C", alt=["T"])
assert variant.is_same_position(variant_also)
# Get Allele Index
assert variant.get_idx_from_allele("T") == 1
assert variant.get_idx_from_allele("G", add=True) == 2
assert len(variant.alleles) == 3
# Add Allele
variant.add_allele("GT")
assert len(variant.alleles) == 4
# Is Valid Allele Index
assert variant.is_valid_allele_idx(1)
assert not variant.is_valid_allele_idx(10)
# Same variant despite adding additional alleles
assert variant.is_same_position(variant_also)
# But variant not equal
assert not variant == variant_also
|
11512611 | from time import strftime
from time import gmtime
import tekore as tk
from PIL import Image
#import time
from modules import d_functions as d_f
import os
import requests
creddir = os.path.join(os.path.dirname(os.path.dirname(os.path.realpath(__file__))), 'credentials')
picdir = os.path.join(os.path.dirname(os.path.dirname(os.path.realpath(__file__))), 'pic')
file = os.path.join(creddir, 'tekore.cfg')
cover_path = os.path.join(picdir, 'cover.bmp')
def get_spot_info():
conf = tk.config_from_file(file, return_refresh=True)
token = tk.refresh_user_token(*conf[:2], conf[3])
spotify = tk.Spotify(token)
p = spotify.playback()
with spotify.token_as(token):
p = spotify.playback()
x_limit = 20
not_playing = False
sp_data = []
if p is not None:
if p.is_playing is not False:
if p.currently_playing_type == 'track':
name = p.device.name
sec_format = strftime("%M:%S", gmtime(p.item.duration_ms/1000))
device = p.device.type
title, title_2 = d_f.sep_strings(p.item.name, x_limit)
if title_2 != ' ':
title_3, title_4 = d_f.sep_strings(title_2, x_limit)
else:
title_3 = ' '
title_4 = ' '
artists = p.item.artists
artist = ''
for x in range(len(artists)):
if artist == '':
artist = p.item.artists[x].name
else:
artist += ', ' + p.item.artists[x].name
artist_fm, artist_fm2 = d_f.sep_strings(artist, x_limit)
if artist_fm2 != ' ':
artist_fm3, artist_fm4 = d_f.sep_strings(artist_fm2, x_limit)
else:
artist_fm3 = ' '
artist_fm4 = ' '
album, album_2 = d_f.sep_strings(p.item.album.name, x_limit)
if album_2 != ' ':
album_3, album_4 = d_f.sep_strings(album_2, x_limit)
else:
album_3 = ' '
album_4 = ' '
year = p.item.album.release_date[0:4]
url = p.item.album.images[0].url
img_data = requests.get(url).content
duration = (p.item.duration_ms/1000)-(p.progress_ms/1000)
with open(cover_path, 'wb') as handler:
handler.write(img_data)
sp_data.append(str(p.currently_playing_type))
sp_data.append(str(duration))
sp_data.append('Active Reproduction on '+device + ' --> ' + name)
sp_data.append('Song: ' + title)
sp_data.append(title_3)
sp_data.append(title_4)
sp_data.append('By ' + artist_fm)
sp_data.append(artist_fm3)
sp_data.append(artist_fm4)
sp_data.append('Album: '+album)
sp_data.append(album_3)
sp_data.append(album_4)
sp_data.append('Year: [' + year + ']')
sp_data.append('Duration = ' + str(sec_format) + ' min')
not_playing = False
else:
not_playing = True
else:
not_playing = True
else:
not_playing = True
if not_playing is True:
sp_data.append('off')
sp_data.append('Currently not playing')
sp_data.append('or playing Ads,')
sp_data.append('wait until it refreshes')
return sp_data
def draw_music_mod(tran_s_x, tran_s_y, spoti, color, draw, template):
draw.text((tran_s_x, tran_s_y-40), 'SPOTIFY', font=d_f.font_size(30), fill=color)
if spoti[0] == 'track':
for x in range(2, len(spoti)):
if spoti[x] != ' ':
draw.text((tran_s_x, tran_s_y), spoti[x], font=d_f.font_size(18), fill=color)
tran_s_y = tran_s_y + 20
c_img = Image.open(cover_path)
im_grey = c_img.convert('L')
template.paste(im_grey.resize((180, 180), resample=3), (245, 75))
elif spoti[0] == 'off':
for x in range(1, len(spoti)):
draw.text((tran_s_x, tran_s_y), spoti[x], font=d_f.font_size(26), fill=color)
tran_s_y = tran_s_y + 28
|
11512612 | import os
import uuid
import subprocess
from jivago.config.properties.application_properties import ApplicationProperties
from jivago.lang.annotations import Inject
from jivago.templating.rendered_view import RenderedView
from jivago.wsgi.annotations import Resource
from jivago.wsgi.methods import GET, POST
from jivago.wsgi.request.request import Request
from jivago.wsgi.request.response import Response
@Resource("/2x2")
class PdfnupResource(object):
@Inject
def __init__(self, properties: ApplicationProperties):
self.temp_dir = properties.get("temp_directory")
@GET
def get(self) -> RenderedView:
return RenderedView("2x2.html", {})
@POST
def post(self, request: Request) -> Response:
filename = os.path.join(self.temp_dir, str(uuid.uuid4())) + ".pdf"
new_filename = os.path.join(self.temp_dir, str(uuid.uuid4())) + ".pdf"
with open(filename, 'wb') as f:
f.write(request.body)
subprocess.call(("""pdfnup --nup 2x2 """ + filename + """ --papersize {8.5in,11in} -o """ + new_filename).split(" "))
with open(new_filename, 'rb') as f:
body = f.read()
return Response(200, {}, body)
|
11512626 | from typing import Tuple, List
import numpy as np
from src.base import Optimizer, Layer
class Adam(Optimizer):
def __init__(
self, lr: float,
beta1: float = 0.9,
beta2: float = 0.999,
eps: float = 1e-8
):
"""
:param lr - learning rate
:param beta1 -
:param beta2 -
:param eps - small value to avoid zero denominator
"""
self._cache_v = {}
self._cache_s = {}
self._lr = lr
self._beta1 = beta1
self._beta2 = beta2
self._eps = eps
def update(self, layers: List[Layer]) -> None:
if len(self._cache_s) == 0 or len(self._cache_v) == 0:
self._init_cache(layers)
for idx, layer in enumerate(layers):
weights, gradients = layer.weights, layer.gradients
if weights is None or gradients is None:
continue
(w, b), (dw, db) = weights, gradients
dw_key, db_key = Adam._get_cache_keys(idx)
self._cache_v[dw_key] = self._beta1 * self._cache_v[dw_key] + \
(1 - self._beta1) * dw
self._cache_v[db_key] = self._beta1 * self._cache_v[db_key] + \
(1 - self._beta1) * db
self._cache_s[dw_key] = self._beta2 * self._cache_s[dw_key] + \
(1 - self._beta2) * np.square(dw)
self._cache_s[db_key] = self._beta2 * self._cache_s[db_key] + \
(1 - self._beta2) * np.square(db)
dw = self._cache_v[dw_key] / (np.sqrt(self._cache_s[dw_key]) + self._eps)
db = self._cache_v[db_key] / (np.sqrt(self._cache_s[db_key]) + self._eps)
layer.set_wights(
w=w - self._lr * dw,
b=b - self._lr * db
)
def _init_cache(self, layers: List[Layer]) -> None:
for idx, layer in enumerate(layers):
gradients = layer.gradients
if gradients is None:
continue
dw, db = gradients
dw_key, db_key = Adam._get_cache_keys(idx)
self._cache_v[dw_key] = np.zeros_like(dw)
self._cache_v[db_key] = np.zeros_like(db)
self._cache_s[dw_key] = np.zeros_like(dw)
self._cache_s[db_key] = np.zeros_like(db)
@staticmethod
def _get_cache_keys(idx: int) -> Tuple[str, str]:
"""
:param idx - index of layer
"""
return f"dw{idx}", f"db{idx}"
|
11512634 | import torch
import torch.nn as nn
import numpy as np
from functools import partial
import torch.nn.init as init
import torch.nn.functional as F
import math
from timm.models.layers import DropPath, to_2tuple
import pdb
DROPOUT_FLOPS = 4
LAYER_NORM_FLOPS = 5
ACTIVATION_FLOPS = 8
SOFTMAX_FLOPS = 5
class GroupLinear(nn.Module):
'''
Group Linear operator
'''
def __init__(self, in_planes, out_channels,groups=1, bias=True):
super(GroupLinear, self).__init__()
assert in_planes%groups==0
assert out_channels%groups==0
self.in_dim = in_planes
self.out_dim = out_channels
self.groups=groups
self.bias = bias
self.group_in_dim = int(self.in_dim/self.groups)
self.group_out_dim = int(self.out_dim/self.groups)
self.group_weight = nn.Parameter(torch.zeros(self.groups, self.group_in_dim, self.group_out_dim))
self.group_bias=nn.Parameter(torch.zeros(self.out_dim))
def forward(self, x):
t,b,d=x.size()
x = x.view(t,b,self.groups,int(d/self.groups))
out = torch.einsum('tbgd,gdf->tbgf', (x, self.group_weight)).reshape(t,b,self.out_dim)+self.group_bias
return out
def extra_repr(self):
s = ('{in_dim}, {out_dim}')
if self.groups != 1:
s += ', groups={groups}'
if self.bias is None:
s += ', bias=False'
return s.format(**self.__dict__)
class Mlp(nn.Module):
'''
MLP with support to use group linear operator
'''
def __init__(self, in_features, hidden_features=None, out_features=None, act_layer=nn.GELU, drop=0., group=1):
super().__init__()
out_features = out_features or in_features
hidden_features = hidden_features or in_features
if group==1:
self.fc1 = nn.Linear(in_features, hidden_features)
self.fc2 = nn.Linear(hidden_features, out_features)
else:
self.fc1 = GroupLinear(in_features, hidden_features,group)
self.fc2 = GroupLinear(hidden_features, out_features,group)
self.act = act_layer()
self.drop = nn.Dropout(drop)
def forward(self, x):
x = self.fc1(x)
x = self.act(x)
x = self.drop(x)
x = self.fc2(x)
x = self.drop(x)
return x
class GroupNorm(nn.Module):
def __init__(self, num_groups, embed_dim, eps=1e-5, affine=True):
super().__init__()
self.gn = nn.GroupNorm(num_groups, embed_dim,eps,affine)
def forward(self, x):
B,T,C = x.shape
x = x.view(B*T,C)
x = self.gn(x)
x = x.view(B,T,C)
return x
class MultiResoPatchEmbed4_2(nn.Module):
"""
Image to Patch Embedding with 4 layer convolution
"""
def __init__(self, img_size_list=[112,224], patch_size=16, in_chans=3, embed_dim=768):
super().__init__()
new_patch_size = to_2tuple(patch_size // 2)
img_size_list = [to_2tuple(k) for k in img_size_list]
patch_size = to_2tuple(patch_size)
num_patches_list = [(img_size[1] // patch_size[1]) * (img_size[0] // patch_size[0]) for img_size in img_size_list]
self.img_size_list = img_size_list
self.patch_size = patch_size
self.num_patches_list = num_patches_list
self.embed_dim = embed_dim
self.conv1 = nn.Conv2d(in_chans, 64, kernel_size=7, stride=2, padding=3, bias=False) # 112x112
self.bn1 = nn.BatchNorm2d(64)
self.relu = nn.ReLU(inplace=True)
self.conv2 = nn.Conv2d(64, 64, kernel_size=3, stride=1, padding=1, bias=False) # 112x112
self.bn2 = nn.BatchNorm2d(64)
self.conv3 = nn.Conv2d(64, 64, kernel_size=3, stride=1, padding=1, bias=False)
self.bn3 = nn.BatchNorm2d(64)
self.proj = nn.Conv2d(64, embed_dim, kernel_size=new_patch_size, stride=new_patch_size)
def forward(self, x):
x = self.conv1(x)
x = self.bn1(x)
x = self.relu(x)
x = self.conv2(x)
x = self.bn2(x)
x = self.relu(x)
x = self.conv3(x)
x = self.bn3(x)
x = self.relu(x)
x = self.proj(x) # [B, C, W, H]
return x
def flops(self):
img_size = self.img_size[0]
block_flops = dict(
conv1=img_size/2*img_size/2*3*64*7*7,
conv2=img_size/2*img_size/2*64*64*3*3,
conv3=img_size/2*img_size/2*64*64*3*3,
proj=img_size/2*img_size/2*64*self.embed_dim,
)
return sum(block_flops.values())
class Block(nn.Module):
'''
Pre-layernorm transformer block
'''
def __init__(self, dim, num_heads, head_dim=None, mlp_ratio=4., qkv_bias=False, qk_scale=None, drop=0., attn_drop=0.,
drop_path=0., act_layer=nn.GELU, norm_layer=nn.LayerNorm, group=1, skip_lam=1.):
super().__init__()
self.dim = dim
self.mlp_hidden_dim = int(dim * mlp_ratio)
self.skip_lam = skip_lam
self.norm1 = norm_layer(dim)
self.attn = Attention(
dim, num_heads=num_heads, head_dim=head_dim, qkv_bias=qkv_bias, qk_scale=qk_scale, attn_drop=attn_drop, proj_drop=drop)
self.drop_path = DropPath(drop_path) if drop_path > 0. else nn.Identity()
self.norm2 = norm_layer(dim)
self.mlp = Mlp(in_features=dim, hidden_features=self.mlp_hidden_dim, act_layer=act_layer, drop=drop, group=group)
def forward(self, x, padding_mask=None):
x2, atten = self.attn(self.norm1(x),padding_mask)
x = x + self.drop_path(x2)/self.skip_lam
x = x + self.drop_path(self.mlp(self.norm2(x)))/self.skip_lam
return x, atten
def flops(self, s):
heads = self.attn.num_heads
h = self.dim
i = self.mlp_hidden_dim
mha_block_flops = dict(
kqv=3 * h * h ,
attention_scores=h * s,
attn_softmax=SOFTMAX_FLOPS * s * heads,
attention_dropout=DROPOUT_FLOPS * s * heads,
attention_scale=s * heads,
attention_weighted_avg_values=h * s,
attn_output=h * h,
attn_output_bias=h,
attn_output_dropout=DROPOUT_FLOPS * h,
attn_output_residual=h,
attn_output_layer_norm=LAYER_NORM_FLOPS * h,)
ffn_block_flops = dict(
intermediate=h * i,
intermediate_act=ACTIVATION_FLOPS * i,
intermediate_bias=i,
output=h * i,
output_bias=h,
output_dropout=DROPOUT_FLOPS * h,
output_residual=h,
output_layer_norm=LAYER_NORM_FLOPS * h,)
return sum(mha_block_flops.values())*s + sum(ffn_block_flops.values())*s
class Attention(nn.Module):
'''
Multi-head self-attention
from https://github.com/rwightman/pytorch-image-models/blob/master/timm/models/vision_transformer.py
with some modification to support different num_heads and head_dim.
'''
def __init__(self, dim, num_heads=8, head_dim=None, qkv_bias=False, qk_scale=None, attn_drop=0., proj_drop=0.):
super().__init__()
self.num_heads = num_heads
if head_dim is not None:
self.head_dim=head_dim
else:
head_dim = dim // num_heads
self.head_dim = head_dim
self.scale = qk_scale or head_dim ** -0.5
self.qkv = nn.Linear(dim, self.head_dim* self.num_heads * 3, bias=qkv_bias)
self.attn_drop = nn.Dropout(attn_drop)
self.proj = nn.Linear(self.head_dim* self.num_heads, dim)
self.proj_drop = nn.Dropout(proj_drop)
def forward(self, x, padding_mask=None):
B, N, C = x.shape
qkv = self.qkv(x).reshape(B, N, 3, self.num_heads, self.head_dim).permute(2, 0, 3, 1, 4)
# B,heads,N,C/heads
q, k, v = qkv[0], qkv[1], qkv[2]
# trick here to make q@k.t more stable
attn = ((q * self.scale) @ k.transpose(-2, -1))
if padding_mask is not None:
attn = attn.view(B, self.num_heads, N, N)
attn = attn.masked_fill(
padding_mask.unsqueeze(1).unsqueeze(2).to(torch.bool),
float("-inf"),
)
attn_float = attn.softmax(dim=-1, dtype=torch.float32)
attn = attn_float.type_as(attn)
else:
attn = attn.softmax(dim=-1)
attn = self.attn_drop(attn)
x = (attn @ v).transpose(1, 2).reshape(B, N, self.head_dim* self.num_heads)
x = self.proj(x)
x = self.proj_drop(x)
return x, attn |
11512642 | import numpy as np
import torch
import torch.nn as nn
import torch.optim as optim
import torch.nn.functional as F
import torch.autograd as autograd
from multiprocessing_env import SubprocVecEnv
from minipacman import MiniPacman
import matplotlib.pyplot as plt
from tqdm import tqdm
#USE_CUDA = torch.cuda.is_available()
#Variable = lambda *args, **kwargs: autograd.Variable(*args, **kwargs).cuda() if USE_CUDA else autograd.Variable(*args, **kwargs)
class OnPolicy(nn.Module):
def __init__(self):
super(OnPolicy, self).__init__()
def forward(self, x):
raise NotImplementedError
def act(self, x, deterministic=False):
logit, value = self.forward(x)
probs = F.softmax(logit)
if deterministic:
action = probs.max(1)[1]
else:
action = probs.multinomial(1)
return action
def evaluate_actions(self, x, action):
logit, value = self.forward(x)
probs = F.softmax(logit)
log_probs = F.log_softmax(logit)
action_log_probs = log_probs.gather(1, action)
entropy = -(probs * log_probs).sum(1).mean()
return logit, action_log_probs, value, entropy
class ActorCritic(OnPolicy):
def __init__(self, in_shape, num_actions):
super(ActorCritic, self).__init__()
self.in_shape = in_shape
self.features = nn.Sequential(
nn.Conv2d(in_shape[0], 16, kernel_size=3, stride=1),
nn.ReLU(),
nn.Conv2d(16, 16, kernel_size=3, stride=2),
nn.ReLU(),
)
self.fc = nn.Sequential(
nn.Linear(self.feature_size(), 256),
nn.ReLU(),
)
self.critic = nn.Linear(256, 1)
self.actor = nn.Linear(256, num_actions)
def forward(self, x):
x = self.features(x)
x = x.view(x.size(0), -1)
x = self.fc(x)
logit = self.actor(x)
value = self.critic(x)
return logit, value
def feature_size(self):
return self.features(autograd.Variable(torch.zeros(1, *self.in_shape))).view(1, -1).size(1)
# @ikostrikov style
class RolloutStorage(object):
def __init__(self, num_steps, num_envs, state_shape):
self.num_steps = num_steps
self.num_envs = num_envs
self.states = torch.zeros(num_steps + 1, num_envs, *state_shape)
self.rewards = torch.zeros(num_steps, num_envs, 1)
self.masks = torch.ones(num_steps + 1, num_envs, 1)
self.actions = torch.zeros(num_steps, num_envs, 1).long()
#self.use_cuda = False
def cuda(self):
#self.use_cuda = True
self.states = self.states.cuda()
self.rewards = self.rewards.cuda()
self.masks = self.masks.cuda()
self.actions = self.actions.cuda()
def insert(self, step, state, action, reward, mask):
self.states[step + 1].copy_(state)
self.actions[step].copy_(action)
self.rewards[step].copy_(reward)
self.masks[step + 1].copy_(mask)
def after_update(self):
self.states[0].copy_(self.states[-1])
self.masks[0].copy_(self.masks[-1])
def compute_returns(self, next_value, gamma):
returns = torch.zeros(self.num_steps + 1, self.num_envs, 1)
#if self.use_cuda:
# returns = returns.cuda()
returns[-1] = next_value
for step in reversed(range(self.num_steps)):
returns[step] = returns[step + 1] * gamma * self.masks[step + 1] + self.rewards[step]
return returns[:-1]
def main():
mode = "regular"
num_envs = 16
def make_env():
def _thunk():
env = MiniPacman(mode, 1000)
return env
return _thunk
envs = [make_env() for i in range(num_envs)]
envs = SubprocVecEnv(envs)
state_shape = envs.observation_space.shape
#a2c hyperparams:
gamma = 0.99
entropy_coef = 0.01
value_loss_coef = 0.5
max_grad_norm = 0.5
num_steps = 5
num_frames = int(10e3)
#rmsprop hyperparams:
lr = 7e-4
eps = 1e-5
alpha = 0.99
#Init a2c and rmsprop
actor_critic = ActorCritic(envs.observation_space.shape, envs.action_space.n)
optimizer = optim.RMSprop(actor_critic.parameters(), lr, eps=eps, alpha=alpha)
#if USE_CUDA:
# actor_critic = actor_critic.cuda()
rollout = RolloutStorage(num_steps, num_envs, envs.observation_space.shape)
#rollout.cuda()
all_rewards = []
all_losses = []
state = envs.reset()
state = torch.FloatTensor(np.float32(state))
rollout.states[0].copy_(state)
episode_rewards = torch.zeros(num_envs, 1)
final_rewards = torch.zeros(num_envs, 1)
for i_update in tqdm(range(num_frames)):
for step in range(num_steps):
action = actor_critic.act(autograd.Variable(state))
next_state, reward, done, _ = envs.step(action.squeeze(1).cpu().data.numpy())
reward = torch.FloatTensor(reward).unsqueeze(1)
episode_rewards += reward
masks = torch.FloatTensor(1-np.array(done)).unsqueeze(1)
final_rewards *= masks
final_rewards += (1-masks) * episode_rewards
episode_rewards *= masks
#if USE_CUDA:
# masks = masks.cuda()
state = torch.FloatTensor(np.float32(next_state))
rollout.insert(step, state, action.data, reward, masks)
_, next_value = actor_critic(autograd.Variable(rollout.states[-1], volatile=True))
next_value = next_value.data
returns = rollout.compute_returns(next_value, gamma)
logit, action_log_probs, values, entropy = actor_critic.evaluate_actions(
autograd.Variable(rollout.states[:-1]).view(-1, *state_shape),
autograd.Variable(rollout.actions).view(-1, 1)
)
values = values.view(num_steps, num_envs, 1)
action_log_probs = action_log_probs.view(num_steps, num_envs, 1)
advantages = autograd.Variable(returns) - values
value_loss = advantages.pow(2).mean()
action_loss = -(autograd.Variable(advantages.data) * action_log_probs).mean()
optimizer.zero_grad()
loss = value_loss * value_loss_coef + action_loss - entropy * entropy_coef
loss.backward()
nn.utils.clip_grad_norm(actor_critic.parameters(), max_grad_norm)
optimizer.step()
if i_update % num_frames == 0:
all_rewards.append(final_rewards.mean())
all_losses.append(loss.item())
#clear_output(True)
plt.figure(figsize=(20,5))
plt.subplot(131)
plt.title('epoch %s. reward: %s' % (i_update, np.mean(all_rewards[-10:])))
plt.plot(all_rewards)
plt.subplot(132)
plt.title('loss %s' % all_losses[-1])
plt.plot(all_losses)
plt.show()
rollout.after_update()
torch.save(actor_critic.state_dict(), "actor_critic_" + mode)
import time
def displayImage(image, step, reward):
#clear_output(True)
s = "step: " + str(step) + " reward: " + str(reward)
plt.figure(figsize=(10,3))
plt.title(s)
plt.imshow(image)
plt.show()
time.sleep(0.1)
env = MiniPacman(mode, 1000)
done = False
state = env.reset()
total_reward = 0
step = 1
while not done:
current_state = torch.FloatTensor(state).unsqueeze(0)
#if USE_CUDA:
# current_state = current_state.cuda()
action = actor_critic.act(autograd.Variable(current_state))
next_state, reward, done, _ = env.step(action.data[0, 0])
total_reward += reward
state = next_state
image = torch.FloatTensor(state).permute(1, 2, 0).cpu().numpy()
displayImage(image, step, total_reward)
step += 1
if __name__ == '__main__':
main()
|
11512671 | from scipy.optimize import minimize;
import numpy as np;
from scipy import stats
import itertools;
import analysis;
class BaseModel:
def __init__(self):
self.p = None;
def set(self,p):
self.p = p;
class SexAgeModel(BaseModel):
def __init__(self):
self.p = np.array([[4.0,3,10.6,12,75,181],\
[3.0,8,7.0,30,53,144]]);
#fitted: 0.03737 in train
def fit(self, info, train_true):
print("use fitted values, no fitting")
def predict(self,info):
res = {};
for idx,row in info.iterrows():
case,age,sex = row['Id'],row['age'],row['sex'];
p = self.p;
if sex=='M':
if age<15:
hS = [p[0][0]*age+p[0][1],15];
hD = [p[0][2]*age+p[0][3], 35];
else:
hS = [p[0][4],35];
hD = [p[0][5],45];
elif sex=='F':
if age<15:
hS = [p[1][0]*age+p[1][1],15];
hD = [p[1][2]*age+p[1][3],35];
else:
hS = [p[1][4],35];
hD = [p[1][5],40];
else:
print("!!!no such sex type!");
hS = [p[1][4],35];
hD = [p[1][5],45];
res[case] = np.asarray(hS + hD);
return res;
class OneSliceModel(BaseModel):
def __init__(self):
self.p = np.array([5,0.00115,10,0.00124,0.080,6,0.075,7]);
#fitted on train, score = 0.01519
def fit(self, areas_all, train_true):
print("not implemented yet, use default to fit")
def predict(self, areas_all):
#take the area_data as input
#return sys_vol, sys_err, dias_vol, dias_error
res = {};
p = self.p;
for case,areas in areas_all.iteritems():
x = np.sum(areas[:,1:],axis=0);
tsys,tdias = np.argmin(x),np.argmax(x);
a = areas[:,tdias+1];
if np.sum(a>100) <= 2:
dias_v = np.nan;
sys_v = np.nan;
else:
da = np.percentile(a,80);
dias_v = np.clip(p[2] + p[3]*da**1.5,5,580);
a = areas[:,tsys+1];
if np.sum(a>100) <= 2:
sys_v = np.nan;
else:
sa = np.percentile(a,80);
sys_v = np.clip(p[0] + p[1]*(10+sa)*(da**0.5+sa**0.5)/2,5,580);
sys_err = np.clip(sys_v * p[4] + p[5],0,30);
dias_err = np.clip(dias_v * p[6] + p[7],0,30);
res[case] = np.asarray([sys_v, sys_err, dias_v, dias_err]);
return res;
class SaxModel(BaseModel):
def __init__(self,version=1):
self.version = version;
if version == 1:
self.p0 = [1.05,1.05,0.05,4];
self.bounds = [(0.8,1.5),(0.8,1.3),(0.03,0.07),(0,10)];
elif version == 2:
self.p0 = [1.0,1.0,0.05,4,0.05,4];
self.bounds = [(-0.5,1.8),(-0.5,1.5),(0.03,0.10),(0,10),(0.03,0.10),(0,10)];
elif version == 3:
self.p0 = [1.05,0, 1.05, 0, 0.05,4, 0.05, 4];
self.bounds = [(0.8,1.5),(0,30), (0.8,1.3),(0,50),(0.03,0.10),(0,10), (0.03,0.10),(0,10)];
self.p = None;
def _get_result(self,X,p):#X a single column vector of sys and dias volume
CLIP = 25;
Y = np.zeros((X.shape[0],2));
if self.version == 1:
Y[::2,0] = X[::2]*p[0];
Y[1::2,0] = X[1::2]*p[1];
Y[:,1] = np.clip(Y[:,0]*p[2]+p[3], 0, CLIP);
elif self.version == 2:
Y[::2,0] = X[::2] - np.sqrt(X[::2])*p[0];
Y[1::2,0] = X[1::2] - np.sqrt(X[1::2])*p[1];
Y[::2,1] = np.clip(Y[::2,0]*p[2]+p[3], 0, CLIP);
Y[1::2,1] = np.clip(Y[1::2,0]*p[4]+p[5], 0, CLIP);
elif self.version == 3:
Y[::2,0] = X[::2]*p[0] + p[1];
Y[1::2,0] = X[1::2]*p[2] + p[3];
Y[::2,1] = np.clip(Y[::2,0]*p[4]+p[5], 0, CILP);
Y[1::2,1] = np.clip(Y[1::2,0]*p[6]+p[7], 0, CLIP);
return Y;
def fit(self, results, train_true):
x = [];
y = [];
count = 0;
missing = [];
for idx,row in train_true.iterrows():
res = results.get(row['Id']);
if res is None:
missing.append(row['Id']);
continue
count+=1;
x.extend(res);
y.extend([row['Systole'],row['Diastole']]);
print("{} cases are used to fit the model".format(count));
if len(missing)>0:
print("cases are missing: " + ','.join([str(m_) for m_ in missing]));
x = np.asarray(x);
y = np.asarray(y);
ff = minimize(lambda p:analysis.crps_score(self._get_result(x,p),y), self.p0, bounds=self.bounds, options={'gtol':1e-5,'maxiter':500,'eps':1e-5});
self.p = ff.x;
print("fitting parameters " + str(self.p));
print("fitting score " + str(ff.fun));
def predict(self,results):
res = {};
if self.p is None:
print("need to fit the model first");
for case,sd in results.iteritems():
res[case] = self._get_result(np.asarray(sd),self.p).flatten();
return res;
class Ch4Model(BaseModel):
def __init__(self):
self.p0 = [.8,10,.3,.9,.09,4];
self.bounds = [(.6,.98),(0,20),(.2,0.7),(0.6,0.98),(.03,.2),(0,10)];
self.p = None;
def _get_result(self,X,p):#X a single column vector of sys and dias volume
Y = np.zeros((X.shape[0],2));
Y[1::2,0] = np.clip(X[1::2]*p[0]+p[1],4,580);
Y[::2,0] = np.clip(np.maximum(Y[1::2,0]*p[2], X[::2]*p[3]),4,580);
Y[:,1] = np.clip(Y[:,0]*p[4]+p[5], 0, 35);
dele = np.array([[i*2,i*2+1] for i in range(X.shape[0]/2) if X[i*2+1]<40]).reshape((-1))
if len(dele) > 0:
Y[dele]=np.nan
return Y;
def fit(self, results, train_true):
x = [];
y = [];
count = 0;
missing = [];
for idx,row in train_true.iterrows():
res = results.get(row['Id']);
if res is None or res[1] < 40:
missing.append(row['Id']);
continue
count+=1;
x.extend(res);
y.extend([row['Systole'],row['Diastole']]);
print("{} cases are used to fit the model".format(count));
if len(missing)>0:
print("cases are missing in train: " + ','.join([str(int(m)) for m in missing]));
x = np.asarray(x);
y = np.asarray(y);
ff = minimize(lambda p:analysis.crps_score(self._get_result(x,p),y), self.p0, bounds=self.bounds, options={'gtol':1e-5,'maxiter':500,'eps':1e-3});
self.p = ff.x;
print("fitting parameters " + str(self.p));
print("fitting score " + str(ff.fun));
def predict(self,results):
res = {};
if self.p is None:
print("need to fit the model first");
for case,sd in results.iteritems():
res[case] = self._get_result(np.asarray(sd),self.p).flatten();
return res;
class AverageModel(BaseModel):
def __init__(self,ll=9.5e-5):
self.p = None;
self.ll = ll;
def _get_result(self,X,p):
"""
how to deal with nans???
this code treat them as missing use the same coefficients
ideally, it should fit another model use only the rest of models
"""
NR = X.shape[0];
y = np.zeros((NR,2));
p = np.asarray(p);
for i in range(NR):
preds = np.copy(X[i]).reshape((-1,2));
err0 = np.copy(preds[:,1]);
preds[:,1] = err0*p;
preds = preds[~np.isnan(preds[:,0])];
if preds.shape[0]==0:
y[i] = [np.nan,np.nan];
continue;
me = np.sum(preds[:,0]/preds[:,1]**2);
err = np.sum(1.0/preds[:,1]**2);
me /= err;
err = 1.0/np.sqrt(err);
err = np.minimum(np.nanmin(err0),err);
err *=(1.0 + np.std(preds[:,0])/np.max(preds[:,1])/3)**0.5;
y[i] = [me,err];
return y;
def fit(self,preds,train_true):
N = len(preds);
print("combine # predictions:" + ','.join([str(len(x)) for x in preds]));
self.p0 = np.ones(N)*np.sqrt(N);
X = np.zeros((train_true.shape[0]*2,N*2));
X[:] = np.nan;
y = [];
i = 0;
for idx,row in train_true.iterrows():
case = row['Id'];
y.extend([row['Systole'],row['Diastole']]);
for j in range(N):
sede = preds[j].get(case);
if sede is not None:
X[i*2,2*j:2*j+2] = sede[0:2];
X[i*2+1,2*j:2*j+2] = sede[2:4];
i += 1;
y = np.asarray(y);
print("init score :{}".format(analysis.crps_score(self._get_result(X,self.p0),y)));
ff = minimize(lambda p:analysis.crps_score(self._get_result(X,p),y) + self.ll*np.var(p), self.p0, options={'gtol':1e-5,'eps':1e-4,'maxiter':500});
self.p = ff.x;
print("fitting parameters " + str(self.p));
print("fitting score " + str(ff.fun));
def predict(self,preds):
print("combine # predictions:" + ','.join([str(len(x)) for x in preds]));
res = {};
css = [list(x.keys()) for x in preds];
css = set(list(itertools.chain.from_iterable(css)));
N = len(preds);
assert(N == self.p.size);
for case in css:
X = np.zeros((2,2*N));
X[:] = np.nan;
for j in range(N):
sede = preds[j].get(case);
if sede is not None:
X[0,2*j:2*j+2] = sede[0:2];
X[1,2*j:2*j+2] = sede[2:4];
res[case] = self._get_result(X,self.p).flatten();
return res;
class SaxFilterModel(BaseModel):
def __init__(self):
self.p0 = [1.0,1.0,0.05,4,0.05,4];
self.bounds = [(-0.5,1.8),(-0.5,1.5),(0.03,0.10),(0,10),(0.03,0.10),(0,10)];
self.p = None;
def _get_result(self,X,p):#X a single column vector of sys and dias volume
Y = np.zeros((X.shape[0],2));
idx = X[:,1]>1;
ridx = np.logical_not(idx);
Y[idx,0] = X[idx,0] - np.sqrt(X[idx,0])*p[0];
Y[ridx,0] = X[ridx,0] - np.sqrt(X[ridx,0])*p[1];
Y[idx,1] = np.clip(Y[idx,0]*p[2]+p[3],0,25);
Y[ridx,1] = np.clip(Y[ridx,0]*p[4]+p[5],0,25);
return Y;
def fit(self, results,train_true):
x = [];
y = [];
count = 0;
missing = [];
for idx,row in train_true.iterrows():
res = results.get(row['Id']);
if res is None:
missing.append(row['Id']);
continue
count+=1;
x.extend(res);
y.extend([row['Systole'],row['Diastole']]);
print("{} cases are used to fit the model".format(count));
if len(missing)>0:
print("cases are missing: " + ','.join([str(_x) for _x in missing]));
x = np.asarray(x).reshape((-1,2));
y = np.asarray(y);
ff = minimize(lambda p:analysis.crps_score(self._get_result(x,p),y), self.p0, bounds=self.bounds, options={'gtol':1e-5,'maxiter':500,'eps':1e-5});
self.p = ff.x;
print("fitting parameters " + str(self.p));
print("fitting score " + str(ff.fun));
def predict(self,results):
res = {};
if self.p is None:
print("need to fit the model first");
for case,sd in results.iteritems():
res[case] = self._get_result(np.asarray(sd).reshape(-1,2),self.p).flatten();
return res;
class SaxFeatureModel(BaseModel):
def __init__(self):
self.p0 = [0.2,-0.2,0.9, 0.5,-0.5,0.5,4];
self.bounds = [(-0.5,0.5),(-0.5,0.5),(0.0,2.0),\
(-3.0,3.0),(-3.0,3.0),(-3.0,3.0),(2,10)];
self.p = None;
def _get_result(self,X,p):#X a single column vector of sys and dias volume
Y = np.zeros((X.shape[0],2));
e1 = (X[:,1]>1)*1.0;
e2 = (X[:,2]<=7)*1.0;
e3 = (X[:,3]>1.3)*1.0;
Y[:,0] = X[:,0] - np.sqrt(X[:,0])*(p[0]*e1+p[1]*e2+p[2])
Y[:,1] = np.clip(X[:,0]*(p[3]*e1+p[4]*e2+p[5]*e3+p[6])/100+4,4,30);
return Y;
def fit(self, results,train_true):
x = [];
y = [];
count = 0;
missing = [];
for idx,row in train_true.iterrows():
res = results.get(row['Id']);
if res is None:
missing.append(row['Id']);
continue
count+=1;
x.extend(res);
y.extend([row['Systole'],row['Diastole']]);
print("{} cases are used to fit the model".format(count));
if len(missing)>0:
print("cases are missing: " + ','.join([str(_x) for _x in missing]));
x = np.asarray(x).reshape((-1,4));
y = np.asarray(y);
ff = minimize(lambda p:analysis.crps_score(self._get_result(x,p),y), self.p0, bounds=self.bounds, options={'gtol':1e-6,'maxiter':500,'eps':1e-5});
self.p = ff.x;
print("fitting parameters " + str(self.p));
print("fitting score " + str(ff.fun));
def predict(self,results):
res = {};
if self.p is None:
print("need to fit the model first");
for case,sd in results.iteritems():
res[case] = self._get_result(np.asarray(sd).reshape(-1,4),self.p).flatten();
return res;
|
11512697 | import matplotlib.pyplot as plt
import numpy as np
from fractions import Fraction
def create_pi_labels(a=0, b=2, step=0.5, ax=None, direction='x'):
"""
A function that gives back ticks an labels in radians
Keyword arguments:
a -- lower limit is a*pi (default 0.0)
b -- upper limit is b*pi (default 2.0)
step -- step is step*pi (default 0.5)
ax -- if ax is not None then ticks and labels are set for this axes (default None)
direction -- 'x' or 'y' or 'z' (default 'x') which axis you want to label
return value is ticks, labels
"""
max_denominator = int(1/step)
values = np.arange(a, b+0.1*step, step)
fracs = [Fraction(x).limit_denominator(max_denominator) for x in values]
ticks = values*np.pi
if plt.rcParams["text.usetex"] is True:
vspace = r"\vphantom{\frac{1}{2}}"
else:
vspace = ""
labels = []
for frac in fracs:
if frac.numerator==0:
labels.append(r"$0" + vspace + "$")
elif frac.numerator<0:
if frac.denominator==1 and abs(frac.numerator)==1:
labels.append(r"$-\pi" + vspace + "$")
elif frac.denominator==1:
labels.append(r"$-{}\pi".format(abs(frac.numerator)) +vspace + "$")
else:
labels.append(r"$-\frac{{{}}}{{{}}} \pi$".format(abs(frac.numerator), frac.denominator))
else:
if frac.denominator==1 and frac.numerator==1:
labels.append(r"$\pi" + vspace + "$")
elif frac.denominator==1:
labels.append(r"${}\pi".format(frac.numerator) + vspace + "$")
else:
labels.append(r"$\frac{{{}}}{{{}}} \pi$".format(frac.numerator, frac.denominator))
if ax is not None:
if direction == 'x':
ax.set_xticks(ticks)
ax.set_xticklabels(labels)
elif direction == 'y':
ax.set_yticks(ticks)
ax.set_yticklabels(labels)
elif direction == 'z':
ax.set_zticks(ticks)
ax.set_zticklabels(labels)
else:
print("direction ", direction, "is not a proper argument")
return ticks, labels
if __name__ == '__main__':
x = np.linspace(-np.pi, 2*np.pi, 1000)
fig = plt.figure()
ax = fig.add_subplot(1,1,1)
ax.set_title("Automatically create Labels as Multiples of $\pi$")
ax.plot(x, np.sin(x), 'r-', label=r"$\sin(x)$")
ax.plot(x, np.cos(x), 'b-', label=r"$\cos(x)$")
ax.grid()
ax.set_xlim(-np.pi, 2*np.pi)
ax.set_ylim(-1.1, 1.1)
ax.set_xlabel(r"$x$")
ax.set_ylabel(r"$f(x)$")
create_pi_labels(-1, 2, 1/3, ax, 'x')
ax.legend(loc="best")
# ax.xaxis.labelpad = 50
fig.tight_layout()
fig.savefig("../images/create_pi_labels.png", dpi=300)
|
11512797 | from django.db.models import Q
from dal_select2.views import Select2QuerySetView
class AuthorAutocomplete(Select2QuerySetView):
def get_queryset(self):
from modules.users.service import _authors, _users
if not self.request.user.is_authenticated:
return []
if not self.request.user.has_perm("wagtailadmin.access_admin"):
return []
# Disabling this because sometimes a user will need to be added as an author before they
# have been given the group permssions
# qs = _authors.all()
qs = _users.all()
if self.q:
if " " in self.q:
full = self.q.split(" ")
firstname = full[0]
lastname = full[-1]
qs = qs.filter(
first_name__istartswith=firstname, last_name__istartswith=lastname
).order_by("first_name")
else:
qs = qs.filter(
Q(first_name__istartswith=self.q) | Q(last_name__istartswith=self.q)
).order_by("first_name")
return qs
|
11512802 | import unittest
from unittest.mock import patch
from unittest.mock import Mock
import os
from programy.services.rest.microsoft.search.service import MicrosoftSearchService
from programy.services.config import ServiceConfiguration
from programytest.services.testclient import ServiceTestClient
from programytest.services.testcase import ServiceTestCase
from programytest.externals import integration_tests_active, integration_tests_disabled
from programytest.services.rest.microsoft.search.responses import search_success_reponse
class MicrosoftSearchServiceTestClient(ServiceTestClient):
def __init__(self):
ServiceTestClient.__init__(self, debug=True)
def load_storage(self):
super(MicrosoftSearchServiceTestClient, self).load_storage()
self.add_license_keys_store(self.get_license_key_file())
class MicrosoftSearchServiceTests(ServiceTestCase):
def test_init(self):
service = MicrosoftSearchService(ServiceConfiguration.from_data("rest", "microsoft.search", "search",
url="https://chatilly.cognitiveservices.azure.com/bing/v7.0/search"))
self.assertIsNotNone(service)
def patch_requests_search_success_reponse(self, url, headers, timeout):
mock_response = Mock()
mock_response.status_code = 200
mock_response.json.return_value = search_success_reponse
return mock_response
def _do_search(self):
service = MicrosoftSearchService(ServiceConfiguration.from_data("rest", "microsoft.search", "search",
url="https://chatilly.cognitiveservices.azure.com/bing/v7.0/search"))
self.assertIsNotNone(service)
client = MicrosoftSearchServiceTestClient()
service.initialise(client)
response = service.search("chatbots")
self.assertResponse(response, 'search', "microsoft.search", "search")
@unittest.skip("Needs active cognitiveservices.azure.com account, chatilly closed down")
<EMAIL>If(integration_tests_active() is False, integration_tests_disabled)
def test_search_integration(self):
self._do_search()
@patch("programy.services.rest.base.RESTService._requests_get", patch_requests_search_success_reponse)
def test_search_unit(self):
self._do_search()
@patch("programy.services.rest.base.RESTService._requests_get", patch_requests_search_success_reponse)
def test_search_aiml(self):
client = MicrosoftSearchServiceTestClient()
conf_file = MicrosoftSearchService.get_default_conf_file()
response = self._do_handler_load(client, conf_file, "microsoft.search", "MICROSOFT SEARCH CHATBOTS")
self.assertIsNotNone(response)
self.assertTrue(response.startswith("<ul>\n<li>Chatbots are also appearing in the healthcare industry"))
|
11512837 | from streamlink.plugins.cinergroup import CinerGroup
from tests.plugins import PluginCanHandleUrl
class TestPluginCanHandleUrlCinerGroup(PluginCanHandleUrl):
__plugin__ = CinerGroup
should_match = [
'http://showtv.com.tr/canli-yayin',
'http://haberturk.com/canliyayin',
'http://showmax.com.tr/canliyayin',
'http://showturk.com.tr/canli-yayin/showturk',
'http://bloomberght.com/tv',
'http://haberturk.tv/canliyayin',
]
|
11512852 | from setuptools import setup
setup(name='pyvue',
version='0.1.7',
description='Generate HTML strings in pure python, or JSX style code',
url='http://github.com/oakfang/pyvue',
author='<NAME>',
author_email='<EMAIL>',
license='MIT',
packages=['pyvue'],
entry_points={
"console_scripts": [
"pyvuec = pyvue.parser:compile_file"
]
}) |
11512877 | import os
import sys
sys.path.append("phantom_scripts")
# This is the main phantom script which creates all phantoms.
# Must be run from the folder which contains this file.
class Args:
pass
out_dir = "generated_phantoms"
def verify_correct_path():
dirs = [entry for entry in os.listdir('.') if os.path.isdir(entry)]
if "phantom_scripts" in dirs and "phantom_data" in dirs: return
print "This script must be run from the project root directory."
exit()
def ensure_output_folder_exists():
if not os.path.exists(out_dir):
os.mkdir(out_dir)
def create_artery_phantom():
"""
Stack cross-sectional splines and interpolate shape
in between.
"""
from realistic_artery import create_phantom
args = Args()
args.x_min = -0.06
args.x_max = 0.06
args.h5_out = os.path.join(out_dir, "realistic_artery.h5")
args.spline_files = ["phantom_data/artery_crossection_splines/spline_000.txt",
"phantom_data/artery_crossection_splines/spline_001.txt",
"phantom_data/artery_crossection_splines/spline_002.txt",
"phantom_data/artery_crossection_splines/spline_003.txt",
"phantom_data/artery_crossection_splines/spline_004.txt",
"phantom_data/artery_crossection_splines/spline_005.txt",
"phantom_data/artery_crossection_splines/spline_006.txt"]
args.scale = 3e-3
args.num_scatterers = 2000000
args.inside_factor = 0.1
args.outside_factor = 1.0
args.space_factor = 0.5
create_phantom(args)
def create_carotid_bifurcation_phantoms():
"""
Create carotid bifurcation phantom (1) without plaque and (2) with plaque
"""
from carotid_bifurcation import create_phantom
args = Args()
args.z0 = 0.025
args.x_min = -0.08
args.x_max = 0.08
args.y_min = -0.03
args.y_max = 0.03
args.z_min = 0.0
args.z_max = 0.05
args.num_scatterers = 5000000
args.small_r = 5e-3
args.large_r = 8.2e-3
args.common_x_max = 13e-3
args.theta = 3.141592*10/180.0
args.visualize = False
args.lumen_ampl = 0.1
args.enable_plaque = False
args.h5_file = os.path.join(out_dir, "carotid_no_plaque.h5")
create_phantom(args)
args.enable_plaque = True
args.h5_file = os.path.join(out_dir, "carotid_plaque.h5")
create_phantom(args)
def create_contracting_cylinder():
"""
A cylinder which contracts according to a scaling signal
which is a function of time.
"""
from contracting_cylinder_spline import create_phantom
args = Args()
args.h5_out = os.path.join(out_dir, "contracting_cylinder_spline.h5")
args.h5_scale = "phantom_data/real_left_ventricle_contraction.h5"
args.r0 = 1e-2
args.z0 = 0.12
args.num_scatterers = 20000
args.num_control_points = 10
args.spline_degree = 3
create_phantom(args)
def create_rotating_plaque_phantoms():
"""
A cross-sectional slice through e.g. an artery with a
lump of scatterers moving along the outer perimenter to
simulate a plaque which is moving.
"""
from rotating_plaque import create_phantom
args = Args()
args.x_min = -0.015
args.x_max = 0.015
args.z_min = 0.0
args.z_max = 0.03
args.num_scatterers = 100000
args.z0 = 0.015
args.radius = 5e-3
args.num_cs = 10
args.spline_degree = 3
args.num_plaque_scatterers = 1000
args.inside_ampl = 0.02
args.plaque_radius = 1.6e-3
args.h5_file = os.path.join(out_dir, "rotating_plaque_small.h5")
create_phantom(args)
args.plaque_radius = 2.9e-3
args.h5_file = os.path.join(out_dir, "rotating_plaque_large.h5")
create_phantom(args)
def create_rotating_cube_phantom():
"""
A rotating 3D cube of scatterers, which is a good example
of complex scatterer tracjectories in 3D.
"""
from rotating_cube import create_phantom
args = Args()
args.h5_file = os.path.join(out_dir, "rot_cube.h5")
args.x_min = -0.03
args.x_max = 0.03
args.y_min = -0.03
args.y_max = 0.03
args.z_min = -0.0
args.z_max = 0.03
args.z0 = 0.06
args.num_cs = 20
args.spline_degree = 3
args.t0 = 0.0
args.t1 = 1.0
args.num_scatterers = 100000
# velocities are chosen so that the motion has a period of one second
args.x_angular_velocity = 3.14159*2
args.y_angular_velocity = 3.14159*4
args.z_angular_velocity = 3.14159*8
create_phantom(args)
def create_random_spline_noise_phantom():
"""
Scatterers moving along random 3D trajectories.
"""
from spline_noise import create_phantom
args = Args()
args.h5_file = os.path.join(out_dir, "random_spline_noise.h5")
args.num_scatterers = 100000
args.x_min = -0.04
args.x_max = 0.04
args.y_min = -0.04
args.y_max = 0.04
args.z_min = 0.01
args.z_max = 0.08
args.spline_degree = 3
args.num_cs = 20
create_phantom(args)
def create_harmonic_box_phantom():
"""
A cube of scatterers moving harmonically up and down along
the Z-axis.
"""
from harmonic_box import create_phantom
args = Args()
args.h5_file = os.path.join(out_dir, "harmonic_box.h5")
args.x_min = -0.025
args.x_max = 0.025
args.y_min = -0.025
args.y_max = 0.025
args.thickness = 0.05
args.z0 = 8e-2
args.ampl = 1e-2
args.freq = 1.3
args.num_scatterers = 100000
args.num_control_points = 10
args.t_start = 0.0
args.t_end = 1.0
args.spline_degree =3
create_phantom(args)
def create_lv_spline_phantom():
"""
3D left ventricle phantom which contracts according to a realistic
contraction function.
"""
from lv_spline_model import create_phantom
args = Args()
args.h5_file = os.path.join(out_dir, "lv_spline_model.h5")
args.thickness = 8e-3
args.z_ratio = 0.7
args.x_min = -0.02
args.x_max = 0.02
args.y_min = -0.02
args.y_max = 0.02
args.z_min = 0.008
args.z_max = 0.09
args.num_scatterers_in_box = 400000
args.motion_ampl = 0.25
args.t0 = 0.0
args.t1 = 1.0
args.spline_degree = 2
args.num_cs = 10
args.scale_h5_file = "phantom_data/real_left_ventricle_contraction.h5"
args.lv_max_amplitude = 1.0
args.rotation_scale = 3.0
create_phantom(args)
def create_2d_cyst_phantom():
"""
Create a 2D cyst phantom.
"""
from cyst_phantom_2d import create_phantom
args = Args()
args.h5_file = os.path.join(out_dir, "cyst_2d.h5")
args.density = 500.0
args.cyst_scale = 0.3
create_phantom(args)
def create_simple_phantom():
"""
A few scatterers along the positive z-axis.
"""
from simple import create_phantom
args = Args()
args.h5_file = os.path.join(out_dir, "simple.h5")
args.num_scatterers=12
args.z0 = 0.005
args.z1 = 0.12
create_phantom(args)
def create_tissue_flow_phantom():
from tissue_with_flow import create_phantom
args = Args()
args.h5_file = os.path.join(out_dir, "tissue_with_constant_flow.h5")
args.num_tissue_scatterers = 1000000
args.num_flow_scatterers = 500000
args.box_dim = 0.03
args.radius = 0.008
args.tissue_length = 8e-2
args.flow_ampl_factor = 0.2
args.peak_velocity = 15e-2
args.end_time = 1.0
args.exponent = 20 # approximate constant flow
create_phantom(args)
args.exponent = 2
args.h5_file = os.path.join(out_dir, "tissue_with_parabolic_flow.h5")
create_phantom(args)
def create_spinning_disk_phantom():
from spinning_disc import create_phantom
args = Args()
args.h5_file = os.path.join(out_dir, "spinning_disc.h5")
args.degree = 2
args.num_cs = 10
args.period = 1.0
args.num_scatterers = 20000
args.z0 = 0.025
args.radius = 2e-2
create_phantom(args)
if __name__ == '__main__':
verify_correct_path()
ensure_output_folder_exists()
create_lv_spline_phantom()
create_carotid_bifurcation_phantoms()
create_contracting_cylinder()
create_rotating_plaque_phantoms()
create_rotating_cube_phantom()
create_random_spline_noise_phantom()
create_harmonic_box_phantom()
create_2d_cyst_phantom()
create_simple_phantom()
create_tissue_flow_phantom()
create_spinning_disk_phantom()
print 'NOTE: This is the last script and may take a while to finish...'
create_artery_phantom()
|
11512878 | from collections import deque
import pandas as pd
from xml.etree import ElementTree as ET
def get_gene_ontology(filename='../../data/go-basic.obo'):
# Reading Gene Ontology from OBO Formatted file
go = dict()
obj = None
with open(filename, 'r') as f:
for line in f:
line = line.strip()
if not line:
continue
if line == '[Term]':
if obj is not None:
go[obj['id']] = obj
obj = dict()
obj['is_a'] = list()
obj['part_of'] = list()
obj['regulates'] = list()
obj['is_obsolete'] = False
continue
elif line == '[Typedef]':
obj = None
else:
if obj is None:
continue
l = line.split(": ")
if l[0] == 'id':
obj['id'] = l[1]
elif l[0] == 'is_a':
obj['is_a'].append(l[1].split(' ! ')[0])
elif l[0] == 'name':
obj['name'] = l[1]
elif l[0] == 'is_obsolete' and l[1] == 'true':
obj['is_obsolete'] = True
if obj is not None:
go[obj['id']] = obj
for go_id in go.keys():
if go[go_id]['is_obsolete']:
del go[go_id]
for go_id, val in go.iteritems():
if 'children' not in val:
val['children'] = set()
for p_id in val['is_a']:
if p_id in go:
if 'children' not in go[p_id]:
go[p_id]['children'] = set()
go[p_id]['children'].add(go_id)
return go
def get_anchestors(go, go_id):
go_set = set()
q = deque()
q.append(go_id)
while(len(q) > 0):
g_id = q.popleft()
go_set.add(g_id)
if g_id not in go:
#print g_id
continue
for parent_id in go[g_id]['is_a']:
if parent_id in go:
q.append(parent_id)
return go_set
def get_parents(go, go_id):
go_set = set()
for parent_id in go[go_id]['is_a']:
if parent_id in go:
go_set.add(parent_id)
return go_set
def get_go_set(go, go_id):
go_set = set()
q = deque()
q.append(go_id)
while len(q) > 0:
g_id = q.popleft()
go_set.add(g_id)
for ch_id in go[g_id]['children']:
q.append(ch_id)
return go_set
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.