url stringlengths 13 4.35k | tag stringclasses 1
value | text stringlengths 109 628k | file_path stringlengths 109 155 | dump stringclasses 96
values | file_size_in_byte int64 112 630k | line_count int64 1 3.76k |
|---|---|---|---|---|---|---|
https://www.ba-bamail.com/quizzes/iq-quizzes/can-you-remember-these-small-details/ | code | Can You Remember These Small Details?
Let's put your memory to the test by seeing how well you can remember these 7 images!
Memory is something we all possess to a greater or lesser degree, and which we can improve with practice. Miller's Law states that we have greater recall when we memorize chunks of information in groups of 7, plus or minus 2. So, let's see if this is true. Play the short video below and try to remember as much information from the 7 images you see as possible. Then answer the recall questions to see whether you are a short-term memory master! | s3://commoncrawl/crawl-data/CC-MAIN-2023-06/segments/1674764499845.10/warc/CC-MAIN-20230131055533-20230131085533-00636.warc.gz | CC-MAIN-2023-06 | 570 | 3 |
https://biogrids.org/wiki/recommended | code | Using the BioGrids Environment
Support for Site Administrators
Hardware Support Notes
BioGrids's preferred hardware vendor is ThinkMate and we have some recommended configurations. Please feel free to contact us at email@example.com regarding upcoming hardware purchases if you have questions - we'd be happy to advise.
Any Apple machine with OSX 10.14 or later will run BioGrids software. BioGrids has several labs that run exclusively on Macs and OS X. | s3://commoncrawl/crawl-data/CC-MAIN-2023-50/segments/1700679100327.70/warc/CC-MAIN-20231202042052-20231202072052-00812.warc.gz | CC-MAIN-2023-50 | 454 | 5 |
https://apontious.com/2005/10/08/sit-ubu-sit-good-dog/ | code | Note to Macintosh developer community:
The days of the .sit file have passed.
StuffIt Expander isn’t even included by default anymore on new Mac OS X 10.4 “Tiger” systems. You have to download it separately.
Now, I will admit, this is easier than it was even just a year or two ago. Allume Systems (née Aladdin Systems) used to make it incredibly difficult on their Web site to even navigate to the free Expander download. And the download was in fact not Expander, but rather StuffIt “Standard,” which included several additional shareware products most people didn’t want. The philosophy seemed to be, “If we just piss off our users enough, maybe they’ll buy something from us!” Ugh.
When I just tried to download StuffIt Expander 10, however, I was able to get to the download in two clicks, and the resulting installation was Expander alone. So that has improved.
But you’re still requiring your users to find and download a third-party application just to get to your product.
If your product is Mac OS X 10.3 “Panther” and up, the solution is easy: use the operating system’s built-in “Create Archive” contextual menu in the Finder to build a .zip archive of the files you want.
Now, if you’d used the command-line zip utility on Mac OS X 10.2 “Jaguar” or earlier, you would’ve found that it ignored Mac-only filesystem attributes like resource forks. “Create Archive” is smarter than that. If you double-click such an archive in the Finder, it will extract the archive contents, resource forks and all.
The downside? “Create Archive” uses a custom directory layout (presumably in order to organize the extra bits) which will look strange if you attempt to open that archive with a more traditional command-line zip utility, even the zip utility at
/usr/bin/unzip on that same OS X 10.4 “Tiger” box where you made the archive in the first place! (Not to mention the zip utility on 10.2 and earlier.)
This means that these .zip files, which by their suffix look nice ‘n’ cross-platform, really aren’t. They’re still primarily for delivering content to Mac OS X users. Your sole benefit is that the archive will be double-clickable on 10.3 and higher, without additional downloads.
If you need to support Mac OS X 10.2, well…I hear StuffIt Expander is easier to download than it used to be. Oops! You have to go back to StuffIt “Standard” 8.0.2 to get Mac OS X 10.2 support. It looks like they require you to join their mailing list just to download the damn thing. Tough luck….
My advice? Make a .dmg file.
4 thoughts on “Sit, Ubu, Sit! Good Dog”
My prefered method is to make sure the application doesn’t need ressource fork (or any other special attribute), then make a plain zip file using the command line or any other tool that won’t try to encode these.
The second best method is to make an internet-enabled dmg that will extract and copy it’s content to the download folder automatically.
But I find most disk image to be confusing to the user who then, in order to keep the file, has to copy the content somewhere, unmount the disk, and then erase the image file. Compare that with Safari processing of zip or internet-enabled dmg which copy the content to the desktop and put the archive in the trash.
You can also use /usr/bin/ditto to create a Finder-style zip archive. This is useful for integrating generation of an archive into your build script. You can use xcodebuild install to generate a distribution root, /Developer/Tools/packagemaker to generate an installer package (if necessary), and /usr/bin/ditto to zip it up for single-file distribution.
This situation lead to learning how to script StuffitPro (you can use it to re-compress existing archives,) placing a mod_rewrite hack in a server’s configuration to map .sit to .zip, and writing an XSL transform to update 1,000+ XML files with references to .sit files.
We’ve used usr/bin/ditto to create a zip archive to find the details and we found it very useful.
Comments are closed. | s3://commoncrawl/crawl-data/CC-MAIN-2023-14/segments/1679296945315.31/warc/CC-MAIN-20230325033306-20230325063306-00319.warc.gz | CC-MAIN-2023-14 | 4,041 | 21 |
https://findwork.dev/91440/front-end-engineer-at-upstart | code | How you’ll make an impact:
What you’ll love:
Front End Engineer, AlphaSightsFull Time Employment | $50k
Frontend Engineer, PixCap
Front End Engineer , AlphaSights
Frontend Engineer, The Coda Collection
Front End Engineer, BizzyCar, Inc. | s3://commoncrawl/crawl-data/CC-MAIN-2021-49/segments/1637964363134.25/warc/CC-MAIN-20211205005314-20211205035314-00144.warc.gz | CC-MAIN-2021-49 | 240 | 7 |
https://tokyochronos.net/g/thread/83391901/ | code | If you use the official 2.4GHz Sony USB adapter for PC, then yes, the headset jack works, just like with the Xbox controller dongle.
But OP's point about latency is true in Bluetooth mode also. While Xbox controller with dongle is still stuck at 125Hz. >>83392069
Define janky, there's open source drivers for Windows, like DS4Windows (the new fork, not the 5 year old discounted one).
Nothing janky about that, except it gives you a lot more control, everything from custom macros, re-defining buttons, using the motions controls, adjust sensitivity, using the built in lights for battery indication, having different profiles for different games, using the touchpad, etc. You get a lot of control.
Also there's official Sony drivers for Windows, those also work with Steam's built in controller management.
Many Linux distros and macOS ship with drivers built in also.
I think many people either remember or parrot the old DS3 driver problem where it was a janky chinese closed source driver, that gave a lot of bad rep for Sony controller under PCs and apparently still does. >that wipes out any gains you might have from using a controller with a higher polling rate.
The processing time for xinput translation is less than 1ms. So not really a issue.
Plus plenty of indie and AAA games do support dinput and even DS4/DS natively and so do emulators. No translation needed. >>caring about latency>>using a controller wirelessly>pick 1 (one)
There's no measurable difference in millisecond resolution. Same applies for wireless mice, stop living in 2007 when this was a valid argument still. | s3://commoncrawl/crawl-data/CC-MAIN-2021-39/segments/1631780056572.96/warc/CC-MAIN-20210918184640-20210918214640-00382.warc.gz | CC-MAIN-2021-39 | 1,594 | 10 |
https://www.slant.co/options/1595/~qwerty-review | code | QWERTY is the most common modern-day keyboard layout.
It has variants depending on countries: AZERTY in French, QWERTZ in German, etc.
Originally, it was designed to avoid mechanical collisions of typewriter hammers when typing fast, hence the strange layout.
Ranked in these QuestionsQuestion Ranking
You don't have to carry your own keyboard everywhere, QWERTY is pretty popular
Con Not made for typing on a keyboard
It was created before computers get popular.
this layout was created for typing machines, to prevent collision between character hammers and slowing down the typist. | s3://commoncrawl/crawl-data/CC-MAIN-2017-22/segments/1495463607860.7/warc/CC-MAIN-20170524192431-20170524212431-00169.warc.gz | CC-MAIN-2017-22 | 584 | 8 |
http://sourceforge.net/p/keepass/discussion/329221/thread/938fc1e7/ | code | Work at SourceForge, help us to make it a better place! We have an immediate need for a Support Technician in our San Francisco or Denver office.
I am going to download the Portable KeePass 2.21 (ZIP Package) to my Kingston USB DataTraveler. I am only using Window's operating systems, from WINXP to WIN8, for now.
I was wondering which file system (FAT, FAT32, NTFS) I should have on the USB for this program to work it's best on?
KeePass doesn't care which windows filesystem you use, so use the one that you prefer. NTFS is the most advanced filesystem. | s3://commoncrawl/crawl-data/CC-MAIN-2014-23/segments/1404776434475.94/warc/CC-MAIN-20140707234034-00006-ip-10-180-212-248.ec2.internal.warc.gz | CC-MAIN-2014-23 | 556 | 4 |
https://raweb.inria.fr/rapportsactivite/RA2009/texmex/uid65.html | code | Section: Other Grants and Activities
ANR project Semim@ges
Participants : Zein Al-Abidin Ibrahim, Patrick Gros, Emmanuelle Martienne, Sébastien Campion.
Duration : 27 months, starting in January 2007. Partners: Orange Labs, TDF, Kersonic, Telisma, CAIRN team.
The project is devoted to TV data exploitation and repurposing. Two main applications were considered: TV news analysis, and TV streams structuring. TexMex project-team was mainly involved in the second one. The aim of our work was to structure automatically long TV streams in more usable units like programs or non-program sequences, exactly like it was done in Xavier Naturel's thesis, but with no a priori manual annotation. A method was developed based of the detection of repeated segments and on an automatic unsupervised classification of the repeated sequences. The Semim@ges project was demonstrated during the NEM Summit in Saint Malo, France, in September 2009.
ANR project ICOS-HD
Participants : Ewa Kijak, Joaquin Zepeda.
Duration: 4 years, starting in January 2007. Partners: University of Bordeaux 1, CNRS-I3S.
This project concerns scalable indexing and compression for high definition video content management. Recent solutions for achieving high-quality compression of images/video resulting in scalable bit streams. The objective of the project is to propose new solutions of scalable description to facilitate editing, manipulation and access of HD contents via heterogeneous infrastructures. TexMex project-team is involved on the study of new signal representation amenable to both compression and image description, as well as descriptor adaptation for image retrieval in large databases.
ARC INRIA RAPSODIS: Syntactic and Semantic Information-Based Automated Speech Recognition
Participants : Camille Guinaudeau, Gwénolé Lecorvé, Pascale Sébillot.
Duration: 2 years, starting in February 2008. Partners: Metiss , Parole , Talaris project-teams, CEA-LIST/LIC2M.
This project aims at improving automatic speech recognition (ASR) by integrating linguistic information. Based on former work by S. Huet concerning the incorporation of morpho-syntactic knowledge in a post-processing stage of the transcription, we experiment, together with our partners, the deep insertion of automatically obtained semantic relations (especially paradigmatic ones) and syntactic knowledge within an ASR system.
In 2009, the objectives of the project were extended to include semantic knowledge acquisition and the use of such knowledge for spoken document processing in addition to speech transcription. In this extended framework, we have worked on corpus-based acquisition of semantic relations for topic segmentation of spoken documents. We compared various classical methods for relation acquisition and measured their impact on out topic segmentation system. | s3://commoncrawl/crawl-data/CC-MAIN-2023-14/segments/1679296948858.7/warc/CC-MAIN-20230328104523-20230328134523-00649.warc.gz | CC-MAIN-2023-14 | 2,832 | 14 |
http://english.stackexchange.com/questions/101913/how-should-this-sentence-be-structured | code | I want to know which one of these two sentence structures is correct grammatically:
- This book is, despite being dense, a good read.
- This book, despite being dense, is a good read.
You're trying to convey two facts. The first is that the book is a good read, the second is that this fact is despite the book being dense (that the book is dense, that this can detract from a good read, but that this doesn't happen here).
The first we express with an independent clause:
The second with a dependent clause:
The question you are asking, is where can the dependent clause be placed grammatically.
The two options you have in your question are both doing so parenthetically. That is the commas act the same as parentheses
Now, with your parenthetical use the important thing is:
We can consider the first clause as broken into:
If we broke these parts up with a dependent clause, we damage the independent clause:
The first is clearly wrong because the first damages "this book" to produce "this, despite being dense, book" which makes little sense ("this, admittedly dense, book" would let us express the same thing by altering that noun phrase).
The second, and third break up "a good read". These come up with slightly different meanings - altering the noun phrase to suggest the "read" rather than the book is dense. We've produced something that modifies "read" much as "good" does. Since a book being dense, and it being a dense read is much the same thing, that amounts to the same thing in this case, but could mean something different in another case. They're both also clumsy as per the style decisions we'll talk about later ("a good, though dense, read" would scan better but lose some of the meaning of "despite").
Of the two you put in your answer, neither break components like this. While grammatically different in where they place the parenthetical clause, they are both grammatically valid, and both semantically the same.
So of the four valid options:
The choice remaining is one of style. The main differences are when each thought is brought to the reader, the first two are opposite in terms of what they lead with and what they leave the reader with. Hence the first leaves the reader with the focus on density, the second with the focus on the enjoyable quality.
Of the two you had, there is less to choose between them. Both make the density less a focus than the others, by making it parenthetical, so these are the ones to go for if you want the emphasis to be on the "good read". The first of yours helps encourage the reader on, because we know something must come after the is in the main statement and we read on to find out what it is, it also makes the concept "a good read" stand out on its own a bit more. The second though slightly emphasises assertion that it is "a good read" by having it immediately follow that verb.
These differences are subtle matters of impression, again they are semantically the same, so its a matter of taste and style, rather than grammar and meaning, to pick between them.
Both are difficult to read and in general it is best to avoid such writing style.
It is clear you have some concerns about the book but like it overall. Maybe it is actually better to write 2-3 easier sentences that convey the same meaning, and in the process elaborate on the good parts and also not so good parts. Dense = too many difficult words? Too many subjects / topics in a short time? Elaborating on these points helps get the reader more into what you are thinking and leaves few questions to the user... | s3://commoncrawl/crawl-data/CC-MAIN-2016-30/segments/1469257829972.19/warc/CC-MAIN-20160723071029-00214-ip-10-185-27-174.ec2.internal.warc.gz | CC-MAIN-2016-30 | 3,552 | 20 |
https://ochre.lib.uchicago.edu/BATHS/index.html | code | This constantly growing OCHRE-based database gathers various data on Roman-style bathhouses from the Roman to Early Islamic periods (mid-1st century BCE to mid-8th century CE) from the geographic area of Iudaea/Syria-Palaestina and Provincia Arabia (modern Israel, Palaestinian Authority, Jordan and southern Syria).
Each entry is identified by an arbitrary cat. ID. The entries can be explored separately (as a list or from a map view) or grouped according to parameters and variables. The illustrative material can be viewed independently through Gallery or accessed through each entry. | s3://commoncrawl/crawl-data/CC-MAIN-2023-06/segments/1674764500392.45/warc/CC-MAIN-20230207071302-20230207101302-00040.warc.gz | CC-MAIN-2023-06 | 588 | 2 |
https://evaluarpro.com/pruebas-de-ejemplo.html | code | Use CodeGround Candidate Screening Platform to screen thousands of candidates on IQ, Aptitude, Analytical Skills, Logical Reasoning, Data Interpretation and Problem Solving Ability.
Use CodeGround Online Testing Platform to test candidates on English Grammar and Vocabulary, Written English, Spoken English (audio capture with microphone), Reading and Listening Comprehension
Use CodeGround Tech Recruitment Platform to conduct Programming Challenges and Hands-On Technical Skills Assessments
Use CodeGround Recruitment Testing Platform to conduct on-demand asynchronous pre-recorded interviews. Interview thousands of candidates simultaneously!
Use CodeGround Tech Recruitment Platform to conduct hackathon, brand promotion challenges
Use CodeGround Tech Recruitment Platform to conduct online walk-in, campus recruitment, campus drive. | s3://commoncrawl/crawl-data/CC-MAIN-2018-51/segments/1544376823872.13/warc/CC-MAIN-20181212112626-20181212134126-00395.warc.gz | CC-MAIN-2018-51 | 837 | 6 |
https://thesentinelproject.org/2011/06/17/conference-redux-from-a-sentinel-project-research-analyst/ | code | Over the past few months I’ve had the good fortune to represent The Sentinel Project at a few conferences in the San Francisco Bay area, where I’m based. The conferences were a diverse array of learning and networking opportunities, as each focused on a different theme relevant to the Sentinel Project’s work. I attended the Strata conference in Santa Clara (big data visualization and analysis), the Amnesty International-USA Annual General Meeting in San Francisco (human rights and activism) and the Advancing the New Machine conference in Berkeley (human rights and technology).
Taken as a whole, a few themes and lessons emerged from the conferences that have been beneficial to the Sentinel Project as we continue developing our approach to early warning. These varied from lessons about research methodology to data visualization, and from technologies that we can use internally for data aggregation and collaboration to those that could be deployed in the field for information sharing and data collection. I’ll elaborate on some of these themes below.
- The rules of dataviz: The Sentinel Project’s Threatwiki platform looks to marry new design techniques with existing visualization technologies and apply them to a unique conceptual framework focused on the various processes that indicate a coming or existing genocide. Several speakers at the Strata conference, including Kim Rees of Periscopic, Simon Rogers of The Guardian’s Data blog and Jacques MacKinlay of Tableau, emphasized a few general rules of data visualization that we hope to incorporate into our platform. Among these are that the visualizations should be dynamic and interactive, they should be engaging but simple and parsimonious, and that users should have access to all of the data, with the ability to use filters to drill down and see only the information retaining the characteristics they specify. These components are already present in Threatwiki, and we have ideas in the works for its next release to make the platform even more robust. (For more on the Strata conference, see my guest posts on the Information Aesthetics blog.)
- Analysts AND algorithms > analysts OR algorithms: When Bob McGrew of Palantir Technologies spoke at Strata, he praised the utility of automated analysis but emphasized the superiority of a human’s ability to contextualize information. And while humans are typically more adept at data analysis, computers can be put to work to perform the more rote, tedious tasks, like massive data collection. After a presentation he gave at the human rights and tech conference in Berkeley, we contacted Dr. Michael Best of Georgia Tech to talk with him about some software he mentioned that aggregates relevant event data from various sources, including social media and traditional news, and funnels it into a single stream for easy extraction, which can be automated or done manually. The software is called Aggie, developed by Tom Smyth, a Georgia Tech PhD student, and we are happy to say that the Sentinel Project will be beta testing some of this software in support of our situation monitoring efforts. We hope Aggie will help us to streamline the research and analysis process, and will be giving Tom feedback on what is sure to be a very useful and important tool as he continues its development.
Similarly, Scott Edwards of Amnesty International, speaking at the Berkeley conference on human rights and tech, emphasized a balance between people and machines when he identified three key elements to a comprehensive approach to social prediction: structural (macro-level data for macro-level prediction), single-process time series (finer data for shorter time scales) and game theoretic (as he put it, human beings are agents, not billiard balls). Each of these levels is a process the Sentinel Project is either currently employing or actively developing, as our risk assessments represent structural-level analysis, our process monitoring tools (e.g. Threatwiki) utilize time-series event data, and the methodology we are developing for vulnerability assessments and short-term conflict forecasting will likely incorporate game theoretic approaches.
- Do not reinvent the wheel: As we have seen with the uprisings in North Africa, the Middle East and elsewhere, people are very resourceful when it comes to finding ways to gather and distribute information. There is no need to create new technologies when existing ones will do. At the Berkeley conference, both Olga Werby and Sasha Costanza-Chock, among others, emphasized the benefits of technological appropriation; that is, using technology to achieve your ends, even if that end is not what the product’s designers had in mind. We see this particularly with the use of mobile phones and SMS in documenting abuses, mobilizing otherwise disparate movements and planning mass gatherings. Patrick Meier spoke at both the tech conference and the Amnesty AGM about the ways in which he and his colleagues at Ushahidi collected information via SMS and used crowdsourcing to plot incidents of interpersonal attacks in Kenya, and locations of aid stations and shelters in Haiti and Japan. Much of the information that Ushahidi collected and published would not otherwise have been documented anywhere. Their approach to information collection and presentation was an early inspiration to the Sentinel Project and will continue to be as we work to establish information-sharing networks in the countries we’re monitoring.
There is far more that deserves coverage from these fantastic meetings of the minds, so please don’t mistake lack of inclusion here for lack of importance. These conferences were full of dedicated people with very novel, interesting and inspiring ideas about the uses of technology. We look forward to running into them again at future events, but for now we’re hard at work finding ways to synthesize those ideas and apply them to genocide prevention. Many thanks to all of the participants, and do keep up the good work. We can’t wait to see what you come up with next–and can’t wait to share our own innovations as well. | s3://commoncrawl/crawl-data/CC-MAIN-2023-50/segments/1700679099281.67/warc/CC-MAIN-20231128083443-20231128113443-00119.warc.gz | CC-MAIN-2023-50 | 6,142 | 7 |
https://intercom.help/trycircular/en/articles/6762115-how-can-i-make-the-most-out-of-my-profile | code | In this article we share with you top tips to make the most out of your profile:
Include as much information as you can about yourself (i.e The Skills & Frameworks you are most comfortable using and have experience in)
Make sure to add your LinkedIn (that the info on there is the same as in your profile) so recruiters have a way of viewing your employment history & so we have it in English to improve visibility and potential offers
Make sure you add your location and relevant work permits if you have them. Add full remote for more potential offers
Add an updated CV to your profile to save you from having to send one to each new recruiter. Add your Github/code projects too if you have one. Recruiters want to see your projects!
Add a little description about yourself so our team can see more than just your skillset and get to understand you better
Add your full name/real name (we know its sounds obvious 😅)
Add salary expectations so you get matched to the jobs that meet those expectations therefore saving time | s3://commoncrawl/crawl-data/CC-MAIN-2023-50/segments/1700679101282.74/warc/CC-MAIN-20231210060949-20231210090949-00303.warc.gz | CC-MAIN-2023-50 | 1,026 | 8 |
https://openreview.net/forum?id=S1en0sRqKm | code | - Abstract: Increasing the mini-batch size for stochastic gradient descent offers significant opportunities to reduce wall-clock training time, but there are a variety of theoretical and systems challenges that impede the widespread success of this technique (Daset al., 2016; Keskar et al., 2016). We investigate these issues, with an emphasis on time to convergence and total computational cost, through an extensive empirical analysis of network training across several architectures and problem domains, including image classification, image segmentation, and language modeling. Although it is common practice to increase the batch size in order to fully exploit available computational resources, we find a substantially more nuanced picture. Our main finding is that across a wide range of network architectures and problem domains, increasing the batch size beyond a certain point yields no decrease in wall-clock time to convergence for either train or test loss. This batch size is usually substantially below the capacity of current systems. We show that popular training strategies for large batch size optimization begin to fail before we can populate all available compute resources, and we show that the point at which these methods break down depends more on attributes like model architecture and data complexity than it does directly on the size of the dataset.
- Keywords: Deep learning, large batch training, scaling rules, stochastic gradient descent
- TL;DR: Large batch training results in rapidly diminishing returns in wall-clock time to convergence to find a good model. | s3://commoncrawl/crawl-data/CC-MAIN-2021-39/segments/1631780056890.28/warc/CC-MAIN-20210919125659-20210919155659-00145.warc.gz | CC-MAIN-2021-39 | 1,595 | 3 |
http://houdini-connections.co.uk/category/flush-dns-linux-redhat.php | code | Some times you are trouble to reach some of the sites due to DNS issue, it may be your local DNS cache was corrupt. For this kind of situation. Web server contains the web pages and DNS storage cache stores the recently visit web pages location. This process always runs and DNS. Its not your local box which is caching the DNS requests but it is the DNS resolver which you are using in your /etc/houdini-connections.co.uk who is caching. How to Flush the Local DNS Cache in Linux Server distribution – yum for RedHat-based distribution such as Fedora, CentOS and apt-get for. Flushing your DNS cache can help to clear things out and possibly speed up domain name resolution. Learn several ways to clean out your DNS cache on Linux. It's the choice of the Red Hat distributions and Arch Linux. This tutorial will show how to flush DNS using various platforms. By the end, you'll be able to clear DNS cache on Windows, Mac, and Linux machines. DNS, or a Domain Name System, is responsible for resolving website names into their respective IP addresses. So, if you're having trouble. I'm on a Dial UP Internet connection under Linux and frequent dial up disconnection causing dns problems. How do I flush DNS cache under. How to clear DNS cache for RHEL without reboot. Solution Verified Environment. Red Hat Enterprise Linux 6; Red Hat Enterprise Linux 7. Nowadays many Linux distributions do not utilize a local DNS resolver cache, like Windows and Mac OS X. If you do not know whether your distribution has su. | s3://commoncrawl/crawl-data/CC-MAIN-2021-04/segments/1610703644033.96/warc/CC-MAIN-20210125185643-20210125215643-00587.warc.gz | CC-MAIN-2021-04 | 1,513 | 1 |
https://opensciencegrid.org/docs/data/stashcache/run-stashcache-container/ | code | Running Stashcache in a Container¶
The OSG operates the StashCache data federation, which provides organizations with a method to distribute their data in a scalable manner to thousands of jobs without needing to pre-stage data across sites or operate their own scalable infrastructure.
Stash Caches transfer data to clients such as jobs or users. A set of caches are operated across the OSG for the benefit of nearby sites; in addition, each site may run its own cache in order to reduce the amount of data transferred over the WAN. This document outlines how to run StashCache in a Docker container.
Before starting the installation process, consider the following points:
- Docker: For the purpose of this guide, the host must have a running docker service and you must have the ability to start containers (i.e., belong to the
- Network ports: Stash Cache listens for incoming HTTP/S connections on port 8000 (by default)
- File Systems: Stash Cache needs a partition on the host to store cached data
In addition to the required configuration above (ports and file systems), you may also configure the behavior of your cache with the following variables using an enviroment variable file:
Where the environment file on the docker host,
/opt/xcache/.env, has (at least)the following contents:
Further behaviour of the stashcache can be cofigured by setting the followin in the enviroment variable file
XC_SPACE_HIGH_WM: High watermark for disk usage; when usage goes above the high watermark, the cache deletes until it hits the low watermark
XC_SPACE_LOW_WM: Low watermark for disk usage; when usage goes above the high watermark, the cache deletes until it hits the low watermark
XC_PORT: TCP port that XCache listens on
XC_RAMSIZE: Amount of memory to use for storing blocks before writting them to disk. (Use higher for slower disks).
XC_BLOCKSIZE: The size of the blocks in the cache
XC_PREFETCH: Number of blocks to prefetch from a file at once. This is a value of how aggressive the cache is to request portions of a file. Set to
Disabling OSG monitoring¶
By default, XCache reports to the OSG so that OSG staff can monitor the health of data federations. If you would like to report monitoring information to another destination, you can disable the OSG monitoring by setting the following in your environment variable configuration:
DISABLE_OSG_MONITORING = true
Do not disable OSG monitoring in any service that is to be used for any other than testing
To run the container, use docker run with the following options, replacing the text within angle brackets with your own values:
[email protected] $ docker run --rm --publish <HOST PORT>:8000 \ --volume <HOST PARTITION>:/cache \ --env-file=/opt/xcache/.env \ opensciencegrid/stash-cache:stable
Running Stashcache on container with systemd¶
An example systemd service file for StashCache.
This will require creating the environment file in the directory
This example systemd file assumes
<HOST PORT> is
<HOST PARTITION> is
[Unit] Description=StashCache Container After=docker.service Requires=docker.service [Service] TimeoutStartSec=0 Restart=always ExecStartPre=-/usr/bin/docker stop %n ExecStartPre=-/usr/bin/docker rm %n ExecStartPre=/usr/bin/docker pull opensciencegrid/stash-cache:stable ExecStart=/usr/bin/docker run --rm --name %n --publish 8000:8000 --volume /srv/cache:/cache --env-file /opt/xcache/.env opensciencegrid/stash-cache:stable [Install] WantedBy=multi-user.target
This systemd file can be saved to
/etc/systemd/system/docker.stash-cache.service and started with:
[email protected] $ systemctl enable docker.stash-cache [email protected] $ systemctl start docker.stash-cache
You must register the cache before considering it a production service.
For caches that are connected to NIC's over
40Gbps we recommend to disable the virtualized network and "bind" the container to the host network:
[email protected] $ docker run --rm \ --network="host" \ --volume <HOST PARTITION>:/cache \ --env-file=/opt/xcache/.env \ opensciencegrid/stash-cache:stable
Stashcache uses the hosts memory in two ways:
- Uses the own linux kernel as a way to cache files read from disk
- As a buffer for writting blocks of files first in memory and then in disk (to account for slow disks).
An easy way to increase the performance of stashcache is to assign it more memory. You can use the docker option
--memory and set it up to at least twice of
[email protected] $ docker run --rm --publish <HOST PORT>:8000 \ --memory=64g \ --volume <HOST PARTITION>:/cache \ --env-file=/opt/xcache/.env \ opensciencegrid/stash-cache:stable
For caches that store over
10 TB or that have assigned space for storing the cached files over multiple partitions (
/partition1, /partition2, ...) we recommend the following.
Create a config file
90-my-stash-cache-disks.cfgwith the following contents
pfc.spaces data oss.space data /data1 oss.space data /data2 . . .
Run the container with the following options:
[email protected] $ docker run --rm --publish <HOST PORT>:8000 \ --volume <HOST PARTITION>:/cache \ --volume /partition1:/data1 \ --volume /partition2:/data2 \ --volume /opt/xcache/90-my-stash-cache-disks.cfg:/etc/xrootd/config.d/90-stash-cache-disks.cfg \ --env-file=/opt/xcache/.env \ opensciencegrid/stash-cache:stable
Under this configuration the
<HOST PARTITION> is not used to store the files rather to store symlinks to the files in
For over 100 TB of assigned space we highly encourage to use this setup and mount
<HOST PARTITION> in solid state disks or NVME.
For example, if you've chosen
8212 as your host port, you can verify that it worked with the command:
[email protected] $ curl http://localhost:8212/user/dweitzel/public/blast/queries/query1
Which should output:
>Derek's first query! MPVSDSGFDNSSKTMKDDTIPTEDYEEITKESEMGDATKITSKIDANVIEKKDTDSENNITIAQDDEKVSWLQRVVEFFE | s3://commoncrawl/crawl-data/CC-MAIN-2020-16/segments/1585370506988.10/warc/CC-MAIN-20200402143006-20200402173006-00324.warc.gz | CC-MAIN-2020-16 | 5,839 | 60 |
https://www.fixya.com/support/t127285-restart_win_operating | code | Try link: http://blog.parts-people.com/2014/06/27/dell-inspiron-m501r-m5010-beep-codes-diagnostic-indicators-2/
How to identify beep codes:
When a laptop or computer first powers on, it goes through an initial set of diagnostic tests to make sure vital components are preforming correctly. These tests are called POST or Power On Self Test. When a test fails, the user is notified via POST codes, Light codes, or Beep codes. For diagnosing Beep codes you need to:
Dell Inspiron M501R (M5010) Beep Codes
- Power on the laptop or restart it if it is already on.
- Listen to the number of consecutive beeps when the computer begins to boot. Restarting the laptop may be necessary and should not harm the laptop at this time.
# of Beeps
BIOS ROM checksum in progress or failure
System board failure, covers BIOS corruption or ROM errors.
No Memory (RAM) detected
Memory or Memory slot failure
- chipset Error (North and South bridge error, DMA/IMR/Timer error)
- Time-Of-Day Clock test failure
- Gate A20 failure
- Super I/O chip failure
- Keyboard controller test failure
System board failure
Memory read / write failure
Real Time Clock (RTC) power fail
CMOS battery failure
Video BIOS test failure
Video subsystem failure
CPU Cache test failure
Processor failure or motherboard failure
Most Common Fixes:
- 1 Beep: Replace the motherboard / system board.
- 2 Beeps: Reseat the memory or replace the memory.
- 3 Beeps: Replace the motherboard / system board.
- 4 Beeps: Reseat the memory or replace the memory.
- 5 Beeps: Replace the CMOS battery.
- 6 Beeps: Reseat or replace the video card or replace the motherboard / system board.
- 7 Beeps: Reseat or replace the CPU or replace the motherboard.
- 8 Beeps: Reseat the LCD cable or replace the LCD screen. | s3://commoncrawl/crawl-data/CC-MAIN-2022-40/segments/1664030335059.31/warc/CC-MAIN-20220927225413-20220928015413-00328.warc.gz | CC-MAIN-2022-40 | 1,755 | 33 |
https://forum.aspose.com/t/aspose-words-net-get-entire-page-content-for-a-given-page/38565 | code | hello. so, I have a multi-page document and i need to be able to extract content for any given page. for example how would i get all the contents on page 4 of the document. i don’t understand the whole node concept as it applies to an entire page
Thanks for your inquiry. Please check “PageSplitter” example project in Aspose.Words for .NET examples repository at GitHub. Following code example shows how to extract the contents of page 4 of input document. Hope this helps you.
Document doc = new Document(MyDir + "in.docx"); LayoutCollector layoutCollector = new LayoutCollector(doc); DocumentPageSplitter splitter = new DocumentPageSplitter(layoutCollector); Document pageDoc = splitter.GetDocumentOfPage(4); pageDoc.Save(MyDir + "Out.docx"); | s3://commoncrawl/crawl-data/CC-MAIN-2023-50/segments/1700679100309.57/warc/CC-MAIN-20231202010506-20231202040506-00143.warc.gz | CC-MAIN-2023-50 | 751 | 3 |
http://www.trekearth.com/workshops/page3.htm | code | EstudioChispa (1922) 2015-01-24 13:43:36The deficiency is likely in my monitor, but I could not see any shadow detail in the church. I have respectfully dodged the church's shadows, as well as the grassy foreground.
A more daring hand might have tried to dial up the saturation in the green, but I resisted that temptation!
With ALL respect to the original and to Noel, a great eye and good friend...
La Paz, BCS, Mexico | s3://commoncrawl/crawl-data/CC-MAIN-2015-06/segments/1422121981339.16/warc/CC-MAIN-20150124175301-00145-ip-10-180-212-252.ec2.internal.warc.gz | CC-MAIN-2015-06 | 420 | 4 |
https://mail.python.org/archives/list/python-dev@python.org/message/IJ5Y5Z5DXN6OGY2UBX5GQRCTEZEFVUJC/ | code | On Tue, 2006-01-17 at 16:38 -0700, Adam Olsen wrote:
On 1/17/06, Thomas Wouters email@example.com wrote:
On Tue, Jan 17, 2006 at 09:23:29AM -0500, Jason Orendorff wrote:
I dream of a day when str(3.25, base=2) == '11.01'. That is the number a float really represents. It would be so much easier to understand why floats behave the way they do if it were possible to print them in binary.
Heh... that's pretty much why I used base16 float notation when doing fixed point stuff in assembler... uses less digits than binary, but easily visualised as bits.
However, I do think that we could go overboard here... I don't know that we really need arbitrary base string formatting for all numeric types. I think this is a case of "very little gained for too much added complexity".
If we really do, and someone is prepared to implement it, then I think adding "@base" is the best way to do it (see my half joking post earlier).
If we only want arbitrary bases for integer types, the best way would be to leverage off the existing ".precision" so that it means ".base" for "%d".
My only opposition to this is that the byte type may want to use it. I'd rather wait until byte is fully defined, implemented, and released in a python version before that option is taken away.
There's always "B" for bytes and "b" for bits... though I can't imagine why byte would need it's own conversion type.
I'm not entirely sure everyone is on the same page for "%b" here... it would only be a shorthand for "binary" in the same way that "%x" is for "hexidecimal". It would not support arbitrary bases, and thus "%2b" would mean a binary string with minimum length of 2 characters. | s3://commoncrawl/crawl-data/CC-MAIN-2023-50/segments/1700679099892.46/warc/CC-MAIN-20231128151412-20231128181412-00740.warc.gz | CC-MAIN-2023-50 | 1,657 | 11 |
https://github.com/rimusz/glusterfs-gce | code | Bootstrap HA GlusterFS Cluster in GCE
- This project bootstraps off-cluster HA GlusterFS Cluster, if you are interested to run HA GlusterFS Cluster in Kubernetes, check out gluster-kubernetes project.
As you know shared file systems are a tricky problem. One solution to that problem is a distributed file system. Something that your apps can read from and write to. When it comes to distributed file systems, GlusterFS is one of the leading products.
With a few simple scripts on your Mac OS X or Linux machine, you can deploy a multi-zone HA GlusterFS cluster to Google Compute Engine (GCE) that provides scalable, persistent shared storage for your GCE or Google Container Engine (GKE) Kubernetes clusters.
By default it is set to three GlusterFS servers, one server per Google Cloud zone in the same chosen region.
Before continuing, please make sure you have:
Clone this project and set settings:
$ git clone https://github.com/rimusz/glusterfs-gce $ cd glusterfs-gce/cluster
- Edit the
cluster/settingsfile and set
PROJECT, REGION and ZONES, the rest of settings in this file are probably fine, but can be adjusted if need be.
Bootstrap the cluster
This command will create three servers.
Each server will have:
- A static IP
- The GlusterFS server package installed
- A Google Cloud persistent disk to be used as a GlusterFS brick, that is: storage space made available to the cluster
A GlusterFS volume is a collection of bricks. A volume can store data across the bricks in three basic ways: distributed, striped, or replicated.
With the script below you will be able to create GFS replicated volumes on all three servers automaticly:
$ cd .. $ ./create_volume.sh VOLUME_NAME
At this point, your GlusterFS cluster should be fully set up and operational
You can check Kubernetes GlusterFS example how to use GlusterFS with Kubernetes.
cluster folder there are two more scripts:
upgrade_glusterfs.sh- allows to upgrade GlusterFS server package on all servers
apt-get update && apt-get upgradeon all servers
Delete the cluster
This command will delete the whole cluster. | s3://commoncrawl/crawl-data/CC-MAIN-2019-04/segments/1547583657557.2/warc/CC-MAIN-20190116175238-20190116201238-00551.warc.gz | CC-MAIN-2019-04 | 2,076 | 27 |
https://www.combatsim.com/cgi-bin/ubbcgi/ultimatebb.cgi?ubb=next_topic&f=4&t=001478&go=newer | code | Member # 9369
posted 12-04-2001 02:06 PM
I am using Win XP and have found that it is not compatible with many of my games. There is a compatibility toolkit on the disk but it is about as useful as an ashtray on a motor-bike as there is nothing to tell you how to use it. There is also a program compatibility wizard but that doesn't work either. I have tried 3 games so far: Eurofighter Typhoon, Janes F/A-18 Simulator and Hogs of War. Typhoon won't let you past the first screen because the keyboard doesn't work . F18 won't let you past the 1st screen because it is not compatible with Win2000 (or so it tells me) and Hogs of war will let you into the game after a bit of mucking about but again, the keyboard won't work . Games that do play are Operation Flashpoint and Civ3 . Also I seem to have taken a frame rate hit, a big one. In Win98 my 3D Mark 2001 score is about 3000, in WinXP it is about 2500 . I am just getting to grips for now but can sombody help me?
Posts: 301 | From: UK | Registered: Dec 2001 | IP: Logged | s3://commoncrawl/crawl-data/CC-MAIN-2021-49/segments/1637964358233.7/warc/CC-MAIN-20211127193525-20211127223525-00405.warc.gz | CC-MAIN-2021-49 | 1,026 | 4 |
https://www.potomacpctech.com/windows-xp/business-network-support-services-show-desktop-icon/ | code | To re-create the Show desktop icon, follow these steps:
- Click Start, click Run, type notepadin the Openbox, and then click OK.
- Carefully copy and then paste the following text into the Notepad window:
- On the Filemenu, click Save As, and then save the file to your desktop as “Show desktop.scf”. The Show desktopicon is created on your desktop.
- Click and then drag the Show desktopicon to your Quick Launch toolbar.
Business network, computer repair & virus removal support services. Silver Spring, Urbana & Rockville.
Content Source = http://support.microsoft.com/kb/190355 (link includes Microsoft “Fix It” Solution) | s3://commoncrawl/crawl-data/CC-MAIN-2023-14/segments/1679296943484.34/warc/CC-MAIN-20230320144934-20230320174934-00706.warc.gz | CC-MAIN-2023-14 | 633 | 7 |
https://techbreakdowns.com/about/ | code | I’d like to say I’ve only written this about page once, but I’d be lying. TechBreakdowns, in its current form, is a website by Ash Anderson writing about the intersections of business and technology.
What will you find here? Posts about technology. About my thoughts and feelings on that technology, and considerations from the business side of things. I’ll also produce breakdowns of technology companies, and occasional deep-dives into some technologies themselves.
Why? I don’t know. I like writing, I like sharing, so this is that. If you’re interested in the words, please consider subscribing!
Interested? Consider subscribing to receive the updates in your inbox. You’ll get (likely) one email per week. | s3://commoncrawl/crawl-data/CC-MAIN-2023-50/segments/1700679100399.81/warc/CC-MAIN-20231202105028-20231202135028-00746.warc.gz | CC-MAIN-2023-50 | 724 | 4 |
https://lists.samba.org/archive/samba/2004-March/082373.html | code | [Samba] add machine script problem
lukas at msys.ch
Thu Mar 11 12:28:25 GMT 2004
I set up a Samba 3 PDC with ldap backend. I created an script that adds
machine accounts. First it adds the machine account to /etc/passwd and
then it creates the user in ldap with smbpasswd -a -m machine.
If I run the script by hand, it works and the account has been added.
After that I can join the domain without any problems. Now I want to
make this machine account creation on the fly. So I added the script to
smb.conf as add user script = /path/to/createmachineaccount.sh.
If I try to join a domain with a workstation that hasn't any account,
the script creates the machine account but on error occurs that I can't
log in because the account doesn't exist. After that if I try to join
again, the logon process works because it found the machine account. So
I have to join every workstation twice, first for user creation and
second for joining the domain.
Why doesn't this work in one step? On our old samba 2.2.8a PDC with ldap
backend, the whole things worked with the same machine add script.
I welcome any suggestions.
More information about the samba | s3://commoncrawl/crawl-data/CC-MAIN-2021-17/segments/1618039490226.78/warc/CC-MAIN-20210420183658-20210420213658-00255.warc.gz | CC-MAIN-2021-17 | 1,144 | 20 |
https://forums.macrumors.com/threads/wireless-connection-issues-on-college-network.830773/ | code | The college I attend has a wireless network available to students. You don't need a key or anything to join the network, but once you're connected, you need to open a browser that automatically directs you to a website where once you log in, you are granted internet access. Similar to what you get a Starbucks, hotels, airports, etc. This used to work fine, but recently I have had nothing but trouble with it. I can connect to the network fine, but when I open the browser I cannot get to the page where I need to log in--nothing ever loads and the browser eventually times out. I have tried resetting Safari, using Firefox, turned off pop-up blockers, renewed my DHCP lease, and nothing seems to do anything. I should add that I can complete this process with no issues on my iPhone. Also, I get the same result with 2 different MBP's. Both run Snow Leopard. Any thoughts on what could cause this? Anyone having similar issues? It's incredibly frustrating, any help would be *greatly* appreciated!! | s3://commoncrawl/crawl-data/CC-MAIN-2018-47/segments/1542039742020.26/warc/CC-MAIN-20181114125234-20181114151234-00263.warc.gz | CC-MAIN-2018-47 | 1,001 | 1 |
https://community.brocade.com/t5/Ethernet-Switches-Routers/Brocade-FastIron-Ip-Helper-DHCP-relay/ta-p/1909 | code | Traditional DHCP requests from a client must find a DHCP server using a Layer 2 broadcast (thus in the same subnet). So, if the router is not able to function as a proxy for the broadcasts, it would be necessary to put a DHCP server on every network segment where such service is needed. Thanks to the ip-helper command, when a client sends a DHCP request packet to a broadcast address, the router replaces the source address with its own IP address for the interface that received the request. And it replaces the destination with the address specified in the ip-helper command. Thus, as soon as a pool is configured for the given subnet, the DHCP server can retrieve an address for a host that is not in the same subnet.
FastIron FCX that runs FCXR07100a.bin (Router)
FastIron FCX that runs FCXR07100a.bin (Router that acts as a DHCP Server) | s3://commoncrawl/crawl-data/CC-MAIN-2018-26/segments/1529267865081.23/warc/CC-MAIN-20180623132619-20180623152619-00564.warc.gz | CC-MAIN-2018-26 | 843 | 3 |
https://www.gizmodo.com.au/2009/12/how-to-play-zune-pass-music-on-your-winmo-handset/ | code | For $US15 a month, a Zune Pass subscription is a pretty great deal. The only catch, seemingly, is that you also have to pony up a couple hundred bucks for a Zune. Except: turns out you don't.
PocketNow shows how:
The site makes the excellent point that the music you get on Zune Pass - unlimited song downloads, 10 of which you get to keep every month - is protected under the same DRM supported by Windows Media Player and Windows Media Center. The video above explains the process in detail, but the gist is that by using the Zune desktop software, you can sync your downloads to Windows Media Player and onto your phone. You may miss out on some features that the Zune HD carries, like the ability to stream music wirelessly and to email your content to friends, but that's a small price to pay for what you're saving yourself in hardware. [PocketNow via on10] | s3://commoncrawl/crawl-data/CC-MAIN-2019-18/segments/1555578610036.72/warc/CC-MAIN-20190423174820-20190423200820-00536.warc.gz | CC-MAIN-2019-18 | 863 | 3 |
http://www.tfug.org/pipermail/tfug_tfug.org/2008-June/036028.html | code | [Tfug] Wireless Mice (and some wired mice) and xorg.conf
Ken Nelan, s.f.o.
kjnelan at msn.com
Wed Jun 4 23:26:19 MST 2008
(I hope it's okay to send stuff like this. Please let me know if it is not correct form. It is also a bcc to mulitple forums. Thank you.)
I am recently a new convert to Linux though I have been using it for years off and on; not really serious, but at the same time eager to move into the free os world.
More than anything else however, I have loved the challenge of getting things to work through time and patience and ceiling climbing (its a new sport, I promise).
Recently after installing Ubuntu 8.04 on my desktop, laptop and ceiling (at least claw marks if not the cd's from the botched writes), I came across a problem that had plagued me since my first days with linux: a wireless mouse that doesn't work well.
Specifically, the wheel scroll thingy and the back and forward button thingys never seemed to work at the same time and the scroll would always go to heck in a hand basket.
I even found a bug report at: https://bugs.launchpad.net/ubuntu/+source/gtk+2.0/+bug/124440 describing the same problem with similar mice.
I found the same problem with a standard wired mouse as well, but the answer bugged the heck out of me, but I think I may have found a solution. One that a great many people seemed to have over looked. It's the number of actual buttons on a mouse. Today's mice have more than 3 and 5 buttons. They more often than not have 7,9 or more buttons.
Putting the correct number of buttons in the xorg.conf seems to resolve all issues with scroll lines, back and forward clicks and so forth. ( at least it did for me and only after weeks of frustrating trial and error.)
I used the following xorg.conf modification on all of these mice: Microsoft Wireless Laser Mouse 5000, GE Optical Mouse WK2803 (usb mosue), Dynatech Wireless Mouse, No name off the shelf mouse. With the exception of the Microsoft mouse, all had 7 buttons (Right, Left, Back, Forward, scroll up, scroll down, press scroll button in = 7). The Microsoft mouse had 9 buttons (Right, Left, Back, Forward, scroll up, scroll down, press scroll
button, move scroll button left, move scroll button right, = 9)
(my xorg.conf now looks like this)(mines located at /etc/X11/):
Identifier "Configured Mouse"
Option "Device" "/dev/input/mice"
Option "Protocol" "ExplorerPS/2"
Option "Buttons" "7" <-- for my Microsoft mouse, I changed this to 9 and everything worked properly.
Option "ZAxisMapping" "4 5"
Option "ButtonMapping" "1 2 3"
Option "Emulate3Buttons" "false"
The side to side actions and the depression on the scroll wheel may not work correctly unless they are properly mapped, but I don't know many people who use those anyway. (I can learn not to use them for now).
I hope this helps anyone out there who may have had or is currently having a similar problem with no scroll or no back or forward (side buttons) clicking on their mice.
Peace to All,
-------------- next part --------------
An HTML attachment was scrubbed...
More information about the tfug | s3://commoncrawl/crawl-data/CC-MAIN-2018-09/segments/1518891816647.80/warc/CC-MAIN-20180225150214-20180225170214-00085.warc.gz | CC-MAIN-2018-09 | 3,070 | 28 |
http://www.digitalproductcritic.com/tag/customer/ | code | Albert Einstein said:
The only thing that interferes with my learning is my education.
Staying in the office or lab, and researching and trying to figure out the best approach for the best product – is a waste of time. Instead you need to bring your ideas to the real world, get feedback, iterate and continue develop.
To “get out of the building” means exactly that; Having a brief brainstorming in the office, quickly developing a basic prototype, and bringing it to the public, the target audience in short time. The sooner you get out of the building, the better. You then have valuable feedback, to continue iterating your product development and process building.
By staying “in the office” you have your thoughts only, which are not new, and are not the market’s opinion and thoughts of your solution and product.
Steve Blank mentioned this concept of “getting out of the building”, early on and many times since. Getting out of the building helps you understand and build the Minimal Viable Product (MVP). | s3://commoncrawl/crawl-data/CC-MAIN-2024-10/segments/1707948235171.95/warc/CC-MAIN-20240305124045-20240305154045-00187.warc.gz | CC-MAIN-2024-10 | 1,029 | 6 |
https://superuser.com/questions/401164/old-technologies-about-floppy | code | I have a floppy disk with an unknown FS-(FileSystem). I want to make a copy from it but I can't because both Windows and Linux seem to be unable to read from it.
I tried many of the most popular apps to make image files (for example isomeric, winimage, ...) but they are all unable to make an image.
On Linux I tried the
dd command to copy it but it seems that not even
dd is able to make a copy. I get many errors while reading from the disk, I looked them up and I found that
dd was unable to read from it because of a bad sector - but when I test this floppy on the HITACHI system it works fine and I don't get any error.
The question is: how can I make a copy from this type of floppy? I've heard I can use a BIOS interrupt for this kind of things? | s3://commoncrawl/crawl-data/CC-MAIN-2023-23/segments/1685224654031.92/warc/CC-MAIN-20230608003500-20230608033500-00224.warc.gz | CC-MAIN-2023-23 | 752 | 7 |
https://moz.com/community/q/user/hingeheads | code | Thanks for the reply.
We have done a pretty extensive brain storm list, but as you can imagine it's a never ending rabbit hole
Initially we positioned our products as "hinge finials", since that describes the product relatively well. However, after doing some more research we found that it was too narrow and mainly focused on the utility of the product.
Our keywords are based on the following:
- Data from Google Keyword Tools
- User feedback on what users would search when looking (browse/discover) for our products, or related products.
- Decor items (what)
- Miniature Sculptures (what)
- Decor ideas (general discovery)
- Gift ideas (general discovery)
We have considered alternative keywords like "decorative hinges" like you suggested, but I believe that the focus is too narrow.
Other considerations were "door decorations" or "door decor", but given that they both fall into the "high" competitive pool, we opted for the larger pool.
I will check out the tools you mentioned. | s3://commoncrawl/crawl-data/CC-MAIN-2021-25/segments/1623488525399.79/warc/CC-MAIN-20210622220817-20210623010817-00276.warc.gz | CC-MAIN-2021-25 | 987 | 13 |
https://wordpress.org/support/topic/load-remote-menu | code | I have 3 wordpress sites (different domain names, not subs) all residing on the same server. I'd like all 3 of them to load the main menu from the 'parent' (not a multisite instance)
Is that possible? I've been searching for a mod or plug in, but haven't had any luck.
Any help or suggestions would be massively appreciated. | s3://commoncrawl/crawl-data/CC-MAIN-2016-30/segments/1469257826736.89/warc/CC-MAIN-20160723071026-00192-ip-10-185-27-174.ec2.internal.warc.gz | CC-MAIN-2016-30 | 324 | 3 |
http://nicolaiherzog.de/ | code | my name is nicolai herzog. unfortunately my website is not finished yet. but i am working on it as good as i can. the release is gonna be in the end 2015. if you want to contact me, you can do this with
if you want to take a look at my current portfolio
or my CV
i would recommend you to click on it. | s3://commoncrawl/crawl-data/CC-MAIN-2016-44/segments/1476988719139.8/warc/CC-MAIN-20161020183839-00047-ip-10-171-6-4.ec2.internal.warc.gz | CC-MAIN-2016-44 | 300 | 4 |
https://www.lyndhurst07071.com/forums/topic/where-to-purchase-pamelor-germany-pamelor-receita-azul-ou/ | code | - This topic is empty.
July 2, 2021 at 9:59 am #3729kokGuest
Where To Purchase Pamelor Germany ?, Pamelor receita azul ou branca
What can be better than being sure that the drugs you buy are effective and of high quality!
Save 10% off at our trusted pharmacy! Save your money and time!
Random Internet Quotes:
Including cost savings, to buy steroids for the location you. We pride ourselves on google plus new drugs online no prescription drug, any influence. Drug chemistry and ventura counties. New drugs online pet prescriptions, generic drugs. History will use to pharmnord brand, in the alliance for any other information useful: drowsiness, 2018 at multiple causes nausea and established an academic affiliation with your pet’s fur can use to co-ordinate refills and has contacted online pharmacy practice nurses for children, cutting or have them. Taking steroids should be ineffective in person. Glucosamine plays a convenient home setup where appliances and devices can be a pediatric research. Diverge from us at this kind of everything from us news purchase we classified the conference venue. But my god has pamelor and people are there are exceptions. Click here, she wants to august, this site has pamelor receita azul ou branca. That’s a mexican physician for persons buying on-line while morphine and pamelor and its accompanying seal of new buyers into direct consultation with us on your pet from an example of the overwhelming volume of your factory? Trips to protect herself-and her family-from … | s3://commoncrawl/crawl-data/CC-MAIN-2021-39/segments/1631780057036.89/warc/CC-MAIN-20210920101029-20210920131029-00472.warc.gz | CC-MAIN-2021-39 | 1,522 | 7 |
http://sourceforge.net/mailarchive/forum.php?forum_name=webware-discuss&max_rows=25&style=nested&viewmonth=200309&viewday=11 | code | Two things. First, Webware's sessions tracking is based on a session id
that can be stored in a cookie or in a URL parameter. The IP address of
the client is not involved in session tracking.
Secondly, you can create your own persisitent cookies if you like, but
there's no technical reason why that state can't be stored on the
server. For example, most shopping cart contents are kept server side
these days, whereas in the early days of cookies, cookies were seen as a
good place to put that kind of information.
>>> probably does not matter.
> Why? Does Webware provide some other form of session to session persistence?
> If so, what about users on dialup and/or other connections which change IP? | s3://commoncrawl/crawl-data/CC-MAIN-2013-48/segments/1386163051516/warc/CC-MAIN-20131204131731-00072-ip-10-33-133-15.ec2.internal.warc.gz | CC-MAIN-2013-48 | 702 | 11 |
https://newmicrosoft.com/microsofts-new-year-gift-to-developers-unlimited-free-private-repositories-for-all/ | code | Developers were worried when Microsoft acquired GitHub. Some of them even switched to it’s competitors like GitLab or Bitbucket. But since then a lot of things have changed. The Company has shipped over 125 improvements to GitHub, including many of the top-requested features and today’s announcement solidifies our belief that GitHub is in safe hands.
In a blog post, Github CEO Nat Friedman announced that developers can now host as many private coding projects they want for free with up to three contributors. This is huge.
As you can see in the above image, the free plan will have all the pro features except “Unlimited collaborators” and “Advanced code review tools”. If you feel the Pro plan has no significance anymore, then think again because some pretty cool stuff will be coming to Pro users later this year
- Starting today, Github free tire will include unlimited private repositories. Developers can use GitHub for their private projects with up to three collaborators per repository for free. Public repositories are still free and include unlimited collaborators.
- Github Enterprise combines GitHub Business Cloud and GitHub Enterprise plans to create a single unified product for Enterprise Cloud. Organizations that want the flexibility to use GitHub in a cloud or self-hosted configuration can now access both at one per-seat price. And with GitHub Connect, these products can be securely linked, providing a hybrid option so developers can work seamlessly across both environments.
- GitHub Pro (formerly GitHub Developer) and GitHub Team are also available for developers and teams who need professional coding and collaboration features. And of course, open source contributors will still have everything they need to collaborate on public repositories, including our free version of GitHub Team.
Source: GitHub Blog | s3://commoncrawl/crawl-data/CC-MAIN-2019-13/segments/1552912201455.20/warc/CC-MAIN-20190318152343-20190318174343-00366.warc.gz | CC-MAIN-2019-13 | 1,853 | 7 |
http://www.downloadery.com/most/parsergenerator/ | code | Analysis and transformation of texts (even in the free version): multiple replacements of words, evaluation of extracted data, conversion and much more. Projects can be tested step by step. Ready projects can be applied to single texts interactively. The integrated transformation manager transforms arbitrary groups of files, e.g. whole directories. Parsers also can be exported as c++ code.
See also: regular expression, translation, conversion, text, transformation, debugger, scanner, parser, text processing, programming, interpreter, parsergenerator, parser generator, regular expressions, reengineering, refactoring, boost | s3://commoncrawl/crawl-data/CC-MAIN-2015-06/segments/1422115860277.59/warc/CC-MAIN-20150124161100-00157-ip-10-180-212-252.ec2.internal.warc.gz | CC-MAIN-2015-06 | 629 | 2 |
https://www.sembly.ai/api/ | code | Introducing Sembly API for best-in-class professional speech-to-text and conversational analytics.
Use Sembly API to extract summaries and meaning from conversations: automatically detect topics, actions, issues, risks, requirements, and more!
Our AI engine is tailored to understand business conversations specifically, providing best-in-class results for business-related and professional meeting content.
Sembly’s AI-powered speech-to-text engine provides a highly accurate transcription of both native and non-native English speakers, regardless of surrounding noise.
Additionally, Sembly offers speaker diarization (speaker separation) and Voice ID.
Automatic extraction of key moments from conversations, such as topics, action items, issues, risks, requirements, and more!
Strong focus on privacy and security that scales to any size organization.
Extract key takeaways from your records with the power of AI
Enables analysis of support conversations
Optimize meeting productivity with AI summaries, topics, and key items identification
Automated and indexed transcripts for any podcast
Analyze conversation sentiment, performance on empathy, behavior, and competencies during interviews
Integrate and deploy conversation intelligence solutions for your business
Simplified captioning and transcription for audios
REV.AI API Language support English Multiple Multiple English Speaker diarization – Audio & text summarization – – – Actions, issues, risks, and requirements identification – – – Integration time Up to 1 hour 1-2 days 1-2 days 2-4 hours Sentiment analysis – – –
Leave your email to obtain early access to Sembly APIRequest Early Access | s3://commoncrawl/crawl-data/CC-MAIN-2022-27/segments/1656104676086.90/warc/CC-MAIN-20220706182237-20220706212237-00777.warc.gz | CC-MAIN-2022-27 | 1,678 | 16 |
https://answers.sap.com/questions/1582618/connection-between-b1-and-bi2004s.html | code | I would like to know how to connect between B1 and BI(2004s).
Before BW=<35, there are 3 ways, they are 1)File, 2)DB connect, 3)Business connector.
Now, which way is the recommendation? I think DB connect is better, but I only know about BW=<35. And I am afraid it is changed drastically after 2004s.(for example layout of the views are changed..)
And I have heard B1i is used for connecting B1 and other SAP solution. is it the best to use this? | s3://commoncrawl/crawl-data/CC-MAIN-2023-14/segments/1679296949701.0/warc/CC-MAIN-20230401032604-20230401062604-00452.warc.gz | CC-MAIN-2023-14 | 446 | 4 |
https://community.magento.com/t5/Magento-2-x-Technical-Issues/Clicking-on-the-category-is-opening-search-for-terms/td-p/480950 | code | Clicking on the category is opening search for terms.
I created a category in the root menu with two products inside, it won't be visible in the menu, it's just to work as a link. But if I put the category link in the browser, for example ''https://example.com/categoryname.html'', the site does a search for the words that are in the category name. I tried to make it visible in the menu menu and click on it to see if the link would open, but it still searches the terms. How do I do it the right way? | s3://commoncrawl/crawl-data/CC-MAIN-2022-33/segments/1659882573145.32/warc/CC-MAIN-20220818003501-20220818033501-00318.warc.gz | CC-MAIN-2022-33 | 503 | 2 |
https://www.raspberrypi.hackster.io/kaushikts/intruder-alert-using-bolt-iot-and-arduino-54a84b | code | Its system that alerts the user if an intruder tries breach his/her home. The device is placed near the door, while you are going out you should power on the device using a switch, which can be present outside and only known to you or your family members. when an intruder open the door, this motion is determined by HC SR04 ultrosonic distance sensor. With the help of Bolt Iot and arduino the buzzer is made on and alert message is sent to users . Bolt Wi-Fi module communicates with arduino through serial communication. So now the user can complain to local police and necessary bodies . And here is the demo videoHARDWARE SETUP
You can setup the circuit as shown in fritzing schematics.
The Arduino code linked below measure the distance using HC SR04 Ultrasonic distance sensor and sends it to Bolt Wi-Fi module over serial communication.
Before writing the python code you need to install bolt iot module. Which can be done by writing (python pip install bolt iot) in windows power shell if you are using it through windows OS.
This code queries the Bolt cloud for distance using the Bolt python library. Then it checks the threshold distance. In case if distance value is less than threshold, an SMS alert is sent using Twilio SMS service.
Alert message received to my phone | s3://commoncrawl/crawl-data/CC-MAIN-2020-34/segments/1596439739134.49/warc/CC-MAIN-20200814011517-20200814041517-00300.warc.gz | CC-MAIN-2020-34 | 1,282 | 6 |
https://www.fr.freelancer.com/projects/php-website-design/something-like-buddypress/ | code | I want someone to build a site for me something like buddypress, but not advanced to make it more than one database
3 freelance ont fait une offre moyenne de 567 $ pour ce travail
I have more than 2 years experience in website design, php site developement.I have 4 members team in my hand. All team mates have more than 2 years experience. Can you explain the whole concept of your concept.. | s3://commoncrawl/crawl-data/CC-MAIN-2017-47/segments/1510934806708.81/warc/CC-MAIN-20171122233044-20171123013044-00322.warc.gz | CC-MAIN-2017-47 | 392 | 3 |
https://write.as/maxgross/ | code | Software is about actions
I remember learning about object-oriented programming in some of my earliest computer science and programming classes.
To me, the paradigm of OOP is a simple and alluring one: A business application is often filled with things. Users. Emails. Network sockets. These are nouns, and actions happen with them. It makes so much sense to abstract them as
email.send(), doesn’t it?
If only it were that simple.
The more that my day-to-day work has been software engineering, the more that I’m convinced that object-oriented programming has gotten it all wrong. Software programs are not about things; software programs are about actions.
An accountant does not open Excel for the spreadsheet, but to perform calculations. A dog owner does not open the camera app for the images, but to take photos.
Even the stuff closer to the metal is about actions:
grep is about searching, not text.
git is about change tracking, not files. The x86-64 instruction set is literally a set of actions.
With that in mind, I have been increasingly struggling to think of situations where object-oriented programming would make sense in a day-to-day basis.
Maybe a monolith, so an instantiated object will always remain available in memory? Or in a utility package, as a form of encapsulation, so the implementation details are hidden from external users? | s3://commoncrawl/crawl-data/CC-MAIN-2024-18/segments/1712296816832.57/warc/CC-MAIN-20240413180040-20240413210040-00009.warc.gz | CC-MAIN-2024-18 | 1,360 | 12 |
https://tf2maps.net/threads/pl_goldrush-vid-pre-release.3053/ | code | Stumbled across this vid on youtube. Thought it was interesting seeing the things that have changed. It seems this would have been released before the map itself. [ame="http://www.youtube.com/watch?v=9Kj4WgFqLVY"]YouTube - New Team Fortress 2 Gameplay Mode/Map - Gold Rush[/ame] Also it's probably a good point to ammatuer level designers. If something doesn't work or feel right. Change it. A lot of the time in my past if something didn't work i didn't want to change things because of the amount of time i had spent on a given area or something etc etc. You shouldn't be afraid to revise what you have. | s3://commoncrawl/crawl-data/CC-MAIN-2020-24/segments/1590347435238.60/warc/CC-MAIN-20200603144014-20200603174014-00254.warc.gz | CC-MAIN-2020-24 | 605 | 1 |
http://tex.stackexchange.com/users/7217/alex | code | Apparently, this user prefers to keep an air of mystery about them.
23 How can I use a table generated by R in LaTeX? Aug 12 '11
6 Automating LaTeX tables with specifications from R Aug 19 '11
1 Why are some columns truncated in my table output? Aug 15 '11 | s3://commoncrawl/crawl-data/CC-MAIN-2016-30/segments/1469257829320.70/warc/CC-MAIN-20160723071029-00222-ip-10-185-27-174.ec2.internal.warc.gz | CC-MAIN-2016-30 | 256 | 4 |
https://iamdeepak.com/category/family/ | code | On last count Google Play store has an approximate 2 million Android Apps listed there. Apple store has another million… and million other app stores have millions more. But I have always wondered how does the app developer feel when he completes an app and uploads it to the app store. What sort of accomplishment do they feel? Is there a background story behind that app, or was it just cos of professional contract?
I got the opportunity to experience all these feelings in the last 10 days. I work in a Mobile Ad network as as part of the Ad Operations team. Though I delve with apps day in and day out, I am not the technical guy. I am a quasi-tech guy, who can understand what sort of discussion is going on within the Product team. One of the few advantages of working in a Product startup. I am also a person who gets intrigued with any new tech challenges. That has led me to get my own domain names, my own self-hosted WordPress blogs and so on.
Now coming back to the story, it all started when my wife went to a Reiki course. She came back and said that she wanted to practice Reiki everyday and she need a timer app for it. I checked the default apps, but they weren’t helpful and the appstore had 100’s of variations, but my wife wasn’t satisfied with any of them. She challenged me to get an app done for her specific requirement.
The requirement was, it should have a timer that counts down from 180 seconds. After every 180 second, the timer should reset. Each 180 seconds was 1 Task for her.
I was already dabbling with MIT App Inventor, initially developed by Google, but later open sourced and taken up by MIT. Since I know the basics of programming, it was easier for me to set up the logic. And the App Inventor’s WYSIWYG editor was very easy to set up the interface. After 3 hours of dabbling, I got her basic Reiki App ready. She was happy with it.
Then an idea stuck me. Why to restrict this to 180 seconds only. This sort of timer app can be used for any exercises. This is my golden opportunity to work on my full-fledged Android app. Another 4 days…and 8 hours later… I had my first prototype of Timer App. On May 30th, on my Dad’s 64thBirthday, I released the app in Google Play store.
That moment, I felt a sense of accomplishment. I was very happy the entire day. My wife’s requirement was met. I have published my first Android app. I have learnt a new semi-skill now. On last count, My app had 21 installs (in a span of 4 days) and 5 uninstalls. But, I am very happy that my app is still useful for those remaining 16 users.
P.S: There is a known issue with this app. The screen will not turn off during the usage of this app. The reason is, since this app was created using App Inventor, it won’t be kept alive in the latest smartphones that have the Doze facility. So, I had to create a workaround such that the app stays live for the entire duration of the app usage. | s3://commoncrawl/crawl-data/CC-MAIN-2024-18/segments/1712296815919.75/warc/CC-MAIN-20240412101354-20240412131354-00135.warc.gz | CC-MAIN-2024-18 | 2,923 | 8 |
https://blender.stackexchange.com/questions/263150/how-do-you-make-boolean-cuts-that-curve-around-an-object | code | I'm trying to figure out to make the cuts shown in the 3d model in the picture. I know how to make individual boolean cuts but I am unsure as to how to make the cuts curve around an object.
To mimic the cuts shown in the picture, I did the following:
- I went into edit mode and duplicated the mesh only at the locations where I wanted the cuts.
- Resized the copied mesh so when cut through the original cube it would be light cut.
- I then created the copy of the cube I wanted to cut.
- I used the bool tool difference function for the first cut on the original cube I wanted to cut.
- Then I used the bool tool intersection function on the copy of the original cube I wanted to cut. | s3://commoncrawl/crawl-data/CC-MAIN-2023-50/segments/1700679100602.36/warc/CC-MAIN-20231206162528-20231206192528-00455.warc.gz | CC-MAIN-2023-50 | 686 | 7 |
http://math.stanford.edu/~rmbellov/sags/sags-s10/bellovin0426.html | code | Good Reduction of Abelian Varieties
Given an abelian variety over a p-adic field, when is its reduction mod p again an abelian variety? I will make this question precise and then give a solution. Along the way, I will digress to talk about Neron models (without proofs). If time permits, I will discuss some further questions along these lines and some applications. The talk should be relatively accessible; the phrase "elliptic curve" can be freely substituted for "abelian variety". | s3://commoncrawl/crawl-data/CC-MAIN-2018-05/segments/1516084886939.10/warc/CC-MAIN-20180117122304-20180117142304-00626.warc.gz | CC-MAIN-2018-05 | 485 | 2 |
https://www.freelancer.hu/projects/Excel/Very-small-project-copy-paste/ | code | I have a very small task which will only take few minutes, to copy information from one page and put it on another.
Budget is only $5 as its a very quick job, maybe 5-10 minutes max.
22 szabadúszó tett átlagosan $5/óra árajánlatot erre a munkára
Hello, I am interested in your project, because i have experience with data entry, and copy paste work. Feel free to contact [login to view URL] you in advance. | s3://commoncrawl/crawl-data/CC-MAIN-2018-22/segments/1526794867254.84/warc/CC-MAIN-20180525235049-20180526015049-00242.warc.gz | CC-MAIN-2018-22 | 413 | 4 |
https://www.construct.net/en/tutorials/properly-encapsulating-project-657 | code | This is my first tutorial, so there might be some screw ups in here regarding hyperlinks, so my apologies. So yea, from what I could tell I didn't see anything talking about Encapsulating a project.
I refer to this tutorial as intermediate, because I think it's something that someone who's generally comfortable with C2 will make better sense of, but there are some important concepts here that a beginner could take from this as well.
This template also includes other things I've found very useful for a typical game including pausing. I made this stripped of all custom plugins so it "should" open for anyone, but I don't know first hand if this capx will open for you without hassle.
Disclaimer: I'm not saying this is the best / only way to do things. There are people out there way more clever at structuring and making things smarter than how I do things. I have so much more to learn about C2.
My very first serious project, I had a lot of things repeating in each event sheet because that's how I knew things would work. Mouse overs.. transitions, etc.
Lots of repeated work. It wasn't so bad when I was just making each scene, but I ran into trouble when I wanted to make some changes to things. What would I have to do if I wanted to change the mouse over or transition speeds? I'd have to go into each event sheet and update that one. It was a drag.
My second serious project though, I'd realized that I could break up things into individual event sheets and attaching those sheets the main event sheets of each scene. This second project was by far easier to manage. So I felt like this might be something that could help others. This community has been incredibly helpful to me so I hope I can continue to offer some tutorials of value in the future.
Ok now for the meat
Here is a link http://part12studios.com/games/Template/ that demonstrates what this capx attached on the left side of the screen contains. However the capx you will get is not going to look exactly the same because I made one for this tutorial that I believe makes no references to plugins I normally use like SpriteFont+ and LiteTween. I stripped them out so I hope the capx opens for you all.
So the basic idea behind encapsulation is that you group certain activities into their own space. In terms C2 this is done by creating a new event sheet. Name it appropriately.. "Monster", "Pause", "Player", "Game Management", etc..
So if we break all this code up all this code, how the heck does anything work? Well the key here is to right click on the event sheet associated with your current scene and "include event sheet". Add any / all event sheets that relate to your current scene... here's an example:
you are at your main menu scene.. called "Main Menu". you have an event sheet also called "Main Menu". You want the main menu to have rain going on in the background, but this rain effect is also see in the "Game" scene. Rather than including the events in both you make a specific Event Sheet and we'll call it "Rain".
You would right click on the "Main Menu" event sheet and add event sheet "Rain" to it. Then when the main menu runs it also includes the code from the Rain event sheet.
It's amazing once you get comfortable with the idea.. you can make your crazy event sheets become so much cleaner breaking up things. If you ever find yourself looking at more than a page of event sheets, consider encapsulation.
I love grouping variables
Another really great thing I've found that's helpful with encapsulation is to make a "Variable" event sheet that is where you put ALL of your global variables so they are all in one place. No more hunting around various event sheets to find the right event.
Deep in a game already with vars all over the place? Notice that C2 actually allows you to move a global variable to another event sheet! So it's very easy to clean things up.
About the template included
Ok so as I said before this template includes more than just a sample of encapsulation, it also covers (at least for me as of right now) the most important things.. though I just realized I left out a version number.. ok corrected... so yea I have it setup like this:
So the splash screen gives me a space to brand the game but also allows me a place to do some preloading of audio depending on the platform
Main Menu Page
the main menu just gives the game a central location to start and get to places. Level selection and other deeper features would just be new layouts the menu would point too instead of going right into the game.
This is where people can learn more about the game and who's involved. This is a great place to put credits and links to artists and musicians that might be involved especially if they are making their services free in exchange for recognition and sometimes providing links to their sites.
This is a basic game space but notice something? Its empty! Except for a few attached event sheets. have a pause system in place.. So now I can get right into making my game without a bit of prep work done for me and now i can just get into making my game.
I have a basic pause functionality (which you'll need for windows phone 8.0 apps). If you want to do that, you can just wire of the WP8 plugin back button to coincide with the various touch events already defined in here.
I'm not going to explain the pause stuff in this because there are probably other tutorials that show it better. My pause is probably not the best way to do it, but it's the best way I've found that I have figured out.
Hopefully though this template could offer you a way to speed up your game development.. I made this for myself this week after making a few recent games and realizing I'm spending time redoing the same things each time.
That's pretty much it. I'll be happy to explain more / fix anything you see that's wrong. I'll do my best to insure this information is accurate and useful to everyone. | s3://commoncrawl/crawl-data/CC-MAIN-2022-21/segments/1652662595559.80/warc/CC-MAIN-20220526004200-20220526034200-00613.warc.gz | CC-MAIN-2022-21 | 5,912 | 28 |
https://securitywatch.pcmag.com/security-software/284381-banking-trojan-defeats-2-factor-authentication | code | A report in MIT's Technology Review details how a bank account was compromised even though it required 2 factor authentication. The story is instructive.
The conventional malware threat to banking is to steal the username and password. This information is used then by the malicious third party (or whomever they sold it to) in order to steal the money of out it. But various different security systems can thwart this approach: They take note of unusual transactions from unusual locations and they can require a second factor of authentication, like a one-time password device.
Bank-heist trojans are an attractive proposition for thieves: This report claims that a gang in Ukraine bilked $6 million using the Zeus trojan, which may have been the specific malware used in the MIT article.
In the case in the MIT article, the user was using 2 factor authentication but it didn't matter. The trojan was running on the same system the user was on, so when the user authenticated then so did the trojan. It was able to perform transactions on that same system without having to know any credentials.
ZDNet's Dancho Danchev digs further into this phenomenon, citing studies on the growth of Zeus and its resistance to anti-virus. Security guru Bruce Schneier took the opportunity to restate his argument that "...two-factor authentication doesn't solve anything." This is an overstatementit surely doesn't solve everything, but it does solve a number of problems. | s3://commoncrawl/crawl-data/CC-MAIN-2019-43/segments/1570986658566.9/warc/CC-MAIN-20191015104838-20191015132338-00439.warc.gz | CC-MAIN-2019-43 | 1,460 | 5 |
https://mattes-hobbyfotografie.de/instagram-traditional-wedding-dresses.html | code | Mysql workbench postgresql plugin
- Microsoft Windows 2000/XP/2003/Vista and Windows 7, 8, 10. dbForge Studio for PostgreSQL by Devart is a GUI tool for database development and management. The IDE for PostgreSQL allows users to create, develop, and execute queries, edit and adjust the code to their requirements in a convenient and user-friendly interface.
- Data Migration. The MySQL Workbench Migration Wizard is designed to save DBA and developer time by providing visual, point and click ease of use around all phases of configuring and managing a complex migration process: Improved! Database migrations - enables migrations from Microsoft SQL Server, Microsoft Access, PostgreSQL, Sybase ASE, Sybase ...
- Oct 04, 2018 · It supports MySQL, SQL Server, PostgreSQL, Presto, Vertica, Crate, SAP HANA, and Cassandra. It is a self-hosted that you can install in your Infrastructure (VM, Container, Dedicated server e.t.c) or running in a cloud compute instance.
- This is a 64 bit version of apache mysql server Apache/2.4.20 (Win64) PHP/7.0.7 Mysql 5.5.50 phpmyadmin 4.6.2 mysql workbench 6.3 All passwords and usernames are root and root. This will work on any drive including a USB stick I have configured the apache to work with pretty permalinks' and pictures of SMF 2, wordpress, joomla, and prestashop ...
- Design. MySQL Workbench enables a DBA, developer, or data architect to visually design, model, generate, and manage databases. It includes everything a data modeler needs for creating complex ER models, forward and reverse engineering, and also delivers key features for performing difficult change management and documentation tasks that normally require much time and effort.
- MySQL Workbench. MySQL Workbench is a graphical data management tool that allows accountants, programmers, and other stakeholders to structure the data with complete configurations. It is accessible via different operating systems like Windows, Linux, and Mac OS X that let developers shape the stats via snippets and figures.
- In MySQL Workbench 5.2.26 a new query execution command is available, where query output is sent as text to the text Output tab of the SQL Editor. Some MySQL Workbench users liked the "Results to Text" option available in Microsoft SQL Server Management Studio.
- vscode-mysql: The original version of this extension. mysqldump: Data dump lib. sql-formatter Sql format lib. umy-ui: Result view render. Core Lib: node-mysql2: Mysql client. node-postgres: PostgreSql client. tedious: SqlServer client. ioredis: Redis client. vscode-sqlite: SQLite client code reference.
- Query PostgreSQL from MySQL Workbench. The steps below outline connecting to the virtual PostgreSQL database created in the SQL Gateway from MySQL Workbench and issuing basic queries to work with live PostgreSQL data. Connect to PostgreSQL through the SQL Gateway. In MySQL Workbench, click to add a new MySQL connection.
Nba 2k20 black referee
Polygamy relationship stories
Camera online unblocked
When bill and rhonda visited their local pediatrician he diagnosed easton with
MySQL provides MySQL Workbench as a GUI tool, PostgreSQL provides PgAdmin. MySQL only supports standard data types (string, numeric, date, and time) while PostgreSQL supports advanced data types such as arrays, hstore, and user-defined data types. PostgreSQL vs MySQL; Now that we know the basic features and characteristics of PostgreSQL and ...In my previous SQL for data analysis tutorial, I briefly mentioned that I prefer SQL Workbench over pgadmin4 for SQL querying.Today I will show you how you can install it too! The setup process is more or less the same on Mac, Windows and Linux, but I'll highlight the slight differences in my article - and you can always select the appropriate solutions for yourself.Jan 01, 2014 · The previous blog post showed how easy the migration via command line was for MySQL to PostgreSQL. Keep in mind though that when bringing data back to MySQL the Data Engine has to be considered. To put it simply, if you are going to bring data back into MySQL from PostgreSQL a fast option is likely the MySQL Workbench. But that is not an ...
Long distance situationship
Okta attribute mapping
Airflow rest api parameters
Tremco manufacturing locations
The voice 2020 australia
North vernon police department
Best tibetan mastiff breeders
Semi truck fleet sales
Clayton homes everest
Roller coaster builder online
Bayou tranquille for sale
Squish band calculator
North carolina mountain rifle
Kimberly johnson obituary
Big brother spoilers
Gaming mouse pad rgb
10 needle embroidery machine for sale
Scratch building ho structures
Deer head chihuahua breeders
Refrigeration training pdf | s3://commoncrawl/crawl-data/CC-MAIN-2021-49/segments/1637964360803.6/warc/CC-MAIN-20211201143545-20211201173545-00501.warc.gz | CC-MAIN-2021-49 | 4,693 | 35 |
https://bblais.github.io/posts/2019/Jan/14/dynamical-systems-with-pyndamics/ | code | What would happen if two people out in space a few meters apart, abandoned by their spacecraft, decided to wait until gravity pulled them together? My initial thought was that …
Describe dynamical systems in terms of the differential equations without having to write the coding loops or functions. Easily plot the changes in the variables, show phase plots, and vector fields. Explore examples from modeling the zombie apocalypse, the infectiousness of ideas on Twitter, or the exchange of energy in the Earth climate system. Useful for teaching dynamical systems for students with little programming experience.
Included is an interface to Bayesian MCMC with the emcee package for doing Bayesian parameter estimation and model comparison!
Blais, B.S. and Skaza, J., Modeling the Infectiousness of Twitter Hashtags. Sep 2016. Bryant University Science Seminar.
Skaza, J. and Blais, B.S., Mathematical Modeling of Trending Topics on Twitter. Apr 14, 2015. Honors Capstone Presentation.
Brian Blais, Colin Gannon, Qin Leng, Robert Patalano, Hong Yang. October 2013. Bayesian Parameter Estimation in a 1D Model of Precipitation and Evaporation: Comparison of Middle Miocene and Modern Climates Using Plant Lipid Deuterium dD Measurements Geological Society of America Conference. Some extra slides that didn't fit on the poster.
Modeling Ecosystems and Climates: A Teaching Simulator for Systems Dynamics* (Rhode Island Space Grant Consortium Annual Symposium, November 2009)
Skaza, J. and Blais, B.S. 2015. Modeling the Infectiousness of Twitter Hashtags. Physica A: Statistical Mechanics and its Applications. Volume 465, 1 January 2017, Pages 289–296.
Witkowski, C. and Blais, B.S. 2013. Bayesian analysis of epidemics - zombies, influenza, and other diseases . Available from the arXiv at http://arxiv.org/abs/1311.6376 as well as on ScienceOpen. An iPython notebook with the simulations is available here.
Mathematical models of epidemic dynamics offer significant insight into predicting and controlling infectious diseases. The dynamics of a disease model generally follow a susceptible, infected, and recovered (SIR) model, with some standard modifications. In this paper, we extend the work of Munz et.al (2009) on the application of disease dynamics to the so-called ``zombie apocalypse'', and then apply the identical methods to influenza dynamics. Unlike Munz et.al (2009), we include data taken from specific depictions of zombies in popular culture films and apply Markov Chain Monte Carlo (MCMC) methods on improved dynamical representations of the system. To demonstrate the usefulness of this approach, beyond the entertaining example, we apply the identical methodology to Google Trend data on influenza to establish infection and recovery rates. Finally, we discuss the use of the methods to explore hypothetical intervention policies regarding disease outbreaks. | s3://commoncrawl/crawl-data/CC-MAIN-2023-06/segments/1674764500384.17/warc/CC-MAIN-20230207035749-20230207065749-00488.warc.gz | CC-MAIN-2023-06 | 2,884 | 10 |
https://forum.storj.io/t/how-do-i-get-the-browser-url-of-a-file-of-which-i-know-the-bucket-address-of-via-cli/12040 | code | And is this the correct category for Tardigrade user questions?
Welcome to the forum @folaht!
Even if it is not the right category, someone from support or other regulars can categorize it properly. You can ask away your questions.
I could have been at the wrong forum for all I know.
After all, it’s the storj forum, not the tardigrade forum.
You can use the command
uplink share --url for the known path, i.e.
uplink share --url sj://mybucket/mysite/wondeful.png
You also can configure it as a static web-site with your own custom domain:
I am beginning to understand that the seemingly randomly generated URL is not so random after all and will not be changed after resharing.
Yes, it’s not random, it includes macaroons:
You can change it for the same object, if you would use a different base access grant from the satellite UI or change some permissions, for example - time-based like | s3://commoncrawl/crawl-data/CC-MAIN-2021-17/segments/1618038064520.8/warc/CC-MAIN-20210411144457-20210411174457-00128.warc.gz | CC-MAIN-2021-17 | 894 | 12 |
http://www.freedownloadscenter.com/Network_and_Internet/FTP_and_Archie_Clients/FlashFXP.html | code | This is a FTP client in Windows environment that can handle secure transfers.
FlashFXP is a FTP client for windows. The tool also supports secure transfers in the form of SFTP (Secure Shell/SSH), FTPS (Secure Socket Layer (SSL) over FTP) and seamless one time password support. FlashFXP makes publishing and maintaining websites quite easy by helping with the upload and download of files, such as documents, photos, videos, music and so on. You are able to transfer or backup local and remote files and do FXP server to server ftp transfers. That can be useful in keeping servers synchronized quite easily. Other useful features include multi-firewall and proxy support, speed limiting, server file searching, remote editing with automatic (or manual) uploading, automated transfer scheduling with email notifications, priority transfer lists, extensive file transfer rules, user customizable interface and so on. On the fly compression can speed up your transfers. The interface can be customized in any one of some 20 language options available.
The tool should be easy to use for even novice users. The layout is on the lines of the familiar Windows explorer. One of the windows shows the file arrangements on the server you are downloading from. On the receiving window, you are able to monitor detailed files available, the log window shows you the actual progress of the file transfers. The client can choose binary or ASCII mode automatically. Drag & drop of files is available. Transfers are automatically resumed if interrupted for any reason. Features that enhance the usability of the tool for webmasters include easy file management, remote editing and setting/changing of file permissions recursively. | s3://commoncrawl/crawl-data/CC-MAIN-2017-43/segments/1508187821189.10/warc/CC-MAIN-20171017125144-20171017145144-00481.warc.gz | CC-MAIN-2017-43 | 1,715 | 3 |
https://listman.redhat.com/archives/et-mgmt-tools/2007-June/001088.html | code | [et-mgmt-tools] Unable to open connection
Rob van Oostveen
rob at vanoostveen.net
Wed Jun 27 17:08:24 UTC 2007
I build virt-manager from source as well as the libvirt. When I try to run
virt-manager I get the following:
Unable to open connection to hypervisor URI 'xen':
..bunch of python lines..
I tried to run virt-manager --connect='..', but without any luck. On the
libvirt website I read about connection URIs. I tried that, but again no luck.
Can anyone give me any hints on this?
Thanks in advance.
More information about the et-mgmt-tools | s3://commoncrawl/crawl-data/CC-MAIN-2023-06/segments/1674764499891.42/warc/CC-MAIN-20230131222253-20230201012253-00245.warc.gz | CC-MAIN-2023-06 | 546 | 13 |
https://www.waldonell.com/thoughts/articles/jboss-seam-s-fileupload-and-null-data | code | However it ALWAYS returned null for noteManagement.restoreNotesData which is a byte property on the noteManagement seam component. The reason? Idiot me forgot to wrap that s:fileUpload in a separate form element declared as a multipart form:
id="restore_notes_form" enctype="multipart/form-data"> ...
After adding that, file uploads worked beautifully. Of course you still have to have this in components.xml:
<component class="org.jboss.seam.web.MultipartFilter"> <property name="createTempFiles">true</property> <property name="maxRequestSize">1000000</property> </component> | s3://commoncrawl/crawl-data/CC-MAIN-2018-09/segments/1518891812259.30/warc/CC-MAIN-20180218212626-20180218232626-00001.warc.gz | CC-MAIN-2018-09 | 577 | 4 |
https://forums.creativecow.net/docs/forums/post.php?forumid=139&postid=855737&univpostid=855737&pview=t | code | I am fairly new to InDesign, however I have picked up the basics quite quickly and I have a strong experience in programming.
One of the things I hate doing is making proposals, as I find myself repeating the same thing over and over.
So I was thinking of making a little program that asks me a series of questions, takes some defined text inputs and then saves that to a database from which an XML file is generated.
The XML file would contain the information I typed in, along with the 'options' I chose.
So for example, I will have written in the introduction as a text input, and I might have chosen three out of four pre-defined items to appear in an estimate table. I would imagine the XML something like this:
Firstly, I want to import this file into InDesign, and then have InDesign place in the data from the tags into defined sections of the document, which is the easy part I suspect.
Secondly, I wondered whether InDesign would be able to look at each node and where it exists, then it should show that section in the document (which I have already prepared). Then within each section, it should hide all items in a table that don't appear as nodes within the XML. Probably a lot harder, right?
Anyway, if somebody has some useful pointers or information I'd be really grateful. | s3://commoncrawl/crawl-data/CC-MAIN-2018-34/segments/1534221215404.70/warc/CC-MAIN-20180819224020-20180820004020-00328.warc.gz | CC-MAIN-2018-34 | 1,290 | 8 |
https://jamyco.com/latest-biafra-news-friday-august-30th-2019/ | code | Good Morning, Nigeria, welcome to Jamyco roundup of Biafra news headlines for today Friday, August 30th, 2019.
1. Biafra: Why IPOB Will Not Let Buhari Leave Japan – Nnamdi Kanu
The leader of the Indigenous People of Biafra (IPOB), Nnamdi Kanu, has claimed that members of his group have encircled and trapped President Muhammadu Buhari in a Yokohama hotel in Japan. Naija News had earlier reported that President Buhari travelled out of Nigeria to Japan to participate in the Seventh Tokyo International Conference on African Development (TICAD7) holding in the City of Yokohama, August 28-30, 2019.
2. Biafra: Attack Me Abroad, Rotimi Amaechi Dares Nnamdi Kanu, IPOB (Video)
Rotimi Amaechi, the Minister of Transportation, has dared members of the outlawed Indigenous People of Biafra (IPOB) led by Nnamdi Kanu, to attack him abroad. Naija News reports that Amaechi made this comment in reaction to claims that politicians in Nigeria are afraid of traveling abroad after the attack on a former Deputy Senate President, Ike Ekweremadu, by IPOB members.
3. Biafra: Nigerians Abroad Issues Strong Warning Against IPOB, Nnamdi Kanu
The Nigerians in Diaspora Monitoring Group (NDMG) has warned Nigerians to avoid Nnamdi Kanu and members of his outlawed Indigenous People of Biafra (IPOB). Speaking at a press conference at the Enish Restaurant, Finchley, London on Wednesday, the group said IPOB activities outside the shores of Nigeria needed concerted efforts by all critical stakeholders to protect the image of the country. | s3://commoncrawl/crawl-data/CC-MAIN-2020-29/segments/1593655897168.4/warc/CC-MAIN-20200714145953-20200714175953-00458.warc.gz | CC-MAIN-2020-29 | 1,525 | 7 |
https://blog.unity.com/engine-platform/creative-scripting-for-timeline | code | Timeline is a powerful tool for creating cutscenes and short movies. But there’s more to it! Let’s see how we can leverage Timeline to blend gameplay and storytelling, bringing our game to the next level.
With the release of 2017.1, Unity added a new and powerful tool to its arsenal: Timeline. You have probably seen at this point how creators have leveraged Timeline to create incredible short movies, like Neil Blomkamp’s Adam Episode 2 and 3 or Unity’s own Book of the Dead, or to add storytelling to their games.
This all sounds very exciting, but as a game developer, the question that I asked myself when I saw Timeline was: is it really just a linear sequencing tool? Can I only create cutscenes with it? Interrupt the gameplay, play a non-interactive sequence that advances the story, and resume gameplay?
With this question in mind, I created a small demo to use Timeline in a creative way. I made a little Real-Time Strategy game, in which I used some custom Timeline tracks to achieve a couple of interesting effects. And I found the answer to my question (spoiler): with a little bit of scripting, Timeline can do so much more.
Let’s start with a simple scenario. Let’s say I want the Timeline to incorporate a dialogue, and I want it to stop automatically to allow the viewer to read the text on screen. When the Spacebar is pressed, the Timeline resumes.
Since this functionality goes hand in hand with the text on the screen, I created a custom track called Dialogue Track that hooks into the UI Manager of my game. Each clip has as properties the text to display, and a simple boolean to decide whether to stop or not. This is the Inspector of the clip:
Each clip on this track tells the UI Manager to display the dialogue UI, what text, and what size to use. Additionally, it can tell the GameManager to stop the Timeline and passes a reference to which one, so the GameManager - once Spacebar is pressed - knows which Timeline to resume. When the clip ends, it tells the UI Manager to hide the dialogue box.
Pretty simple stuff, but it allows me to quickly build dialogues and decide when to stop, or not! (notice that the dialogue where Andy screams “Oi!” doesn’t stop, because it’s non-important text). Here’s how the Timeline looks like:
What if I want to rewind the Timeline? Not at the end (that would be easy: just set it to loop!) but at any arbitrary point, and only when a specific condition is verified. This basically allows for non-linear Timelines: sometimes they go back, sometimes they don’t. You can almost imagine them as if they contained an if-else statement.
In this example, I have created a Timeline that animates a storm: the sunlight dims, flashes appear in the sky, lightning strikes hit the ground, and rain start falling down.
I didn’t just create the storm as one continuous sequence, but I envisioned it as three parts. At the beginning, there’s the “transition in”, while the end has a “transition out” to normal weather. In the middle, I left a section of the Timeline which will play during gameplay. Notice there are no Cinemachine clips, so Timeline gives control back to the regular gameplay camera.
I want the storm to go on as long as those two little monsters are alive. I want Timeline to play the intro, play the gameplay part, and just before hitting the outro, I want it to evaluate a condition: are those two little monster dead? If no, rewind the gameplay part and keep playing. If yes, just play the outro.
Enter the Time Machine Track. Clips here can have two functions. One is to act as named markers (see the first clip), the other is to rewind or fast-forward the Timeline to a specific Marker or time. Let’s call this the “action” of the clip.
The other important property of the clips is the “condition”. It can be always, never (basically muting the clip), or if a group of units is dead. Notice how if the two monster are alive, the Timeline rewinds:
While if they are dead, it just goes on without interruption, playing the outro:
A note: This “is-dead” condition is very specific to my game, but you can come up with something new for your own specific needs, by plugging into the gameplay logic. Has the player reached a certain point? Has the player collected enough of a specific resource? The possibilities are endless!
Now for the result:
The storm starts, then gameplay resumes and the storm goes on, rewinding a couple of times. As you can see, it’s a seamless rewind. Then, once the monsters are defeated - after a couple of seconds - the storm ends and gameplay resumes again.
This is where things get exciting. Until now, we have put our animation on the Timeline. But what if we could defer this animation to some other system in our game? In my little RTS Demo, I have one very important system that’s active all the time: the game AI. This system is responsible of moving units around (by virtue of the NavMesh Agent), of controlling their Animator components and having the the units play the right animations at the right time: walking, idle, attack, or die.
So, say now I want to choreograph a big battle. I have two ways to do it: one is to create dozens of tracks, one for each unit, and then add hundreds of little animation clips: attack, move, attack, move again, attack again, and then die. All of these need to be adjusted in time, and some offset needs to be applied if I want them to match in space. All in all, it’s a lot of work.
The other way is what I did with my AI Command track: this scripted track takes a special type in the binding, that I called “Platoon”. The Platoon is nothing else than a small script with an array of units. When you send a command to the Platoon script, it “broadcasts” the command to all of the units in its array. I actually use it for the selection in the game, creating a Platoon with the selected units to issue mouse commands.
Back to the Timeline. By binding a Platoon to the AI Command track, I’m able to create clips that represent one command: move there and stand still, move there and guard, attack this specific unit, or even… die on the spot! When the Timeline is played, the units belonging to that Platoon will listen to these commands which will take precedence over whatever they were doing before, resulting in the ability to sequence commands on the AI on the Timeline.
Add in a few camera shots (using Cinemachine, of course!), and you have a big battle with dozens of units using just 3-4 AI Command tracks:
Let’s see the result:
I hope to have sparked your curiosity and creativity with this post. Next time you look at Timeline, think: what could I do with it? Create a Quick-Time-Event system? Orchestrate entire battles? Plan the bullet patterns in a Bullet Hell shooter? (I’m seriously thinking of doing it)
There’s so much you can do with Timeline, a little creativity, and some scripting. I would personally love to hear what you come up with here in the comments or on Twitter. Get creating! | s3://commoncrawl/crawl-data/CC-MAIN-2024-18/segments/1712296817491.77/warc/CC-MAIN-20240420060257-20240420090257-00133.warc.gz | CC-MAIN-2024-18 | 7,027 | 26 |
https://helpsarkari.com/download-security-software-for-windows-mac-android/ | code | I’m an electronics engineer, avid writer, and tech-enthusiast specializing in troubleshooting computer-related issues. I enjoy reading both fiction and non-fiction in diverse genres.
- AVG driver updater has a good reputation for making trustworthy code.
- It throws me a ‘failed to load start load kernel modules’ and freeze with no ability to go to tty or anything.
- Click the icon at the bottom right of Driver Booster interface, COPY & PASTE your license code into the box, and click the icon at the right side.
Disable button now visible in the bottom-right of the window. This will disable the application from launching when you start your device. System File Checker is a tool available in Windows 10 by default. It’s also called an “SFC scan,” and it’s your quickest way to automatically fix corrupted system files and other issues. Keeping your operating system up to date is extremely important.
The Options For Immediate Programs For Driver Updater
Windows 10 keeps installing the latest driver software for it rather then the version that I manually installed. Intel DSA identifies your adapter and updates your driver to the latest version, if needed. Find the name of the wireless adapter manufacturer in Device Manager. Try being as close as possible from the router/wireless access point. This process is not possible for many applications, but running some programs without properly installing them is possible. If this is the case for you, don’t forget to navigate to their location using the file explorer and delete such apps if you don’t need them any longer. You can use Save for Web to export your images as 24-bit transparent PNG files and upload them to TinyPNG.
Select the printer that you’ve connected from the list of available devices. If you have any questions about using a printer with your Cricut machine, consult the user manual for your specific model. You can also contact Cricut customer support for more assistance. First, you will need to ensure that the printer you choose is compatible with your Cricut model. You should also check whether it requires any particular paper or settings in order to work correctly.
Increase Free Space of System Drive
Now, select the operating system that you are currently accessing and then download Epson printer drivers. Not only the Epson drivers, but all the software drivers need to be updated frequently to avoid the issues. But, effectively, we are here to teach you about how you can download Epson printer drivers for Windows. You can also find the printer driver in the windows update and install the same. Insert installation CD and run the printer set up application (usually “setup.exe”), which will install the printer drivers. In-Operating System (In-OS) – Basic, print-only driver included in the Windows 7 operating system to provide limited print software features.
Consult this list for Windows 7 driver support intel hd graphics 530 drivers for HP Laser printers. Consult this list for Windows 7 driver support for HP Inkjet printers. Consult this list for Windows 7 driver support for HP ENVY Photo printers. Consult this list for Windows 7 driver support for HP ENVY printers. Consult this list for Windows 7 driver support for HP Deskjet printers. Consult this list for Windows 7 driver support for HP AMP printers. | s3://commoncrawl/crawl-data/CC-MAIN-2022-49/segments/1669446710710.91/warc/CC-MAIN-20221129164449-20221129194449-00686.warc.gz | CC-MAIN-2022-49 | 3,340 | 11 |
https://smarthome.exposed/about-this-web/ | code | I NEVER THOUGHT I WILL EVER DO THIS THING
Maybe you'll change the way you think about smart homes.
ABOUT THIS SITE
Back in 2014 when I started building my own new house I was eager to get as much information and tips as possible to help me find out the best ways how to implement smart home infrastructure. One of the key resources for me that time was the official Loxone forum.
However on September 4th 2015 Loxone community forum has been closed, which was by far the biggest mistake they made in my opinion. Since then the Loxone community is spread across many locations. In the meantime, many of my friends that started to go the same smarthome journey ended up asking me questions for things I already sorted out.
I'd like to use this site to share some of my stories with tips and tricks to help others with their own implementation. I hope you'll find it useful. | s3://commoncrawl/crawl-data/CC-MAIN-2024-18/segments/1712296819273.90/warc/CC-MAIN-20240424112049-20240424142049-00085.warc.gz | CC-MAIN-2024-18 | 871 | 6 |
https://www.generationgenius.com/engineering-design-process-reading-material-grades-6-8/ | code | The engineering design process is a series of steps used by engineers to guide the creative process of solving problems. The number of steps may vary as well as the order in which they are used. However, there are three main phases of the engineering design process: define the problem, develop ideas, and optimize the design solution.
To better understand the engineering design process…
LET’S BREAK IT DOWN!
Engineering Design Process
The engineering design process is a series of steps that engineers follow to help guide the process of coming up with a solution to a problem. Many versions of the engineering design process can be found online. Some have only six steps while others might have up to 19 steps! However, all of these versions of the engineering design processes have three main phases in common.
The first phase is defining the problem. This is when engineers figure out the exact requirements for the problem they are trying to solve. During the second phase, engineers develop possible solutions. This phase may consist of brainstorming, sketching, modeling, testing of materials, interviewing experts, or doing anything that can help inspire ideas for a possible design solution. During the third phase, engineers optimize the design solution by testing and improving their design until it has met all the design requirements. Although there are three main phases, engineers will jump around and repeat steps of these phases as necessary. The process is considered iterative because steps are repeated and not necessarily used in a linear order.
Defining the Problem
In the first phase of the engineering design process, engineers are either given a problem to work on or they observe the natural and designed world around them to figure out a problem that needs to be solved. Engineers are often trying to improve problems in our society, such as how to reduce pollution or how to make a machine to help doctors perform surgery. However, some engineers are asked to solve problems like how to make a race car move faster! The field of engineering is very broad, and engineers try to solve many different types of problems.
When engineers begin the process of solving a problem, they need to clearly understand the criteria and constraints of the design solution. Criteria are the requirements needed to be met in order for the design idea to be considered a success. Constraints are the limitations that are placed on the design idea, such as how much it costs to build, the materials that can be used, or the time allowed to finish the project. The criteria and constraints are used to not only guide the engineering design process but also evaluate competing design ideas and overall success of the design solution.
Brainstorming and Research
During the second phase of the engineering design process, engineers begin to develop ideas for possible design solutions. A significant amount of time is spent brainstorming. Brainstorming can happen both individually and collaboratively in a group. Brainstorming is an informal, creative process used to generate ideas. Engineers often sketch and label diagrams and take notes about ideas that could be used for the design solution. All ideas are documented, but none of them are judged during brainstorming. It is all about getting the ideas on paper!
Research is generally done after brainstorming to see if any of the ideas documented can be enhanced or have already been developed. Research is when engineers use online or print resources, test materials, and interview experts or users of a product to gain more information about the problem they are trying to solve. Engineers will often go back and forth between brainstorming and research.
Developing Possible Solutions
After engineers have brainstormed and researched, they begin to more fully develop one or more design solutions. Sometimes a model is drawn with labels explaining the inputs, outputs, and flow of energy within the system they are developing. Sometimes a three-dimensional computer-aided design (CAD) model is developed that shows how the parts of the system move and interact with one another. These models are used to choose the best idea, which usually leads to the building of a prototype.
Optimizing the Design Solution
A prototype is a first, or preliminary, model that is built to demonstrate and test the functionality of a design solution. Engineers will perform tests and collect data on how well the design solution meets the criteria and constraints. These data are analyzed and used to develop new ideas to help improve the design. This is the third phase of the engineering design process during which engineers will repeatedly test and improve their design solutions in order to optimize the test results. | s3://commoncrawl/crawl-data/CC-MAIN-2022-21/segments/1652663011588.83/warc/CC-MAIN-20220528000300-20220528030300-00391.warc.gz | CC-MAIN-2022-21 | 4,771 | 16 |
http://www.meducator.net/?q=content/objectives | code | mEducator aims to
- identify and collect a critical mass of different types of health educational material such as:
- conventional educational content types: lecture notes, books, lecture presentations, exam questions, practices, scientific papers, graphs, images/videos, algorithms and simulators
- educational content types unique in medical education: teaching files, virtual patients, evidence based medicine forms, objective standard clinical examinations, clinical guidelines, anatomical atlases, electronic traces of images, etc
- alternative educational content types: active learning techniques and problem/case based learning sessions via web 2.0 technologies, serious games (2D/3D), web traces, wikis, blogs/discussion forums, etc.
- examine to what extend existing standards like Healthcare LOM can address all types of health educational material listed above, and make respective recommendations for standards extensions.
- examine to what extend existing standards like SCORM for Healthcare are adequate to support the packaging and seamless delivery of all these types of educational material.
- examine possible extensions of existing ontological schemata, which describe the semantics of LOs (e.g. s-LOM ontology).
- communicate and interact with standardization bodies like MedBiquitous Europe, IEEE, IMS, CEN, Health On the Net, HL7, etc to ensure adoption of recommendations/extensions into standards.
In order to derive best practices for medical educational content re-use and sharing, the mEducator BPN needs a critical mass of medical educational content types (rather than items), representing various educational approaches (e.g. conventional teaching, active learning, e-learning and blended learning, etc), various audiences, various languages and various cultures.
Key transferable outcomes of the mEducator BPN include:
- A metadata scheme for description of all types of medical educational content, with reference to relevant standards (i.e. Healthcare LOM).
- Recommendations on how to apply and/or extend the medical educational standard Healthcare LOM to address variable types of medical content, content re-purposing, and content sharing and exchange
- Recommendations on best practices in implementing and using standardized commonplace technology and respective reference models for content medical educational content use, re-use and sharing.
- Medical educational content of a vast variety of types, formally described, re-purposed and delivered along existing standards in loosely coupled isolated LCMSs and in federated LCMSs of the partners.
- A simple IPR scheme for educational content provided and re-purposed in academic networks. | s3://commoncrawl/crawl-data/CC-MAIN-2017-13/segments/1490218191444.45/warc/CC-MAIN-20170322212951-00329-ip-10-233-31-227.ec2.internal.warc.gz | CC-MAIN-2017-13 | 2,679 | 16 |
https://artofhacking.com/tucops3/files/unsorted/s/live/aoh_b1a-1055.htm | code | CVE-2010-1454: SpringSource tc Server unauthenticated remote access to JMX interface
SpringSource, a division of VMware
tc Server Runtime 6.0.19.A, 6.0.20.A, 6.0.20.B, 6.0.20.C, 6.0.25.A
A problem has been identified in the com.springsource.tcserver.serviceability.rmi.JmxSocketListener. If the listener is configured to use an encrypted password ( i.e. the password is prefaced with s2enc:// ) then entering either the correct password or an empty string will allow authenticated access to the JMX interface. The JMX interface is not remotely accessible by default but may be configured for remote access by setting the address attribute.
All users are recommended to immediately switch to non-encrypted passwords for the JMX interface or to disable the JMX interface.
Users wishing to continue to use the JMX interface with encrypted passwords should upgrade the tc Server Runtime to 6.0.20.D or 6.0.25.A-SR01 (included in tc Server 2.0.0.SR01) available from the SpringSource support portal (for customers with support contracts) or the SpringSource download centre.
This vulnerability was discovered by Erhan Baz at Yapi Kredi.
SpringSource Security Team | s3://commoncrawl/crawl-data/CC-MAIN-2024-18/segments/1712296819273.90/warc/CC-MAIN-20240424112049-20240424142049-00009.warc.gz | CC-MAIN-2024-18 | 1,158 | 8 |
https://howtocatchsmallmouthbass.com/ultra-clear-backwater-creek-smallmouth-bed-fishing-underwater-fish-catch/ | code | Danglin Smallies on Beds!
Location: Angostura Reservoir
Follow me on Instagram/ @ryan.lamontagne
Hope you all enjoyed the video! Make sure to hit that LIKE button for me and SUBSCIBE if your new to the channel so you never miss out on my new videos!
Shop my NEW MERCH Here!
Drop a Comment! | s3://commoncrawl/crawl-data/CC-MAIN-2021-43/segments/1634323585321.65/warc/CC-MAIN-20211020121220-20211020151220-00571.warc.gz | CC-MAIN-2021-43 | 289 | 6 |
https://digitalhumanitiesseminar.ua.edu/blog/2015/03/30/databases-doc-or-not/ | code | After reading the two slide shows, I think I’m more confused about databases than when I began. I had always thought of a database the way it’s described in the second set of slides: sort of like spreadsheets where one doesn’t see the whole sheet at once and only pulls out the records needed for a particular task (the difference between databases and spreadsheets being that databases can interact with one another). In the first slide show, however, Quamen seems to view databases as pure data, not as documents, since he says both “documents and databases” can co-exist. Is a database sort of like Plato’s ideal solids, in that it doesn’t physically exist anywhere as a document? Is the spreadsheet comparison just a way for us humans to give a structure to something that is really only bits of data scattered over a server?
In the second slide show, the description of a database as “a high-quality representation of the real world” muddied the waters further for me. How can a collection of data represent the real world at “high quality”? To use the example database, a table of information listing species of birds could, I suppose, literally represent real birds, but I don’t see this representation as being high quality, or really anything above rudimentary. The table doesn’t even stand in for actual individual birds, just species. Likewise, the table of data about club members could be said to represent them, but a person’s name and phone number is such a tiny fraction of who s/he is, I take issue with it being either a high-quality or a real-world representation. I suppose I’m just arguing semantics, as I am when I question whether or not a database is a document or not. And I guess the answer doesn’t really matter as long as I understand how databases work, which I do.
Data culture privileges queries and treats answers as if they are ephemeral.
This quote reminded me of the part of The Hitchhiker’s Guide to the Galaxy where, after millions of years of computation, the supercomputer Deep Thought calculated the answer to the question of the meaning of life: 42. It wasn’t until after Deep Thought announced the answer that anyone realized they’d forgotten to ask him what the question was.
Maybe the question is “Are databases documents or not?”
Yeah, after reading this I’m even more confused than I was before. Are databases like Shrodinger’s Cat? Do they cease existing once we think of them in a certain way? Do databases operate by quantum rules wherein they appear differently under observation?
I, too, don’t regard data as a ‘high-quality representation,’ almost as an improvement upon the necessary deformations of reality. Interestingly, this is getting into the debate between nominalism and realism and the measure of meaning in semiotics. I am probably wrong in assuming that the PowerPoint even slightly suggests attributing a hierarchy of meaning to database, but the relative meaning-ness or authenticity concerning image, print, and data might be an interesting discussion to have. Famously, the Positivists of the early 20th Cent. claimed that nothing is worth saying if it isn’t scientifically verifiable. Does the selection that Susanna chose imply that print has a tendency toward nonsense? Do we understand data to be an accurate representation of reality or more informative than reality?
I think the “understanding” that I presented in my post is not necessarily true, because now that I read some others I feel that its not quite right. I like the references to Schrodinger’s cat though, Matt, and I’ll raise you “this is not a pipe.” It seems that some of what you are questioning is the role of representation and its relationship to whatever it describes out there. I think many people live under the assumption that if we had calculus advanced enough we could calculate the world out there. I am inclined to agree with this, but the calculation itself is a representation to some extent, and if it isn’t then isn’t it just the map from the Borges tale–a map so detailed that its indistinguishable from the world it maps. I have no answers, but I think you both hit on something both fascinating and puzzling.
To answer your first set of questions, Susanna, it’s my understanding that a database does, as you put it, exist as a document rather than just as scattered bits of data. A database is a set of interrelated tables, and the Excel workbook: database / Excel spreadsheet: table analogy seems to be a close one. | s3://commoncrawl/crawl-data/CC-MAIN-2023-14/segments/1679296943750.71/warc/CC-MAIN-20230322051607-20230322081607-00543.warc.gz | CC-MAIN-2023-14 | 4,548 | 9 |
https://structureresearch.net/2019/09/13/sunevision-iadvantage-reports-fy19-results-building-on-position-in-hk/ | code | SUNeVision iAdvantage reports FY19 results; building on position in HK
SUNeVision reported its FY19 results ending June 30, 2019. The results pointed to a growing data centre business in Hong Kong as it continues to acquire land at premium prices for new data centre development.
// added by JK:
// calculate if the user is able to see the pdf or not.
$requiredSubscription = (array)get_post_meta(get_the_ID(),'_required_capabilities', true);
$showPdf = !$requiredSubscription || (class_exists('swishu') && swishu::has_access_to_content(wp_get_single_post($_GET['id']))) || is_user_logged_in(); | s3://commoncrawl/crawl-data/CC-MAIN-2020-24/segments/1590347396163.18/warc/CC-MAIN-20200527204212-20200527234212-00045.warc.gz | CC-MAIN-2020-24 | 594 | 6 |
https://www.experts-exchange.com/questions/22085930/Listbox-Problem-Why-does-my-ListBox-reset-the-values-on-a-TabControl-SelectedIndex-Change.html | code | I've got a Form with a TabControl. On the second tab, I have a ListBox with the selection mode set to MultiSimple. When I load the form, the SelectedIndexChanged event of the Tab Control gets called before the Form Load does. I have no idea why that is. I load up my values from my DB in the Form Load event, but when I select the second tab, the values of that ListBox and what is supposed to be selected are lost. It goes back to selecting the first value, which it does by default. Again, I have no idea why. So to fix that, I ended up loading up the values of that ListBox from the DB on that SelectedIndexChanged event of the Tab Control. Which works fine (so everytime that specific tab is selected, it loads the correct values), but if someone changes the values and then goes to a different tab, once they go back to that tab, all of those values they just selected are gone. Of course, since my SelectedIndexChanged event was tripped again and it reloaded the values from the DB.
Is this a bug in the .NET Framework? Or am I doing something wrong? None of the other controls act this way. They all load up fine and don't change their values based on a Tab Control SelectedIndexChanged event. What am I doing wrong? Is there something I'm not setting somewhere?
If this truly is a bug, how can I get around this? I want the values to load up properly and also keep them selected in that Listbox if the tabs change. Any ideas? | s3://commoncrawl/crawl-data/CC-MAIN-2021-43/segments/1634323585522.78/warc/CC-MAIN-20211022212051-20211023002051-00573.warc.gz | CC-MAIN-2021-43 | 1,433 | 3 |
https://thestartuppitch.com/pitches/pitch-for-pill-identifier-pro-and-drug-info/ | code | Company / App Name: Pill Identifier Pro and Drug Info
What does it do?
Pill Identifier Pro and Drug Info is a utility app which provides all the drug information approved by FDA in United States. Pill Identifier tool helps to identify a pill by its name, color, shape and imprint. Disease search. BMI Calculator
Why do we need it?
If you have a loose drug at home and you are not able to recall what it was for, then use
our Pill Identifier Pro tool to get the details of the pill/medication. You can identify a pill by
simply entering its Shape, Color and Imprint.
Who is it for?
This app is mainly built for USA citizen as the drugs in the app approved by FDA. But the BMI calculator, Disease search can be used by all over the world.
What makes it stand out from the crowd?
This app provides information about,
Any Pill by its color, shape and imprint
FDA approved drug details
Drug recall news
And also that app allows you to store the drug information in My Meds section.
We are working continuously to improve the features in the app. Also we are planning to incorporate pill reminder tool and other utility tools in the app to make it more helpful to the users. | s3://commoncrawl/crawl-data/CC-MAIN-2019-04/segments/1547584518983.95/warc/CC-MAIN-20190124035411-20190124061411-00228.warc.gz | CC-MAIN-2019-04 | 1,168 | 16 |
https://johnjaret.com/ | code | John Jaret is an actor.
You may have seen John Jaret on television, but probably not.
As you can see, John Jaret is kind of a tool.
Sometimes, even the greatest television shows will cast a mediocre actor, like John Jaret.
See John Jaret play Someone Else in this ad for the Rhode Island Blood Center.
Look at John Jaret's dumb face slinging chicken. Normally he just slings mediocrity.
See John Jaret play Someone Else working hard. This is a stretch for John Jaret. John Jaret is lazy.
This one has great insight into John Jaret's relationships with children. Children tend to abuse John Jaret.
See John Jaret wear a gorilla mask. This might be his most tolerable work.
This is John Jaret's "travel vlog" where he recites Wikipedia.
See John Jaret play Someone Else reading a 'Thank You' card. John Jaret does not send nor receive 'Thank You' cards.
John Jaret directed a film. For people like John Jaret, figuring out how to turn on a camera is considered a success.
...the crap is this?
If you're feeling guilty for having a great day while there's so much suffering in the world, check this one out. | s3://commoncrawl/crawl-data/CC-MAIN-2020-45/segments/1603107893402.83/warc/CC-MAIN-20201027052750-20201027082750-00013.warc.gz | CC-MAIN-2020-45 | 1,104 | 14 |
http://web2.sys-con.com/node/2442627 | code | |By Marketwired .||
|November 13, 2012 07:15 AM EST||
DALLAS, TX -- (Marketwire) -- 11/13/12 -- Phytel, the leader in automated, provider-led population health improvement, announced today that Orlando Health, one of Florida's most comprehensive private, not-for-profit healthcare networks, has selected Phytel's Atmosphere suite of Web-based population health management tools as a critical component of its strategy to build new healthcare delivery models. All of the primary care physicians in the 400-doctor Orlando Health Physician Group will use Phytel's Outreach, Insight, and Coordinate modules to ensure that every patient receives the most appropriate intervention and follow-up care. Additionally, Orlando Health will introduce Phytel Transition to improve post-discharge care coordination and reduce preventable readmissions.
Rick Schooler, Vice President and Chief Information Officer of Orlando Health and winner of the prestigious CHIME/HIMSS John E. Gall, Jr. CIO of The Year award, commented, "Of all the systems we've invested in as an organization or are considering adopting, nothing is currently more critical to our strategy of being able to effectuate population health, improve quality, and lower cost than Phytel. The fact that Phytel has already integrated its solution with many of the leading EHRs is also important, because it would mean private practice physicians in any accountable care organization we may form would have access to Phytel's vital reports on patient care gaps. Overall, I've been encouraged by Phytel's successful implementations at other complex health systems."
Orlando Health has pursued numerous strategies to adjust to the fast-evolving value-based system of health, which rewards providers commensurate with the quality of care they deliver. To succeed in a value-based environment, Orlando Health's leaders realized they needed population health and care management tools that went far beyond the capabilities offered by their electronic health record (EHR). After an extensive search by administrators, IT staff, and physicians, Orlando Health chose Phytel because it offered the best combination of field-tested solutions that fit clinician workflows, patient engagement tools, and integration. That integration was especially important because Orlando Health is affiliated with hundreds of community physicians who use a variety of EHRs from different vendors and who may at some point join the health system in forming an ACO.
In selecting Phytel for population health, Orlando Health was particularly encouraged by the recognition of Phytel by the National Committee on Quality Assurance (NCQA), which credentials PCMHs. Moreover, the health system's leaders recognized that Phytel could enable an ACO to quickly scale up its population health management efforts.
"It's going to be absolutely critical to our success as a value-based organization, and potentially an ACO, that we have a product like Phytel to help us manage our population's health," said Jennifer Endicott, Vice President of Clinical Integrations for Orlando Health. "Phytel's care management tools have a seamless end-user interface that makes them easy for clinicians to use. And, unlike the other solutions we looked at, Phytel includes a well-thought-out patient engagement piece that fits right into our patient portal. Its solution is also well-designed to help us obtain recognition of patient-centered medical homes, because aspects of NCQA's criteria are integrated into Phytel's product."
Phytel also plans to integrate its web-based solution with Orlando Health's health information exchange and patient portal platforms, enabling physicians and patients to conveniently access information pertinent to their respective needs and priorities. Both Phytel and Orlando Health believe this integration is vital to support streamlined provider workflows as well as effective engagement of patients.
Steve Schelhammer, CEO of Phytel, said, "Orlando Health's decision to adopt Phytel's complete solution across their entire organization is a strong signal of confidence in our company and our ability to implement at scale and on time. We are committed to helping Orlando Health -- one of the premier healthcare systems in the country -- gain patient-centered medical home recognition and build a successful accountable care organization. With the assistance of our user-friendly care coordination tools, expertise in patient engagement, and knowledge of population health management, we're confident that Orlando Health will achieve its goals."
The premier company empowering physician-led population health improvement, Phytel provides physicians with proven technology to deliver timely, coordinated care to their patients. Phytel's state-of-the-art registry, which now encompasses more than 25 million patients nationwide, uses evidence-based chronic and preventive care protocols to identify and notify patients due for service, while tracking compliance and measuring quality and financial results. For more information, please visit www.phytel.com. Follow us on Twitter and find us on Facebook.
About Orlando Health
Orlando Health is a $1.9 billion not-for-profit health care organization and a community-based network of hospitals and care centers throughout Central Florida. The organization, which includes the area's only Level One Trauma Centers for adults and pediatrics, is a statutory teaching hospital system that offers both specialty and community hospitals. They are: Orlando Regional Medical Center; Arnold Palmer Hospital for Children; Winnie Palmer Hospital for Women & Babies; Dr. P. Phillips Hospital; South Seminole Hospital; Health Central Hospital, South Lake Hospital (50 percent affiliation); St. Cloud Regional Medical Center (20 percent affiliation), and MD Anderson Cancer Center Orlando -- the first affiliate of one of the nation's premier cancer centers, The University of Texas MD Anderson Cancer Center in Houston. In all, Orlando Health serves 1.6 million Central Florida residents and nearly 3,000 international patients annually. More information can be found at www.orlandohealth.com.
Companies can harness IoT and predictive analytics to sustain business continuity; predict and manage site performance during emergencies; minimize expensive reactive maintenance; and forecast equipment and maintenance budgets and expenditures. Providing cost-effective, uninterrupted service is challenging, particularly for organizations with geographically dispersed operations.
Feb. 12, 2016 06:00 PM EST
SYS-CON Events announced today that Interoute, owner-operator of one of Europe's largest networks and a global cloud services platform, has been named “Bronze Sponsor” of SYS-CON's 18th Cloud Expo, which will take place on June 7-9, 2015 at the Javits Center in New York, New York. Interoute is the owner-operator of one of Europe's largest networks and a global cloud services platform which encompasses 12 data centers, 14 virtual data centers and 31 colocation centers, with connections to 195 ad...
Feb. 12, 2016 04:15 PM EST Reads: 425
Join us at Cloud Expo | @ThingsExpo 2016 – June 7-9 at the Javits Center in New York City and November 1-3 at the Santa Clara Convention Center in Santa Clara, CA – and deliver your unique message in a way that is striking and unforgettable by taking advantage of SYS-CON's unmatched high-impact, result-driven event / media packages.
Feb. 12, 2016 03:00 PM EST
SYS-CON Events announced today that Commvault, a global leader in enterprise data protection and information management, has been named “Bronze Sponsor” of SYS-CON's 18th International Cloud Expo, which will take place on June 7–9, 2016, at the Javits Center in New York City, NY, and the 19th International Cloud Expo, which will take place on November 1–3, 2016, at the Santa Clara Convention Center in Santa Clara, CA. Commvault is a leading provider of data protection and information management...
Feb. 12, 2016 02:15 PM EST Reads: 449
There will be new vendors providing applications, middleware, and connected devices to support the thriving IoT ecosystem. This essentially means that electronic device manufacturers will also be in the software business. Many will be new to building embedded software or robust software. This creates an increased importance on software quality, particularly within the Industrial Internet of Things where business-critical applications are becoming dependent on products controlled by software. Qua...
Feb. 12, 2016 02:15 PM EST
With an estimated 50 billion devices connected to the Internet by 2020, several industries will begin to expand their capabilities for retaining end point data at the edge to better utilize the range of data types and sheer volume of M2M data generated by the Internet of Things. In his session at @ThingsExpo, Don DeLoach, CEO and President of Infobright, will discuss the infrastructures businesses will need to implement to handle this explosion of data by providing specific use cases for filte...
Feb. 12, 2016 01:00 PM EST Reads: 229
SYS-CON Events announced today that Pythian, a global IT services company specializing in helping companies adopt disruptive technologies to optimize revenue-generating systems, has been named “Bronze Sponsor” of SYS-CON's 18th Cloud Expo, which will take place on June 7-9, 2015 at the Javits Center in New York, New York. Founded in 1997, Pythian is a global IT services company that helps companies compete by adopting disruptive technologies such as cloud, Big Data, advanced analytics, and DevO...
Feb. 12, 2016 12:30 PM EST Reads: 263
SYS-CON Events announced today that Avere Systems, a leading provider of enterprise storage for the hybrid cloud, will exhibit at SYS-CON's 18th International Cloud Expo®, which will take place on June 7-9, 2016, at the Javits Center in New York City, NY. Avere delivers a more modern architectural approach to storage that doesn’t require the overprovisioning of storage capacity to achieve performance, overspending on expensive storage media for inactive data or the overbuilding of data centers ...
Feb. 12, 2016 12:30 PM EST Reads: 108
SYS-CON Events announced today that Alert Logic, Inc., the leading provider of Security-as-a-Service solutions for the cloud, will exhibit at SYS-CON's 18th International Cloud Expo®, which will take place on June 7-9, 2016, at the Javits Center in New York City, NY. Alert Logic, Inc., provides Security-as-a-Service for on-premises, cloud, and hybrid infrastructures, delivering deep security insight and continuous protection for customers at a lower cost than traditional security solutions. Ful...
Feb. 12, 2016 11:45 AM EST Reads: 453
Fortunately, meaningful and tangible business cases for IoT are plentiful in a broad array of industries and vertical markets. These range from simple warranty cost reduction for capital intensive assets, to minimizing downtime for vital business tools, to creating feedback loops improving product design, to improving and enhancing enterprise customer experiences. All of these business cases, which will be briefly explored in this session, hinge on cost effectively extracting relevant data from ...
Feb. 12, 2016 11:15 AM EST Reads: 141
SYS-CON Events announced today that iDevices®, the preeminent brand in the connected home industry, will exhibit at SYS-CON's 18th International Cloud Expo®, which will take place on June 7-9, 2016, at the Javits Center in New York City, NY. iDevices, the preeminent brand in the connected home industry, has a growing line of HomeKit-enabled products available at the largest retailers worldwide. Through the “Designed with iDevices” co-development program and its custom-built IoT Cloud Infrastruc...
Feb. 12, 2016 10:00 AM EST Reads: 133
As enterprises work to take advantage of Big Data technologies, they frequently become distracted by product-level decisions. In most new Big Data builds this approach is completely counter-productive: it presupposes tools that may not be a fit for development teams, forces IT to take on the burden of evaluating and maintaining unfamiliar technology, and represents a major up-front expense. In his session at @BigDataExpo at @ThingsExpo, Andrew Warfield, CTO and Co-Founder of Coho Data, will dis...
Feb. 12, 2016 09:30 AM EST Reads: 217
The Quantified Economy represents the total global addressable market (TAM) for IoT that, according to a recent IDC report, will grow to an unprecedented $1.3 trillion by 2019. With this the third wave of the Internet-global proliferation of connected devices, appliances and sensors is poised to take off in 2016. In his session at @ThingsExpo, David McLauchlan, CEO and co-founder of Buddy Platform, will discuss how the ability to access and analyze the massive volume of streaming data from mil...
Feb. 12, 2016 09:00 AM EST
WebSocket is effectively a persistent and fat pipe that is compatible with a standard web infrastructure; a "TCP for the Web." If you think of WebSocket in this light, there are other more hugely interesting applications of WebSocket than just simply sending data to a browser. In his session at 18th Cloud Expo, Frank Greco, Director of Technology for Kaazing Corporation, will compare other modern web connectivity methods such as HTTP/2, HTTP Streaming, Server-Sent Events and new W3C event APIs ...
Feb. 12, 2016 09:00 AM EST
SYS-CON Events announced today that Men & Mice, the leading global provider of DNS, DHCP and IP address management overlay solutions, will exhibit at SYS-CON's 18th International Cloud Expo®, which will take place on June 7-9, 2016, at the Javits Center in New York City, NY. The Men & Mice Suite overlay solution is already known for its powerful application in heterogeneous operating environments, enabling enterprises to scale without fuss. Building on a solid range of diverse platform support,...
Feb. 12, 2016 06:00 AM EST Reads: 255
Eighty percent of a data scientist’s time is spent gathering and cleaning up data, and 80% of all data is unstructured and almost never analyzed. Cognitive computing, in combination with Big Data, is changing the equation by creating data reservoirs and using natural language processing to enable analysis of unstructured data sources. This is impacting every aspect of the analytics profession from how data is mined (and by whom) to how it is delivered. This is not some futuristic vision: it's ha...
Feb. 12, 2016 05:45 AM EST Reads: 463
Silver Spring Networks, Inc. (NYSE: SSNI) extended its Internet of Things technology platform with performance enhancements to Gen5 – its fifth generation critical infrastructure networking platform. Already delivering nearly 23 million devices on five continents as one of the leading networking providers in the market, Silver Spring announced it is doubling the maximum speed of its Gen5 network to up to 2.4 Mbps, increasing computational performance by 10x, supporting simultaneous mesh communic...
Feb. 12, 2016 05:00 AM EST
The cloud promises new levels of agility and cost-savings for Big Data, data warehousing and analytics. But it’s challenging to understand all the options – from IaaS and PaaS to newer services like HaaS (Hadoop as a Service) and BDaaS (Big Data as a Service). In her session at @BigDataExpo at @ThingsExpo, Hannah Smalltree, a director at Cazena, will provide an educational overview of emerging “as-a-service” options for Big Data in the cloud. This is critical background for IT and data profes...
Feb. 12, 2016 02:30 AM EST Reads: 235
With the Apple Watch making its way onto wrists all over the world, it’s only a matter of time before it becomes a staple in the workplace. In fact, Forrester reported that 68 percent of technology and business decision-makers characterize wearables as a top priority for 2015. Recognizing their business value early on, FinancialForce.com was the first to bring ERP to wearables, helping streamline communication across front and back office functions. In his session at @ThingsExpo, Kevin Roberts...
Feb. 12, 2016 12:45 AM EST Reads: 413
Cognitive Computing is becoming the foundation for a new generation of solutions that have the potential to transform business. Unlike traditional approaches to building solutions, a cognitive computing approach allows the data to help determine the way applications are designed. This contrasts with conventional software development that begins with defining logic based on the current way a business operates. In her session at 18th Cloud Expo, Judith S. Hurwitz, President and CEO of Hurwitz & ...
Feb. 12, 2016 12:00 AM EST Reads: 291 | s3://commoncrawl/crawl-data/CC-MAIN-2016-07/segments/1454701165484.60/warc/CC-MAIN-20160205193925-00118-ip-10-236-182-209.ec2.internal.warc.gz | CC-MAIN-2016-07 | 16,666 | 52 |
http://www.sourcecodeonline.com/details/rest_provider.html | code | REST Provider 6.x-1.0-beta1
File ID: 98340
REST Provider 6.x-1.0-beta1 Description
The REST Provider module provides a simple framework for creating RESTful web services using Drupal. It strives to be simple and unobtrusive, imposing as few constraints on developers as possible. Developers are free to create any kind of RESTful web service, not just "Drupalesque" services. This module also takes care of some of the more tedious aspects of creating a RESTful web service.
Difference From Other Drupal REST Modules
There are currently three other REST-related modules for Drupal. Here's how this module compares to those:
* REST API d-deOCL This module's purpose is to access Drupal functions through a (mostly) RESTful interface, not creating web services with Drupal.
* RESTfulness d-deOCL This module's purpose, like the REST API module, is to access Drupal functions through a RESTful interface. The module has had no releases and doesn't appear to be in active development.
* REST Server d-deOCL This module's purpose is to provide a (somewhat) RESTful implementation of the Services API. It is thus beholden to the Services module's constraints.
For documentation, please see the readme.html file in the module's folder.
Note: This module requires the pecl_http module because it relies on a couple of functions found in that library.
Initial development sponsored by pingVision.
Related: Module, restful, drupal, Creating, Services, purpose, Functions, Interface, Development, Access, Simple, Active, Server, provide, restfulness, Scripts, Provider, beta, rest provider, provider scripts
O/S:BSD, Linux, Solaris, Mac OS X
File Size: 10.0 KB
|More Similar Code|
UniDirect .NET data provider offers universal access to data of different databases for the Microsoft .NET Framework. It supports most of major database servers such as Microsoft SQL Server, Microsoft Access, Oracle, DB2, MySQL, PostgreSQL and others through OLE DB and ODBC. The provider is completely based on ADO.NET technology and can be used in the same way as the SQL Server .NET or the OLE DB .NET Data Provider. At the same time UniDirect...
SIBPROvider is a good OLE DB Provider specific for Interbase/Firebird. SIBPROvider makes possible to access Interbase through of ADO/OLEDB applications like Visual Basic, Delphi,ASP, Dreamweaver, Crystal Reports and anything that work with ADO or...
The oEmbed provider plugin makes WordPress an oEmbed provider, compliant with the XML and JSON specification at http://www.oembed.com.
oEmbed is a powerful protocol that allows sites to automatically embed content from 3rd parties...
The OpenID Provider Persona module is aiming to provide persona support to the existing OpenID Provider module for drupal. This module will not implement any of the underlying protocol but will hold all pertinent information regarding a users...
Lookup Internet Service Provider (ISP) by IP Address allows you to / visitor's geographical location. It also provides features for Display native language and currency, Redirect based on country, Digital Rights Management, Prevent password...
SQL Query Provider for Adv. Email Mgr is an ASP based .NET application through which user are allowed to create their own mail list corresponding to their SQL query in their email campaign. This tool offers various features like providing partial...
SQLXML 3.0 Managed Provider Classes is an user friendly tutorial in which author gives an idea about the procedure for utilizing SQLXML managed provider class through which users can create a customized XML documnets using the XML templates and...
Write Your Own Provider For the ASP.NET DataGrid is an interesting article which discusess about how to create custom data provider to populate datagrid control. In this article the author describes the Enumerable interface of the ADO.NET and its...
DBISAM ADO.Net Provider is a data provider designed to communicate with DBISAM Database Server by Elevate Software from an application or ASP.Net page written for the Microsoft .NET Framework. It is based on ActiveX Data Objects for the .NET...
This small recipe allows you to convert a reST text to HTML without creating a full HTML document but returning only a snippet that you can then put anywhere on a web page.
|User Review for REST Provider | s3://commoncrawl/crawl-data/CC-MAIN-2020-29/segments/1593655881763.20/warc/CC-MAIN-20200706160424-20200706190424-00579.warc.gz | CC-MAIN-2020-29 | 4,290 | 28 |
https://www.tr.freelancer.com/projects/java/jasperreport | code | Teslim sırasında ödenir
Project Title: JasperReport
The project involves creating a JasperReport that will display moderately complex data in the form of text. The layout for the report is open to interpretation, as the client is open to anything.
Skills and Experience:
- Proficiency in JasperReports
- Strong understanding of report design
- Ability to handle moderately complex data in a clear and concise manner
- Creativity and adaptability to create a visually appealing layout for the report
Proje NO: #37499999
Bu iş için 7 freelancer ortalamada ₹8371 teklif veriyor
Hi I am full stack Java developer having very strong experience in Jasper Report development.. Jasper design/ integration with Java object/database connection Let's discuss your report generation requirements...
Hello, Paresh! I am happy to bid on your project. I will perfectly complete a Jasper Report that will display moderately complex data in the form of text in 1 day, based on my strong Java, Spring Boot and AngularJS ex Daha Fazla | s3://commoncrawl/crawl-data/CC-MAIN-2024-10/segments/1707947476396.49/warc/CC-MAIN-20240303142747-20240303172747-00233.warc.gz | CC-MAIN-2024-10 | 1,022 | 12 |
http://www.siski.de/~carsten/diplomarbeit.html | code | Inter vehicle communication
After finishing my student research project with the topic Bootloader und embedded Linux Anpassungen für ein ARM9 basierendes Mikrocontrollerboard (engl. Bootloader and embedded Linux adaption to an ARM9 based microcontroller board) I'm now working on my diploma thesis. The diploma thesis will be based on the student reasearch project.
The target of my diploma thesis is making measurements of inter vehicle communication. Some work is already done in the department OMI at the university Ulm. Not only simulations by also measurements with real cars. By using model cars it should be possible to get reproduceable results in defined environments. These results can be compared with the simulations that are already done. The target is to avoid measurements in the normal road traffic because these are hardly reproduceable and require a lot of time.
The following image shows the microcontroller board mounted on the model car:
This is a new version of the microcontroller board. It has a SD card reader and some bugfixes. Additionally the board now holds 8 MiByte Flash-ROM. This way not only the Linux kernel but also the root filesystem is directly stored in flash. 3 MiByte are available for applications.
To let the car model drive around both model servos (steering and drive control) are connected to the pwm capable outputs of the microcontroller. For AT91RM9200 insider: The GPIO pins PA17 and PA19 are programmed to be peripheral function `B'. PA17 controls the steering servo, PA19 the driving servo.
To have reproducable drive ways a sensor has to be installed to measure the travelled distance. As the measurements should be done inside a building GPS cannot be used for this. My idea is to use the sensor of an optical mouse for the measurement of the travelled distance. Using the USB port of the boards it is easy to read data from the mouse. In the meantime the even better idea to read the data directly from the mouse sensor is formed. To do this the sensor chip ADNS-2610 is directly connected to the SPI interface of the AT91RM9200.
Advantage: The sensors and the model car control is so easy that the steering can be done by a very small program. No complex sensor data handling is necessary.
A WLAN card is to be plugged into the CF slot. The WLAN board is doing the communication with other vehicals or stationary AP.
This work is already done
- Writing a device driver to program the AT91RM9200 to generate the servo pulses.
- Test software to control steering and drive motor of the model car.
- Writing software to read the mouse data from the device file.
- Measurement of the original mouse optics.
- Building a connection wire to connect the microcontroller board and the model car with the model car battery.
- Measurement of the new mouse optics to check the focussing of the new optics. I used some software from http://sprite.student.utwente.nl/~jeroen/projects/mouseeye/ for a first start. In the meantime the software is completly rewritten to get the data via the SPI interface from the AT91RM9200 CPU.
- Write software for the ARM9 board that reads the X-/Y- data from the mouse sensor.
- Integrate software that reads sensor data into the model car control software.
- Make measurements using the moving model car.
- Finish writing the diplom thesis (the paper work).
The next images show you the sensor board from up and downside, together with the lens. The sensor board is just mounted on the front holding plate below the foamed plastic.
The next image shows you how the sensor sees the "ground" if one drives over the USAF-1951 test chart. | s3://commoncrawl/crawl-data/CC-MAIN-2017-22/segments/1495463607369.90/warc/CC-MAIN-20170523045144-20170523065144-00198.warc.gz | CC-MAIN-2017-22 | 3,615 | 22 |
https://www.wgt.com/forums/t/570564.aspx?PageIndex=4 | code | You were on a months probation and during that time you played about 4 club competitions. You didn't play with any other members and you didn't try to participate in the club.
I messaged you pointing these things out but still nothing changed !!!.
I'm sorry if you didn't agree with my decision but to me why join a club if your not going to join in.
If you want to do your own thing that's fine that's up to you, but why ask to join a club if you don't want to mix in ?.
My advice would be to anybody that is thinking of joining a club check it out first. Read the club advert on here if they have one, check the clubs own page find out how active the members are. Write to the owner asking about the club to find out if it suites your needs before you join.
My club is all about people having fun with the other people in it so if that's not what you want then please don't join. | s3://commoncrawl/crawl-data/CC-MAIN-2020-40/segments/1600400196999.30/warc/CC-MAIN-20200920062737-20200920092737-00389.warc.gz | CC-MAIN-2020-40 | 881 | 6 |
https://www.laurenwinkler.com/resume | code | With experience in UX design and software engineering, my passion is for creating digital solutions that lead to intuitive interactions. I'm driven by my lifelong love of design and tech, paired with a desire to help others.Download PDF
Learn and practice a wide range of UX methods and concepts, taking a idea through the design process from problem definition to high fidelity prototype.
Developer on team owning the Web UI and APIs behind Capital One’s implementation of Zelle, a money movement platform
Developer for a machine learning platform that enables real-time decisions by ingesting and streaming massive quantities of data
Developer on an agile team creating APIs for the acquisition of new credit card accounts
Developer on a team producing a flexible enterprise page layout tool that can assign custom attribution to page content | s3://commoncrawl/crawl-data/CC-MAIN-2020-34/segments/1596439737238.53/warc/CC-MAIN-20200808021257-20200808051257-00417.warc.gz | CC-MAIN-2020-34 | 846 | 6 |
http://www.copyquery.com/merging-multiple-child-managed-object-contexts/ | code | In my iOS application, I am attempting to sync core data with a web back end. I want to use a separate background managed object context for the sync so I can keep my main context free to accept changes from the ui while the sync is processing. Both contexts are children of my write-to-disk context as per this blog post http://www.cocoanetics.com/2012/07/multi-context-coredata/.
My question is, how can I merge both children contexts before I save to disk?
If I subscribe to contextDidSaveNotifications, I can merge the contexts using
but according to the documentation…
“This method refreshes any objects which have been updated in the other context, faults in any newly-inserted objects, and invokes deleteObject:: on those which have been deleted.”
I don’t want to refresh the updated objects and lose changes made to the mainContext, but rather merge both change sets.
I am new to multi-context core data, so I may be thinking of this in the wrong way. | s3://commoncrawl/crawl-data/CC-MAIN-2015-35/segments/1440645371566.90/warc/CC-MAIN-20150827031611-00236-ip-10-171-96-226.ec2.internal.warc.gz | CC-MAIN-2015-35 | 967 | 7 |
https://www.dominopoint.it/dominopoint/dominopoint_blog.nsf/dx/rilasciato_lotus_symphony_1_3 | code | Vi ricordiamo che Lotus Symphony è lo strumento Office di IBM gratuito multipiattaforma.
Provare non costa nulla.
Molte le novità fra cui evidenziamo il supporto all'importazione di documenti Office 2007, ai fogli protetti, alle tabelle pivot, ai widgets, alle transizioni PowerPoint e le nuove api DOM per documneti e fogli elettronici.
- Enabled Microsoft® Office 2007 files import support.
- Significant enhancements in DataPilot in spreadsheets, including show/hide field items panel, drill down to details, DataPilot cache support, and default styles.
- Numbering enhancement in documents to improve interoperability with Microsoft Word.
- Enabled Microsoft Office and IBM Lotus SmartSuite® password protection support for spreadsheets.
- Enabled network URI access and hyperlink support that allows you to create network connection hyperlinks for URI protocols including FTP, MailTo, and SMB.
- Enabled envelope support which allows you to create an envelope, set envelope properties, and set printing options.
- Enabled Widgets Catalog server support.
- Improved print performance.
- Enabled Sumproduct's ForceArray formula support in spreadsheets.
- Significant start-up performance improvement on Mac OS X.
- In presentations, page layout is more visible by locating the Properties sidebar in the right panel.
- Provided better animation effects interoperability with Microsoft PowerPoint on font-relative effects, fade-exit effects, and multiple motion paths; and enabled the animation play at automatic page transitions.
- Provided an automatic cursor in presentation screen shows as a default option.
- Presentation pages can be deleted continuously without any prompt.
- Provided new graphic bullets and clip art.
- Provided enhanced color pallette in color picker.
- Enhancements in live text.
- Enabled support that allows you to open a file by dragging and dropping a file to the home page or the New.
- A continuous improvement in mail merge in documents.
- Default font is changed to Arial in presentations and documents.
- Enlarged the pull-down list length upper limit to 20 items to make more options visible.
- Enabled Ctrl+left Shift and Ctrl+right Shift hotkey support to switch BIDI layout.
- Enhanced toolbar and main menu usability.
- Provided rich Lotus Symphony document model APIs for Spreadsheets and Documents.
- Enhanced help content for spreadsheets, common, and preferences topics.
- Added drag-to-install function in the Plug-ins section.
- Added support for multiple downloads and enabled Atom feeds for clip art and templates in the Gallery section.
- Expanded search function for the Forum.
- Rotated announcements on the Home page.
Nessun Commento Trovato | s3://commoncrawl/crawl-data/CC-MAIN-2023-14/segments/1679296944452.97/warc/CC-MAIN-20230322211955-20230323001955-00235.warc.gz | CC-MAIN-2023-14 | 2,699 | 33 |
http://stackoverflow.com/questions/8083464/using-factory-girl-within-a-rake-task-getting-uninitialized-constant | code | I'm trying to use Factory Girl in a rake task like this:
require 'factory_girl' require File.expand_path("spec/factories.rb") namespace :users do desc "Create sample users for use in development" task :create_sample_users => :environment do Factory(:user, :email => "firstname.lastname@example.org") Factory(:approved_user, :email => "email@example.com") end end
However when I run
rake users:create_sample_users I get the error
uninitialized constant Entry (Entry is the name of one of my app's classes).
Can anyone tell me how to get Factory girl to see my classes? It's working fine in my tests, just failing in my rake tasks. | s3://commoncrawl/crawl-data/CC-MAIN-2014-52/segments/1418802775338.41/warc/CC-MAIN-20141217075255-00145-ip-10-231-17-201.ec2.internal.warc.gz | CC-MAIN-2014-52 | 629 | 6 |
http://visualcsharptutorials.com/ | code | Welcome to Visual C# Tutorials
Visual C# is a great programming language. It is one of the languages supported by the .NET Framework developed by Microsoft. You can use C# to create different kinds of application such as desktop and web applications. Your imagination is the limit.
Start learning this language here at this site by reading our easy to follow C# tutorials and lessons. This site contains tutorials about the basics of C#, how to create Windows Forms, connecting to databases, and many more. The tutorials and lessons also aim to teach you the different programming concepts that you can apply not only in C#, but also in other languages as well. Start learning Visual C#! | s3://commoncrawl/crawl-data/CC-MAIN-2016-40/segments/1474738661767.35/warc/CC-MAIN-20160924173741-00283-ip-10-143-35-109.ec2.internal.warc.gz | CC-MAIN-2016-40 | 687 | 3 |
http://stackoverflow.com/users/1424780/davidgo | code | A system administrator by trade, living in a land Down Under with knowledge of network administration gleaned from years of working with niche market ISP's.
1 Is it possible to use computer name in iptables may 29 '12
1 How to solve rsync error: error in rsync protocol data stream (code 12) at io.c(600) on windows apr 9 '13
0 Why is php not running? jul 16
0 pscp command for a range of files may 30 '12
-1 File not uploading PHP may 29 '12 | s3://commoncrawl/crawl-data/CC-MAIN-2015-18/segments/1429246654687.23/warc/CC-MAIN-20150417045734-00294-ip-10-235-10-82.ec2.internal.warc.gz | CC-MAIN-2015-18 | 442 | 6 |
https://www.sqlservercentral.com/Forums/Topic1476133-1549-1.aspx | code | Some connection is using the database. This is nothing to do with cluster. Find out the connection and disconnect it. To restore a database on the existing database, it requires an exclusive lock. Since some users are using that database, SQL server fails to acquire an exclusive lock, which causes the error.
To find the session that is using the database:
select spid, status, loginame, db_name(dbid), cmd from master.sys.sysprocesses where db_name(dbid) = 'DB_NAME'
Find out the activity that is going on the database
DBCC INPUTBUFFER(<SPID NUMBER>
Disconnect the session:
KILL <SPID NUMBER> | s3://commoncrawl/crawl-data/CC-MAIN-2018-05/segments/1516084892699.72/warc/CC-MAIN-20180123211127-20180123231127-00410.warc.gz | CC-MAIN-2018-05 | 594 | 7 |
https://northreport.ca/episodes/improving-loyalty-through-consumer-psychology | code | This week North Report comes to you from the land down under! Our team was in Sydney Australia when we spoke with Philip Shelper about building the most competitive loyalty and rewards programs. He is the CEO at Loyalty & Reward Co and Author of 'Blockchain Loyalty'.
From Sydney Australia, North Report speaks with Philip Shelper; the CEO at Loyalty & Reward Co and Author of 'Blockchain Loyalty'. They speak about a variety of topics including the homogenization of loyalty designs, the importance of simplicity and studying consumer psychology to create the most effective loyalty and rewards program.
Enjoying North Report? Be sure to tag us @north_report
00:30 - Introductions
01:29 - Competitor monitoring
03:09 - Blockchain Loyalty
04:12 - Here to stay?
05:31 - Sectors Consulted
06:05 - How do they differ?
07:30 - Differentiating your program
08:59 - Human Psychology
09:23 - What are people getting wrong?
11:03 - People arent spending enough
11:32 - Why loyalty programs?
13:29 - Card Linking
14:05 - How has the space changed?
16:08 - Hyper-Personalization
16:40 - What’s in your basket?
17:53 - What would you have told yourself?
19:55 - Current Projects
21:15 - 3 Takeaways
22:53 - Outro
If you'd like to be a guest on a future episode or want to hear more about a topic, email us at firstname.lastname@example.org | s3://commoncrawl/crawl-data/CC-MAIN-2020-16/segments/1585371876625.96/warc/CC-MAIN-20200409185507-20200409220007-00206.warc.gz | CC-MAIN-2020-16 | 1,330 | 23 |
http://www.ps3news.com/forums/downloads.php?do=file&id=3536 | code | This is a new version of GTA Loader for PSP. Changes for 2.80 FW PSP users:
1) Support for v2.80 Firmware. v2.80 is still only user-mode support, and there are some minor syscalls that canít be resolved. But in general, the vast majority of user-mode homebrew works fine.
2) This release includes an experimental new way of using GTA Loader, called xLoader. xLoader allows you to run homebrew directly from the PSPís XMB menu, just like on a v1.0 PSP. Usage is a lot like Dark_AleX's HEN C, but the underlying technology is very different. Because itís experimental, and a lot of work to fix up for each firmware, itís currently only supported for v2.80 Firmware, and compatibility is a little lower than standard GTA Loader.
3) You can now use the power switch to enter suspend mode in any homebrew that normally supports suspend mode on v1.5 firmware. This works in GTA Loader on firmware 2.5-2.71, and in xLoader.
4) The built-in PSP on-screen keyboard now works in xLoader.
5) Stability and compatibility is mostly improved over v0.99, although some homebrew is less stable, especially on v2.00 firmware. You may want to keep 0.99 and 0.995 side-by-side on firmware that can run both. | s3://commoncrawl/crawl-data/CC-MAIN-2014-52/segments/1418802765093.40/warc/CC-MAIN-20141217075245-00169-ip-10-231-17-201.ec2.internal.warc.gz | CC-MAIN-2014-52 | 1,192 | 6 |
https://www.my.freelancer.com/projects/nodejs/react-gatsby-firebase-nodejs/?ngsw-bypass=&w=f | code | Pekerjaan Tidak Dijumpai
Maaf kami tidak dapat mencari pekerjaan yang anda cari.
Cari pekerjaan paling terkini di sini:
I am creating trading website so i want coonect my wordpress website with broker api
Need someone expert to implement the new design on my website. I will provide the reference site to copy the design from thanks
Our organization is hosting a conference on August 20-21 in Berlin. We need a moderator to be at the event to introduce the speakers, answer questions, and make sure the event goes smoothly. Requirements: - Fluent English - Ability to work independently - Prior event experience preferred
Estamos en busqueda de una persona con experiencia comprobada en proyectos con tecnologia blockchain y cripto monedas para el asesoramiento en la creacion y construccion de un proyecto. Se requiere que hable espanol fluido y pueda trabajar al menos 15 horas por semana
I will tell you more about the project, if you think you are able to make highly complicated erc20 smart contracts that also can interract with my website through web3. So please do not contact me if you are not experience and you have no portoflio in regards to my needs.
I need someone to create a new logo for my company brand name.
I need some graphic design. I need a designer for design sublimation T-Shirt. Design like this jersey T-Shirt
Request details My website is written in Angular(frontend) and Laravel(backend). What I need modifications for my website are CORS [ to prevent video links(using digital ocean) embedding in other websites ] Ads Integration [ in admin panel, developer need to add the section for Ads(banner, float,...etc,] VAST Ads Integration [ any kind of VAST ads will be able to advertise through video player ]
I have attached the brief below, kindly read it and get back to me and I will explain further about it
We are having an issue with our website that doesn't allow us to update Wordpress, our theme, or page builder. When we try it gives errors and shuts the whole website down. However, when we reactivate all plugins, it resets the website and it's back up. After troubleshooting and reaching out to support it seems that we need to change the PHP , increase execution time, increase max load... | s3://commoncrawl/crawl-data/CC-MAIN-2021-31/segments/1627046156141.29/warc/CC-MAIN-20210805161906-20210805191906-00462.warc.gz | CC-MAIN-2021-31 | 2,230 | 13 |
https://mattermodeling.stackexchange.com/questions/4991/how-to-calculate-and-plot-localised-orbitals-with-xtb/4993 | code | The question is similar to How to calculate/plot molecular orbitals with XTB? Hence we can produce molden files from xTB calculations, which include the molecular orbitals. How do I proceed to get localised orbitals and how would I then plot these? I am considering this as more of a visual aid that could guide further investigations or a certain narrative, than actual fact producing science. Since xTB itself is open source it would be great if there was a similar way.
You can do it with Multiwfn (http://sobereva.com/multiwfn/)
First, xTB has to be run with the
--molden directive, to output the converged molecular orbitals as a molden file. Normally xTB will produce this file with the name
Multiwfn is able to open this file. After opening, select option
Orbital Localization Analysis. You can change various settings related to the localization procedure here, including criterion of convergence, threshold for determining 1 and 2-centre LMOs, maximum number of localization cycles etc. The option
-6 selects the scheme for localization—default is
Pipek-Mezey with Mulliken population. There are also
Pipek-Mezey with Lowdin population and
Foster-Boys localization schemes available.
After changing settings (or leaving them with the default options), select option
1 to localize the occupied orbitals. (Option
2 localizes occupied and unoccupied orbitals separately). Multiwfn will now generate a file containing the localized orbitals, named
new.fch. (Which can be opened and visualized with multiwfn or other programs)
To test this, I localized the orbitals of methane after running a calculation with GFN2-xTB. It seems to have worked:
(This is one of the localized orbitals)
Note that this would only calculate the wavefunctions of the LMO's but not their energies. (If you see energies in visualisation software, they are probably wrong.) To get LMO energies, the Fock matrix also needs to be supplied to Multiwfn, and I am not sure if there is any way to do that with xTB. | s3://commoncrawl/crawl-data/CC-MAIN-2024-18/segments/1712296817729.0/warc/CC-MAIN-20240421040323-20240421070323-00862.warc.gz | CC-MAIN-2024-18 | 1,990 | 17 |
https://www.tr.freelancer.com/projects/python/need-telegram-members/?ngsw-bypass=&w=f | code | Need telegram members to be added to my group at Rs 500 for 1,00,000 members.
Bu iş için 5 freelancer ortalamada ₹780 teklif veriyor
Hi, I am a electronics and communication engineer with more than 2 years of experience but I am also a software/Program developer. The languages I use to work on are : 1. Python :- Web automation, Scraping, ML, Da Daha Fazla | s3://commoncrawl/crawl-data/CC-MAIN-2021-43/segments/1634323587794.19/warc/CC-MAIN-20211026011138-20211026041138-00389.warc.gz | CC-MAIN-2021-43 | 361 | 3 |
https://www.dailyvideo.watch/8412/ | code | This video have top 8 tasty recpies that I try collection for all of you and i hope all recipes you want to try 🙂
-Vid1- Cheesesteak Crescent Ring Full recipe: https://taste.md/2gWxkpk
-Vid2- Beer & Cheeze Pretzel Fries Full recipe: https://taste.md/2kzeGVt
-Vid3- Rainbow Unicorn Cupcakes Full recipe: https://taste.md/2k52iQv
-Vid4- Char Siu Ribs Full recipe: https://taste.md/2kqY2aD
-Vid5- Buffalo Chicken Mozzarella Sticks Full recipe: http://taste.md/2l2iGyd
-Vid6- Spaghetti Squash Fritters Full recipe: https://taste.md/2jXyuVy
-Vid7- Baked Banana Split Full recipe: https://taste.md/2iVod9C
-Vid8- The Archie Original Burger
7 oz ground pork
2 tsp dried or fresh parsley
Pinch of salt
1 tsp crushed garlic
5 oz ground chorizo
4 bacon strips
2 brioche buns, halved
4 tsp onion relish
2 slices of Swiss cheese
2 handfuls of arugula
Begin by adding the ground pork to a large mixing bowl along with the egg, parsley, salt, crushed garlic and chorizo. Mix until well combined.
Split between two patties and shape into large, round balls using the palms of your hands. Flatten balls to make patties a little bigger than the brioche buns.
Preheat a grill pan on high heat. Add patties. Lower heat to medium and cook for 4 minutes on each side.
Add bacon strips to pan and grill until crispy. Add brioche buns and lightly toast on pan.
To assemble, add onion relish to bun, and spread around a little. Add crispy bacon and pork patty, followed by Swiss cheese and arugula and top with second brioche bun.
channel subscribe : https://www.youtube.com/channel/UCjAgyTGU81vvR4JwfI7FQ0w
Facebook page : https://www.facebook.com/Best-Foods-Cakes-994689387245309/?notif_t=page_fan
twitter : https://twitter.com/BestTasty1
pinterest : https://www.pinterest.com/besttasty/
Affimity : https://affimity.com/u/BestTasty | s3://commoncrawl/crawl-data/CC-MAIN-2020-45/segments/1603107904834.82/warc/CC-MAIN-20201029154446-20201029184446-00429.warc.gz | CC-MAIN-2020-45 | 1,812 | 29 |
https://chrishardie.com/blog/tag/consumerist/page/2/ | code | I've generally been content not having a physical phone line at home and using my cell phone instead. I'm not much of a phone person anyway, my back yard looked a lot nicer when Verizon cut down the unsightly cable, and it's certainly a cost savings. But sometimes, I still long to have a regular old phone sitting on my desk that I can pick up and make a call on. Recently, for various reasons, I've been playing with having just that setup, but with a twist: my new home phone setup is run on open source software, and the conversations are carried over my broadband Internet connection.
Here's my configuration (perhaps mostly for geeks, but hopefully also for anyone who's interested): | s3://commoncrawl/crawl-data/CC-MAIN-2023-23/segments/1685224648858.14/warc/CC-MAIN-20230602204755-20230602234755-00270.warc.gz | CC-MAIN-2023-23 | 689 | 2 |
http://www.ninechime.com/forum/post.php?tid=849&qid=4432 | code | Furry stuff, oekaki stuff, and other stuff.
You are not logged in.
I've heard reports about Chibi Paint flattening layers and ShiPainter corrupting animations, which suggests that there's either something wrong with the oekaki, or there's a problem with Java's caching system. I've tried for years to track down the problem in the oekaki and have found nothing.
Would you be able to show me the picture that has the issue? If I can download the image file and layers file, I'll have a better idea of why it's not working.
Please note that ChibiPaint always asks whether to send the layers file or not every time the image is edited. If the artist says "No" to the request, the layers file will be discarded. People should always say "Yes."
It appears that my friend's layers are merged with Chibi Paint and I cannot solve it on my own, i feel so powerless x')
This is why i was using the search function on the forum :3 I've though this topic could solve the problem
The patch only works for Wax Poteto earlier than version 5.7.1. It does not work with Wacintaki because it uses the old database system.
Are you having a specific problem with Wacintaki?
I'm really sorry for bringing this topic back to the surface of the earth but, does this patch works for Wacintaki too ?
Actually I've tried but i got a database error TwT
I have an oekaki, http://nanimoko.pichusworld.net/index.php which I recently upgraded from .6.4 to the latest version.
The chibi .chi file does save to the picture folder, but upon retouch all the layers merge down.
Also, I'm not sure if this is a bug, but when I delete a picture made in chibi, it anim file does not automatically delete. Will it stay in the folder forever or does it take some time for it to be overwritten?
Thanks for your support and the fantastic wax/wacintaki software. :3 | s3://commoncrawl/crawl-data/CC-MAIN-2013-48/segments/1386164011314/warc/CC-MAIN-20131204133331-00080-ip-10-33-133-15.ec2.internal.warc.gz | CC-MAIN-2013-48 | 1,821 | 15 |
https://solrezza.net/en/encyclopedia/digital-sound-narratives/ | code | The term digital sound narratives refers to storytelling experiences that use audio as the primary medium to convey a story. It involves the use of digital technology and techniques to create immersive audio narratives that can be experienced across various platforms and devices, such as interactive media, virtual reality, augmented reality, or audio-only formats.
In digital sound narratives, audio plays a central role in shaping narrative structure, atmosphere, and emotional impact. These narratives often take advantage of spatial audio techniques and binaural audio processing to create a sense of presence and spatial immersion. By employing advanced audio technologies such as ambisonics or object-based audio, digital sound narratives can create a more immersive and realistic listening and interactive experience.
Digital sound narratives can take various forms, including interactive audio dramas, audio books, podcast dramas, location-based audio experiences, or virtual reality storytelling. | s3://commoncrawl/crawl-data/CC-MAIN-2024-10/segments/1707947473824.13/warc/CC-MAIN-20240222161802-20240222191802-00552.warc.gz | CC-MAIN-2024-10 | 1,006 | 3 |
http://timkastelle.org/blog/2010/09/chance-favours-the-connected-mind/ | code | Steven Johnson is a fantastic author, and his next book is about innovation. It is called Where Good Ideas Come From, and it comes out next month. It is the result of a few years of study, where he has investigated creative, innovative environments. He explains the key points from the book in this TED talk:
There are a few key points that are important for people trying to encourage innovation within organisations:
- Ideas are networks: Johnson maintains that innovative ideas at their most basic level are the result of new, novel connections within the mind. Just as important is the environment in which people are working. Those that regularly come into contact with people having diverse interests and viewpoints are more likely to come up with innovative ideas. Innovation = Connections – one of the key themes that we repeatedly come back to here.
- If we want to encourage innovation, we need to design workspaces to support it: this conclusion follows directly from the first point. If good ideas depend on interactions between people, we need to take a network view when we design the spaces in which we’ll work. How can we regularly interact with those that are working on different problems? How can we encourage diverse viewpoints? The physical space has a significant impact on these issues, and we need to take this into account.
- Good ideas are more likely to result from slow hunches: one of the points that Johnson makes is that even when an idea seems to come to us in a flash of inspiration, it usually actually has a longer history behind it. He uses the example of Darwin, who in his autobiography says that the idea for natural selection came to him in a flash one day while he was reading Malthus. However, recent research based on his notebooks shows that the theory had been developing for months prior to that.
Johnson closes the talk with a great story – he tells how GPS developed from the work of two guys that were initially just curious about whether or not they could track the signals from Sputnik. They figured that out. Then they figured out how to use the doppler effect to figure out where Sputnik was. And through a series of similar small steps, we ended up with GPS.
The GPS story demonstrates how ideas generate interactively, and how they can have wildly unexpected outcomes once you execute them. It is a great innovation story – and it shows how chance favours the connected mind.
Note: Here’s another video that has been made to promote the book. It is shorter than the TED video, and uses a completely different set of examples. Both are worth watching. I’m looking forward to the book! | s3://commoncrawl/crawl-data/CC-MAIN-2018-05/segments/1516084890394.46/warc/CC-MAIN-20180121080507-20180121100507-00031.warc.gz | CC-MAIN-2018-05 | 2,650 | 8 |
https://www.lawyersclubindia.com/forum/details.asp?mod_id=207273&offset=1 | code | I buyed 2 plots in my name name like ponam rekha w/o ponam suresh.
my sur name is ponam.my wife ponam rekha had sold 1 plot where she signed like "p rekha"
we are not divorsed
she changed her name to her father surname =madadi .In adhar card like "madadi rekha"
now she sold another plot bought by me in her name by signing like "madadi rekha"
Now she expired 2 months back.
Query:Can we cancel the sale deeds because of this mismatch of signs
Why you want to cheat people on your dead wife's name. You are dishonest. if she sold her plots why are you worried. You greedy fellow. File suit and spend whatever you have earned so far and burn your peace and energy,,, | s3://commoncrawl/crawl-data/CC-MAIN-2021-04/segments/1610703515235.25/warc/CC-MAIN-20210118185230-20210118215230-00561.warc.gz | CC-MAIN-2021-04 | 665 | 8 |
https://github.com/rene | code | Prevent this user from interacting with your repositories and sending you notifications.
Learn more about blocking users.
You must be logged in to block users.
Contact GitHub support about this user’s behavior.
Learn more about reporting abuse.
TempOS Project: TempOS is an educational and multi purpose Operating System
FUSE filesystem to allow symbolic links on filesystems without such support
A C library with simple API to be used as a measurement system.
A simple utility that aims to make a video stream using an icecast server and record the video on files
Renê's Gentoo overlay
A simple tool to measure system resources
Seeing something unexpected? Take a look at the
GitHub profile guide. | s3://commoncrawl/crawl-data/CC-MAIN-2021-49/segments/1637964363309.86/warc/CC-MAIN-20211206163944-20211206193944-00211.warc.gz | CC-MAIN-2021-49 | 701 | 13 |
https://bbs.csdn.net/topics/90467183 | code | Event ID: 7000
Source Service Control Manager
The DLIP Service service failed to start due to the following error:
The system cannot find the file specifed
Event ID: 4
This kerberos client received a KRB_AP_ERR_MODIFIED error from server w051$.The target name used was cifs/w088.isp0.isp.com.This indicates that the password used to encrypt the kerberos service ticket is different than that on the target server.Commonly this is due to identically named machine accounts in the target realm(isp0.isp.com)and the client realm. | s3://commoncrawl/crawl-data/CC-MAIN-2019-39/segments/1568514575751.84/warc/CC-MAIN-20190922221623-20190923003623-00462.warc.gz | CC-MAIN-2019-39 | 526 | 6 |
http://www.nvnews.net/vbulletin/showpost.php?p=1148950&postcount=4 | code | Re: Two installer bugs
That's not necessarily true - if X crashed in the middle of such a "refresh" installation or if it was run stand-alone (i.e. without a session manager), it would not recover. It's also possible that the console isn't restored correctly in this case, which would probably look just like a system crash to many users. I'm not sure I understand why X can't be shut down temporarily as part of the maintenance updates, e.g. right before the NVIDIA Linux graphics driver installation. | s3://commoncrawl/crawl-data/CC-MAIN-2015-18/segments/1430450458964.67/warc/CC-MAIN-20150501032058-00050-ip-10-235-10-82.ec2.internal.warc.gz | CC-MAIN-2015-18 | 502 | 2 |
https://www.construct.net/en/forum/construct-2/general-discussion-17/request-hotspot-positions-88954 | code | Tiled Background, 9patch, Spritefont, Text. Why all of this objects can have hotspot only on Top-Left and Center?
For many releases now I've been modifying official plugins just to get more hotspots options. And it's very annoying to do so on every new release.
Yes i know I should not modify official plugins, but for something simple like this it's just not worth for making a separate plugin.
Ashley please can you add this?
Adding all hotspot possibilities: Top-Left, Top, Top-Right, Left, Center, Right, Bottom-Left, Bottom, Bottom-Right takes about 1,5 minute for each object. There are no compatibility problems or other strange issues (some of them I've modified while working on a project, and been using it for few months now and never experience any of strange behaviors).
Don't need to tell anyone how this makes life a lot easier. | s3://commoncrawl/crawl-data/CC-MAIN-2022-33/segments/1659882573145.32/warc/CC-MAIN-20220818003501-20220818033501-00217.warc.gz | CC-MAIN-2022-33 | 843 | 6 |
https://forums.comodo.com/t/listing-registry-key-that-triggered-protected-registry-key-hips-warning/285750 | code | It is very disappointing that v6 (2013) of the neatest HIPS engine for windows now has an incredibly gimped UI. The warning “Application is attempting to write to a protected registry key” no longer displays the actual key. This makes building a complex ruleset with per key ACLs impossible and destroys so much of the power this HIPS engine had.
Please put the ability to display verbose HIPS warnings back – and allow us to generate per key / per resource ACLS.
I had to import the version 5.x ruleset to enable some of the functionality that the previous version had.
The UI is crippling for the power user and really dumbs the product down.
I would happily pay for a power version of this former functionality. | s3://commoncrawl/crawl-data/CC-MAIN-2024-18/segments/1712296817095.3/warc/CC-MAIN-20240416124708-20240416154708-00737.warc.gz | CC-MAIN-2024-18 | 720 | 5 |