CombinedText
stringlengths
4
3.42M
class ResponseObject def initialize() end end def returnJSON(text, option) json = JSON.parse( '{ "version": "1.0", "response": { "outputSpeech": { "type": "PlainText", "text": "' + text + '" }, "shouldEndSession": " ' + to_sb(option) + ' " } }') end def returnIntroduction() json = JSON.parse( '{ "version": "1.0", "session": { "new": "true" }, "response": { "outputSpeech": { "type": "PlainText", "text": "Welcome to Jedi Archives. What would you like to know?" }, "shouldEndSession": "false" } }') end def storeSessionAttribute(input, result, newSession, endSession) puts "---RESULT---" puts result json = JSON.parse( '{ "version": "1.0", "session": { "new": "' + to_sb(newSession) + '" }, "sessionAttributes": { "input": "' + input + '" }, "response": { "outputSpeech": { "type": "PlainText", "text": "' + result + '" }, "card": { "type": "Simple", "title": "Star Wars Character", "content": "' + result + '" }, "reprompt": { "outputSpeech": { "type": "PlainText", "text": "Would you like to know anything else?" } }, "shouldEndSession": "' + to_sb(endSession) + '" } }') end def storeSessionAttributeForMovie(input, result, newSession, endSession) json = JSON.parse( '{ "version": "1.0", "sessionAttributes": { "film": "' + input + '" }, "response": { "outputSpeech": { "type": "PlainText", "text": "' + result + '" }, "card": { "type": "Simple", "title": "Star Wars Movie", "content": "' + result + '" }, "reprompt": { "outputSpeech": { "type": "PlainText", "text": "Would you like to know anything else?" } }, "shouldEndSession": "false" } }') end def storeSessionAttributeForPlanet(planet, result, newSession, endSession) json = JSON.parse( '{ "version": "1.0", "sessionAttributes": { "planet": "' + planet + '" }, "response": { "outputSpeech": { "type": "PlainText", "text": "' + result + '" }, "card": { "type": "Simple", "title": "Star Wars Planet", "content": "' + result + '" }, "reprompt": { "outputSpeech": { "type": "PlainText", "text": "Would you like to know anything else?" } }, "shouldEndSession": "false" } }') end def storeSessionAttributeForStarship(starship, result, newSession, endSession) json = JSON.parse( '{ "version": "1.0", "sessionAttributes": { "starship": "' + starship + '" }, "response": { "outputSpeech": { "type": "PlainText", "text": "' + result + '" }, "card": { "type": "Simple", "title": "Star Wars Starship", "content": "' + result + '" }, "reprompt": { "outputSpeech": { "type": "PlainText", "text": "Would you like to know anything else?" } }, "shouldEndSession": "false" } }') end def startSessionAttribute(result, newSession, endSession) puts "---RESULT---" puts result json = JSON.parse( '{ "version": "1.0", "session": { "new": "' + to_sb(newSession) + '" }, "response": { "outputSpeech": { "type": "PlainText", "text": "' + result + '" }, "shouldEndSession": "' + to_sb(endSession) + '" } }') end def returnError(input, result, newSession, endSession) puts "---RESULT---" puts result json = JSON.parse( '{ "version": "1.0", "session": { "new": "' + to_sb(newSession) + '" }, "sessionAttributes": { "input": "' + input + '" }, "response": { "outputSpeech": { "type": "PlainText", "text": "' + result + '" }, "shouldEndSession": "' + to_sb(endSession) + '" }') end def to_sb(option) if option == true return 'true' else return 'false' end end Fix session class ResponseObject def initialize() end end def returnJSON(text, option) json = JSON.parse( '{ "version": "1.0", "response": { "outputSpeech": { "type": "PlainText", "text": "' + text + '" }, "shouldEndSession": " ' + to_sb(option) + ' " } }') end def returnIntroduction() json = JSON.parse( '{ "version": "1.0", "session": { "new": "true" }, "response": { "outputSpeech": { "type": "PlainText", "text": "Welcome to Jedi Archives. What would you like to know?" }, "shouldEndSession": "false" } }') end def storeSessionAttribute(input, result, newSession, endSession) puts "---RESULT---" puts result json = JSON.parse( '{ "version": "1.0", "session": { "new": "' + to_sb(newSession) + '" }, "sessionAttributes": { "input": "' + input + '" }, "response": { "outputSpeech": { "type": "PlainText", "text": "' + result + '" }, "card": { "type": "Simple", "title": "Star Wars Character", "content": "' + result + '" }, "reprompt": { "outputSpeech": { "type": "PlainText", "text": "Would you like to know anything else?" } }, "shouldEndSession": "' + to_sb(endSession) + '" } }') end def storeSessionAttributeForMovie(input, result, newSession, endSession) json = JSON.parse( '{ "version": "1.0", "sessionAttributes": { "film": "' + input + '" }, "response": { "outputSpeech": { "type": "PlainText", "text": "' + result + '" }, "card": { "type": "Simple", "title": "Star Wars Movie", "content": "' + result + '" }, "reprompt": { "outputSpeech": { "type": "PlainText", "text": "Would you like to know anything else?" } }, "shouldEndSession": "false" } }') end def storeSessionAttributeForPlanet(planet, result, newSession, endSession) json = JSON.parse( '{ "version": "1.0", "sessionAttributes": { "planet": "' + planet + '" }, "response": { "outputSpeech": { "type": "PlainText", "text": "' + result + '" }, "card": { "type": "Simple", "title": "Star Wars Planet", "content": "' + result + '" }, "reprompt": { "outputSpeech": { "type": "PlainText", "text": "Would you like to know anything else?" } }, "shouldEndSession": "false" } }') end def storeSessionAttributeForStarship(starship, result, newSession, endSession) json = JSON.parse( '{ "version": "1.0", "sessionAttributes": { "starship": "' + starship + '" }, "response": { "outputSpeech": { "type": "PlainText", "text": "' + result + '" }, "card": { "type": "Simple", "title": "Star Wars Starship", "content": "' + result + '" }, "reprompt": { "outputSpeech": { "type": "PlainText", "text": "Would you like to know anything else?" } }, "shouldEndSession": "false" } }') end def startSessionAttribute(result, newSession, endSession) puts "---RESULT---" puts result json = JSON.parse( '{ "version": "1.0", "session": { "new": "' + to_sb(newSession) + '" }, "response": { "outputSpeech": { "type": "PlainText", "text": "' + result + '" }, "shouldEndSession": "' + to_sb(endSession) + '" } }') end def returnError(result, newSession, endSession) puts "---RESULT---" puts result json = JSON.parse( '{ "version": "1.0", "response": { "outputSpeech": { "type": "PlainText", "text": "' + result + '" }, "shouldEndSession": "' + to_sb(endSession) + '" }') end def to_sb(option) if option == true return 'true' else return 'false' end end
module ReportCard class Grader attr_reader :project, :config, :scores, :old_scores def initialize(project, config) @project = project @config = config end def grade return unless ready? STDERR.puts ">> Building metrics for #{project.name}" configure generate wrapup if success? end def wrapup score notify if score_changed? end def ready? dir = Integrity::ProjectBuilder.new(project).send(:export_directory) if File.exist?(dir) Dir.chdir dir else STDERR.puts ">> Skipping, directory does not exist: #{dir}" end end def configure ENV['CC_BUILD_ARTIFACTS'] = self.output_path MetricFu::Configuration.run do |config| config.reset config.data_directory = self.archive_path config.template_class = AwesomeTemplate config.metrics = config.graphs = [:flog, :flay, :rcov, :reek, :roodi] config.rcov = { :test_files => ['test/**/*_test.rb', 'spec/**/*_spec.rb'], :rcov_opts => ["--sort coverage", "--no-html", "--text-coverage", "--no-color", "--profile", "--rails", "--include test", "--exclude /gems/,/usr/local/lib/site_ruby/1.8/,spec"]} end MetricFu.report.instance_variable_set(:@report_hash, {}) end def generate begin MetricFu.metrics.each { |metric| MetricFu.report.add(metric) } MetricFu.graphs.each { |graph| MetricFu.graph.add(graph) } MetricFu.report.save_output(MetricFu.report.to_yaml, MetricFu.base_directory, 'report.yml') MetricFu.report.save_output(MetricFu.report.to_yaml, MetricFu.data_directory, "#{Time.now.strftime("%Y%m%d")}.yml") MetricFu.report.save_templatized_report MetricFu.graph.generate @success = true rescue Exception => e STDERR.puts "Problem generating the reports: #{e}" @success = false end end def score report = YAML.load_file(File.join(MetricFu.base_directory, 'report.yml')) @scores = { :flay => report[:flay][:total_score].to_s, :flog_total => report[:flog][:total].to_s, :flog_average => report[:flog][:average].to_s, :reek => report[:reek][:matches].inject(0) { |sum, match| sum + match[:code_smells].size }.to_s, :roodi => report[:roodi][:problems].size.to_s } @scores[:rcov] = report[:rcov][:global_percent_run].to_s if report.has_key?(:rcov) if File.exist?(self.scores_path) @old_scores = YAML.load_file(self.scores_path) else FileUtils.mkdir_p(File.dirname(self.scores_path)) @old_scores = {} end File.open(self.scores_path, "w") do |f| f.write @scores.to_yaml end end def notify return if @config['skip_notification'] STDERR.puts ">> Scores differ, notifying Campfire" begin config = @project.notifiers.first.config room ||= begin options = {} options[:ssl] = true campfire = Tinder::Campfire.new(config["account"], options) campfire.login(config["user"], config["pass"]) campfire.find_room_by_name(config["room"]) end room.speak self.message room.paste self.scoreboard room.leave rescue Exception => e STDERR.puts ">> Problem connecting to Campfire: #{e}" end end def message path = @project.public ? "" : "private" "New metrics generated for #{@project.name}: #{File.join(@config['url'], path, @project.name, 'output')}" end def scoreboard scores = "" columns = "%15s%20s%20s\n" scores << sprintf(columns, "", "This Run", "Last Run") scores << sprintf(columns, "Flay Score", @scores[:flay], @old_scores[:flay]) scores << sprintf(columns, "Flog Total/Avg", "#{@scores[:flog_total]}/#{@scores[:flog_average]}", "#{@old_scores[:flog_total]}/#{@old_scores[:flog_average]}") scores << sprintf(columns, "Reek Smells", @scores[:reek], @old_scores[:reek]) scores << sprintf(columns, "Roodi Problems", @scores[:roodi], @old_scores[:roodi]) end def score_changed? self.scores != self.old_scores end def success? @success end def site_path(*dirs) site_dir = @config['site'] || File.join(File.dirname(__FILE__), "..", "..") File.expand_path(File.join(site_dir, *dirs)) end def output_path path = [@project.name] path.unshift("private") unless @project.public site_path(*path) end def scores_path site_path("scores", @project.name) end def archive_path site_path("archive", @project.name) end end end Moving the build message into #ready? so #grade is clean module ReportCard class Grader attr_reader :project, :config, :scores, :old_scores def initialize(project, config) @project = project @config = config end def grade return unless ready? configure generate wrapup if success? end def wrapup score notify if score_changed? end def ready? dir = Integrity::ProjectBuilder.new(project).send(:export_directory) if File.exist?(dir) STDERR.puts ">> Building metrics for #{project.name}" Dir.chdir dir else STDERR.puts ">> Skipping, directory does not exist: #{dir}" end end def configure ENV['CC_BUILD_ARTIFACTS'] = self.output_path MetricFu::Configuration.run do |config| config.reset config.data_directory = self.archive_path config.template_class = AwesomeTemplate config.metrics = config.graphs = [:flog, :flay, :rcov, :reek, :roodi] config.rcov = { :test_files => ['test/**/*_test.rb', 'spec/**/*_spec.rb'], :rcov_opts => ["--sort coverage", "--no-html", "--text-coverage", "--no-color", "--profile", "--rails", "--include test", "--exclude /gems/,/usr/local/lib/site_ruby/1.8/,spec"]} end MetricFu.report.instance_variable_set(:@report_hash, {}) end def generate begin MetricFu.metrics.each { |metric| MetricFu.report.add(metric) } MetricFu.graphs.each { |graph| MetricFu.graph.add(graph) } MetricFu.report.save_output(MetricFu.report.to_yaml, MetricFu.base_directory, 'report.yml') MetricFu.report.save_output(MetricFu.report.to_yaml, MetricFu.data_directory, "#{Time.now.strftime("%Y%m%d")}.yml") MetricFu.report.save_templatized_report MetricFu.graph.generate @success = true rescue Exception => e STDERR.puts "Problem generating the reports: #{e}" @success = false end end def score report = YAML.load_file(File.join(MetricFu.base_directory, 'report.yml')) @scores = { :flay => report[:flay][:total_score].to_s, :flog_total => report[:flog][:total].to_s, :flog_average => report[:flog][:average].to_s, :reek => report[:reek][:matches].inject(0) { |sum, match| sum + match[:code_smells].size }.to_s, :roodi => report[:roodi][:problems].size.to_s } @scores[:rcov] = report[:rcov][:global_percent_run].to_s if report.has_key?(:rcov) if File.exist?(self.scores_path) @old_scores = YAML.load_file(self.scores_path) else FileUtils.mkdir_p(File.dirname(self.scores_path)) @old_scores = {} end File.open(self.scores_path, "w") do |f| f.write @scores.to_yaml end end def notify return if @config['skip_notification'] STDERR.puts ">> Scores differ, notifying Campfire" begin config = @project.notifiers.first.config room ||= begin options = {} options[:ssl] = true campfire = Tinder::Campfire.new(config["account"], options) campfire.login(config["user"], config["pass"]) campfire.find_room_by_name(config["room"]) end room.speak self.message room.paste self.scoreboard room.leave rescue Exception => e STDERR.puts ">> Problem connecting to Campfire: #{e}" end end def message path = @project.public ? "" : "private" "New metrics generated for #{@project.name}: #{File.join(@config['url'], path, @project.name, 'output')}" end def scoreboard scores = "" columns = "%15s%20s%20s\n" scores << sprintf(columns, "", "This Run", "Last Run") scores << sprintf(columns, "Flay Score", @scores[:flay], @old_scores[:flay]) scores << sprintf(columns, "Flog Total/Avg", "#{@scores[:flog_total]}/#{@scores[:flog_average]}", "#{@old_scores[:flog_total]}/#{@old_scores[:flog_average]}") scores << sprintf(columns, "Reek Smells", @scores[:reek], @old_scores[:reek]) scores << sprintf(columns, "Roodi Problems", @scores[:roodi], @old_scores[:roodi]) end def score_changed? self.scores != self.old_scores end def success? @success end def site_path(*dirs) site_dir = @config['site'] || File.join(File.dirname(__FILE__), "..", "..") File.expand_path(File.join(site_dir, *dirs)) end def output_path path = [@project.name] path.unshift("private") unless @project.public site_path(*path) end def scores_path site_path("scores", @project.name) end def archive_path site_path("archive", @project.name) end end end
require "active_support/core_ext/array" require "active_support/core_ext/string" require "builder" require "representative/base" require "representative/empty" module Representative # Easily generate XML while traversing an object-graph. # class Xml < Base # Create an XML-generating Representative. The first argument should be an instance of # Builder::XmlMarkup (or something that implements it's interface). The second argument # if any, is the initial #subject of representation. # def initialize(xml_builder, subject = nil, options = {}) @xml = xml_builder super(subject, options) yield self if block_given? end # Generate an element. # # With two arguments, it generates an element with the specified text content. # # r.element :size, 42 # # => <size>42</size> # # More commonly, though, the second argument is omitted, in which case the # element content is assumed to be the named property of the current #subject. # # r.representing my_shoe do # r.element :size # end # # => <size>9</size> # # If a block is attached, nested elements can be generated. The element "value" # (whether explicitly provided, or derived from the current subject) becomes the # subject during evaluation of the block. # # r.element :book, book do # r.title # r.author # end # # => <book><title>Whatever</title><author>Whoever</author></book> # # Providing a final Hash argument specifies element attributes. # # r.element :size, :type => "integer" # # => <size type="integer">9</size> # def element(name, *args, &block) metadata = @inspector.get_metadata(current_subject, name) attributes = args.extract_options!.merge(metadata) subject_of_element = if args.empty? lambda do |subject| @inspector.get_value(current_subject, name) end else args.shift end raise ArgumentError, "too many arguments" unless args.empty? representing(subject_of_element) do content_string = content_block = nil unless current_subject.nil? if block unless block == Representative::EMPTY content_block = Proc.new do block.call(current_subject) end end else content_string = current_subject.to_s end end resolved_attributes = resolve_attributes(attributes) tag_args = [content_string, resolved_attributes].compact @xml.tag!(name.to_s.dasherize, *tag_args, &content_block) end end # Generate a list of elements from Enumerable data. # # r.list_of :books, my_books do # r.element :title # end # # => <books type="array"> # # <book><title>Sailing for old dogs</title></book> # # <book><title>On the horizon</title></book> # # <book><title>The Little Blue Book of VHS Programming</title></book> # # </books> # # Like #element, the value can be explicit, but is more commonly extracted # by name from the current #subject. # def list_of(name, *args, &block) options = args.extract_options! list_subject = args.empty? ? name : args.shift raise ArgumentError, "too many arguments" unless args.empty? list_attributes = options[:list_attributes] || {} item_name = options[:item_name] || name.to_s.singularize item_attributes = options[:item_attributes] || {} items = resolve_value(list_subject) element(name, items, list_attributes.merge(:type => lambda{"array"})) do items.each do |item| element(item_name, item, item_attributes, &block) end end end # Return a magic value that, when passed to #element as a block, forces # generation of an empty element. # # r.element(:link, :rel => "me", :href => "http://dogbiscuit.org", &r.empty) # # => <link rel="parent" href="http://dogbiscuit.org"/> # def empty Representative::EMPTY end # Generate a comment def comment(text) @xml.comment!(text) end end end Tweak to work with activesupport-3.0.0. require "active_support/core_ext" require "active_support/core_ext" require "builder" require "representative/base" require "representative/empty" module Representative # Easily generate XML while traversing an object-graph. # class Xml < Base # Create an XML-generating Representative. The first argument should be an instance of # Builder::XmlMarkup (or something that implements it's interface). The second argument # if any, is the initial #subject of representation. # def initialize(xml_builder, subject = nil, options = {}) @xml = xml_builder super(subject, options) yield self if block_given? end # Generate an element. # # With two arguments, it generates an element with the specified text content. # # r.element :size, 42 # # => <size>42</size> # # More commonly, though, the second argument is omitted, in which case the # element content is assumed to be the named property of the current #subject. # # r.representing my_shoe do # r.element :size # end # # => <size>9</size> # # If a block is attached, nested elements can be generated. The element "value" # (whether explicitly provided, or derived from the current subject) becomes the # subject during evaluation of the block. # # r.element :book, book do # r.title # r.author # end # # => <book><title>Whatever</title><author>Whoever</author></book> # # Providing a final Hash argument specifies element attributes. # # r.element :size, :type => "integer" # # => <size type="integer">9</size> # def element(name, *args, &block) metadata = @inspector.get_metadata(current_subject, name) attributes = args.extract_options!.merge(metadata) subject_of_element = if args.empty? lambda do |subject| @inspector.get_value(current_subject, name) end else args.shift end raise ArgumentError, "too many arguments" unless args.empty? representing(subject_of_element) do content_string = content_block = nil unless current_subject.nil? if block unless block == Representative::EMPTY content_block = Proc.new do block.call(current_subject) end end else content_string = current_subject.to_s end end resolved_attributes = resolve_attributes(attributes) tag_args = [content_string, resolved_attributes].compact @xml.tag!(name.to_s.dasherize, *tag_args, &content_block) end end # Generate a list of elements from Enumerable data. # # r.list_of :books, my_books do # r.element :title # end # # => <books type="array"> # # <book><title>Sailing for old dogs</title></book> # # <book><title>On the horizon</title></book> # # <book><title>The Little Blue Book of VHS Programming</title></book> # # </books> # # Like #element, the value can be explicit, but is more commonly extracted # by name from the current #subject. # def list_of(name, *args, &block) options = args.extract_options! list_subject = args.empty? ? name : args.shift raise ArgumentError, "too many arguments" unless args.empty? list_attributes = options[:list_attributes] || {} item_name = options[:item_name] || name.to_s.singularize item_attributes = options[:item_attributes] || {} items = resolve_value(list_subject) element(name, items, list_attributes.merge(:type => lambda{"array"})) do items.each do |item| element(item_name, item, item_attributes, &block) end end end # Return a magic value that, when passed to #element as a block, forces # generation of an empty element. # # r.element(:link, :rel => "me", :href => "http://dogbiscuit.org", &r.empty) # # => <link rel="parent" href="http://dogbiscuit.org"/> # def empty Representative::EMPTY end # Generate a comment def comment(text) @xml.comment!(text) end end end
module ResourceFull class ResourceNotFound < Exception; end class Base < ActionController::Base unless Rails.version == "2.3.2" session :off, :if => lambda { |request| request.format.xml? || request.format.json? } end def model_name; self.class.model_name; end def model_class; self.class.model_class; end class << self # Returns the list of all resources handled by ResourceFull. def all_resources ActionController::Routing.possible_controllers.map do |possible_controller| controller_for(possible_controller) end.select do |controller_class| controller_class.ancestors.include?(self) end end # Returns the controller for the given resource. def controller_for(resource) return resource if resource.is_a?(Class) && resource.ancestors.include?(ActionController::Base) "#{resource.to_s.underscore}_controller".classify.constantize rescue NameError raise ResourceFull::ResourceNotFound, "not found: #{resource}" end private def inherited(controller) super(controller) controller.send :extend, ClassMethods controller.send :include, ResourceFull::Retrieve, ResourceFull::Query, ResourceFull::Dispatch, ResourceFull::Render controller.send :alias_retrieval_methods! end end end module ClassMethods attr_accessor_with_default :paginatable, true attr_accessor_with_default :resource_identifier, :id # Returns true if this resource is paginatable, which is to say, it recognizes and honors # the :limit and :offset parameters if present in a query. True by default. def paginatable?; paginatable; end # The name of the model exposed by this resource. Derived from the name of the controller # by default. See +exposes+. def model_name @model_class ? @model_class.simple_name.underscore : self.controller_name.singularize end # Indicates that this resource is identified by a database column other than the default # :id. # TODO This should honor the model's primary key column but needn't be bound by it. # TODO Refactor this. # TODO Improve the documentation. def identified_by(*args, &block) opts = args.extract_options! column = args.first if !block.nil? self.resource_identifier = block elsif !column.nil? if !opts.empty? && ( opts.has_key?(:if) || opts.has_key?(:unless) ) if opts[:unless] == :id_numeric opts[:unless] = lambda { |id| id =~ /^[0-9]+$/ } end # Negate the condition to generate an :if from an :unless. condition = opts[:if] || lambda { |id| not opts[:unless].call(id) } self.resource_identifier = lambda do |id| if condition.call(id) column else :id end end else self.resource_identifier = column end else raise ArgumentError, "identified_by expects either a block or a column name and some options" end end # The class of the model exposed by this resource. Derived from the model name. See +exposes+. def model_class @model_class ||= model_name.camelize.constantize end # Indicates that the CRUD methods should be called on the given class. Accepts # either a class object or the name of the desired model. def exposes(model_class) remove_retrieval_methods! @model_class = model_class.to_s.singularize.camelize.constantize alias_retrieval_methods! end # Renders the resource as XML. def to_xml(opts={}) { :name => self.controller_name, :parameters => self.queryable_params, :identifier => self.xml_identifier }.to_xml(opts.merge(:root => "resource")) end protected def xml_identifier (self.resource_identifier.is_a?(Proc) ? self.resource_identifier.call(nil) : self.resource_identifier).to_s end private def alias_retrieval_methods! define_method("new_#{model_name}") { new_model_object } define_method("find_#{model_name}") { find_model_object } define_method("create_#{model_name}") { create_model_object } define_method("update_#{model_name}") { update_model_object } define_method("destroy_#{model_name}") { destroy_model_object } define_method("find_all_#{model_name.pluralize}") { find_all_model_objects } define_method("count_all_#{model_name.pluralize}") { count_all_model_objects } end def remove_retrieval_methods! remove_method "new_#{model_name}" remove_method "find_#{model_name}" remove_method "create_#{model_name}" remove_method "update_#{model_name}" remove_method "destroy_#{model_name}" remove_method "find_all_#{model_name.pluralize}" remove_method "count_all_#{model_name.pluralize}" end end end Vijay: Added checks to safely try and remove the stubbed methods - so that it does not fail if the methods have not yet been defined. module ResourceFull class ResourceNotFound < Exception; end class Base < ActionController::Base unless Rails.version == "2.3.2" session :off, :if => lambda { |request| request.format.xml? || request.format.json? } end def model_name; self.class.model_name; end def model_class; self.class.model_class; end class << self # Returns the list of all resources handled by ResourceFull. def all_resources ActionController::Routing.possible_controllers.map do |possible_controller| controller_for(possible_controller) end.select do |controller_class| controller_class.ancestors.include?(self) end end # Returns the controller for the given resource. def controller_for(resource) return resource if resource.is_a?(Class) && resource.ancestors.include?(ActionController::Base) "#{resource.to_s.underscore}_controller".classify.constantize rescue NameError raise ResourceFull::ResourceNotFound, "not found: #{resource}" end private def inherited(controller) super(controller) controller.send :extend, ClassMethods controller.send :include, ResourceFull::Retrieve, ResourceFull::Query, ResourceFull::Dispatch, ResourceFull::Render controller.send :alias_retrieval_methods! end end end module ClassMethods attr_accessor_with_default :paginatable, true attr_accessor_with_default :resource_identifier, :id # Returns true if this resource is paginatable, which is to say, it recognizes and honors # the :limit and :offset parameters if present in a query. True by default. def paginatable?; paginatable; end # The name of the model exposed by this resource. Derived from the name of the controller # by default. See +exposes+. def model_name @model_class ? @model_class.simple_name.underscore : self.controller_name.singularize end # Indicates that this resource is identified by a database column other than the default # :id. # TODO This should honor the model's primary key column but needn't be bound by it. # TODO Refactor this. # TODO Improve the documentation. def identified_by(*args, &block) opts = args.extract_options! column = args.first if !block.nil? self.resource_identifier = block elsif !column.nil? if !opts.empty? && ( opts.has_key?(:if) || opts.has_key?(:unless) ) if opts[:unless] == :id_numeric opts[:unless] = lambda { |id| id =~ /^[0-9]+$/ } end # Negate the condition to generate an :if from an :unless. condition = opts[:if] || lambda { |id| not opts[:unless].call(id) } self.resource_identifier = lambda do |id| if condition.call(id) column else :id end end else self.resource_identifier = column end else raise ArgumentError, "identified_by expects either a block or a column name and some options" end end # The class of the model exposed by this resource. Derived from the model name. See +exposes+. def model_class @model_class ||= model_name.camelize.constantize end # Indicates that the CRUD methods should be called on the given class. Accepts # either a class object or the name of the desired model. def exposes(model_class) remove_retrieval_methods! @model_class = model_class.to_s.singularize.camelize.constantize alias_retrieval_methods! end # Renders the resource as XML. def to_xml(opts={}) { :name => self.controller_name, :parameters => self.queryable_params, :identifier => self.xml_identifier }.to_xml(opts.merge(:root => "resource")) end protected def xml_identifier (self.resource_identifier.is_a?(Proc) ? self.resource_identifier.call(nil) : self.resource_identifier).to_s end private def alias_retrieval_methods! define_method("new_#{model_name}") { new_model_object } define_method("find_#{model_name}") { find_model_object } define_method("create_#{model_name}") { create_model_object } define_method("update_#{model_name}") { update_model_object } define_method("destroy_#{model_name}") { destroy_model_object } define_method("find_all_#{model_name.pluralize}") { find_all_model_objects } define_method("count_all_#{model_name.pluralize}") { count_all_model_objects } end def remove_retrieval_methods! remove_method "new_#{model_name}" if method_defined? "new_#{model_name}" remove_method "find_#{model_name}" if method_defined? "find_#{model_name}" remove_method "create_#{model_name}" if method_defined? "create_#{model_name}" remove_method "update_#{model_name}" if method_defined? "update_#{model_name}" remove_method "destroy_#{model_name}" if method_defined? "destroy_#{model_name}" remove_method "find_all_#{model_name.pluralize}" if method_defined? "find_all_#{model_name.pluralize}" remove_method "count_all_#{model_name.pluralize}" if method_defined? "count_all_#{model_name.pluralize}" end end end
# encoding: utf-8 # # Copyright (c) 2002-2007 Minero Aoki # 2008-2014 Minero Aoki, Kenshi Muto, Masayoshi Takahashi, # KADO Masanori # # This program is free software. # You can distribute or modify this program under the terms of # the GNU LGPL, Lesser General Public License version 2.1. # require 'review/builder' require 'review/htmlutils' require 'review/htmllayout' require 'review/textutils' require 'review/sec_counter' module ReVIEW class HTMLBuilder < Builder include TextUtils include HTMLUtils [:ref].each {|e| Compiler.definline(e) } Compiler.defblock(:memo, 0..1) Compiler.defblock(:tip, 0..1) Compiler.defblock(:info, 0..1) Compiler.defblock(:planning, 0..1) Compiler.defblock(:best, 0..1) Compiler.defblock(:important, 0..1) Compiler.defblock(:security, 0..1) Compiler.defblock(:caution, 0..1) Compiler.defblock(:notice, 0..1) Compiler.defblock(:point, 0..1) Compiler.defblock(:shoot, 0..1) def pre_paragraph '<p>' end def post_paragraph '</p>' end def extname ".#{ReVIEW.book.param["htmlext"]}" end def builder_init(no_error = false) @no_error = no_error @column = 0 @noindent = nil @ol_num = nil end private :builder_init def builder_init_file @warns = [] @errors = [] @chapter.book.image_types = %w( .png .jpg .jpeg .gif .svg ) @sec_counter = SecCounter.new(5, @chapter) end private :builder_init_file def result layout_file = File.join(@book.basedir, "layouts", "layout.erb") if File.exist?(layout_file) title = convert_outencoding(strip_html(compile_inline(@chapter.title)), ReVIEW.book.param["outencoding"]) messages() + HTMLLayout.new(@output.string, title, layout_file).result else # default XHTML header/footer header = <<EOT <?xml version="1.0" encoding="#{ReVIEW.book.param["outencoding"] || :UTF-8}"?> EOT if ReVIEW.book.param["htmlversion"].to_i == 5 header += <<EOT <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:#{xmlns_ops_prefix}="http://www.idpf.org/2007/ops" xml:lang="#{ReVIEW.book.param["language"]}"> <head> <meta charset="#{ReVIEW.book.param["outencoding"] || :UTF-8}" /> EOT else header += <<EOT <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.1//EN" "http://www.w3.org/TR/xhtml11/DTD/xhtml11.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:ops="http://www.idpf.org/2007/ops" xml:lang="#{ReVIEW.book.param["language"]}"> <head> <meta http-equiv="Content-Type" content="text/html;charset=#{ReVIEW.book.param["outencoding"] || :UTF-8}" /> <meta http-equiv="Content-Style-Type" content="text/css" /> EOT end unless ReVIEW.book.param["stylesheet"].nil? ReVIEW.book.param["stylesheet"].each do |style| header += <<EOT <link rel="stylesheet" type="text/css" href="#{style}" /> EOT end end header += <<EOT <meta name="generator" content="Re:VIEW" /> <title>#{convert_outencoding(strip_html(compile_inline(@chapter.title)), ReVIEW.book.param["outencoding"])}</title> </head> <body> EOT footer = <<EOT </body> </html> EOT header + messages() + convert_outencoding(@output.string, ReVIEW.book.param["outencoding"]) + footer end end def xmlns_ops_prefix if ReVIEW.book.param["epubversion"].to_i == 3 "epub" else "ops" end end def warn(msg) if @no_error @warns.push [@location.filename, @location.lineno, msg] puts "----WARNING: #{escape_html(msg)}----" else $stderr.puts "#{@location}: warning: #{msg}" end end def error(msg) if @no_error @errors.push [@location.filename, @location.lineno, msg] puts "----ERROR: #{escape_html(msg)}----" else $stderr.puts "#{@location}: error: #{msg}" end end def messages error_messages() + warning_messages() end def error_messages return '' if @errors.empty? "<h2>Syntax Errors</h2>\n" + "<ul>\n" + @errors.map {|file, line, msg| "<li>#{escape_html(file)}:#{line}: #{escape_html(msg.to_s)}</li>\n" }.join('') + "</ul>\n" end def warning_messages return '' if @warns.empty? "<h2>Warnings</h2>\n" + "<ul>\n" + @warns.map {|file, line, msg| "<li>#{escape_html(file)}:#{line}: #{escape_html(msg)}</li>\n" }.join('') + "</ul>\n" end def headline_prefix(level) @sec_counter.inc(level) anchor = @sec_counter.anchor(level) prefix = @sec_counter.prefix(level, ReVIEW.book.param["secnolevel"]) [prefix, anchor] end private :headline_prefix def headline(level, label, caption) prefix, anchor = headline_prefix(level) puts '' if level > 1 a_id = "" unless anchor.nil? a_id = %Q[<a id="h#{anchor}"></a>] end if caption.empty? puts a_id unless label.nil? else if label.nil? puts %Q[<h#{level}>#{a_id}#{prefix}#{compile_inline(caption)}</h#{level}>] else puts %Q[<h#{level} id="#{label}">#{a_id}#{prefix}#{compile_inline(caption)}</h#{level}>] end end end def nonum_begin(level, label, caption) puts '' if level > 1 unless caption.empty? if label.nil? puts %Q[<h#{level}>#{compile_inline(caption)}</h#{level}>] else puts %Q[<h#{level} id="#{label}">#{compile_inline(caption)}</h#{level}>] end end end def nonum_end(level) end def column_begin(level, label, caption) puts %Q[<div class="column">] @column += 1 puts '' if level > 1 a_id = %Q[<a id="column-#{@column}"></a>] if caption.empty? puts a_id unless label.nil? else if label.nil? puts %Q[<h#{level}>#{a_id}#{compile_inline(caption)}</h#{level}>] else puts %Q[<h#{level} id="#{label}">#{a_id}#{compile_inline(caption)}</h#{level}>] end end # headline(level, label, caption) end def column_end(level) puts '</div>' end def xcolumn_begin(level, label, caption) puts %Q[<div class="xcolumn">] headline(level, label, caption) end def xcolumn_end(level) puts '</div>' end def ref_begin(level, label, caption) print %Q[<div class="reference">] headline(level, label, caption) end def ref_end(level) puts '</div>' end def sup_begin(level, label, caption) print %Q[<div class="supplement">] headline(level, label, caption) end def sup_end(level) puts '</div>' end def tsize(str) # null end def captionblock(type, lines, caption) puts %Q[<div class="#{type}">] unless caption.nil? puts %Q[<p class="caption">#{compile_inline(caption)}</p>] end if ReVIEW.book.param["deprecated-blocklines"].nil? blocked_lines = split_paragraph(lines) puts blocked_lines.join("\n") else lines.each {|l| puts "<p>#{l}</p>" } end puts '</div>' end def memo(lines, caption = nil) captionblock("memo", lines, caption) end def tip(lines, caption = nil) captionblock("tip", lines, caption) end def info(lines, caption = nil) captionblock("info", lines, caption) end def planning(lines, caption = nil) captionblock("planning", lines, caption) end def best(lines, caption = nil) captionblock("best", lines, caption) end def important(lines, caption = nil) captionblock("important", lines, caption) end def security(lines, caption = nil) captionblock("security", lines, caption) end def caution(lines, caption = nil) captionblock("caution", lines, caption) end def notice(lines, caption = nil) captionblock("notice", lines, caption) end def point(lines, caption = nil) captionblock("point", lines, caption) end def shoot(lines, caption = nil) captionblock("shoot", lines, caption) end def box(lines, caption = nil) puts %Q[<div class="syntax">] puts %Q[<p class="caption">#{compile_inline(caption)}</p>] unless caption.nil? print %Q[<pre class="syntax">] lines.each {|line| puts detab(line) } puts '</pre>' puts '</div>' end def note(lines, caption = nil) captionblock("note", lines, caption) end def ul_begin puts '<ul>' end def ul_item(lines) puts "<li>#{lines.join}</li>" end def ul_item_begin(lines) print "<li>#{lines.join}" end def ul_item_end puts "</li>" end def ul_end puts '</ul>' end def ol_begin if @ol_num puts "<ol start=\"#{@ol_num}\">" ## it's OK in HTML5, but not OK in XHTML1.1 @ol_num = nil else puts '<ol>' end end def ol_item(lines, num) puts "<li>#{lines.join}</li>" end def ol_end puts '</ol>' end def dl_begin puts '<dl>' end def dt(line) puts "<dt>#{line}</dt>" end def dd(lines) puts "<dd>#{lines.join}</dd>" end def dl_end puts '</dl>' end def paragraph(lines) if @noindent.nil? puts "<p>#{lines.join}</p>" else puts %Q[<p class="noindent">#{lines.join}</p>] @noindent = nil end end def parasep() puts '<br />' end def read(lines) if ReVIEW.book.param["deprecated-blocklines"].nil? blocked_lines = split_paragraph(lines) puts %Q[<div class="lead">\n#{blocked_lines.join("\n")}\n</div>] else puts %Q[<p class="lead">\n#{lines.join("\n")}\n</p>] end end alias :lead read def list(lines, id, caption) puts %Q[<div class="caption-code">] begin list_header id, caption rescue KeyError error "no such list: #{id}" end list_body id, lines puts '</div>' end def list_header(id, caption) if get_chap.nil? puts %Q[<p class="caption">#{I18n.t("list")}#{I18n.t("format_number_header_without_chapter", [@chapter.list(id).number])}#{I18n.t("caption_prefix")}#{compile_inline(caption)}</p>] else puts %Q[<p class="caption">#{I18n.t("list")}#{I18n.t("format_number_header", [get_chap, @chapter.list(id).number])}#{I18n.t("caption_prefix")}#{compile_inline(caption)}</p>] end end def list_body(id, lines) id ||= '' print %Q[<pre class="list">] body = lines.inject(''){|i, j| i + detab(j) + "\n"} lexer = File.extname(id).gsub(/\./, '') puts highlight(:body => body, :lexer => lexer, :format => 'html') puts '</pre>' end def source(lines, caption = nil) puts %Q[<div class="source-code">] source_header caption source_body caption, lines puts '</div>' end def source_header(caption) if caption.present? puts %Q[<p class="caption">#{compile_inline(caption)}</p>] end end def source_body(id, lines) id ||= '' print %Q[<pre class="source">] body = lines.inject(''){|i, j| i + detab(j) + "\n"} lexer = File.extname(id).gsub(/\./, '') puts highlight(:body => body, :lexer => lexer, :format => 'html') puts '</pre>' end def listnum(lines, id, caption) puts %Q[<div class="code">] begin list_header id, caption rescue KeyError error "no such list: #{id}" end listnum_body lines puts '</div>' end def listnum_body(lines) print %Q[<pre class="list">] lines.each_with_index do |line, i| puts detab((i+1).to_s.rjust(2) + ": " + line) end puts '</pre>' end def emlist(lines, caption = nil) puts %Q[<div class="emlist-code">] puts %Q(<p class="caption">#{caption}</p>) unless caption.nil? print %Q[<pre class="emlist">] lines.each do |line| puts detab(line) end puts '</pre>' puts '</div>' end def emlistnum(lines, caption = nil) puts %Q[<div class="emlistnum-code">] puts %Q(<p class="caption">#{caption}</p>) unless caption.nil? print %Q[<pre class="emlist">] lines.each_with_index do |line, i| puts detab((i+1).to_s.rjust(2) + ": " + line) end puts '</pre>' puts '</div>' end def cmd(lines, caption = nil) puts %Q[<div class="cmd-code">] puts %Q(<p class="caption">#{caption}</p>) unless caption.nil? print %Q[<pre class="cmd">] lines.each do |line| puts detab(line) end puts '</pre>' puts '</div>' end def quotedlist(lines, css_class) print %Q[<blockquote><pre class="#{css_class}">] lines.each do |line| puts detab(line) end puts '</pre></blockquote>' end private :quotedlist def quote(lines) if ReVIEW.book.param["deprecated-blocklines"].nil? blocked_lines = split_paragraph(lines) puts "<blockquote>#{blocked_lines.join("\n")}</blockquote>" else puts "<blockquote><pre>#{lines.join("\n")}</pre></blockquote>" end end def doorquote(lines, ref) if ReVIEW.book.param["deprecated-blocklines"].nil? blocked_lines = split_paragraph(lines) puts %Q[<blockquote style="text-align:right;">] puts "#{blocked_lines.join("\n")}" puts %Q[<p>#{ref}より</p>] puts %Q[</blockquote>] else puts <<-QUOTE <blockquote style="text-align:right;"> <pre>#{lines.join("\n")} #{ref}より</pre> </blockquote> QUOTE end end def talk(lines) puts %Q[<div class="talk">] if ReVIEW.book.param["deprecated-blocklines"].nil? blocked_lines = split_paragraph(lines) puts "#{blocked_lines.join("\n")}" else print '<pre>' puts "#{lines.join("\n")}" puts '</pre>' end puts '</div>' end def texequation(lines) puts %Q[<div class="equation">] if ReVIEW.book.param["mathml"] p = MathML::LaTeX::Parser.new(:symbol=>MathML::Symbol::CharacterReference) puts p.parse(unescape_html(lines.join("\n")), true) else print '<pre>' puts "#{lines.join("\n")}" puts '</pre>' end puts '</div>' end def handle_metric(str) if str =~ /\Ascale=([\d.]+)\Z/ return "width=\"#{($1.to_f * 100).round}%\"" else k, v = str.split('=', 2) return %Q|#{k}=\"#{v.sub(/\A["']/, '').sub(/["']\Z/, '')}\"| end end def result_metric(array) " #{array.join(' ')}" end def image_image(id, caption, metric) metrics = parse_metric("html", metric) puts %Q[<div class="image">] puts %Q[<img src="#{@chapter.image(id).path.sub(/\A\.\//, "")}" alt="#{escape_html(compile_inline(caption))}"#{metrics} />] image_header id, caption puts %Q[</div>] end def image_dummy(id, caption, lines) puts %Q[<div class="image">] puts %Q[<pre class="dummyimage">] lines.each do |line| puts detab(line) end puts %Q[</pre>] image_header id, caption puts %Q[</div>] end def image_header(id, caption) puts %Q[<p class="caption">] if get_chap.nil? puts %Q[#{I18n.t("image")}#{I18n.t("format_number_header_without_chapter", [@chapter.image(id).number])}#{I18n.t("caption_prefix")}#{compile_inline(caption)}] else puts %Q[#{I18n.t("image")}#{I18n.t("format_number_header", [get_chap, @chapter.image(id).number])}#{I18n.t("caption_prefix")}#{compile_inline(caption)}] end puts %Q[</p>] end def table(lines, id = nil, caption = nil) rows = [] sepidx = nil lines.each_with_index do |line, idx| if /\A[\=\-]{12}/ =~ line # just ignore #error "too many table separator" if sepidx sepidx ||= idx next end rows.push line.strip.split(/\t+/).map {|s| s.sub(/\A\./, '') } end rows = adjust_n_cols(rows) puts %Q[<div class="table">] begin table_header id, caption unless caption.nil? rescue KeyError error "no such table: #{id}" end table_begin rows.first.size return if rows.empty? if sepidx sepidx.times do tr rows.shift.map {|s| th(s) } end rows.each do |cols| tr cols.map {|s| td(s) } end else rows.each do |cols| h, *cs = *cols tr [th(h)] + cs.map {|s| td(s) } end end table_end puts %Q[</div>] end def table_header(id, caption) if get_chap.nil? puts %Q[<p class="caption">#{I18n.t("table")}#{I18n.t("format_number_header_without_chapter", [@chapter.table(id).number])}#{I18n.t("caption_prefix")}#{compile_inline(caption)}</p>] else puts %Q[<p class="caption">#{I18n.t("table")}#{I18n.t("format_number_header", [get_chap, @chapter.table(id).number])}#{I18n.t("caption_prefix")}#{compile_inline(caption)}</p>] end end def table_begin(ncols) puts '<table>' end def tr(rows) puts "<tr>#{rows.join}</tr>" end def th(str) "<th>#{str}</th>" end def td(str) "<td>#{str}</td>" end def table_end puts '</table>' end def comment(lines, comment = nil) lines ||= [] lines.unshift comment unless comment.blank? if ReVIEW.book.param["draft"] str = lines.map{|line| escape_html(line) }.join("<br />") puts %Q(<div class="draft-comment">#{str}</div>) else str = lines.join("\n") puts %Q(<!-- #{escape_html(str)} -->) end end def footnote(id, str) if ReVIEW.book.param["epubversion"].to_i == 3 puts %Q(<div class="footnote" epub:type="footnote" id="fn-#{id}"><p class="footnote">[*#{@chapter.footnote(id).number}] #{compile_inline(str)}</p></div>) else puts %Q(<div class="footnote"><p class="footnote">[<a id="fn-#{id}">*#{@chapter.footnote(id).number}</a>] #{compile_inline(str)}</p></div>) end end def indepimage(id, caption="", metric=nil) metrics = parse_metric("html", metric) caption = "" if caption.nil? puts %Q[<div class="image">] begin puts %Q[<img src="#{@chapter.image(id).path.sub(/\A\.\//, "")}" alt="#{escape_html(compile_inline(caption))}"#{metrics} />] rescue puts %Q[<pre>missing image: #{id}</pre>] end unless caption.empty? puts %Q[<p class="caption">] puts %Q[#{I18n.t("numberless_image")}#{I18n.t("caption_prefix")}#{compile_inline(caption)}] puts %Q[</p>] end puts %Q[</div>] end alias :numberlessimage indepimage def hr puts "<hr />" end def label(id) puts %Q(<a id="#{id}"></a>) end def linebreak puts "<br />" end def pagebreak puts %Q(<br class="pagebreak" />) end def bpo(lines) puts "<bpo>" lines.each do |line| puts detab(line) end puts "</bpo>" end def noindent @noindent = true end def inline_labelref(idref) %Q[<a target='#{escape_html(idref)}'>「●● #{escape_html(idref)}」</a>] end alias inline_ref inline_labelref def inline_chapref(id) title = super if ReVIEW.book.param["chapterlink"] %Q(<a href="./#{id}.html">#{title}</a>) else title end rescue KeyError error "unknown chapter: #{id}" nofunc_text("[UnknownChapter:#{id}]") end def inline_chap(id) if ReVIEW.book.param["chapterlink"] %Q(<a href="./#{id}.html">#{@chapter.env.chapter_index.number(id)}</a>) else @chapter.env.chapter_index.number(id) end rescue KeyError error "unknown chapter: #{id}" nofunc_text("[UnknownChapter:#{id}]") end def inline_title(id) if ReVIEW.book.param["chapterlink"] %Q(<a href="./#{id}.html">#{compile_inline(@chapter.env.chapter_index.title(id))}</a>) else @chapter.env.chapter_index.title(id) end rescue KeyError error "unknown chapter: #{id}" nofunc_text("[UnknownChapter:#{id}]") end def inline_fn(id) if ReVIEW.book.param["epubversion"].to_i == 3 %Q(<a href="#fn-#{id}" class="noteref" epub:type="noteref">*#{@chapter.footnote(id).number}</a>) else %Q(<a href="#fn-#{id}" class="noteref">*#{@chapter.footnote(id).number}</a>) end end def compile_ruby(base, ruby) if ReVIEW.book.param["htmlversion"].to_i == 5 %Q[<ruby>#{escape_html(base)}<rp>#{I18n.t("ruby_prefix")}</rp><rt>#{escape_html(ruby)}</rt><rp>#{I18n.t("ruby_postfix")}</rp></ruby>] else %Q[<ruby><rb>#{escape_html(base)}</rb><rp>#{I18n.t("ruby_prefix")}</rp><rt>#{ruby}</rt><rp>#{I18n.t("ruby_postfix")}</rp></ruby>] end end def compile_kw(word, alt) %Q[<b class="kw">] + if alt then escape_html(word + " (#{alt.strip})") else escape_html(word) end + "</b><!-- IDX:#{escape_html(word)} -->" end def inline_i(str) %Q(<i>#{escape_html(str)}</i>) end def inline_b(str) %Q(<b>#{escape_html(str)}</b>) end def inline_ami(str) %Q(<span class="ami">#{escape_html(str)}</span>) end def inline_bou(str) %Q(<span class="bou">#{escape_html(str)}</span>) end def inline_tti(str) if ReVIEW.book.param["htmlversion"].to_i == 5 %Q(<code class="tt"><i>#{escape_html(str)}</i></code>) else %Q(<tt><i>#{escape_html(str)}</i></tt>) end end def inline_ttb(str) if ReVIEW.book.param["htmlversion"].to_i == 5 %Q(<code class="tt"><b>#{escape_html(str)}</b></code>) else %Q(<tt><b>#{escape_html(str)}</b></tt>) end end def inline_dtp(str) "<?dtp #{str} ?>" end def inline_code(str) if ReVIEW.book.param["htmlversion"].to_i == 5 %Q(<code class="inline-code tt">#{escape_html(str)}</code>) else %Q(<tt class="inline-code">#{escape_html(str)}</tt>) end end def inline_idx(str) %Q(#{escape_html(str)}<!-- IDX:#{escape_html(str)} -->) end def inline_hidx(str) %Q(<!-- IDX:#{escape_html(str)} -->) end def inline_br(str) %Q(<br />) end def inline_m(str) if ReVIEW.book.param["mathml"] p = MathML::LaTeX::Parser.new(:symbol=>MathML::Symbol::CharacterReference) %Q[<span class="equation">#{p.parse(str, nil)}</span>] else %Q[<span class="equation">#{escape_html(str)}</span>] end end def text(str) str end def bibpaper(lines, id, caption) puts %Q[<div class="bibpaper">] bibpaper_header id, caption unless lines.empty? bibpaper_bibpaper id, caption, lines end puts "</div>" end def bibpaper_header(id, caption) print %Q(<a id="bib-#{id}">) print "[#{@chapter.bibpaper(id).number}]" print %Q(</a>) puts " #{compile_inline(caption)}" end def bibpaper_bibpaper(id, caption, lines) print split_paragraph(lines).join("") end def inline_bib(id) %Q(<a href=".#{@book.bib_file.gsub(/re\Z/, "html")}#bib-#{id}">[#{@chapter.bibpaper(id).number}]</a>) end def inline_hd_chap(chap, id) n = chap.headline_index.number(id) if chap.number and ReVIEW.book.param["secnolevel"] >= n.split('.').size str = "「#{n} #{compile_inline(chap.headline(id).caption)}」" else str = "「#{compile_inline(chap.headline(id).caption)}」" end if ReVIEW.book.param["chapterlink"] anchor = "h"+n.gsub(/\./, "-") %Q(<a href="#{chap.id}.html\##{anchor}">#{str}</a>) else str end end def inline_column(id) if ReVIEW.book.param["chapterlink"] %Q(<a href="\##{id}" class="columnref">#{@chapter.column(id).caption}</a>) else @chapter.column(id).caption end rescue KeyError error "unknown column: #{id}" nofunc_text("[UnknownColumn:#{id}]") end def inline_list(id) chapter, id = extract_chapter_id(id) if get_chap(chapter).nil? "#{I18n.t("list")}#{I18n.t("format_number_without_header", [chapter.list(id).number])}" else "#{I18n.t("list")}#{I18n.t("format_number", [get_chap(chapter), chapter.list(id).number])}" end rescue KeyError error "unknown list: #{id}" nofunc_text("[UnknownList:#{id}]") end def inline_table(id) chapter, id = extract_chapter_id(id) if get_chap(chapter).nil? "#{I18n.t("table")}#{I18n.t("format_number_without_chapter", [chapter.table(id).number])}" else "#{I18n.t("table")}#{I18n.t("format_number", [get_chap(chapter), chapter.table(id).number])}" end rescue KeyError error "unknown table: #{id}" nofunc_text("[UnknownTable:#{id}]") end def inline_img(id) chapter, id = extract_chapter_id(id) if get_chap(chapter).nil? "#{I18n.t("image")}#{I18n.t("format_number_without_chapter", [chapter.image(id).number])}" else "#{I18n.t("image")}#{I18n.t("format_number", [get_chap(chapter), chapter.image(id).number])}" end rescue KeyError error "unknown image: #{id}" nofunc_text("[UnknownImage:#{id}]") end def inline_asis(str, tag) %Q(<#{tag}>#{escape_html(str)}</#{tag}>) end def inline_abbr(str) inline_asis(str, "abbr") end def inline_acronym(str) inline_asis(str, "acronym") end def inline_cite(str) inline_asis(str, "cite") end def inline_dfn(str) inline_asis(str, "dfn") end def inline_em(str) inline_asis(str, "em") end def inline_kbd(str) inline_asis(str, "kbd") end def inline_samp(str) inline_asis(str, "samp") end def inline_strong(str) inline_asis(str, "strong") end def inline_var(str) inline_asis(str, "var") end def inline_big(str) inline_asis(str, "big") end def inline_small(str) inline_asis(str, "small") end def inline_sub(str) inline_asis(str, "sub") end def inline_sup(str) inline_asis(str, "sup") end def inline_tt(str) if ReVIEW.book.param["htmlversion"].to_i == 5 %Q(<code class="tt">#{escape_html(str)}</code>) else %Q(<tt>#{escape_html(str)}</tt>) end end def inline_del(str) inline_asis(str, "del") end def inline_ins(str) inline_asis(str, "ins") end def inline_u(str) %Q(<u>#{escape_html(str)}</u>) end def inline_recipe(str) %Q(<span class="recipe">「#{escape_html(str)}」</span>) end def inline_icon(id) begin %Q[<img src="#{@chapter.image(id).path.sub(/\A\.\//, "")}" alt="[#{id}]" />] rescue %Q[<pre>missing image: #{id}</pre>] end end def inline_uchar(str) %Q(&#x#{str};) end def inline_comment(str) if ReVIEW.book.param["draft"] %Q(<span class="draft-comment">#{escape_html(str)}</span>) else %Q(<!-- #{escape_html(str)} -->) end end def inline_raw(str) super(str) end def nofunc_text(str) escape_html(str) end def compile_href(url, label) %Q(<a href="#{escape_html(url)}" class="link">#{label.nil? ? escape_html(url) : escape_html(label)}</a>) end def flushright(lines) if ReVIEW.book.param["deprecated-blocklines"].nil? puts split_paragraph(lines).join("\n").gsub("<p>", "<p class=\"flushright\">") else puts %Q[<div style="text-align:right;">] print %Q[<pre class="flushright">] lines.each {|line| puts detab(line) } puts '</pre>' puts '</div>' end end def centering(lines) puts split_paragraph(lines).join("\n").gsub("<p>", "<p class=\"center\">") end def image_ext "png" end def olnum(num) @ol_num = num.to_i end end end # module ReVIEW fix column label # encoding: utf-8 # # Copyright (c) 2002-2007 Minero Aoki # 2008-2014 Minero Aoki, Kenshi Muto, Masayoshi Takahashi, # KADO Masanori # # This program is free software. # You can distribute or modify this program under the terms of # the GNU LGPL, Lesser General Public License version 2.1. # require 'review/builder' require 'review/htmlutils' require 'review/htmllayout' require 'review/textutils' require 'review/sec_counter' module ReVIEW class HTMLBuilder < Builder include TextUtils include HTMLUtils [:ref].each {|e| Compiler.definline(e) } Compiler.defblock(:memo, 0..1) Compiler.defblock(:tip, 0..1) Compiler.defblock(:info, 0..1) Compiler.defblock(:planning, 0..1) Compiler.defblock(:best, 0..1) Compiler.defblock(:important, 0..1) Compiler.defblock(:security, 0..1) Compiler.defblock(:caution, 0..1) Compiler.defblock(:notice, 0..1) Compiler.defblock(:point, 0..1) Compiler.defblock(:shoot, 0..1) def pre_paragraph '<p>' end def post_paragraph '</p>' end def extname ".#{ReVIEW.book.param["htmlext"]}" end def builder_init(no_error = false) @no_error = no_error @column = 0 @noindent = nil @ol_num = nil end private :builder_init def builder_init_file @warns = [] @errors = [] @chapter.book.image_types = %w( .png .jpg .jpeg .gif .svg ) @sec_counter = SecCounter.new(5, @chapter) end private :builder_init_file def result layout_file = File.join(@book.basedir, "layouts", "layout.erb") if File.exist?(layout_file) title = convert_outencoding(strip_html(compile_inline(@chapter.title)), ReVIEW.book.param["outencoding"]) messages() + HTMLLayout.new(@output.string, title, layout_file).result else # default XHTML header/footer header = <<EOT <?xml version="1.0" encoding="#{ReVIEW.book.param["outencoding"] || :UTF-8}"?> EOT if ReVIEW.book.param["htmlversion"].to_i == 5 header += <<EOT <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:#{xmlns_ops_prefix}="http://www.idpf.org/2007/ops" xml:lang="#{ReVIEW.book.param["language"]}"> <head> <meta charset="#{ReVIEW.book.param["outencoding"] || :UTF-8}" /> EOT else header += <<EOT <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.1//EN" "http://www.w3.org/TR/xhtml11/DTD/xhtml11.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:ops="http://www.idpf.org/2007/ops" xml:lang="#{ReVIEW.book.param["language"]}"> <head> <meta http-equiv="Content-Type" content="text/html;charset=#{ReVIEW.book.param["outencoding"] || :UTF-8}" /> <meta http-equiv="Content-Style-Type" content="text/css" /> EOT end unless ReVIEW.book.param["stylesheet"].nil? ReVIEW.book.param["stylesheet"].each do |style| header += <<EOT <link rel="stylesheet" type="text/css" href="#{style}" /> EOT end end header += <<EOT <meta name="generator" content="Re:VIEW" /> <title>#{convert_outencoding(strip_html(compile_inline(@chapter.title)), ReVIEW.book.param["outencoding"])}</title> </head> <body> EOT footer = <<EOT </body> </html> EOT header + messages() + convert_outencoding(@output.string, ReVIEW.book.param["outencoding"]) + footer end end def xmlns_ops_prefix if ReVIEW.book.param["epubversion"].to_i == 3 "epub" else "ops" end end def warn(msg) if @no_error @warns.push [@location.filename, @location.lineno, msg] puts "----WARNING: #{escape_html(msg)}----" else $stderr.puts "#{@location}: warning: #{msg}" end end def error(msg) if @no_error @errors.push [@location.filename, @location.lineno, msg] puts "----ERROR: #{escape_html(msg)}----" else $stderr.puts "#{@location}: error: #{msg}" end end def messages error_messages() + warning_messages() end def error_messages return '' if @errors.empty? "<h2>Syntax Errors</h2>\n" + "<ul>\n" + @errors.map {|file, line, msg| "<li>#{escape_html(file)}:#{line}: #{escape_html(msg.to_s)}</li>\n" }.join('') + "</ul>\n" end def warning_messages return '' if @warns.empty? "<h2>Warnings</h2>\n" + "<ul>\n" + @warns.map {|file, line, msg| "<li>#{escape_html(file)}:#{line}: #{escape_html(msg)}</li>\n" }.join('') + "</ul>\n" end def headline_prefix(level) @sec_counter.inc(level) anchor = @sec_counter.anchor(level) prefix = @sec_counter.prefix(level, ReVIEW.book.param["secnolevel"]) [prefix, anchor] end private :headline_prefix def headline(level, label, caption) prefix, anchor = headline_prefix(level) puts '' if level > 1 a_id = "" unless anchor.nil? a_id = %Q[<a id="h#{anchor}"></a>] end if caption.empty? puts a_id unless label.nil? else if label.nil? puts %Q[<h#{level}>#{a_id}#{prefix}#{compile_inline(caption)}</h#{level}>] else puts %Q[<h#{level} id="#{label}">#{a_id}#{prefix}#{compile_inline(caption)}</h#{level}>] end end end def nonum_begin(level, label, caption) puts '' if level > 1 unless caption.empty? if label.nil? puts %Q[<h#{level}>#{compile_inline(caption)}</h#{level}>] else puts %Q[<h#{level} id="#{label}">#{compile_inline(caption)}</h#{level}>] end end end def nonum_end(level) end def column_begin(level, label, caption) puts %Q[<div class="column">] @column += 1 puts '' if level > 1 a_id = %Q[<a id="column-#{@column}"></a>] if caption.empty? puts a_id unless label.nil? else if label.nil? puts %Q[<h#{level}>#{a_id}#{compile_inline(caption)}</h#{level}>] else puts %Q[<h#{level} id="#{label}">#{a_id}#{compile_inline(caption)}</h#{level}>] end end # headline(level, label, caption) end def column_end(level) puts '</div>' end def xcolumn_begin(level, label, caption) puts %Q[<div class="xcolumn">] headline(level, label, caption) end def xcolumn_end(level) puts '</div>' end def ref_begin(level, label, caption) print %Q[<div class="reference">] headline(level, label, caption) end def ref_end(level) puts '</div>' end def sup_begin(level, label, caption) print %Q[<div class="supplement">] headline(level, label, caption) end def sup_end(level) puts '</div>' end def tsize(str) # null end def captionblock(type, lines, caption) puts %Q[<div class="#{type}">] unless caption.nil? puts %Q[<p class="caption">#{compile_inline(caption)}</p>] end if ReVIEW.book.param["deprecated-blocklines"].nil? blocked_lines = split_paragraph(lines) puts blocked_lines.join("\n") else lines.each {|l| puts "<p>#{l}</p>" } end puts '</div>' end def memo(lines, caption = nil) captionblock("memo", lines, caption) end def tip(lines, caption = nil) captionblock("tip", lines, caption) end def info(lines, caption = nil) captionblock("info", lines, caption) end def planning(lines, caption = nil) captionblock("planning", lines, caption) end def best(lines, caption = nil) captionblock("best", lines, caption) end def important(lines, caption = nil) captionblock("important", lines, caption) end def security(lines, caption = nil) captionblock("security", lines, caption) end def caution(lines, caption = nil) captionblock("caution", lines, caption) end def notice(lines, caption = nil) captionblock("notice", lines, caption) end def point(lines, caption = nil) captionblock("point", lines, caption) end def shoot(lines, caption = nil) captionblock("shoot", lines, caption) end def box(lines, caption = nil) puts %Q[<div class="syntax">] puts %Q[<p class="caption">#{compile_inline(caption)}</p>] unless caption.nil? print %Q[<pre class="syntax">] lines.each {|line| puts detab(line) } puts '</pre>' puts '</div>' end def note(lines, caption = nil) captionblock("note", lines, caption) end def ul_begin puts '<ul>' end def ul_item(lines) puts "<li>#{lines.join}</li>" end def ul_item_begin(lines) print "<li>#{lines.join}" end def ul_item_end puts "</li>" end def ul_end puts '</ul>' end def ol_begin if @ol_num puts "<ol start=\"#{@ol_num}\">" ## it's OK in HTML5, but not OK in XHTML1.1 @ol_num = nil else puts '<ol>' end end def ol_item(lines, num) puts "<li>#{lines.join}</li>" end def ol_end puts '</ol>' end def dl_begin puts '<dl>' end def dt(line) puts "<dt>#{line}</dt>" end def dd(lines) puts "<dd>#{lines.join}</dd>" end def dl_end puts '</dl>' end def paragraph(lines) if @noindent.nil? puts "<p>#{lines.join}</p>" else puts %Q[<p class="noindent">#{lines.join}</p>] @noindent = nil end end def parasep() puts '<br />' end def read(lines) if ReVIEW.book.param["deprecated-blocklines"].nil? blocked_lines = split_paragraph(lines) puts %Q[<div class="lead">\n#{blocked_lines.join("\n")}\n</div>] else puts %Q[<p class="lead">\n#{lines.join("\n")}\n</p>] end end alias :lead read def list(lines, id, caption) puts %Q[<div class="caption-code">] begin list_header id, caption rescue KeyError error "no such list: #{id}" end list_body id, lines puts '</div>' end def list_header(id, caption) if get_chap.nil? puts %Q[<p class="caption">#{I18n.t("list")}#{I18n.t("format_number_header_without_chapter", [@chapter.list(id).number])}#{I18n.t("caption_prefix")}#{compile_inline(caption)}</p>] else puts %Q[<p class="caption">#{I18n.t("list")}#{I18n.t("format_number_header", [get_chap, @chapter.list(id).number])}#{I18n.t("caption_prefix")}#{compile_inline(caption)}</p>] end end def list_body(id, lines) id ||= '' print %Q[<pre class="list">] body = lines.inject(''){|i, j| i + detab(j) + "\n"} lexer = File.extname(id).gsub(/\./, '') puts highlight(:body => body, :lexer => lexer, :format => 'html') puts '</pre>' end def source(lines, caption = nil) puts %Q[<div class="source-code">] source_header caption source_body caption, lines puts '</div>' end def source_header(caption) if caption.present? puts %Q[<p class="caption">#{compile_inline(caption)}</p>] end end def source_body(id, lines) id ||= '' print %Q[<pre class="source">] body = lines.inject(''){|i, j| i + detab(j) + "\n"} lexer = File.extname(id).gsub(/\./, '') puts highlight(:body => body, :lexer => lexer, :format => 'html') puts '</pre>' end def listnum(lines, id, caption) puts %Q[<div class="code">] begin list_header id, caption rescue KeyError error "no such list: #{id}" end listnum_body lines puts '</div>' end def listnum_body(lines) print %Q[<pre class="list">] lines.each_with_index do |line, i| puts detab((i+1).to_s.rjust(2) + ": " + line) end puts '</pre>' end def emlist(lines, caption = nil) puts %Q[<div class="emlist-code">] puts %Q(<p class="caption">#{caption}</p>) unless caption.nil? print %Q[<pre class="emlist">] lines.each do |line| puts detab(line) end puts '</pre>' puts '</div>' end def emlistnum(lines, caption = nil) puts %Q[<div class="emlistnum-code">] puts %Q(<p class="caption">#{caption}</p>) unless caption.nil? print %Q[<pre class="emlist">] lines.each_with_index do |line, i| puts detab((i+1).to_s.rjust(2) + ": " + line) end puts '</pre>' puts '</div>' end def cmd(lines, caption = nil) puts %Q[<div class="cmd-code">] puts %Q(<p class="caption">#{caption}</p>) unless caption.nil? print %Q[<pre class="cmd">] lines.each do |line| puts detab(line) end puts '</pre>' puts '</div>' end def quotedlist(lines, css_class) print %Q[<blockquote><pre class="#{css_class}">] lines.each do |line| puts detab(line) end puts '</pre></blockquote>' end private :quotedlist def quote(lines) if ReVIEW.book.param["deprecated-blocklines"].nil? blocked_lines = split_paragraph(lines) puts "<blockquote>#{blocked_lines.join("\n")}</blockquote>" else puts "<blockquote><pre>#{lines.join("\n")}</pre></blockquote>" end end def doorquote(lines, ref) if ReVIEW.book.param["deprecated-blocklines"].nil? blocked_lines = split_paragraph(lines) puts %Q[<blockquote style="text-align:right;">] puts "#{blocked_lines.join("\n")}" puts %Q[<p>#{ref}より</p>] puts %Q[</blockquote>] else puts <<-QUOTE <blockquote style="text-align:right;"> <pre>#{lines.join("\n")} #{ref}より</pre> </blockquote> QUOTE end end def talk(lines) puts %Q[<div class="talk">] if ReVIEW.book.param["deprecated-blocklines"].nil? blocked_lines = split_paragraph(lines) puts "#{blocked_lines.join("\n")}" else print '<pre>' puts "#{lines.join("\n")}" puts '</pre>' end puts '</div>' end def texequation(lines) puts %Q[<div class="equation">] if ReVIEW.book.param["mathml"] p = MathML::LaTeX::Parser.new(:symbol=>MathML::Symbol::CharacterReference) puts p.parse(unescape_html(lines.join("\n")), true) else print '<pre>' puts "#{lines.join("\n")}" puts '</pre>' end puts '</div>' end def handle_metric(str) if str =~ /\Ascale=([\d.]+)\Z/ return "width=\"#{($1.to_f * 100).round}%\"" else k, v = str.split('=', 2) return %Q|#{k}=\"#{v.sub(/\A["']/, '').sub(/["']\Z/, '')}\"| end end def result_metric(array) " #{array.join(' ')}" end def image_image(id, caption, metric) metrics = parse_metric("html", metric) puts %Q[<div class="image">] puts %Q[<img src="#{@chapter.image(id).path.sub(/\A\.\//, "")}" alt="#{escape_html(compile_inline(caption))}"#{metrics} />] image_header id, caption puts %Q[</div>] end def image_dummy(id, caption, lines) puts %Q[<div class="image">] puts %Q[<pre class="dummyimage">] lines.each do |line| puts detab(line) end puts %Q[</pre>] image_header id, caption puts %Q[</div>] end def image_header(id, caption) puts %Q[<p class="caption">] if get_chap.nil? puts %Q[#{I18n.t("image")}#{I18n.t("format_number_header_without_chapter", [@chapter.image(id).number])}#{I18n.t("caption_prefix")}#{compile_inline(caption)}] else puts %Q[#{I18n.t("image")}#{I18n.t("format_number_header", [get_chap, @chapter.image(id).number])}#{I18n.t("caption_prefix")}#{compile_inline(caption)}] end puts %Q[</p>] end def table(lines, id = nil, caption = nil) rows = [] sepidx = nil lines.each_with_index do |line, idx| if /\A[\=\-]{12}/ =~ line # just ignore #error "too many table separator" if sepidx sepidx ||= idx next end rows.push line.strip.split(/\t+/).map {|s| s.sub(/\A\./, '') } end rows = adjust_n_cols(rows) puts %Q[<div class="table">] begin table_header id, caption unless caption.nil? rescue KeyError error "no such table: #{id}" end table_begin rows.first.size return if rows.empty? if sepidx sepidx.times do tr rows.shift.map {|s| th(s) } end rows.each do |cols| tr cols.map {|s| td(s) } end else rows.each do |cols| h, *cs = *cols tr [th(h)] + cs.map {|s| td(s) } end end table_end puts %Q[</div>] end def table_header(id, caption) if get_chap.nil? puts %Q[<p class="caption">#{I18n.t("table")}#{I18n.t("format_number_header_without_chapter", [@chapter.table(id).number])}#{I18n.t("caption_prefix")}#{compile_inline(caption)}</p>] else puts %Q[<p class="caption">#{I18n.t("table")}#{I18n.t("format_number_header", [get_chap, @chapter.table(id).number])}#{I18n.t("caption_prefix")}#{compile_inline(caption)}</p>] end end def table_begin(ncols) puts '<table>' end def tr(rows) puts "<tr>#{rows.join}</tr>" end def th(str) "<th>#{str}</th>" end def td(str) "<td>#{str}</td>" end def table_end puts '</table>' end def comment(lines, comment = nil) lines ||= [] lines.unshift comment unless comment.blank? if ReVIEW.book.param["draft"] str = lines.map{|line| escape_html(line) }.join("<br />") puts %Q(<div class="draft-comment">#{str}</div>) else str = lines.join("\n") puts %Q(<!-- #{escape_html(str)} -->) end end def footnote(id, str) if ReVIEW.book.param["epubversion"].to_i == 3 puts %Q(<div class="footnote" epub:type="footnote" id="fn-#{id}"><p class="footnote">[*#{@chapter.footnote(id).number}] #{compile_inline(str)}</p></div>) else puts %Q(<div class="footnote"><p class="footnote">[<a id="fn-#{id}">*#{@chapter.footnote(id).number}</a>] #{compile_inline(str)}</p></div>) end end def indepimage(id, caption="", metric=nil) metrics = parse_metric("html", metric) caption = "" if caption.nil? puts %Q[<div class="image">] begin puts %Q[<img src="#{@chapter.image(id).path.sub(/\A\.\//, "")}" alt="#{escape_html(compile_inline(caption))}"#{metrics} />] rescue puts %Q[<pre>missing image: #{id}</pre>] end unless caption.empty? puts %Q[<p class="caption">] puts %Q[#{I18n.t("numberless_image")}#{I18n.t("caption_prefix")}#{compile_inline(caption)}] puts %Q[</p>] end puts %Q[</div>] end alias :numberlessimage indepimage def hr puts "<hr />" end def label(id) puts %Q(<a id="#{id}"></a>) end def linebreak puts "<br />" end def pagebreak puts %Q(<br class="pagebreak" />) end def bpo(lines) puts "<bpo>" lines.each do |line| puts detab(line) end puts "</bpo>" end def noindent @noindent = true end def inline_labelref(idref) %Q[<a target='#{escape_html(idref)}'>「●● #{escape_html(idref)}」</a>] end alias inline_ref inline_labelref def inline_chapref(id) title = super if ReVIEW.book.param["chapterlink"] %Q(<a href="./#{id}.html">#{title}</a>) else title end rescue KeyError error "unknown chapter: #{id}" nofunc_text("[UnknownChapter:#{id}]") end def inline_chap(id) if ReVIEW.book.param["chapterlink"] %Q(<a href="./#{id}.html">#{@chapter.env.chapter_index.number(id)}</a>) else @chapter.env.chapter_index.number(id) end rescue KeyError error "unknown chapter: #{id}" nofunc_text("[UnknownChapter:#{id}]") end def inline_title(id) if ReVIEW.book.param["chapterlink"] %Q(<a href="./#{id}.html">#{compile_inline(@chapter.env.chapter_index.title(id))}</a>) else @chapter.env.chapter_index.title(id) end rescue KeyError error "unknown chapter: #{id}" nofunc_text("[UnknownChapter:#{id}]") end def inline_fn(id) if ReVIEW.book.param["epubversion"].to_i == 3 %Q(<a href="#fn-#{id}" class="noteref" epub:type="noteref">*#{@chapter.footnote(id).number}</a>) else %Q(<a href="#fn-#{id}" class="noteref">*#{@chapter.footnote(id).number}</a>) end end def compile_ruby(base, ruby) if ReVIEW.book.param["htmlversion"].to_i == 5 %Q[<ruby>#{escape_html(base)}<rp>#{I18n.t("ruby_prefix")}</rp><rt>#{escape_html(ruby)}</rt><rp>#{I18n.t("ruby_postfix")}</rp></ruby>] else %Q[<ruby><rb>#{escape_html(base)}</rb><rp>#{I18n.t("ruby_prefix")}</rp><rt>#{ruby}</rt><rp>#{I18n.t("ruby_postfix")}</rp></ruby>] end end def compile_kw(word, alt) %Q[<b class="kw">] + if alt then escape_html(word + " (#{alt.strip})") else escape_html(word) end + "</b><!-- IDX:#{escape_html(word)} -->" end def inline_i(str) %Q(<i>#{escape_html(str)}</i>) end def inline_b(str) %Q(<b>#{escape_html(str)}</b>) end def inline_ami(str) %Q(<span class="ami">#{escape_html(str)}</span>) end def inline_bou(str) %Q(<span class="bou">#{escape_html(str)}</span>) end def inline_tti(str) if ReVIEW.book.param["htmlversion"].to_i == 5 %Q(<code class="tt"><i>#{escape_html(str)}</i></code>) else %Q(<tt><i>#{escape_html(str)}</i></tt>) end end def inline_ttb(str) if ReVIEW.book.param["htmlversion"].to_i == 5 %Q(<code class="tt"><b>#{escape_html(str)}</b></code>) else %Q(<tt><b>#{escape_html(str)}</b></tt>) end end def inline_dtp(str) "<?dtp #{str} ?>" end def inline_code(str) if ReVIEW.book.param["htmlversion"].to_i == 5 %Q(<code class="inline-code tt">#{escape_html(str)}</code>) else %Q(<tt class="inline-code">#{escape_html(str)}</tt>) end end def inline_idx(str) %Q(#{escape_html(str)}<!-- IDX:#{escape_html(str)} -->) end def inline_hidx(str) %Q(<!-- IDX:#{escape_html(str)} -->) end def inline_br(str) %Q(<br />) end def inline_m(str) if ReVIEW.book.param["mathml"] p = MathML::LaTeX::Parser.new(:symbol=>MathML::Symbol::CharacterReference) %Q[<span class="equation">#{p.parse(str, nil)}</span>] else %Q[<span class="equation">#{escape_html(str)}</span>] end end def text(str) str end def bibpaper(lines, id, caption) puts %Q[<div class="bibpaper">] bibpaper_header id, caption unless lines.empty? bibpaper_bibpaper id, caption, lines end puts "</div>" end def bibpaper_header(id, caption) print %Q(<a id="bib-#{id}">) print "[#{@chapter.bibpaper(id).number}]" print %Q(</a>) puts " #{compile_inline(caption)}" end def bibpaper_bibpaper(id, caption, lines) print split_paragraph(lines).join("") end def inline_bib(id) %Q(<a href=".#{@book.bib_file.gsub(/re\Z/, "html")}#bib-#{id}">[#{@chapter.bibpaper(id).number}]</a>) end def inline_hd_chap(chap, id) n = chap.headline_index.number(id) if chap.number and ReVIEW.book.param["secnolevel"] >= n.split('.').size str = "「#{n} #{compile_inline(chap.headline(id).caption)}」" else str = "「#{compile_inline(chap.headline(id).caption)}」" end if ReVIEW.book.param["chapterlink"] anchor = "h"+n.gsub(/\./, "-") %Q(<a href="#{chap.id}.html\##{anchor}">#{str}</a>) else str end end def column_label(id) num = @chapter.column(id).number "column-#{num}" end private :column_label def inline_column(id) if ReVIEW.book.param["chapterlink"] %Q(<a href="\##{column_label(id)}" class="columnref">#{@chapter.column(id).caption}</a>) else @chapter.column(id).caption end rescue KeyError error "unknown column: #{id}" nofunc_text("[UnknownColumn:#{id}]") end def inline_list(id) chapter, id = extract_chapter_id(id) if get_chap(chapter).nil? "#{I18n.t("list")}#{I18n.t("format_number_without_header", [chapter.list(id).number])}" else "#{I18n.t("list")}#{I18n.t("format_number", [get_chap(chapter), chapter.list(id).number])}" end rescue KeyError error "unknown list: #{id}" nofunc_text("[UnknownList:#{id}]") end def inline_table(id) chapter, id = extract_chapter_id(id) if get_chap(chapter).nil? "#{I18n.t("table")}#{I18n.t("format_number_without_chapter", [chapter.table(id).number])}" else "#{I18n.t("table")}#{I18n.t("format_number", [get_chap(chapter), chapter.table(id).number])}" end rescue KeyError error "unknown table: #{id}" nofunc_text("[UnknownTable:#{id}]") end def inline_img(id) chapter, id = extract_chapter_id(id) if get_chap(chapter).nil? "#{I18n.t("image")}#{I18n.t("format_number_without_chapter", [chapter.image(id).number])}" else "#{I18n.t("image")}#{I18n.t("format_number", [get_chap(chapter), chapter.image(id).number])}" end rescue KeyError error "unknown image: #{id}" nofunc_text("[UnknownImage:#{id}]") end def inline_asis(str, tag) %Q(<#{tag}>#{escape_html(str)}</#{tag}>) end def inline_abbr(str) inline_asis(str, "abbr") end def inline_acronym(str) inline_asis(str, "acronym") end def inline_cite(str) inline_asis(str, "cite") end def inline_dfn(str) inline_asis(str, "dfn") end def inline_em(str) inline_asis(str, "em") end def inline_kbd(str) inline_asis(str, "kbd") end def inline_samp(str) inline_asis(str, "samp") end def inline_strong(str) inline_asis(str, "strong") end def inline_var(str) inline_asis(str, "var") end def inline_big(str) inline_asis(str, "big") end def inline_small(str) inline_asis(str, "small") end def inline_sub(str) inline_asis(str, "sub") end def inline_sup(str) inline_asis(str, "sup") end def inline_tt(str) if ReVIEW.book.param["htmlversion"].to_i == 5 %Q(<code class="tt">#{escape_html(str)}</code>) else %Q(<tt>#{escape_html(str)}</tt>) end end def inline_del(str) inline_asis(str, "del") end def inline_ins(str) inline_asis(str, "ins") end def inline_u(str) %Q(<u>#{escape_html(str)}</u>) end def inline_recipe(str) %Q(<span class="recipe">「#{escape_html(str)}」</span>) end def inline_icon(id) begin %Q[<img src="#{@chapter.image(id).path.sub(/\A\.\//, "")}" alt="[#{id}]" />] rescue %Q[<pre>missing image: #{id}</pre>] end end def inline_uchar(str) %Q(&#x#{str};) end def inline_comment(str) if ReVIEW.book.param["draft"] %Q(<span class="draft-comment">#{escape_html(str)}</span>) else %Q(<!-- #{escape_html(str)} -->) end end def inline_raw(str) super(str) end def nofunc_text(str) escape_html(str) end def compile_href(url, label) %Q(<a href="#{escape_html(url)}" class="link">#{label.nil? ? escape_html(url) : escape_html(label)}</a>) end def flushright(lines) if ReVIEW.book.param["deprecated-blocklines"].nil? puts split_paragraph(lines).join("\n").gsub("<p>", "<p class=\"flushright\">") else puts %Q[<div style="text-align:right;">] print %Q[<pre class="flushright">] lines.each {|line| puts detab(line) } puts '</pre>' puts '</div>' end end def centering(lines) puts split_paragraph(lines).join("\n").gsub("<p>", "<p class=\"center\">") end def image_ext "png" end def olnum(num) @ol_num = num.to_i end end end # module ReVIEW
# -*- encoding: utf-8 -*- lib = File.expand_path('../lib', __FILE__) $LOAD_PATH.unshift(lib) unless $LOAD_PATH.include?(lib) require 'proc_index/version' Gem::Specification.new do |gem| gem.name = "proc_index" gem.version = ProcIndex::VERSION gem.summary = "Process table ORM" gem.description = "Map and search all your processes." gem.license = "MIT" gem.authors = ["Alex Manelis"] gem.email = "amanelis@gmail.com" gem.homepage = "https://rubygems.org/gems/proc_index" gem.files = `git ls-files`.split($/) `git submodule --quiet foreach --recursive pwd`.split($/).each do |submodule| submodule.sub!("#{Dir.pwd}/",'') Dir.chdir(submodule) do `git ls-files`.split($/).map do |subpath| gem.files << File.join(submodule,subpath) end end end gem.executables = gem.files.grep(%r{^bin/}).map{ |f| File.basename(f) } gem.test_files = gem.files.grep(%r{^(test|spec|features)/}) gem.require_paths = ['lib'] gem.add_dependency 'awesome_print', '1.6.1' gem.add_dependency 'fuzzy_match', '2.1.0' gem.add_runtime_dependency 'hashie', '~> 2.1.1' gem.add_development_dependency 'pry', '~> 0.10.3' gem.add_development_dependency 'bundler', '~> 1.10' gem.add_development_dependency 'rake', '~> 10.0' gem.add_development_dependency 'rdoc', '~> 4.0' gem.add_development_dependency 'rspec', '~> 3.0' gem.add_development_dependency 'rubygems-tasks', '~> 0.2' end Symantic errors :) # -*- encoding: utf-8 -*- lib = File.expand_path('../lib', __FILE__) $LOAD_PATH.unshift(lib) unless $LOAD_PATH.include?(lib) require 'proc_index/version' Gem::Specification.new do |gem| gem.name = "proc_index" gem.version = ProcIndex::VERSION gem.summary = "Process table ORM" gem.description = "Map and search all your processes." gem.license = "MIT" gem.authors = ["Alex Manelis"] gem.email = "amanelis@gmail.com" gem.homepage = "https://rubygems.org/gems/proc_index" gem.files = `git ls-files`.split($/) `git submodule --quiet foreach --recursive pwd`.split($/).each do |submodule| submodule.sub!("#{Dir.pwd}/",'') Dir.chdir(submodule) do `git ls-files`.split($/).map do |subpath| gem.files << File.join(submodule,subpath) end end end gem.executables = gem.files.grep(%r{^bin/}).map{ |f| File.basename(f) } gem.test_files = gem.files.grep(%r{^(test|spec|features)/}) gem.require_paths = ['lib'] gem.add_dependency 'awesome_print', '1.6.1' gem.add_dependency 'fuzzy_match', '2.1.0' gem.add_runtime_dependency 'hashie', '~> 2.1', '>= 2.1.1' gem.add_development_dependency 'pry', '~> 0.10.3' gem.add_development_dependency 'bundler', '~> 1.10' gem.add_development_dependency 'rake', '~> 10.0' gem.add_development_dependency 'rdoc', '~> 4.0' gem.add_development_dependency 'rspec', '~> 3.0' gem.add_development_dependency 'rubygems-tasks', '~> 0.2' end
# coding: utf-8 $:.unshift "." require 'spec_helper' require 'rdf/spec/writer' describe JSON::LD::API do describe ".fromRDF" do context "simple tests" do it "One subject IRI object" do input = %(<http://a/b> <http://a/c> <http://a/d> .) serialize(input).should produce([ { '@id' => "http://a/b", "http://a/c" => [{"@id" => "http://a/d"}] }, { '@id' => 'http://a/d' } ], @debug) end it "should generate object list" do input = %(@prefix : <http://example.com/> . :b :c :d, :e .) serialize(input). should produce([{ '@id' => "http://example.com/b", "http://example.com/c" => [ {"@id" => "http://example.com/d"}, {"@id" => "http://example.com/e"} ] }, {"@id" => "http://example.com/d"}, {"@id" => "http://example.com/e"} ], @debug) end it "should generate property list" do input = %(@prefix : <http://example.com/> . :b :c :d; :e :f .) serialize(input). should produce([{ '@id' => "http://example.com/b", "http://example.com/c" => [{"@id" => "http://example.com/d"}], "http://example.com/e" => [{"@id" => "http://example.com/f"}] }, {"@id" => "http://example.com/d"}, {"@id" => "http://example.com/f"} ], @debug) end it "serializes multiple subjects" do input = %q( @prefix : <http://www.w3.org/2006/03/test-description#> . @prefix dc: <http://purl.org/dc/elements/1.1/> . <test-cases/0001> a :TestCase . <test-cases/0002> a :TestCase . ) serialize(input). should produce([ {'@id' => "http://www.w3.org/2006/03/test-description#TestCase"}, {'@id' => "test-cases/0001", '@type' => ["http://www.w3.org/2006/03/test-description#TestCase"]}, {'@id' => "test-cases/0002", '@type' => ["http://www.w3.org/2006/03/test-description#TestCase"]}, ], @debug) end end context "literals" do context "coercion" do it "typed literal" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b "foo"^^ex:d .) serialize(input).should produce([ { '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => "foo", "@type" => "http://example.com/d"}] } ], @debug) end it "integer" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b 1 .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => 1}] }], @debug) end it "integer (non-native)" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b 1 .) serialize(input, :useNativeTypes => false).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => "1","@type" => "http://www.w3.org/2001/XMLSchema#integer"}] }], @debug) end it "boolean" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b true .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => true}] }], @debug) end it "boolean (non-native)" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b true .) serialize(input, :useNativeTypes => false).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => "true","@type" => "http://www.w3.org/2001/XMLSchema#boolean"}] }], @debug) end it "decmal" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b 1.0 .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => "1.0", "@type" => "http://www.w3.org/2001/XMLSchema#decimal"}] }], @debug) end it "double" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b 1.0e0 .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => 1.0E0}] }], @debug) end it "double (non-native)" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b 1.0e0 .) serialize(input, :useNativeTypes => false).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => "1.0E0","@type" => "http://www.w3.org/2001/XMLSchema#double"}] }], @debug) end end context "datatyped (non-native)" do { :integer => 1, :unsignedInteger => 1, :nonNegativeInteger => 1, :float => 1, :nonPositiveInteger => -1, :negativeInteger => -1, }.each do |t, v| it "#{t}" do input = %( @prefix xsd: <http://www.w3.org/2001/XMLSchema#> . @prefix ex: <http://example.com/> . ex:a ex:b "#{v}"^^xsd:#{t} . ) serialize(input, :useNativeTypes => false).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => "#{v}","@type" => "http://www.w3.org/2001/XMLSchema##{t}"}] }], @debug) end end end it "encodes language literal" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b "foo"@en-us .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => "foo", "@language" => "en-us"}] }], @debug) end end context "anons" do it "should generate bare anon" do input = %(@prefix : <http://example.com/> . _:a :a :b .) serialize(input).should produce([ { "@id" => "_:a", "http://example.com/a" => [{"@id" => "http://example.com/b"}] }, {"@id" => "http://example.com/b"} ], @debug) end it "should generate anon as object" do input = %(@prefix : <http://example.com/> . :a :b _:a . _:a :c :d .) serialize(input).should produce([ { "@id" => "_:a", "http://example.com/c" => [{"@id" => "http://example.com/d"}] }, { "@id" => "http://example.com/a", "http://example.com/b" => [{"@id" => "_:a"}] }, {"@id" => "http://example.com/d"}, ], @debug) end end context "lists" do it "should generate literal list" do input = %( @prefix : <http://example.com/> . @prefix rdf: <http://www.w3.org/1999/02/22-rdf-syntax-ns#> . :a :b ("apple" "banana") . ) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{ "@list" => [ {"@value" => "apple"}, {"@value" => "banana"} ] }] }], @debug) end it "should generate iri list" do input = %(@prefix : <http://example.com/> . :a :b (:c) .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{ "@list" => [ {"@id" => "http://example.com/c"} ] }] }, {"@id" => "http://example.com/c"}], @debug) end it "should generate empty list" do input = %(@prefix : <http://example.com/> . :a :b () .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@list" => []}] }], @debug) end it "should generate single element list" do input = %(@prefix : <http://example.com/> . :a :b ( "apple" ) .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@list" => [{"@value" => "apple"}]}] }], @debug) end it "should generate single element list without @type" do input = %( @prefix : <http://example.com/> . :a :b ( _:a ) . _:a :b "foo" .) serialize(input).should produce([ { '@id' => "_:a", "http://example.com/b" => [{"@value" => "foo"}] }, { '@id' => "http://example.com/a", "http://example.com/b" => [{"@list" => [{"@id" => "_:a"}]}] }, ], @debug) end end context "quads" do { "simple named graph" => { :input => %( <http://example.com/a> <http://example.com/b> <http://example.com/c> <http://example.com/U> . ), :output => [ { "@id" => "http://example.com/U", "@graph" => [{ "@id" => "http://example.com/a", "http://example.com/b" => [{"@id" => "http://example.com/c"}] }, {"@id" => "http://example.com/c"}] }, ] }, "with properties" => { :input => %( <http://example.com/a> <http://example.com/b> <http://example.com/c> <http://example.com/U> . <http://example.com/U> <http://example.com/d> <http://example.com/e> . ), :output => [ { "@id" => "http://example.com/U", "@graph" => [{ "@id" => "http://example.com/a", "http://example.com/b" => [{"@id" => "http://example.com/c"}] }, {"@id" => "http://example.com/c"}], "http://example.com/d" => [{"@id" => "http://example.com/e"}] }, {"@id" => "http://example.com/e"} ] }, "with lists" => { :input => %( <http://example.com/a> <http://example.com/b> _:a <http://example.com/U> . _:a <http://www.w3.org/1999/02/22-rdf-syntax-ns#first> <http://example.com/c> <http://example.com/U> . _:a <http://www.w3.org/1999/02/22-rdf-syntax-ns#rest> <http://www.w3.org/1999/02/22-rdf-syntax-ns#nil> <http://example.com/U> . <http://example.com/U> <http://example.com/d> _:b . _:b <http://www.w3.org/1999/02/22-rdf-syntax-ns#first> <http://example.com/e> . _:b <http://www.w3.org/1999/02/22-rdf-syntax-ns#rest> <http://www.w3.org/1999/02/22-rdf-syntax-ns#nil> . ), :output => [ { "@id" => "http://example.com/U", "@graph" => [{ "@id" => "http://example.com/a", "http://example.com/b" => [{"@list" => [{"@id" => "http://example.com/c"}]}] }, {"@id" => "http://example.com/c"}], "http://example.com/d" => [{"@list" => [{"@id" => "http://example.com/e"}]}] }, {"@id" => "http://example.com/e"} ] }, "Two Graphs with same subject and lists" => { :input => %( <http://example.com/a> <http://example.com/b> _:a <http://example.com/U> . _:a <http://www.w3.org/1999/02/22-rdf-syntax-ns#first> <http://example.com/c> <http://example.com/U> . _:a <http://www.w3.org/1999/02/22-rdf-syntax-ns#rest> <http://www.w3.org/1999/02/22-rdf-syntax-ns#nil> <http://example.com/U> . <http://example.com/a> <http://example.com/b> _:b <http://example.com/V> . _:b <http://www.w3.org/1999/02/22-rdf-syntax-ns#first> <http://example.com/e> <http://example.com/V> . _:b <http://www.w3.org/1999/02/22-rdf-syntax-ns#rest> <http://www.w3.org/1999/02/22-rdf-syntax-ns#nil> <http://example.com/V> . ), :output => [ { "@id" => "http://example.com/U", "@graph" => [ { "@id" => "http://example.com/a", "http://example.com/b" => [{ "@list" => [{"@id" => "http://example.com/c"}] }] }, {"@id" => "http://example.com/c"} ] }, { "@id" => "http://example.com/V", "@graph" => [ { "@id" => "http://example.com/a", "http://example.com/b" => [{ "@list" => [{"@id" => "http://example.com/e"}] }] }, {"@id" => "http://example.com/e"} ] } ] }, }.each_pair do |name, properties| it name do r = serialize(properties[:input], :reader => RDF::NQuads::Reader) r.should produce(properties[:output], @debug) end end end context "useRdfType option" do it "uses @type if set to false" do input = %(@prefix ex: <http://example.com/> . ex:a a ex:b .) serialize(input, :useRdfType => false).should produce([{ '@id' => "http://example.com/a", "@type" => ["http://example.com/b"] }, {'@id' => "http://example.com/b"}], @debug) end it "does not use @type if set to true" do input = %(@prefix ex: <http://example.com/> . ex:a a ex:b .) serialize(input, :useRdfType => true).should produce([{ '@id' => "http://example.com/a", '@type' => ["http://example.com/b"] }, {"@id" => "http://example.com/b"}], @debug) end end context "problems" do { "xsd:boolean as value" => [ %( @prefix rdfs: <http://www.w3.org/2000/01/rdf-schema#> . @prefix xsd: <http://www.w3.org/2001/XMLSchema#> . <http://data.wikia.com/terms#playable> rdfs:range xsd:boolean . ), [{ "@id" => "http://data.wikia.com/terms#playable", "http://www.w3.org/2000/01/rdf-schema#range" => [ { "@id" => "http://www.w3.org/2001/XMLSchema#boolean" } ] }, { "@id" => "http://www.w3.org/2001/XMLSchema#boolean" }] ], }.each do |t, (input, output)| it "#{t}" do serialize(input).should produce(output, @debug) end end end end def parse(input, options = {}) reader = options[:reader] || RDF::Turtle::Reader RDF::Repository.new << reader.new(input, options) end # Serialize ntstr to a string and compare against regexps def serialize(ntstr, options = {}) @debug = [] @debug << ntstr if ntstr.is_a?(String) g = ntstr.is_a?(String) ? parse(ntstr, options) : ntstr @debug << g.dump(:trig) statements = g.each_statement.to_a JSON::LD::API.fromRDF(statements, options.merge(:debug => @debug)) end end More fromRdf test updates. # coding: utf-8 $:.unshift "." require 'spec_helper' require 'rdf/spec/writer' describe JSON::LD::API do describe ".fromRDF" do context "simple tests" do it "One subject IRI object" do input = %(<http://a/b> <http://a/c> <http://a/d> .) serialize(input).should produce([ { '@id' => "http://a/b", "http://a/c" => [{"@id" => "http://a/d"}] } ], @debug) end it "should generate object list" do input = %(@prefix : <http://example.com/> . :b :c :d, :e .) serialize(input). should produce([{ '@id' => "http://example.com/b", "http://example.com/c" => [ {"@id" => "http://example.com/d"}, {"@id" => "http://example.com/e"} ] } ], @debug) end it "should generate property list" do input = %(@prefix : <http://example.com/> . :b :c :d; :e :f .) serialize(input). should produce([{ '@id' => "http://example.com/b", "http://example.com/c" => [{"@id" => "http://example.com/d"}], "http://example.com/e" => [{"@id" => "http://example.com/f"}] } ], @debug) end it "serializes multiple subjects" do input = %q( @prefix : <http://www.w3.org/2006/03/test-description#> . @prefix dc: <http://purl.org/dc/elements/1.1/> . <test-cases/0001> a :TestCase . <test-cases/0002> a :TestCase . ) serialize(input). should produce([ {'@id' => "test-cases/0001", '@type' => ["http://www.w3.org/2006/03/test-description#TestCase"]}, {'@id' => "test-cases/0002", '@type' => ["http://www.w3.org/2006/03/test-description#TestCase"]}, ], @debug) end end context "literals" do context "coercion" do it "typed literal" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b "foo"^^ex:d .) serialize(input).should produce([ { '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => "foo", "@type" => "http://example.com/d"}] } ], @debug) end it "integer" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b 1 .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => 1}] }], @debug) end it "integer (non-native)" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b 1 .) serialize(input, :useNativeTypes => false).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => "1","@type" => "http://www.w3.org/2001/XMLSchema#integer"}] }], @debug) end it "boolean" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b true .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => true}] }], @debug) end it "boolean (non-native)" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b true .) serialize(input, :useNativeTypes => false).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => "true","@type" => "http://www.w3.org/2001/XMLSchema#boolean"}] }], @debug) end it "decmal" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b 1.0 .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => "1.0", "@type" => "http://www.w3.org/2001/XMLSchema#decimal"}] }], @debug) end it "double" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b 1.0e0 .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => 1.0E0}] }], @debug) end it "double (non-native)" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b 1.0e0 .) serialize(input, :useNativeTypes => false).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => "1.0E0","@type" => "http://www.w3.org/2001/XMLSchema#double"}] }], @debug) end end context "datatyped (non-native)" do { :integer => 1, :unsignedInteger => 1, :nonNegativeInteger => 1, :float => 1, :nonPositiveInteger => -1, :negativeInteger => -1, }.each do |t, v| it "#{t}" do input = %( @prefix xsd: <http://www.w3.org/2001/XMLSchema#> . @prefix ex: <http://example.com/> . ex:a ex:b "#{v}"^^xsd:#{t} . ) serialize(input, :useNativeTypes => false).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => "#{v}","@type" => "http://www.w3.org/2001/XMLSchema##{t}"}] }], @debug) end end end it "encodes language literal" do input = %(@prefix ex: <http://example.com/> . ex:a ex:b "foo"@en-us .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@value" => "foo", "@language" => "en-us"}] }], @debug) end end context "anons" do it "should generate bare anon" do input = %(@prefix : <http://example.com/> . _:a :a :b .) serialize(input).should produce([ { "@id" => "_:a", "http://example.com/a" => [{"@id" => "http://example.com/b"}] } ], @debug) end it "should generate anon as object" do input = %(@prefix : <http://example.com/> . :a :b _:a . _:a :c :d .) serialize(input).should produce([ { "@id" => "_:a", "http://example.com/c" => [{"@id" => "http://example.com/d"}] }, { "@id" => "http://example.com/a", "http://example.com/b" => [{"@id" => "_:a"}] } ], @debug) end end context "lists" do it "should generate literal list" do input = %( @prefix : <http://example.com/> . @prefix rdf: <http://www.w3.org/1999/02/22-rdf-syntax-ns#> . :a :b ("apple" "banana") . ) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{ "@list" => [ {"@value" => "apple"}, {"@value" => "banana"} ] }] }], @debug) end it "should generate iri list" do input = %(@prefix : <http://example.com/> . :a :b (:c) .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{ "@list" => [ {"@id" => "http://example.com/c"} ] }] }], @debug) end it "should generate empty list" do input = %(@prefix : <http://example.com/> . :a :b () .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@list" => []}] }], @debug) end it "should generate single element list" do input = %(@prefix : <http://example.com/> . :a :b ( "apple" ) .) serialize(input).should produce([{ '@id' => "http://example.com/a", "http://example.com/b" => [{"@list" => [{"@value" => "apple"}]}] }], @debug) end it "should generate single element list without @type" do input = %( @prefix : <http://example.com/> . :a :b ( _:a ) . _:a :b "foo" .) serialize(input).should produce([ { '@id' => "_:a", "http://example.com/b" => [{"@value" => "foo"}] }, { '@id' => "http://example.com/a", "http://example.com/b" => [{"@list" => [{"@id" => "_:a"}]}] }, ], @debug) end end context "quads" do { "simple named graph" => { :input => %( <http://example.com/a> <http://example.com/b> <http://example.com/c> <http://example.com/U> . ), :output => [ { "@id" => "http://example.com/U", "@graph" => [{ "@id" => "http://example.com/a", "http://example.com/b" => [{"@id" => "http://example.com/c"}] }] }, ] }, "with properties" => { :input => %( <http://example.com/a> <http://example.com/b> <http://example.com/c> <http://example.com/U> . <http://example.com/U> <http://example.com/d> <http://example.com/e> . ), :output => [ { "@id" => "http://example.com/U", "@graph" => [{ "@id" => "http://example.com/a", "http://example.com/b" => [{"@id" => "http://example.com/c"}] }], "http://example.com/d" => [{"@id" => "http://example.com/e"}] } ] }, "with lists" => { :input => %( <http://example.com/a> <http://example.com/b> _:a <http://example.com/U> . _:a <http://www.w3.org/1999/02/22-rdf-syntax-ns#first> <http://example.com/c> <http://example.com/U> . _:a <http://www.w3.org/1999/02/22-rdf-syntax-ns#rest> <http://www.w3.org/1999/02/22-rdf-syntax-ns#nil> <http://example.com/U> . <http://example.com/U> <http://example.com/d> _:b . _:b <http://www.w3.org/1999/02/22-rdf-syntax-ns#first> <http://example.com/e> . _:b <http://www.w3.org/1999/02/22-rdf-syntax-ns#rest> <http://www.w3.org/1999/02/22-rdf-syntax-ns#nil> . ), :output => [ { "@id" => "http://example.com/U", "@graph" => [{ "@id" => "http://example.com/a", "http://example.com/b" => [{"@list" => [{"@id" => "http://example.com/c"}]}] }], "http://example.com/d" => [{"@list" => [{"@id" => "http://example.com/e"}]}] } ] }, "Two Graphs with same subject and lists" => { :input => %( <http://example.com/a> <http://example.com/b> _:a <http://example.com/U> . _:a <http://www.w3.org/1999/02/22-rdf-syntax-ns#first> <http://example.com/c> <http://example.com/U> . _:a <http://www.w3.org/1999/02/22-rdf-syntax-ns#rest> <http://www.w3.org/1999/02/22-rdf-syntax-ns#nil> <http://example.com/U> . <http://example.com/a> <http://example.com/b> _:b <http://example.com/V> . _:b <http://www.w3.org/1999/02/22-rdf-syntax-ns#first> <http://example.com/e> <http://example.com/V> . _:b <http://www.w3.org/1999/02/22-rdf-syntax-ns#rest> <http://www.w3.org/1999/02/22-rdf-syntax-ns#nil> <http://example.com/V> . ), :output => [ { "@id" => "http://example.com/U", "@graph" => [ { "@id" => "http://example.com/a", "http://example.com/b" => [{ "@list" => [{"@id" => "http://example.com/c"}] }] } ] }, { "@id" => "http://example.com/V", "@graph" => [ { "@id" => "http://example.com/a", "http://example.com/b" => [{ "@list" => [{"@id" => "http://example.com/e"}] }] } ] } ] }, }.each_pair do |name, properties| it name do r = serialize(properties[:input], :reader => RDF::NQuads::Reader) r.should produce(properties[:output], @debug) end end end context "useRdfType option" do it "uses @type if set to false" do input = %(@prefix ex: <http://example.com/> . ex:a a ex:b .) serialize(input, :useRdfType => false).should produce([{ '@id' => "http://example.com/a", "@type" => ["http://example.com/b"] }], @debug) end it "does not use @type if set to true" do input = %(@prefix ex: <http://example.com/> . ex:a a ex:b .) serialize(input, :useRdfType => true).should produce([{ '@id' => "http://example.com/a", '@type' => ["http://example.com/b"] }], @debug) end end context "problems" do { "xsd:boolean as value" => [ %( @prefix rdfs: <http://www.w3.org/2000/01/rdf-schema#> . @prefix xsd: <http://www.w3.org/2001/XMLSchema#> . <http://data.wikia.com/terms#playable> rdfs:range xsd:boolean . ), [{ "@id" => "http://data.wikia.com/terms#playable", "http://www.w3.org/2000/01/rdf-schema#range" => [ { "@id" => "http://www.w3.org/2001/XMLSchema#boolean" } ] }] ], }.each do |t, (input, output)| it "#{t}" do serialize(input).should produce(output, @debug) end end end end def parse(input, options = {}) reader = options[:reader] || RDF::Turtle::Reader RDF::Repository.new << reader.new(input, options) end # Serialize ntstr to a string and compare against regexps def serialize(ntstr, options = {}) @debug = [] @debug << ntstr if ntstr.is_a?(String) g = ntstr.is_a?(String) ? parse(ntstr, options) : ntstr @debug << g.dump(:trig) statements = g.each_statement.to_a JSON::LD::API.fromRDF(statements, options.merge(:debug => @debug)) end end
require 'spec_helper' describe JSON::JWE do let(:private_key_path) { der_file_path 'rsa/private_key' } describe '#content_type' do let(:jwe) { JSON::JWE.new 'hello' } it do jwe.content_type.should == 'application/jose' end end describe 'encrypt!' do shared_examples_for :unexpected_algorithm_for_encryption do it do expect do jwe.encrypt!(key).to_s # NOTE: encrypt! won't raise, but to_s does. might need to fix. end.to raise_error JSON::JWE::UnexpectedAlgorithm end end shared_examples_for :unsupported_algorithm_for_encryption do it do expect do jwe.encrypt!(key).to_s # NOTE: encrypt! won't raise, but to_s does. might need to fix. end.to raise_error NotImplementedError end end context 'when plaintext given' do let(:plain_text) { 'Hello World' } let(:jwe) { JSON::JWE.new plain_text } context 'when alg=dir' do it :TODO end context 'when alg=A128KW' do it :TODO end context 'when alg=A256KW' do it :TODO end context 'when unknonw/unsupported algorithm given' do let(:key) { public_key } let(:alg) { :RSA1_5 } let(:enc) { :'A128CBC-HS256' } before { jwe.alg, jwe.enc = alg, enc } context 'when alg=unknown' do let(:alg) { :unknown } it_behaves_like :unexpected_algorithm_for_encryption end context 'when enc=unknown' do let(:enc) { :unknown } it_behaves_like :unexpected_algorithm_for_encryption end [:'ECDH-ES', :'ECDH-ES+A128KW', :'ECDH-ES+A256KW'].each do |alg| context "when alg=#{alg}" do let(:alg) { alg } it_behaves_like :unsupported_algorithm_for_encryption end end end end end describe 'decrypt!' do let(:plain_text) { 'Hello World' } let(:jwe_string) do _jwe_ = JSON::JWE.new plain_text _jwe_.alg, _jwe_.enc = alg, enc _jwe_.encrypt! key _jwe_.to_s end let(:jwe) do _jwe_ = JSON::JWE.decode jwe_string, :skip_decryption _jwe_.alg, _jwe_.enc = alg, enc _jwe_ end shared_examples_for :decryptable do it do jwe.decrypt! key jwe.plain_text.should == plain_text end end shared_examples_for :verify_cbc_authentication_tag do let(:jwe_string) do _jwe_ = JSON::JWE.new plain_text _jwe_.alg, _jwe_.enc = alg, enc _jwe_.encrypt! key _jwe_.to_s + 'tampered' end it do expect do jwe.decrypt! key end.to raise_error JSON::JWE::DecryptionFailed end end shared_examples_for :verify_gcm_authentication_tag do let(:jwe_string) do _jwe_ = JSON::JWE.new plain_text _jwe_.alg, _jwe_.enc = alg, enc _jwe_.encrypt! key header, key, iv, cipher_text, auth_tag = _jwe_.to_s.split('.') truncated_auth_tag = Base64.urlsafe_decode64(auth_tag).slice(0..-2) truncated_auth_tag = Base64.urlsafe_encode64(truncated_auth_tag, padding: false) [header, key, iv, cipher_text, truncated_auth_tag].join('.') end it do expect do jwe.decrypt! key end.to raise_error JSON::JWE::DecryptionFailed end end shared_examples_for :unexpected_algorithm_for_decryption do it do expect do jwe.decrypt! key end.to raise_error JSON::JWE::UnexpectedAlgorithm end end shared_examples_for :unsupported_algorithm_for_decryption do it do expect do jwe.decrypt! key end.to raise_error NotImplementedError end end context 'when alg=RSA1_5' do let(:alg) { :RSA1_5 } let(:key) { private_key } context 'when enc=A128GCM' do let(:enc) { :A128GCM } it_behaves_like :decryptable it_behaves_like :verify_gcm_authentication_tag end context 'when enc=A256GCM' do let(:enc) { :A256GCM } it_behaves_like :decryptable it_behaves_like :verify_gcm_authentication_tag end context 'when enc=A128CBC-HS256' do let(:enc) { :'A128CBC-HS256' } it_behaves_like :decryptable end context 'when enc=A256CBC-HS512' do let(:enc) { :'A256CBC-HS512' } it_behaves_like :decryptable end end context 'when alg=RSA-OAEP' do let(:alg) { :'RSA-OAEP' } let(:key) { private_key } context 'when enc=A128GCM' do let(:enc) { :A128GCM } it_behaves_like :decryptable it_behaves_like :verify_gcm_authentication_tag end context 'when enc=A256GCM' do let(:enc) { :A256GCM } it_behaves_like :decryptable it_behaves_like :verify_gcm_authentication_tag end context 'when enc=A128CBC-HS256' do let(:enc) { :'A128CBC-HS256' } it_behaves_like :decryptable it_behaves_like :verify_cbc_authentication_tag end context 'when enc=A256CBC-HS512' do let(:enc) { :'A256CBC-HS512' } it_behaves_like :decryptable it_behaves_like :verify_cbc_authentication_tag end end context 'when alg=dir' do let(:alg) { :dir } let(:key) { SecureRandom.random_bytes key_size } context 'when enc=A128GCM' do let(:enc) { :A128GCM } let(:key_size) { 16 } it_behaves_like :decryptable it_behaves_like :verify_gcm_authentication_tag end context 'when enc=A256GCM' do let(:enc) { :A256GCM } let(:key_size) { 32 } it_behaves_like :decryptable it_behaves_like :verify_gcm_authentication_tag end context 'when enc=A128CBC-HS256' do let(:enc) { :'A128CBC-HS256' } let(:key_size) { 32 } it_behaves_like :decryptable it_behaves_like :verify_cbc_authentication_tag end context 'when enc=A256CBC-HS512' do let(:enc) { :'A256CBC-HS512' } let(:key_size) { 64 } it_behaves_like :decryptable it_behaves_like :verify_cbc_authentication_tag end end context 'when alg=A128KW' do it :TODO end context 'when alg=A256KW' do it :TODO end context 'when unknonw/unsupported algorithm given' do let(:input) { 'header.key.iv.cipher_text.auth_tag' } let(:key) { public_key } let(:alg) { :RSA1_5 } let(:enc) { :'A128CBC-HS256' } context 'when alg=unknown' do let(:alg) { :unknown } it_behaves_like :unexpected_algorithm_for_decryption end context 'when enc=unknown' do let(:enc) { :unknown } it_behaves_like :unexpected_algorithm_for_decryption end [:'ECDH-ES', :'ECDH-ES+A128KW', :'ECDH-ES+A256KW'].each do |alg| context "when alg=#{alg}" do let(:alg) { alg } it_behaves_like :unsupported_algorithm_for_decryption end end end end end Test for CVE-2019-18848 require 'spec_helper' describe JSON::JWE do let(:private_key_path) { der_file_path 'rsa/private_key' } describe '#content_type' do let(:jwe) { JSON::JWE.new 'hello' } it do jwe.content_type.should == 'application/jose' end end describe 'encrypt!' do shared_examples_for :unexpected_algorithm_for_encryption do it do expect do jwe.encrypt!(key).to_s # NOTE: encrypt! won't raise, but to_s does. might need to fix. end.to raise_error JSON::JWE::UnexpectedAlgorithm end end shared_examples_for :unsupported_algorithm_for_encryption do it do expect do jwe.encrypt!(key).to_s # NOTE: encrypt! won't raise, but to_s does. might need to fix. end.to raise_error NotImplementedError end end context 'when plaintext given' do let(:plain_text) { 'Hello World' } let(:jwe) { JSON::JWE.new plain_text } context 'when alg=dir' do it :TODO end context 'when alg=A128KW' do it :TODO end context 'when alg=A256KW' do it :TODO end context 'when unknonw/unsupported algorithm given' do let(:key) { public_key } let(:alg) { :RSA1_5 } let(:enc) { :'A128CBC-HS256' } before { jwe.alg, jwe.enc = alg, enc } context 'when alg=unknown' do let(:alg) { :unknown } it_behaves_like :unexpected_algorithm_for_encryption end context 'when enc=unknown' do let(:enc) { :unknown } it_behaves_like :unexpected_algorithm_for_encryption end [:'ECDH-ES', :'ECDH-ES+A128KW', :'ECDH-ES+A256KW'].each do |alg| context "when alg=#{alg}" do let(:alg) { alg } it_behaves_like :unsupported_algorithm_for_encryption end end end end end describe 'decrypt!' do let(:plain_text) { 'Hello World' } let(:jwe_string) do _jwe_ = JSON::JWE.new plain_text _jwe_.alg, _jwe_.enc = alg, enc _jwe_.encrypt! key _jwe_.to_s end let(:jwe) do _jwe_ = JSON::JWE.decode jwe_string, :skip_decryption _jwe_.alg, _jwe_.enc = alg, enc _jwe_ end shared_examples_for :decryptable do it do jwe.decrypt! key jwe.plain_text.should == plain_text end end shared_examples_for :verify_cbc_authentication_tag do let(:jwe_string) do _jwe_ = JSON::JWE.new plain_text _jwe_.alg, _jwe_.enc = alg, enc _jwe_.encrypt! key hdr, extra, iv, cipher_text, _ = _jwe_.to_s.split '.' [hdr, extra, iv, cipher_text, ''].join '.' end it do # fetching those variables outside of exception block to make sure # we intercept exception in decrypt! and not in other place j = jwe k = key expect do j.decrypt! k end.to raise_error JSON::JWE::DecryptionFailed end end shared_examples_for :verify_gcm_authentication_tag do let(:jwe_string) do _jwe_ = JSON::JWE.new plain_text _jwe_.alg, _jwe_.enc = alg, enc _jwe_.encrypt! key header, key, iv, cipher_text, auth_tag = _jwe_.to_s.split('.') truncated_auth_tag = Base64.urlsafe_decode64(auth_tag).slice(0..-2) truncated_auth_tag = Base64.urlsafe_encode64(truncated_auth_tag, padding: false) [header, key, iv, cipher_text, truncated_auth_tag].join('.') end it do expect do jwe.decrypt! key end.to raise_error JSON::JWE::DecryptionFailed end end shared_examples_for :unexpected_algorithm_for_decryption do it do expect do jwe.decrypt! key end.to raise_error JSON::JWE::UnexpectedAlgorithm end end shared_examples_for :unsupported_algorithm_for_decryption do it do expect do jwe.decrypt! key end.to raise_error NotImplementedError end end context 'when alg=RSA1_5' do let(:alg) { :RSA1_5 } let(:key) { private_key } context 'when enc=A128GCM' do let(:enc) { :A128GCM } it_behaves_like :decryptable it_behaves_like :verify_gcm_authentication_tag end context 'when enc=A256GCM' do let(:enc) { :A256GCM } it_behaves_like :decryptable it_behaves_like :verify_gcm_authentication_tag end context 'when enc=A128CBC-HS256' do let(:enc) { :'A128CBC-HS256' } it_behaves_like :decryptable end context 'when enc=A256CBC-HS512' do let(:enc) { :'A256CBC-HS512' } it_behaves_like :decryptable end end context 'when alg=RSA-OAEP' do let(:alg) { :'RSA-OAEP' } let(:key) { private_key } context 'when enc=A128GCM' do let(:enc) { :A128GCM } it_behaves_like :decryptable it_behaves_like :verify_gcm_authentication_tag end context 'when enc=A256GCM' do let(:enc) { :A256GCM } it_behaves_like :decryptable it_behaves_like :verify_gcm_authentication_tag end context 'when enc=A128CBC-HS256' do let(:enc) { :'A128CBC-HS256' } it_behaves_like :decryptable it_behaves_like :verify_cbc_authentication_tag end context 'when enc=A256CBC-HS512' do let(:enc) { :'A256CBC-HS512' } it_behaves_like :decryptable it_behaves_like :verify_cbc_authentication_tag end end context 'when alg=dir' do let(:alg) { :dir } let(:key) { SecureRandom.random_bytes key_size } context 'when enc=A128GCM' do let(:enc) { :A128GCM } let(:key_size) { 16 } it_behaves_like :decryptable it_behaves_like :verify_gcm_authentication_tag end context 'when enc=A256GCM' do let(:enc) { :A256GCM } let(:key_size) { 32 } it_behaves_like :decryptable it_behaves_like :verify_gcm_authentication_tag end context 'when enc=A128CBC-HS256' do let(:enc) { :'A128CBC-HS256' } let(:key_size) { 32 } it_behaves_like :decryptable it_behaves_like :verify_cbc_authentication_tag end context 'when enc=A256CBC-HS512' do let(:enc) { :'A256CBC-HS512' } let(:key_size) { 64 } it_behaves_like :decryptable it_behaves_like :verify_cbc_authentication_tag end end context 'when alg=A128KW' do it :TODO end context 'when alg=A256KW' do it :TODO end context 'when unknonw/unsupported algorithm given' do let(:input) { 'header.key.iv.cipher_text.auth_tag' } let(:key) { public_key } let(:alg) { :RSA1_5 } let(:enc) { :'A128CBC-HS256' } context 'when alg=unknown' do let(:alg) { :unknown } it_behaves_like :unexpected_algorithm_for_decryption end context 'when enc=unknown' do let(:enc) { :unknown } it_behaves_like :unexpected_algorithm_for_decryption end [:'ECDH-ES', :'ECDH-ES+A128KW', :'ECDH-ES+A256KW'].each do |alg| context "when alg=#{alg}" do let(:alg) { alg } it_behaves_like :unsupported_algorithm_for_decryption end end end end end
require 'spec_helper' require './lib/ael_tracker/bill' describe AelTracker::Bill do it "must include httparty methods" do expect( AelTracker::Bill ).to include HTTParty end it "must have the base url set to the Dribble API endpoint" do expect( AelTracker::Bill.base_uri ).to eq 'http://www.aeltracker.org/api' end describe "GET bill" do let(:bill) { AelTracker::Bill.new("1") } before(:all) do VCR.insert_cassette 'bill', :record => :new_episodes end after(:all) do VCR.eject_cassette end it "must have an profile method" do expect( bill ).to respond_to :profile end it "must parse the api response from JSON to HASH" do expect( bill.profile ).to be_an_instance_of( Hash ) end it "records the fixture" do expect( bill.profile["bill_id"] ).to eq "1" end end end Personalize require 'spec_helper' require './lib/ael_tracker/bill' describe AelTracker::Bill do it "must include httparty methods" do expect( AelTracker::Bill ).to include HTTParty end it "must have the base url set to the AelTracker API endpoint" do expect( AelTracker::Bill.base_uri ).to eq 'http://www.aeltracker.org/api' end describe "GET bill" do let(:bill) { AelTracker::Bill.new("1") } before(:all) do VCR.insert_cassette 'bill', :record => :new_episodes end after(:all) do VCR.eject_cassette end it "must have an profile method" do expect( bill ).to respond_to :profile end it "must parse the api response from JSON to HASH" do expect( bill.profile ).to be_an_instance_of( Hash ) end it "records the fixture" do expect( bill.profile["bill_id"] ).to eq "1" end end end
require "spec_helper" require "dice" RSpec.describe Dice do describe "#new" do describe "dice" do subject {Dice.new.dice} it {is_expected.to be_an_instance_of Array} end subject {Dice.new} it {is_expected.to be_an_instance_of Dice} end end Update dice_spec.rb require "spec_helper" require "dice" RSpec.describe Dice do describe "#new" do subject {Dice.new} it {is_expected.to be_an_instance_of Dice} describe "dice" do subject {Dice.new.dice} it {is_expected.to be_an_instance_of Array} end end end
require 'rubygems' require 'sinatra' require 'mixpanel-ruby' require 'open-uri' require 'nokogiri' require 'rss' require 'pry' require 'awesome_print' require 'uuid' require 'atom' before do content_type :xml # Mixpanel token is set via 'heroku config:set MIXPANEL_TOKEN=whateverthetokenis' @mixpanel = Mixpanel::Tracker.new(ENV['MIXPANEL_TOKEN']) end class AttributeFilter # Since Nokogiri (by way of libxml) only supports XPath 1.0, we're missing # a lot of the more helpful functions. No worries, however! def contains_text node_set, text node_set.find_all { |node| node.to_s =~ /#{ text }/i } end end get '/bids/procurement.xml' do # TODO: Set unique user IDs for Mixpanel tracking. @mixpanel.track('1', 'Added Procurement feed') generate_xml('483') end get '/bids/watershed.xml' do @mixpanel.track('1', 'Added Watershed feed') generate_xml('486') end get '/bids/public-works.xml' do @mixpanel.track('1', 'Added Public Works feed') generate_xml('484') end get '/bids/general-funds.xml' do @mixpanel.track('1', 'Added General Funds feed') generate_xml('482') end def generate_xml(category) # XPaths yanked from WebKit. w00t. xpaths = { # Watershed RFPs '486' => { xpath: %{//*[@id="ctl00_content_Screen"]/table/tbody/tr[1]/td[1]/table[contains_text(., 'Award')]}, name: 'Watershed RFPs' }, '484' => { xpath: %{//*[@id="ctl00_content_Screen"]/table[2]/tbody/tr/td[1]/table[contains_text(., 'Award')]}, name: 'Public Works RFPs'}, '482' => { xpath: %{//*[@id="ctl00_content_Screen"]/table[contains_text(., 'Award')]}, name: 'General Funds RFPs' }, '483' => { xpath: %{//*[@id="ctl00_content_Screen"]/table[contains_text(., 'Award')]}, name: 'Procurement RFPs'} } return unless category doc = Nokogiri::HTML(open("http://www.atlantaga.gov/index.aspx?page=#{ category }")).remove_namespaces! bid_table = doc.xpath(xpaths[category][:xpath], AttributeFilter.new) @bid_opportunities = [] bid_table.each do |bid| _bid = {} # Try a few things to get the project number. _bid[:project_id] = bid.xpath(".//tr[contains_text(., 'Project number')]/td[2]", AttributeFilter.new)[0].content # Project name # For 483, there is no project number set out separately. project_name = bid.xpath(".//tr[contains_text(., 'Project name')]/td[2]", AttributeFilter.new)[0] if project_name != nil _bid[:name] = project_name.content end # Set up enclosures...! _enclosures = bid.xpath(".//a") @enclosures = [] _enclosures.each do |enclosure| _enclosure = {} _enclosure[:name] = enclosure.content if enclosure["href"] && enclosure["href"].to_s.include?("mailto:") _enclosure[:href] = enclosure["href"][7, enclosure["href"].length] elsif enclosure["href"] _enclosure[:href] = "http://atlantaga.gov/#{ enclosure["href"] }" end @enclosures << _enclosure end _last = @enclosures.last if _last[:href].include?("@atlantaga.gov") _bid[:contracting_officer] = @enclosures.pop end _bid[:enclosures] = @enclosures @bid_opportunities << _bid end atom = Atom::Feed.new do |feed| feed.id = "urn:uuid:#{ UUID.new.generate }" feed.title = "City of Atlanta - #{ xpaths[category][:name] }" feed.updated = Time.now.strftime("%Y-%m-%dT%H:%M:%SZ") feed.authors << Atom::Person.new(name: "Department of Procurement", email: "tiffani+DOP@codeforamerica.org") feed.generator = Atom::Generator.new(name: "Supply", version: "1.0", uri: "http://atlantaga.gov/procurement") feed.categories << Atom::Category.new(label: "#{ xpaths[category][:name] }", term: "#{ xpaths[category][:name] }") feed.rights = "Unless otherwise noted, the content, data, and documents offered through this ATOM feed are public domain and made available with a Creative Commons CC0 1.0 Universal dedication. https://creativecommons.org/publicdomain/zero/1.0/" @bid_opportunities.each do |bid_opp| if bid_opp[:contracting_officer] # Clean up names name = bid_opp[:contracting_officer][:name].gsub(/(Mr|Mrs|Ms)\.*/i, "").gsub(/,\s+(Contracting Officer|Contract Administrator)/i, "").strip contracting_officer = Atom::Person.new(name: name, email: bid_opp[:contracting_officer][:href], uri: "http://atlantaga.gov/index.aspx?page=#{ category }") end feed.entries << Atom::Entry.new do |entry| entry.id = "urn:uuid:#{ UUID.new.generate }" entry.title = "#{ bid_opp[:project_id] } - #{ bid_opp[:name].to_s }" bid_opp[:enclosures].each do |enclosure| _enclosure = Atom::Link.new(title: enclosure[:name], href: enclosure[:href], rel: "enclosure", type: "application/pdf") entry.links << _enclosure end entry.authors << contracting_officer # TODO: Don't tie this date to when someone pulls the feed. entry.updated = Time.now.strftime("%Y-%m-%dT%H:%M:%SZ") # TODO: Beef up this summary. entry.summary = "A bid announcement for #{ bid_opp[:name] }." end end end #File.open("/Users/tiffani/Desktop/rss-procurement.xml", "w") { |f| f.write(atom.to_xml)} atom.to_xml end Link to bid documents from something other than just enclosures... require 'rubygems' require 'sinatra' require 'mixpanel-ruby' require 'open-uri' require 'nokogiri' require 'rss' require 'pry' require 'awesome_print' require 'uuid' require 'atom' before do content_type :xml # Mixpanel token is set via 'heroku config:set MIXPANEL_TOKEN=whateverthetokenis' @mixpanel = Mixpanel::Tracker.new(ENV['MIXPANEL_TOKEN']) end class AttributeFilter # Since Nokogiri (by way of libxml) only supports XPath 1.0, we're missing # a lot of the more helpful functions. No worries, however! def contains_text node_set, text node_set.find_all { |node| node.to_s =~ /#{ text }/i } end end get '/bids/procurement.xml' do # TODO: Set unique user IDs for Mixpanel tracking. @mixpanel.track('1', 'Added Procurement feed') generate_xml('483') end get '/bids/watershed.xml' do @mixpanel.track('1', 'Added Watershed feed') generate_xml('486') end get '/bids/public-works.xml' do @mixpanel.track('1', 'Added Public Works feed') generate_xml('484') end get '/bids/general-funds.xml' do @mixpanel.track('1', 'Added General Funds feed') generate_xml('482') end def generate_xml(category) # XPaths yanked from WebKit. w00t. xpaths = { # Watershed RFPs '486' => { xpath: %{//*[@id="ctl00_content_Screen"]/table/tbody/tr[1]/td[1]/table[contains_text(., 'Award')]}, name: 'Watershed RFPs' }, '484' => { xpath: %{//*[@id="ctl00_content_Screen"]/table[2]/tbody/tr/td[1]/table[contains_text(., 'Award')]}, name: 'Public Works RFPs'}, '482' => { xpath: %{//*[@id="ctl00_content_Screen"]/table[contains_text(., 'Award')]}, name: 'General Funds RFPs' }, '483' => { xpath: %{//*[@id="ctl00_content_Screen"]/table[contains_text(., 'Award')]}, name: 'Procurement RFPs'} } return unless category doc = Nokogiri::HTML(open("http://www.atlantaga.gov/index.aspx?page=#{ category }")).remove_namespaces! bid_table = doc.xpath(xpaths[category][:xpath], AttributeFilter.new) @bid_opportunities = [] bid_table.each do |bid| _bid = {} # Try a few things to get the project number. _bid[:project_id] = bid.xpath(".//tr[contains_text(., 'Project number')]/td[2]", AttributeFilter.new)[0].content # Project name # For 483, there is no project number set out separately. project_name = bid.xpath(".//tr[contains_text(., 'Project name')]/td[2]", AttributeFilter.new)[0] if project_name != nil _bid[:name] = project_name.content end # Set up enclosures...! _enclosures = bid.xpath(".//a") @enclosures = [] _enclosures.each do |enclosure| _enclosure = {} _enclosure[:name] = enclosure.content if enclosure["href"] && enclosure["href"].to_s.include?("mailto:") _enclosure[:href] = enclosure["href"][7, enclosure["href"].length] elsif enclosure["href"] _enclosure[:href] = "http://atlantaga.gov/#{ enclosure["href"] }" end @enclosures << _enclosure end _last = @enclosures.last if _last[:href].include?("@atlantaga.gov") _bid[:contracting_officer] = @enclosures.pop end _bid[:enclosures] = @enclosures @bid_opportunities << _bid end atom = Atom::Feed.new do |feed| feed.id = "urn:uuid:#{ UUID.new.generate }" feed.title = "City of Atlanta - #{ xpaths[category][:name] }" feed.updated = Time.now.strftime("%Y-%m-%dT%H:%M:%SZ") feed.authors << Atom::Person.new(name: "Department of Procurement", email: "tiffani+DOP@codeforamerica.org") feed.generator = Atom::Generator.new(name: "Supply", version: "1.0", uri: "http://atlantaga.gov/procurement") feed.categories << Atom::Category.new(label: "#{ xpaths[category][:name] }", term: "#{ xpaths[category][:name] }") feed.rights = "Unless otherwise noted, the content, data, and documents offered through this ATOM feed are public domain and made available with a Creative Commons CC0 1.0 Universal dedication. https://creativecommons.org/publicdomain/zero/1.0/" @bid_opportunities.each do |bid_opp| if bid_opp[:contracting_officer] # Clean up names name = bid_opp[:contracting_officer][:name].gsub(/(Mr|Mrs|Ms)\.*/i, "").gsub(/,\s+(Contracting Officer|Contract Administrator)/i, "").strip contracting_officer = Atom::Person.new(name: name, email: bid_opp[:contracting_officer][:href], uri: "http://atlantaga.gov/index.aspx?page=#{ category }") end feed.entries << Atom::Entry.new do |entry| entry.id = "urn:uuid:#{ UUID.new.generate }" entry.title = "#{ bid_opp[:project_id] } - #{ bid_opp[:name].to_s }" entry_content = %Q{ <p> A bid announcement for #{ bid_opp[:name] }. </p> <p> Included files: <ol> #{ bid_opp[:enclosures].collect { |enclosure| %{<li><a href="#{ enclosure[:href] }">#{ enclosure[:name] }</a></li>} }.join } </ol> </p> } entry.content = Atom::Content::Html.new(entry_content) bid_opp[:enclosures].each do |enclosure| _enclosure = Atom::Link.new(title: enclosure[:name], href: enclosure[:href], rel: "enclosure", type: "application/pdf") entry.links << _enclosure end entry.authors << contracting_officer # TODO: Don't tie this date to when someone pulls the feed. entry.updated = Time.now.strftime("%Y-%m-%dT%H:%M:%SZ") # TODO: Beef up this summary. entry.summary = "A bid announcement for #{ bid_opp[:name] }." end end end #File.open("/Users/tiffani/Desktop/rss-procurement.xml", "w") { |f| f.write(atom.to_xml)} atom.to_xml end
require "base64" require "openssl" require "vagrant/util/retryable" module Vagrant module Util class Keypair extend Retryable # Creates an SSH keypair and returns it. # # @param [String] password Password for the key, or nil for no password. # @return [Array<String, String, String>] PEM-encoded public and private key, # respectively. The final element is the OpenSSH encoded public # key. def self.create(password=nil) # This sometimes fails with RSAError. It is inconsistent and strangely # sleeps seem to fix it. We just retry this a few times. See GH-5056 rsa_key = nil retryable(on: OpenSSL::PKey::RSAError, sleep: 2, tries: 5) do rsa_key = OpenSSL::PKey::RSA.new(2048) end public_key = rsa_key.public_key private_key = rsa_key.to_pem if password cipher = OpenSSL::Cipher::Cipher.new('des3') private_key = rsa_key.to_pem(cipher, password) end # Generate the binary necessary for the OpenSSH public key. binary = [7].pack("N") binary += "ssh-rsa" ["e", "n"].each do |m| val = public_key.send(m) data = val.to_s(2) first_byte = data[0,1].unpack("c").first if val < 0 data[0] = [0x80 & first_byte].pack("c") elsif first_byte < 0 data = 0.chr + data end binary += [data.length].pack("N") + data end openssh_key = "ssh-rsa #{Base64.encode64(binary).gsub("\n", "")} vagrant" public_key = public_key.to_pem return [public_key, private_key, openssh_key] end end end end Do not use deprecated API. require "base64" require "openssl" require "vagrant/util/retryable" module Vagrant module Util class Keypair extend Retryable # Creates an SSH keypair and returns it. # # @param [String] password Password for the key, or nil for no password. # @return [Array<String, String, String>] PEM-encoded public and private key, # respectively. The final element is the OpenSSH encoded public # key. def self.create(password=nil) # This sometimes fails with RSAError. It is inconsistent and strangely # sleeps seem to fix it. We just retry this a few times. See GH-5056 rsa_key = nil retryable(on: OpenSSL::PKey::RSAError, sleep: 2, tries: 5) do rsa_key = OpenSSL::PKey::RSA.new(2048) end public_key = rsa_key.public_key private_key = rsa_key.to_pem if password cipher = OpenSSL::Cipher.new('des3') private_key = rsa_key.to_pem(cipher, password) end # Generate the binary necessary for the OpenSSH public key. binary = [7].pack("N") binary += "ssh-rsa" ["e", "n"].each do |m| val = public_key.send(m) data = val.to_s(2) first_byte = data[0,1].unpack("c").first if val < 0 data[0] = [0x80 & first_byte].pack("c") elsif first_byte < 0 data = 0.chr + data end binary += [data.length].pack("N") + data end openssh_key = "ssh-rsa #{Base64.encode64(binary).gsub("\n", "")} vagrant" public_key = public_key.to_pem return [public_key, private_key, openssh_key] end end end end
module Vmdb module ConsoleMethods def enable_console_sql_logging ActiveRecord::Base.logger.level = 0 end def disable_console_sql_logging ActiveRecord::Base.logger.level = 1 end def toggle_console_sql_logging ActiveRecord::Base.logger.level == 0 ? disable_console_sql_logging : enable_console_sql_logging end def backtrace(include_external = false) caller.select { |path| include_external || path.start_with?(Rails.root.to_s) } end # Development helper method for Rails console for simulating queue workers. def simulate_queue_worker(break_on_complete = false) raise NotImplementedError, "not implemented in production mode" if Rails.env.production? Rails.logger.level = :DEBUG loop do q = MiqQueue.where(MiqQueue.arel_table[:queue_name].not_eq("miq_server")).order(:id).first if q status, message, result = q.deliver q.delivered(status, message, result) unless status == MiqQueue::STATUS_RETRY else break_on_complete ? break : sleep(1.second) end end end end end Fixed Bug in simulate_queue_worker introduced by #8085 module Vmdb module ConsoleMethods def enable_console_sql_logging ActiveRecord::Base.logger.level = 0 end def disable_console_sql_logging ActiveRecord::Base.logger.level = 1 end def toggle_console_sql_logging ActiveRecord::Base.logger.level == 0 ? disable_console_sql_logging : enable_console_sql_logging end def backtrace(include_external = false) caller.select { |path| include_external || path.start_with?(Rails.root.to_s) } end # Development helper method for Rails console for simulating queue workers. def simulate_queue_worker(break_on_complete = false) raise NotImplementedError, "not implemented in production mode" if Rails.env.production? Rails.logger.level = Logger::DEBUG loop do q = MiqQueue.where(MiqQueue.arel_table[:queue_name].not_eq("miq_server")).order(:id).first if q status, message, result = q.deliver q.delivered(status, message, result) unless status == MiqQueue::STATUS_RETRY else break_on_complete ? break : sleep(1.second) end end end end end
require 'ostruct' module Wakame # System wide configuration parameters class Configuration < OpenStruct PARAMS = { #:config_template_root => nil, #:config_tmp_root => nil, #:config_root => nil, :load_paths => [], :ssh_private_key => nil, :drb_command_server_uri => 'druby://localhost:12345', :vm_environment => nil, :amqp_server_uri => nil, :unused_vm_live_period => 60 * 10, :eventmachine_use_epoll => true } def initialize(env=WAKAME_ENV) super(PARAMS) if root_path.nil? root_path = Object.const_defined?(:WAKAME_ROOT) ? WAKAME_ROOT : '../' end @root_path = root_path #default_set.process(self) end def environment ::WAKAME_ENV.to_sym end def root_path ::WAKAME_ROOT end def ssh_known_hosts File.join(self.config_root, "ssh", "known_hosts") end def config_tmp_root File.join(self.config_root, "tmp") end def framework_root_path defined?(::WAKAME_FRAMEWORK_ROOT) ? ::WAKAME_FRAMEWORK_ROOT : "#{root_path}/vendor/wakame" end def framework_paths paths = %w(lib) paths.map{|dir| File.join(framework_root_path, dir) }.select{|path| File.directory?(path) } end # class DefaultSet def process(config) end end class EC2 < DefaultSet def process(config) super(config) config.config_template_root = File.join(config.root, "config", "template") config.config_root = '/home/wakame/config' config.vm_environment = :EC2 config.ssh_private_key = '/home/wakame/config/root.id_rsa' config.aws_access_key = '' config.aws_secret_key = '' end end class StandAlone < DefaultSet def process(config) super(config) config.config_template_root = File.join(config.root, "config", "template") config.config_root = File.join('home', 'wakame', 'config') config.vm_environment = :StandAlone config.amqp_server_uri = 'amqp://localhost/' end end end end Modified configuration variables. require 'ostruct' module Wakame # System wide configuration parameters class Configuration < OpenStruct PARAMS = { #:config_template_root => nil, #:config_tmp_root => nil, :config_root => nil, :cluster_class => 'WebCluster', :load_paths => [], :ssh_private_key => nil, :drb_command_server_uri => 'druby://localhost:12345', :amqp_server_uri => nil, :unused_vm_live_period => 60 * 10, :eventmachine_use_epoll => true } def initialize(env=WAKAME_ENV) super(PARAMS) if root_path.nil? root_path = Object.const_defined?(:WAKAME_ROOT) ? WAKAME_ROOT : '../' end @root_path = root_path self.class.const_get(env).new.process(self) end def environment ::WAKAME_ENV.to_sym end alias :vm_environment :environment def root_path ::WAKAME_ROOT end def tmp_path File.join(root_path, 'tmp') end def ssh_known_hosts File.join(self.config_root, "ssh", "known_hosts") end def config_tmp_root File.join(self.config_root, "tmp") end def framework_root_path defined?(::WAKAME_FRAMEWORK_ROOT) ? ::WAKAME_FRAMEWORK_ROOT : "#{root_path}/vendor/wakame" end def framework_paths paths = %w(lib) paths.map{|dir| File.join(framework_root_path, dir) }.select{|path| File.directory?(path) } end # class DefaultSet def process(config) end end class EC2 < DefaultSet def process(config) super(config) config.config_root = File.join(config.root_path, 'tmp', 'config') config.ssh_private_key = '/home/wakame/config/root.id_rsa' config.aws_access_key = '' config.aws_secret_key = '' end end class StandAlone < DefaultSet def process(config) super(config) config.config_root = File.join(config.root_path, 'tmp', 'config') config.amqp_server_uri = 'amqp://localhost/' end end end end
require 'open-uri' require 'mechanize' require 'nokogiri' module Waterworks class Extractor def initialize(url, store = '~/Downloads') @agent = agent(url) @store = File.expand_path(store) end def save mkdir(save_to) resources.each do |resource| display_resource_info(resource) system("wget -O '#{save_to}#{resource.destination}' '#{resource.source}'") end end protected def agent(url) Nokogiri::HTML(open(url)) end def save_to "#{@store}/#{series}/#{season}" end # return the series name def series; end # return the season name def season; end # return the title def title; end # return the download file path list def resources; end def http_response_headers(uri, redirect_limit = 5) raise ArgumentError, 'HTTP redirect too deep' if redirect_limit == 0 uri = URI.parse(uri) headers = {} Net::HTTP.start(uri.host) do |http| headers = http.head(uri.path) end case headers when Net::HTTPOK headers when Net::HTTPFound uri = headers['Location'] http_response_headers(uri, redirect_limit - 1) end headers end private def mkdir(path) Dir.mkdir(path) unless File.directory?(path) end def display_resource_info(resource) puts "Save to: #{save_to}#{resource.destination}" puts " Source: #{resource.source}" puts " Size: #{resource.size_mb} MB" end end end autoload extractors require 'open-uri' require 'mechanize' require 'nokogiri' module Waterworks class Extractor class << self def matches(uri) Dir.glob(extractor_file_paths).each do |file| require file klass = eval(filename_classify(File.basename(file, '.rb'))).new next unless klass.match?(uri) yield klass end end def filename_classify(filename) filename.split('_').map(&:capitalize).join end def extractor_file_paths [ File.expand_path("#{ENV['HOME']}/.waterworks/extractors/*.rb"), File.expand_path('./lib/waterworks/extractors/*.rb') ] end end def initialize(store = '~/Downloads') @store = File.expand_path(store) end def match?(uri) uri =~ /#{domain}/ end def save(uri) @agent = agent(uri) mkdir(save_to) resources.each do |resource| display_resource_info(resource) system("wget -O '#{save_to}#{resource.destination}' '#{resource.source}'") end end protected def agent(url) Nokogiri::HTML(open(url)) rescue Exception => e abort e.to_s end def save_to "#{@store}/#{series}/#{season}" end # return the domain def domain; end # return the series name def series; end # return the season name def season; end # return the title def title; end # return the download file path list def resources; end def http_response_headers(uri, redirect_limit = 5) raise ArgumentError, 'HTTP redirect too deep' if redirect_limit == 0 uri = URI.parse(uri) headers = {} http_request.start(uri.host) do |http| headers = http.head(uri.path) end case headers when Net::HTTPOK headers when Net::HTTPFound uri = headers['Location'] http_response_headers(uri, redirect_limit - 1) end headers end def http_request proxy_uri = ENV['https_proxy'] || ENV['http_proxy'] || false return Net::HTTP unless proxy_uri proxy = URI.parse(proxy_uri) Net::HTTP::Proxy(proxy.host, proxy.port) end private def mkdir(path) Dir.mkdir(path) unless File.directory?(path) end def display_resource_info(resource) puts "Save to: #{save_to}#{resource.destination}" puts " Source: #{resource.source}" puts " Size: #{resource.size_mb} MB" end end end
module WavesUtilities class Task def initialize(key) @key = key.to_sym end def ==(other) @key == other.to_sym end def description Task.all_task_types.find { |t| t[1] == @key }[0] end def declarations_required_on_create? [ :new_registration, :provisional, :re_registration, :renewal ].include?(@key) end def declarations_required_on_add_owner? return true if declarations_required_on_create? [:change_owner].include?(@key) end def electronic_delivery_available? [:current_transcript, :historic_transcript].include?(@key) end def ownership_can_be_changed? [ :new_registration, :provisional, :change_owner, :renewal, :re_registration, :manual_override ].include?(@key) end def address_can_be_changed? ownership_can_be_changed? || @key == :change_address end def vessel_can_be_edited? [ :new_registration, :provisional, :change_vessel, :renewal, :re_registration, :manual_override ].include?(@key) end def payment_required? ![ :change_address, :closure, :enquiry, :termination_notice, :registrar_closure, :registrar_restores_closure, :issue_csr, :manual_override].include?(@key) end def print_job_templates if prints_certificate? [:registration_certificate, :cover_letter] elsif prints_provisional_certificate? [:provisional_certificate, :cover_letter] elsif prints_current_transcript? [:current_transcript] elsif prints_historic_transcript? [:historic_transcript] elsif @key == :issue_csr [:csr_form] elsif @key == :termination_notice [:termination_notice] end end def prints_certificate? [ :new_registration, :change_owner, :change_vessel, :renewal, :duplicate_certificate, :re_registration ].include?(@key) end def prints_provisional_certificate? [:provisional].include?(@key) end def prints_current_transcript? [:closure, :current_transcript].include?(@key) end def prints_historic_transcript? [:historic_transcript].include?(@key) end def duplicates_certificate? [:duplicate_certificate].include?(@key) end def renews_certificate? [:change_owner, :change_vessel, :renewal, :re_registration] .include?(@key) end def builds_registry? [ :change_owner, :change_vessel, :change_address, :re_registration, :new_registration, :provisional, :renewal, :manual_override, :mortgage].include?(@key) end def builds_registration? [ :change_owner, :change_vessel, :provisional, :re_registration, :new_registration, :renewal].include?(@key) end def emails_application_approval? [ :new_registration, :renewal, :re_registration, :provisional, :change_owner, :change_vessel, :change_address, :closure, :current_transcript, :historic_transcript, :mortgage].include?(@key) end def emails_application_receipt? [ :new_registration, :renewal, :re_registration, :provisional, :change_owner, :change_vessel, :change_address, :closure, :current_transcript, :historic_transcript, :duplicate_certificate, :enquiry, :mortgage].include?(@key) end def referrable? ![:manual_override].include?(@key) end def issues_csr? [:issue_csr].include?(@key) end class << self def finance_task_types all_task_types.delete_if do |t| [:change_address, :closure, :enquiry].include?(t[1]) end end def default_task_types all_task_types.delete_if { |t| t[1] == :unknown } end def govuk_task_types [ :new_registration, :renewal, :change_owner, :change_vessel, :change_address, :duplicate_certificate, :current_transcript, :historic_transcript, :closure ] end def validation_helper_task_type_list default_task_types.map { |t| t[1].to_s } end # rubocop:disable Metrics/MethodLength def all_task_types [ ["New Registration", :new_registration], ["Provisional Registration", :provisional], ["Renewal of Registration", :renewal], ["Re-Registration", :re_registration], ["Change of Ownership", :change_owner], ["Change of Vessel details", :change_vessel], ["Change of Address", :change_address], ["Registration Closure", :closure], ["Current Transcript of Registry", :current_transcript], ["Historic Transcript of Registry", :historic_transcript], ["Duplicate Certificate", :duplicate_certificate], ["General Enquiry", :enquiry], ["Registration Closure: Owner Request", :registrar_closure], ["Registration Closure: Notice of Termination", :termination_notice], ["Registrar Restores Closure", :registrar_restores_closure], ["Mortgage(s)", :mortgage], ["Issue CSR", :issue_csr], ["Manual Override", :manual_override], ["Unknown", :unknown]] end end end end Ensure registrar tools tasks are not in the default_task_types list module WavesUtilities class Task def initialize(key) @key = key.to_sym end def ==(other) @key == other.to_sym end def description Task.all_task_types.find { |t| t[1] == @key }[0] end def declarations_required_on_create? [ :new_registration, :provisional, :re_registration, :renewal ].include?(@key) end def declarations_required_on_add_owner? return true if declarations_required_on_create? [:change_owner].include?(@key) end def electronic_delivery_available? [:current_transcript, :historic_transcript].include?(@key) end def ownership_can_be_changed? [ :new_registration, :provisional, :change_owner, :renewal, :re_registration, :manual_override ].include?(@key) end def address_can_be_changed? ownership_can_be_changed? || @key == :change_address end def vessel_can_be_edited? [ :new_registration, :provisional, :change_vessel, :renewal, :re_registration, :manual_override ].include?(@key) end def payment_required? ![ :change_address, :closure, :enquiry, :termination_notice, :registrar_closure, :registrar_restores_closure, :issue_csr, :manual_override].include?(@key) end def print_job_templates if prints_certificate? [:registration_certificate, :cover_letter] elsif prints_provisional_certificate? [:provisional_certificate, :cover_letter] elsif prints_current_transcript? [:current_transcript] elsif prints_historic_transcript? [:historic_transcript] elsif @key == :issue_csr [:csr_form] elsif @key == :termination_notice [:termination_notice] end end def prints_certificate? [ :new_registration, :change_owner, :change_vessel, :renewal, :duplicate_certificate, :re_registration ].include?(@key) end def prints_provisional_certificate? [:provisional].include?(@key) end def prints_current_transcript? [:closure, :current_transcript].include?(@key) end def prints_historic_transcript? [:historic_transcript].include?(@key) end def duplicates_certificate? [:duplicate_certificate].include?(@key) end def renews_certificate? [:change_owner, :change_vessel, :renewal, :re_registration] .include?(@key) end def builds_registry? [ :change_owner, :change_vessel, :change_address, :re_registration, :new_registration, :provisional, :renewal, :manual_override, :mortgage].include?(@key) end def builds_registration? [ :change_owner, :change_vessel, :provisional, :re_registration, :new_registration, :renewal].include?(@key) end def emails_application_approval? [ :new_registration, :renewal, :re_registration, :provisional, :change_owner, :change_vessel, :change_address, :closure, :current_transcript, :historic_transcript, :mortgage].include?(@key) end def emails_application_receipt? [ :new_registration, :renewal, :re_registration, :provisional, :change_owner, :change_vessel, :change_address, :closure, :current_transcript, :historic_transcript, :duplicate_certificate, :enquiry, :mortgage].include?(@key) end def referrable? ![:manual_override].include?(@key) end def issues_csr? [:issue_csr].include?(@key) end class << self def finance_task_types all_task_types.delete_if do |t| [:change_address, :closure, :enquiry].include?(t[1]) end end def default_task_types all_task_types.delete_if do |t| [ :registrar_closure, :termination_notice, :registrar_restores_closure, :unknown ].include?(t[1]) end end def govuk_task_types [ :new_registration, :renewal, :change_owner, :change_vessel, :change_address, :duplicate_certificate, :current_transcript, :historic_transcript, :closure ] end def validation_helper_task_type_list all_task_types.map { |t| t[1].to_s } end # rubocop:disable Metrics/MethodLength def all_task_types [ ["New Registration", :new_registration], ["Provisional Registration", :provisional], ["Renewal of Registration", :renewal], ["Re-Registration", :re_registration], ["Change of Ownership", :change_owner], ["Change of Vessel details", :change_vessel], ["Change of Address", :change_address], ["Registration Closure", :closure], ["Current Transcript of Registry", :current_transcript], ["Historic Transcript of Registry", :historic_transcript], ["Duplicate Certificate", :duplicate_certificate], ["General Enquiry", :enquiry], ["Registration Closure: Owner Request", :registrar_closure], ["Registration Closure: Notice of Termination", :termination_notice], ["Registrar Restores Closure", :registrar_restores_closure], ["Mortgage(s)", :mortgage], ["Issue CSR", :issue_csr], ["Manual Override", :manual_override], ["Unknown", :unknown]] end end end end
require 'spec_helper' require 'tmpdir' module Vim module Flavor describe LockFile do around :each do |example| Dir.mktmpdir do |tmp_path| @tmp_path = tmp_path example.run end end def flavor(repo_name, locked_version) f = Flavor.new() f.repo_name = repo_name f.locked_version = v(locked_version) f end def v(s) Version.create(s) end it 'has flavors sorted by repo_name' do l = LockFile.new(@tmp_path.to_lockfile_path) foo = flavor('foo', '1.2.3') bar = flavor('bar', '2.3.4') baz = flavor('baz', '3.4.5') [foo, bar, baz].each do |f| l.flavor_table[f.repo_name] = f end expect(l.flavors).to be == [bar, baz, foo] end describe '::serialize_lock_status' do it 'converts a flavor into an array of lines' do expect( LockFile.serialize_lock_status(flavor('foo', '1.2.3')) ).to be == ['foo (1.2.3)'] end end describe '#load' do it 'loads locked information from a lockfile' do File.open(@tmp_path.to_lockfile_path, 'w') do |io| io.write(<<-'END') foo (1.2.3) bar (2.3.4) baz (3.4.5) END end l = LockFile.new(@tmp_path.to_lockfile_path) expect(l.flavor_table).to be_empty l.load() expect(l.flavor_table['foo'].repo_name).to be == 'foo' expect(l.flavor_table['foo'].locked_version).to be == v('1.2.3') expect(l.flavor_table['bar'].repo_name).to be == 'bar' expect(l.flavor_table['bar'].locked_version).to be == v('2.3.4') expect(l.flavor_table['baz'].repo_name).to be == 'baz' expect(l.flavor_table['baz'].locked_version).to be == v('3.4.5') end end describe '::load_or_new' do it 'creates a new instance then loads a lockfile' do File.open(@tmp_path.to_lockfile_path, 'w') do |io| io.write(<<-'END') foo (1.2.3) END end l = LockFile.load_or_new(@tmp_path.to_lockfile_path) expect(l.flavor_table['foo'].repo_name).to be == 'foo' expect(l.flavor_table['foo'].locked_version).to be == v('1.2.3') end it 'only creates a new instance if a given path does not exist' do l = LockFile.load_or_new(@tmp_path.to_lockfile_path) expect(l.flavor_table).to be_empty end end end end end Refine a spec on LockFile#flavors require 'spec_helper' require 'tmpdir' module Vim module Flavor describe LockFile do around :each do |example| Dir.mktmpdir do |tmp_path| @tmp_path = tmp_path example.run end end def flavor(repo_name, locked_version) f = Flavor.new() f.repo_name = repo_name f.locked_version = v(locked_version) f end def v(s) Version.create(s) end describe '#flavors' do it 'is sorted by repo_name' do l = LockFile.new(@tmp_path.to_lockfile_path) foo = flavor('foo', '1.2.3') bar = flavor('bar', '2.3.4') baz = flavor('baz', '3.4.5') [foo, bar, baz].each do |f| l.flavor_table[f.repo_name] = f end expect(l.flavors).to be == [bar, baz, foo] end end describe '::serialize_lock_status' do it 'converts a flavor into an array of lines' do expect( LockFile.serialize_lock_status(flavor('foo', '1.2.3')) ).to be == ['foo (1.2.3)'] end end describe '#load' do it 'loads locked information from a lockfile' do File.open(@tmp_path.to_lockfile_path, 'w') do |io| io.write(<<-'END') foo (1.2.3) bar (2.3.4) baz (3.4.5) END end l = LockFile.new(@tmp_path.to_lockfile_path) expect(l.flavor_table).to be_empty l.load() expect(l.flavor_table['foo'].repo_name).to be == 'foo' expect(l.flavor_table['foo'].locked_version).to be == v('1.2.3') expect(l.flavor_table['bar'].repo_name).to be == 'bar' expect(l.flavor_table['bar'].locked_version).to be == v('2.3.4') expect(l.flavor_table['baz'].repo_name).to be == 'baz' expect(l.flavor_table['baz'].locked_version).to be == v('3.4.5') end end describe '::load_or_new' do it 'creates a new instance then loads a lockfile' do File.open(@tmp_path.to_lockfile_path, 'w') do |io| io.write(<<-'END') foo (1.2.3) END end l = LockFile.load_or_new(@tmp_path.to_lockfile_path) expect(l.flavor_table['foo'].repo_name).to be == 'foo' expect(l.flavor_table['foo'].locked_version).to be == v('1.2.3') end it 'only creates a new instance if a given path does not exist' do l = LockFile.load_or_new(@tmp_path.to_lockfile_path) expect(l.flavor_table).to be_empty end end end end end
Regenerate gemspec for version 0.0.1 # Generated by jeweler # DO NOT EDIT THIS FILE DIRECTLY # Instead, edit Jeweler::Tasks in Rakefile, and run 'rake gemspec' # -*- encoding: utf-8 -*- Gem::Specification.new do |s| s.name = "typecollection" s.version = "0.0.1" s.required_rubygems_version = Gem::Requirement.new(">= 0") if s.respond_to? :required_rubygems_version= s.authors = ["James Petty"] s.date = "2012-01-10" s.description = "Easily map subtypes into their parent type for later retrieval" s.email = "jp@jibe.com" s.extra_rdoc_files = [ "LICENSE.txt", "README.rdoc" ] s.files = [ ".document", "Gemfile", "LICENSE.txt", "README.rdoc", "Rakefile", "VERSION", "lib/typecollection.rb", "lib/typecollection/class+inferred_type.rb", "lib/typecollection/class_methods.rb", "test/helper.rb", "test/test_typecollection.rb" ] s.homepage = "http://github.com/pettyjamesm/TypeCollection" s.licenses = ["MIT"] s.require_paths = ["lib"] s.rubygems_version = "1.8.10" s.summary = "TypeCollection maintains a record of sub-types for a given class based on a common suffix." if s.respond_to? :specification_version then s.specification_version = 3 if Gem::Version.new(Gem::VERSION) >= Gem::Version.new('1.2.0') then s.add_development_dependency(%q<shoulda>, [">= 0"]) s.add_development_dependency(%q<bundler>, ["~> 1.0.0"]) s.add_development_dependency(%q<jeweler>, ["~> 1.6.4"]) s.add_development_dependency(%q<rcov>, [">= 0"]) else s.add_dependency(%q<shoulda>, [">= 0"]) s.add_dependency(%q<bundler>, ["~> 1.0.0"]) s.add_dependency(%q<jeweler>, ["~> 1.6.4"]) s.add_dependency(%q<rcov>, [">= 0"]) end else s.add_dependency(%q<shoulda>, [">= 0"]) s.add_dependency(%q<bundler>, ["~> 1.0.0"]) s.add_dependency(%q<jeweler>, ["~> 1.6.4"]) s.add_dependency(%q<rcov>, [">= 0"]) end end
RSpec.describe Messages do let(:messagable) { Class.new { include Messages }.new } let(:outputting_message) { -> { message } } describe '#inform_creation_of_social_media_links' do let(:message) { messagable.inform_creation_of_social_media_links } it 'outputs a message to stdout' do expect(outputting_message).to output.to_stdout end end describe '#inform_creation_of_employment_history' do let(:message) { messagable.inform_creation_of_employment_history } it 'outputs a message to stdout' do expect(outputting_message).to output.to_stdout end end describe '#inform_creation_of_education_history' do let(:message) { messagable.inform_creation_of_education_history } it 'outputs a message to stdout' do expect(outputting_message).to output.to_stdout end end end Bring code coverage back up RSpec.describe Messages do let(:messagable) { Class.new { include Messages }.new } let(:outputting_message) { -> { message } } describe '#inform_creation_of_social_media_links' do let(:message) { messagable.inform_creation_of_social_media_links } it 'outputs a message to stdout' do expect(outputting_message).to output.to_stdout end end describe '#inform_creation_of_technical_skills' do let(:message) { messagable.inform_creation_of_technical_skills } it 'outputs a message to stdout' do expect(outputting_message).to output.to_stdout end end describe '#inform_creation_of_employment_history' do let(:message) { messagable.inform_creation_of_employment_history } it 'outputs a message to stdout' do expect(outputting_message).to output.to_stdout end end describe '#inform_creation_of_education_history' do let(:message) { messagable.inform_creation_of_education_history } it 'outputs a message to stdout' do expect(outputting_message).to output.to_stdout end end end
added organise controller, authorise method. added ISO country codes and UN/LOCODEs. { :en => { :hello => "Hello, world!", :name => "Name", :aliases => "Aliases", :about_me => "About me", :gender => "Gender", :date_of_birth => "Date of Birth", :country => "Country" } }
# # Ruby Benchmark driver # require 'net/http' require 'tempfile' RAW_URL = 'https://raw.githubusercontent.com/ruby-bench/ruby-bench-suite/master/ruby/benchmarks/bm_' first = true begin require 'optparse' rescue LoadError if first first = false $:.unshift File.join(File.dirname(__FILE__), '../lib') retry else raise end end require 'benchmark' require 'pp' class BenchmarkDriver def self.benchmark(opt) driver = self.new(opt[:execs], opt[:dir], opt) begin driver.run ensure driver.show_results end end def output *args puts(*args) @output and @output.puts(*args) end def message *args output(*args) if @verbose end def message_print *args if @verbose print(*args) STDOUT.flush @output and @output.print(*args) end end def progress_message *args unless STDOUT.tty? STDERR.print(*args) STDERR.flush end end def initialize execs, dir, opt = {} @execs = execs.map{|e| e.strip! next if e.empty? if /(.+)::(.+)/ =~ e # ex) ruby-a::/path/to/ruby-a label = $1.strip path = $2 version = `#{path} -v`.chomp else path = e version = label = `#{path} -v`.chomp end [path, label, version] }.compact @dir = dir @repeat = opt[:repeat] || 1 @repeat = 1 if @repeat < 1 @patterns = opt[:pattern] || [] @excludes = opt[:exclude] || [] @verbose = opt[:quiet] ? false : (opt[:verbose] || false) @output = opt[:output] ? open(opt[:output], 'w') : nil @rawdata_output = opt[:rawdata_output] ? open(opt[:rawdata_output], 'w') : nil @loop_wl1 = @loop_wl2 = nil @ruby_arg = opt[:ruby_arg] || nil @opt = opt # [[name, [[r-1-1, r-1-2, ...], [r-2-1, r-2-2, ...]]], ...] @results = [] @memory_results = {} if @verbose @start_time = Time.now message @start_time @execs.each_with_index{|(path, label, version), i| message "target #{i}: " + (label == version ? "#{label}" : "#{label} (#{version})") + " at \"#{path}\"" } end end def adjusted_results name, results results.first.map(&:to_f).min end def show_results output if @verbose message '-----------------------------------------------------------' message 'raw data:' message message PP.pp(@results, "", 79) message message "Elapsed time: #{Time.now - @start_time} (sec)" end if @rawdata_output h = {} h[:cpuinfo] = File.read('/proc/cpuinfo') if File.exist?('/proc/cpuinfo') h[:executables] = @execs h[:results] = @results @rawdata_output.puts h.inspect end output '-----------------------------------------------------------' output 'benchmark results:' if @verbose and @repeat > 1 output "minimum results in each #{@repeat} measurements." end output "Execution time (sec)" output "name\t#{@execs.map{|(_, v)| v}.join("\t")}" @results.each{|v, result| rets = adjusted_results(v, result) http = Net::HTTP.new(ENV["API_URL"] || 'rubybench.org') request = Net::HTTP::Post.new('/benchmark_runs') request.basic_auth(ENV["API_NAME"], ENV["API_PASSWORD"]) initiator_hash = {} if(ENV['RUBY_COMMIT_HASH']) initiator_hash['commit_hash'] = ENV['RUBY_COMMIT_HASH'] elsif(ENV['RUBY_VERSION']) initiator_hash['version'] = ENV['RUBY_VERSION'] end request.set_form_data({ 'benchmark_type[category]' => "#{v}_memory", 'benchmark_type[unit]' => 'kilobytes', 'benchmark_type[script_url]' => "#{RAW_URL}#{v}.rb", "benchmark_run[result][rss_kb]" => rets, 'benchmark_run[environment]' => @execs.map { |(_,v)| v }.first, 'repo' => 'ruby', 'organization' => 'ruby' }.merge(initiator_hash)) http.request(request) output "Posting memory results to Web UI...." } if @opt[:output] output output "Log file: #{@opt[:output]}" end end def files flag = {} @files = Dir.glob(File.join(@dir, 'bm*.rb')).map{|file| next if !@patterns.empty? && /#{@patterns.join('|')}/ !~ File.basename(file) next if !@excludes.empty? && /#{@excludes.join('|')}/ =~ File.basename(file) case file when /bm_(vm[12])_/, /bm_loop_(whileloop2?).rb/ flag[$1] = true end file }.compact if flag['vm1'] && !flag['whileloop'] @files << File.join(@dir, 'bm_loop_whileloop.rb') elsif flag['vm2'] && !flag['whileloop2'] @files << File.join(@dir, 'bm_loop_whileloop2.rb') end @files.sort! progress_message "total: #{@files.size * @repeat} trial(s) (#{@repeat} trial(s) for #{@files.size} benchmark(s))\n" @files end def run files.each_with_index{|file, i| @i = i r = measure_file(file) if /bm_loop_whileloop.rb/ =~ file @loop_wl1 = r[1].map{|e| e.min} elsif /bm_loop_whileloop2.rb/ =~ file @loop_wl2 = r[1].map{|e| e.min} end } end def measure_file file name = File.basename(file, '.rb').sub(/^bm_/, '') prepare_file = File.join(File.dirname(file), "prepare_#{name}.rb") load prepare_file if FileTest.exist?(prepare_file) result = [name] result << @execs.map{|(e, v)| (0...@repeat).map{ message_print "#{v}\t" m = measure(e, file) output "#{name}: rss_kb=#{m}" m } } @results << result result end unless defined?(File::NULL) if File.exist?('/dev/null') File::NULL = '/dev/null' end end def measure executable, file cmd = "#{executable} #{@ruby_arg} #{file}" begin if !(file.match(/so_nsieve_bits/)) File.copy_stream(file, "#{file}.temp") temp_file_read = File.open("#{file}.temp", 'r').read if temp_file_read.match(/__END__/) begin temp = Tempfile.new("extract") File.open(file, 'r').each do |line| if line.match(/__END__/) temp << "mem = `ps -o rss= -p \#\{$$\}`.to_i\nputs \"mem_result:\#\{mem\}\"\n__END__\n" else temp << line end end ensure temp.close end File.copy_stream(temp, file) else File.open(file, 'a') do |f| f << "mem = `ps -o rss= -p \#\{$$\}`.to_i\n" f << "puts \"mem_result:\#\{mem\}\"" end end end memory = `#{cmd}` ensure if !(file.match(/so_nsieve_bits/)) File.copy_stream("#{file}.temp", file) File.delete("#{file}.temp") end end if $? != 0 output "\`#{cmd}\' exited with abnormal status (#{$?})" 0 else memory.encode('UTF-8', 'binary', invalid: :replace, undef: :replace, replace: '') =~ /mem_result:(.+)\Z/ $1.to_f end end end if __FILE__ == $0 opt = { :execs => [], :dir => File.dirname(__FILE__), :repeat => 1, :output => "bmlog-#{Time.now.strftime('%Y%m%d-%H%M%S')}.#{$$}", :raw_output => nil } parser = OptionParser.new{|o| o.on('-e', '--executables [EXECS]', "Specify benchmark one or more targets (e1::path1; e2::path2; e3::path3;...)"){|e| e.split(/;/).each{|path| opt[:execs] << path } } o.on('-d', '--directory [DIRECTORY]', "Benchmark suites directory"){|d| opt[:dir] = d } o.on('-p', '--pattern <PATTERN1,PATTERN2,PATTERN3>', "Benchmark name pattern"){|p| opt[:pattern] = p.split(',') } o.on('-x', '--exclude <PATTERN1,PATTERN2,PATTERN3>', "Benchmark exclude pattern"){|e| opt[:exclude] = e.split(',') } o.on('-r', '--repeat-count [NUM]', "Repeat count"){|n| opt[:repeat] = n.to_i } o.on('-o', '--output-file [FILE]', "Output file"){|f| opt[:output] = f } o.on('--ruby-arg [ARG]', "Optional argument for ruby"){|a| opt[:ruby_arg] = a } o.on('--rawdata-output [FILE]', 'output rawdata'){|r| opt[:rawdata_output] = r } o.on('-v', '--verbose'){|v| opt[:verbose] = v } o.on('-q', '--quiet', "Run without notify information except result table."){|q| opt[:quiet] = q opt[:verbose] = false } } parser.parse!(ARGV) BenchmarkDriver.benchmark(opt) end Copy file before closing it. Fixes: https://github.com/ruby-bench/ruby-bench-suite/issues/14. # # Ruby Benchmark driver # require 'net/http' require 'tempfile' RAW_URL = 'https://raw.githubusercontent.com/ruby-bench/ruby-bench-suite/master/ruby/benchmarks/bm_' first = true begin require 'optparse' rescue LoadError if first first = false $:.unshift File.join(File.dirname(__FILE__), '../lib') retry else raise end end require 'benchmark' require 'pp' class BenchmarkDriver def self.benchmark(opt) driver = self.new(opt[:execs], opt[:dir], opt) begin driver.run ensure driver.show_results end end def output *args puts(*args) @output and @output.puts(*args) end def message *args output(*args) if @verbose end def message_print *args if @verbose print(*args) STDOUT.flush @output and @output.print(*args) end end def progress_message *args unless STDOUT.tty? STDERR.print(*args) STDERR.flush end end def initialize execs, dir, opt = {} @execs = execs.map{|e| e.strip! next if e.empty? if /(.+)::(.+)/ =~ e # ex) ruby-a::/path/to/ruby-a label = $1.strip path = $2 version = `#{path} -v`.chomp else path = e version = label = `#{path} -v`.chomp end [path, label, version] }.compact @dir = dir @repeat = opt[:repeat] || 1 @repeat = 1 if @repeat < 1 @patterns = opt[:pattern] || [] @excludes = opt[:exclude] || [] @verbose = opt[:quiet] ? false : (opt[:verbose] || false) @output = opt[:output] ? open(opt[:output], 'w') : nil @rawdata_output = opt[:rawdata_output] ? open(opt[:rawdata_output], 'w') : nil @loop_wl1 = @loop_wl2 = nil @ruby_arg = opt[:ruby_arg] || nil @opt = opt # [[name, [[r-1-1, r-1-2, ...], [r-2-1, r-2-2, ...]]], ...] @results = [] @memory_results = {} if @verbose @start_time = Time.now message @start_time @execs.each_with_index{|(path, label, version), i| message "target #{i}: " + (label == version ? "#{label}" : "#{label} (#{version})") + " at \"#{path}\"" } end end def adjusted_results name, results results.first.map(&:to_f).min end def show_results output if @verbose message '-----------------------------------------------------------' message 'raw data:' message message PP.pp(@results, "", 79) message message "Elapsed time: #{Time.now - @start_time} (sec)" end if @rawdata_output h = {} h[:cpuinfo] = File.read('/proc/cpuinfo') if File.exist?('/proc/cpuinfo') h[:executables] = @execs h[:results] = @results @rawdata_output.puts h.inspect end output '-----------------------------------------------------------' output 'benchmark results:' if @verbose and @repeat > 1 output "minimum results in each #{@repeat} measurements." end output "Execution time (sec)" output "name\t#{@execs.map{|(_, v)| v}.join("\t")}" @results.each{|v, result| rets = adjusted_results(v, result) http = Net::HTTP.new(ENV["API_URL"] || 'rubybench.org') request = Net::HTTP::Post.new('/benchmark_runs') request.basic_auth(ENV["API_NAME"], ENV["API_PASSWORD"]) initiator_hash = {} if(ENV['RUBY_COMMIT_HASH']) initiator_hash['commit_hash'] = ENV['RUBY_COMMIT_HASH'] elsif(ENV['RUBY_VERSION']) initiator_hash['version'] = ENV['RUBY_VERSION'] end request.set_form_data({ 'benchmark_type[category]' => "#{v}_memory", 'benchmark_type[unit]' => 'kilobytes', 'benchmark_type[script_url]' => "#{RAW_URL}#{v}.rb", "benchmark_run[result][rss_kb]" => rets, 'benchmark_run[environment]' => @execs.map { |(_,v)| v }.first, 'repo' => 'ruby', 'organization' => 'ruby' }.merge(initiator_hash)) http.request(request) output "Posting memory results to Web UI...." } if @opt[:output] output output "Log file: #{@opt[:output]}" end end def files flag = {} @files = Dir.glob(File.join(@dir, 'bm*.rb')).map{|file| next if !@patterns.empty? && /#{@patterns.join('|')}/ !~ File.basename(file) next if !@excludes.empty? && /#{@excludes.join('|')}/ =~ File.basename(file) case file when /bm_(vm[12])_/, /bm_loop_(whileloop2?).rb/ flag[$1] = true end file }.compact if flag['vm1'] && !flag['whileloop'] @files << File.join(@dir, 'bm_loop_whileloop.rb') elsif flag['vm2'] && !flag['whileloop2'] @files << File.join(@dir, 'bm_loop_whileloop2.rb') end @files.sort! progress_message "total: #{@files.size * @repeat} trial(s) (#{@repeat} trial(s) for #{@files.size} benchmark(s))\n" @files end def run files.each_with_index{|file, i| @i = i r = measure_file(file) if /bm_loop_whileloop.rb/ =~ file @loop_wl1 = r[1].map{|e| e.min} elsif /bm_loop_whileloop2.rb/ =~ file @loop_wl2 = r[1].map{|e| e.min} end } end def measure_file file name = File.basename(file, '.rb').sub(/^bm_/, '') prepare_file = File.join(File.dirname(file), "prepare_#{name}.rb") load prepare_file if FileTest.exist?(prepare_file) result = [name] result << @execs.map{|(e, v)| (0...@repeat).map{ message_print "#{v}\t" m = measure(e, file) output "#{name}: rss_kb=#{m}" m } } @results << result result end unless defined?(File::NULL) if File.exist?('/dev/null') File::NULL = '/dev/null' end end def measure executable, file cmd = "#{executable} #{@ruby_arg} #{file}" begin if !(file.match(/so_nsieve_bits/)) File.copy_stream(file, "#{file}.temp") temp_file_read = File.open("#{file}.temp", 'r').read if temp_file_read.match(/__END__/) begin temp = Tempfile.new("extract") File.open(file, 'r').each do |line| if line.match(/__END__/) temp << "mem = `ps -o rss= -p \#\{$$\}`.to_i\nputs \"mem_result:\#\{mem\}\"\n__END__\n" else temp << line end end File.copy_stream(temp, file) ensure temp.close end else File.open(file, 'a') do |f| f << "mem = `ps -o rss= -p \#\{$$\}`.to_i\n" f << "puts \"mem_result:\#\{mem\}\"" end end end memory = `#{cmd}` ensure if !(file.match(/so_nsieve_bits/)) File.copy_stream("#{file}.temp", file) File.delete("#{file}.temp") end end if $? != 0 output "\`#{cmd}\' exited with abnormal status (#{$?})" 0 else memory.encode('UTF-8', 'binary', invalid: :replace, undef: :replace, replace: '') =~ /mem_result:(.+)\Z/ $1.to_f end end end if __FILE__ == $0 opt = { :execs => [], :dir => File.dirname(__FILE__), :repeat => 1, :output => "bmlog-#{Time.now.strftime('%Y%m%d-%H%M%S')}.#{$$}", :raw_output => nil } parser = OptionParser.new{|o| o.on('-e', '--executables [EXECS]', "Specify benchmark one or more targets (e1::path1; e2::path2; e3::path3;...)"){|e| e.split(/;/).each{|path| opt[:execs] << path } } o.on('-d', '--directory [DIRECTORY]', "Benchmark suites directory"){|d| opt[:dir] = d } o.on('-p', '--pattern <PATTERN1,PATTERN2,PATTERN3>', "Benchmark name pattern"){|p| opt[:pattern] = p.split(',') } o.on('-x', '--exclude <PATTERN1,PATTERN2,PATTERN3>', "Benchmark exclude pattern"){|e| opt[:exclude] = e.split(',') } o.on('-r', '--repeat-count [NUM]', "Repeat count"){|n| opt[:repeat] = n.to_i } o.on('-o', '--output-file [FILE]', "Output file"){|f| opt[:output] = f } o.on('--ruby-arg [ARG]', "Optional argument for ruby"){|a| opt[:ruby_arg] = a } o.on('--rawdata-output [FILE]', 'output rawdata'){|r| opt[:rawdata_output] = r } o.on('-v', '--verbose'){|v| opt[:verbose] = v } o.on('-q', '--quiet', "Run without notify information except result table."){|q| opt[:quiet] = q opt[:verbose] = false } } parser.parse!(ARGV) BenchmarkDriver.benchmark(opt) end
# Improves on v3 by catching unnecessary concat in the case of very negative current state. # Still always building the Add and Subtract class Centipad def initialize(min=1, max=9, equal=100, print=false) @equal = equal @print = print @current_state = (min..max).to_a @current_location = 1 @solutions = 0 @last_add = true end def solve() beginning_time = Time.now loop() end_time = Time.now puts @solutions.to_s puts "Time elapsed #{(end_time - beginning_time)*1000} milliseconds" end def loop() if @current_location >= @current_state.size # Evaluate and print solution = @current_state.join() if eval(solution) == @equal puts solution if @print @solutions += 1 end return else concat = true # If no + yet or the most recent is addition, current term should be no more than 100 larger than rest of remaining numbers (maybe ensure length before eval'ing?) if @current_location > 1 && @current_location + 1 < @current_state.size current_value = eval(@current_state[0,@current_location].join()) if @last_add == true && current_value > @current_state[@current_location+1, @current_state.size-1].join().to_i + @equal concat = false end if @last_add == false && current_value < -(@current_state[@current_location+1, @current_state.size-1].join().to_i + @equal) concat = false end end # Concat Operation if concat @current_location += 1 loop() @current_location -= 1 end # Add Operation @current_state.insert(@current_location, '+') @current_location += 2 @last_add = true loop() @current_location -= 2 @current_state.delete_at(@current_location) # Subtract Operation @current_state.insert(@current_location, '-') @current_location += 2 @last_add = false loop() @current_location -= 2 @current_state.delete_at(@current_location) end end end v5. Limit unnecessary Add and Subtract operations. # Features: # + Global object memory optimization (v2) # + Concat limiting (v3, v4) # + Add limiting (v5) # + Subtract limiting (v5) # # Potential Improvements: # - current_value not always available or may be evaluated too often # - ditch eval() for faster expression evaluator (build one?) # - change arguments to a params hash class Centipad def initialize(min=1, max=9, equal=100, print=false) @equal = equal @print = print @current_state = (min..max).to_a @current_location = 1 @solutions = 0 @last_add = true end def solve() beginning_time = Time.now loop() end_time = Time.now puts @solutions.to_s puts "Time elapsed #{(end_time - beginning_time)*1000} milliseconds" end def loop() if @current_location >= @current_state.size # Evaluate and print solution = @current_state.join() if eval(solution) == @equal puts solution if @print @solutions += 1 end return else # Concat limiting logic concat = true current_value = nil # TODO: Revisit this if statement. Not sure about @current_state.size/2 being the optimal case. if @current_location > @current_state.size/2 && @current_location + 1 < @current_state.size current_value = eval(@current_state[0,@current_location].join()) # If no + yet or the most recent is addition, current term should be no more than 100 larger than rest of remaining numbers if @last_add == true && current_value > @current_state[@current_location+1, @current_state.size-1].join().to_i + @equal concat = false end if @last_add == false && current_value < -(@current_state[@current_location+1, @current_state.size-1].join().to_i + @equal) concat = false end end # Concat Operation if concat @current_location += 1 loop() @current_location -= 1 end # Add Operation if current_value.nil? || current_value >= -(@current_state[@current_location, @current_state.size-1].join().to_i + @equal) @current_state.insert(@current_location, '+') @current_location += 2 @last_add = true loop() @current_location -= 2 @current_state.delete_at(@current_location) end # Subtract Operation if current_value.nil? || current_value <= @current_state[@current_location, @current_state.size-1].join().to_i + @equal @current_state.insert(@current_location, '-') @current_location += 2 @last_add = false loop() @current_location -= 2 @current_state.delete_at(@current_location) end end end end
# coding: utf-8 lib = File.expand_path('../lib', __FILE__) $LOAD_PATH.unshift(lib) unless $LOAD_PATH.include?(lib) require 'ruby_svg_image_generator/version' Gem::Specification.new do |spec| spec.name = "ruby_svg_image_generator" spec.version = RubySvgImageGenerator::VERSION spec.authors = ["santiriera626" , "camumino", "franx0"] spec.email = ["santiriera626@gmail.com", "camumino@gmail.com", "francisco.moya.martinez@gmail.com"] spec.summary = %q{TODO: Write a short summary, because Rubygems requires one.} spec.description = %q{TODO: Write a longer description or delete this line.} spec.homepage = "TODO: Put your gem's website or public repo URL here." spec.license = "MIT" # Prevent pushing this gem to RubyGems.org by setting 'allowed_push_host', or # delete this section to allow pushing this gem to any host. if spec.respond_to?(:metadata) spec.metadata['allowed_push_host'] = "TODO: Set to 'http://mygemserver.com'" else raise "RubyGems 2.0 or newer is required to protect against public gem pushes." end spec.files = `git ls-files -z`.split("\x0").reject { |f| f.match(%r{^(test|spec|features)/}) } spec.bindir = "exe" spec.executables = spec.files.grep(%r{^exe/}) { |f| File.basename(f) } spec.require_paths = ["lib"] spec.add_development_dependency "bundler", "~> 1.5" spec.add_development_dependency "rake", "~> 10.0" spec.add_development_dependency 'rspec', "~> 3.4.0" spec.add_dependency "ruby_matrix_to_svg", "~> 0.0.1" end fix gemspec error to build travis # coding: utf-8 lib = File.expand_path('../lib', __FILE__) $LOAD_PATH.unshift(lib) unless $LOAD_PATH.include?(lib) require 'ruby_svg_image_generator/version' Gem::Specification.new do |spec| spec.name = "ruby_svg_image_generator" spec.version = RubySvgImageGenerator::VERSION spec.authors = ["santiriera626" , "camumino", "franx0"] spec.email = ["santiriera626@gmail.com", "camumino@gmail.com", "francisco.moya.martinez@gmail.com"] spec.summary = "%q{TODO: Write a short summary, because Rubygems requires one.}" spec.description = "%q{TODO: Write a longer description or delete this line" spec.homepage = "TODO: Put your gem's website or public repo URL here." spec.license = "MIT" # Prevent pushing this gem to RubyGems.org by setting 'allowed_push_host', or # delete this section to allow pushing this gem to any host. if spec.respond_to?(:metadata) spec.metadata['allowed_push_host'] = "TODO: Set to 'http://mygemserver.com'" else raise "RubyGems 2.0 or newer is required to protect against public gem pushes." end spec.files = `git ls-files -z`.split("\x0").reject { |f| f.match(%r{^(test|spec|features)/}) } spec.bindir = "exe" spec.executables = spec.files.grep(%r{^exe/}) { |f| File.basename(f) } spec.require_paths = ["lib"] spec.add_development_dependency "bundler", "~> 1.5" spec.add_development_dependency "rake", "~> 10.0" spec.add_development_dependency 'rspec', "~> 3.4.0" spec.add_dependency "ruby_matrix_to_svg", "~> 0.0.1" end
require 'capistrano' require 'capistrano_colors' require 'bundler/capistrano' require 'airbrake/capistrano' module RPCapistrano module Base def self.load_into(configuration) configuration.load do after 'deploy:restart', 'deploy:cleanup' before 'deploy:setup', 'rvm:create_gemset' # User details _cset :user, 'capi' _cset(:group) { user } _cset :sudo_user, 'www' # Application details _cset(:app_name) { abort "Please specify the short name of your application, set :app_name, 'foo'" } set(:application) { app_name } _cset :use_sudo, false _cset(:passenger_user) { sudo_user } _cset(:passenger_group) { sudo_user } # SCM settings set :deploy_to, "/var/www/#{app_name}" _cset :scm, 'git' set(:repository) { "git@nas01:#{app_name}" } _cset :branch, $1 if `git branch` =~ /\* (\S+)\s/m _cset :deploy_via, :remote_cache set :ssh_options, { :forward_agent => true } _cset :bundle_flags, "--deployment" # Git settings for Capistrano default_run_options[:pty] = true # needed for git password prompts namespace :deploy do task :start do ; end task :stop do ; end task :restart, :roles => :app, :except => { :no_release => true } do run "#{try_sudo} touch #{File.join(current_path,'tmp','restart.txt')}" end desc "Make sure local git is in sync with remote." task :check_revision, roles: :web do unless `git rev-parse HEAD` == `git rev-parse origin/#{branch}` puts "WARNING: HEAD is not the same as origin/#{branch}" puts "Run `git push` to sync changes." exit end end before "deploy", "deploy:check_revision" end end end end end if Capistrano::Configuration.instance RPCapistrano::Base.load_into(Capistrano::Configuration.instance) end Fix remote caching issue to speed up deploys require 'capistrano' require 'capistrano_colors' require 'bundler/capistrano' require 'airbrake/capistrano' module RPCapistrano module Base def self.load_into(configuration) configuration.load do after 'deploy:restart', 'deploy:cleanup' before 'deploy:setup', 'rvm:create_gemset' # User details _cset :user, 'capi' _cset(:group) { user } _cset :sudo_user, 'www' # Application details _cset(:app_name) { abort "Please specify the short name of your application, set :app_name, 'foo'" } set(:application) { app_name } _cset :use_sudo, false _cset(:passenger_user) { sudo_user } _cset(:passenger_group) { sudo_user } # SCM settings set :deploy_to, "/var/www/#{app_name}" set :scm, 'git' set(:repository) { "git@nas01:#{app_name}" } _cset :branch, $1 if `git branch` =~ /\* (\S+)\s/m set :deploy_via, :remote_cache set :ssh_options, { :forward_agent => true } _cset :bundle_flags, "--deployment" # Git settings for Capistrano default_run_options[:pty] = true # needed for git password prompts namespace :deploy do task :start do ; end task :stop do ; end task :restart, :roles => :app, :except => { :no_release => true } do run "#{try_sudo} touch #{File.join(current_path,'tmp','restart.txt')}" end desc "Make sure local git is in sync with remote." task :check_revision, roles: :web do unless `git rev-parse HEAD` == `git rev-parse origin/#{branch}` puts "WARNING: HEAD is not the same as origin/#{branch}" puts "Run `git push` to sync changes." exit end end before "deploy", "deploy:check_revision" end end end end end if Capistrano::Configuration.instance RPCapistrano::Base.load_into(Capistrano::Configuration.instance) end
require File.join(File.dirname(__FILE__), 'selenium') require File.join(File.dirname(__FILE__), 'exceptions') # NOTE: Function names beginning with these words are forbidden: # # - check # - ensure # - reject # - note # - show # - start # # This is because the above words are keywords in Slim script tables; if # the first cell of a script table begins with any of these words, Slim tries # to apply special handling to them, which usually doesn't do what you want. module Rsel class SeleniumTest # Start up a test, connecting to the given Selenium server and opening # a browser. # # @param [String] url # Full URL, including http://, of the system under test # @param [String] server # IP address or hostname where selenium-server is running # @param [String] port # Port number of selenium-server # @param [String] browser # Which browser to test with # # @example # | script | selenium test | http://site.to.test/ | # | script | selenium test | http://site.to.test/ | 192.168.0.3 | 4445 | # def initialize(url, server='localhost', port='4444', browser='*firefox') @selenium = Selenium::SeleniumDriver.new(server, port, browser, url) end # Start the Selenium session. # # @example # | Open browser | # def open_browser begin @selenium.start rescue raise SeleniumNotRunning, "Could not start Selenium." else return true end end # Close the browser window # # @example # | Close browser | # def close_browser @selenium.stop return true end # ---------------------------------------- # Navigation # ---------------------------------------- # Load an absolute URL or a relative path in the browser. # # @param [String] path_or_url # Relative path or absolute URL to load # # @example # | Visit | http://www.automation-excellence.com | # | Visit | /software | # def visit(path_or_url) @selenium.open(path_or_url) return true end # Click the Back button to navigate to the previous page. # # @example # | Click back | # def click_back @selenium.go_back return true end # Reload the current page. # # @example # | refresh page | # def refresh_page @selenium.refresh return true end # ---------------------------------------- # Verification # ---------------------------------------- # Ensure that the given text appears on the current page. # # @param [String] text # Plain text that should be visible on the current page # # @example # | Should see | Welcome, Marcus | # def should_see(text) return @selenium.is_text_present(text) end # Ensure that the current page has the given title text. # # @param [String] title # Text of the page title that you expect to see # # @example # | Should see title | Our Homepage | # | Should see | Our Homepage | title | # def should_see_title(title) if @selenium.get_title == title then return true else return false end end # ---------------------------------------- # Entering text # ---------------------------------------- # Type a value into the given field # # @param [String] text # What to type into the field # @param [String] locator # Locator string for the field you want to type into # # @example # | Type | Dale | into field | First name | # | Type | Dale | into | First name | field | # def type_into_field(text, locator) @selenium.type(get_locator(locator, textFieldLocators), text) return true end # ---------------------------------------- # Clicking things # ---------------------------------------- # Click on a link. # # @param [String] locator # Link text, or the id, name, or href of the anchor element # # @example # | Click | Logout | link | # | Click link | Logout | # def click_link(locator) begin @selenium.click(get_locator(locator, linkLocators)) rescue @selenium.click("Link=#{locator}") end end # Press a button. # # @param [String] locator # Button text, or the id or name of the button/submit element # # @example # | Click | Login | button | # | Click button | Login | # def click_button(locator) @selenium.click(get_locator(locator, buttonLocators)) end # Check or uncheck a checkbox. # # @param [String] locator # Label, id, or name of the checkbox to click # # @example # | Click | Send me spam | checkbox | # | Click checkbox | Send me spam | # def click_checkbox(locator) @selenium.click(get_locator(locator, checkboxLocators)) end # Click on an image. # # @param [String] locator # The id, src, title, or href of the image to click on # # @example # | Click | colorado.png | image | # | Click image | colorado.png | # def click_image(locator) @selenium.click(get_locator(locator, imageLocators)) end # Click on a radiobutton. # # @param [String] locator # Label, id, or name of the radiobutton to click # # @example # | Click | female | radio | # | Click radio | female | def click_radio(locator) @selenium.click(get_locator(locator, radioLocators)) end # ---------------------------------------- # Waiting # ---------------------------------------- # Pause for a certain number of seconds. # # @param [String, Int] seconds # How many seconds to pause # # @example # | Pause | 5 | seconds | # def pause_seconds(seconds) sleep seconds.to_i return true end # ---------------------------------------- # Form stuff # ---------------------------------------- # Select a value from a dropdown/combo box. # # @param [String] value # The value to choose from the dropdown # @param [String] locator # Dropdown locator # # @example # | select | Tall | from | Height | dropdown | # | select | Tall | from dropdown | Height | # def select_from_dropdown(value, locator) # TODO: Provide xpaths for locator @selenium.select(locator, value) end # Submit the form with the given name. # # @param [String] locator # Form id, name or action # # @example # | submit form | place_order | # | submit | place_order | form | # def submit_form(locator) @selenium.submit(get_locator(locator, formLocators)) end # ---------------------------------------- # Miscellaneous # ---------------------------------------- # Maximize the browser window. May not work in some browsers. # # @example # | maximize window | # def maximize_window @selenium.window_maximize end # Wait some number of seconds for the current page request to finish. # # @example # | page reloads in less than | 10 | seconds | # def page_reloads_in_less_than_seconds(seconds) return @selenium.wait_for_page_to_load(seconds + "000") end # ---------------------------------------- # Helper functions # ---------------------------------------- def capitalizeEachWord(str) return str.gsub(/^[a-z]|\s+[a-z]/) { |a| a.upcase } end def get_locator(caption, possibleFormats) possibleCaptions = getPossibleCaptions(caption) possibleCaptions.each do |possibleCaption| possibleFormats.each do |possibleFormat| locator = possibleFormat.sub('{0}', possibleCaption) puts "possible locator: " + locator if @selenium.is_element_present(locator) return locator end end end raise LocatorNotFound, "Could not find locator '#{caption}'" end # possible variations on the caption to look for def getPossibleCaptions(caption) possibleCaptions = Array.new possibleCaptions[0] = caption possibleCaptions[1] = ' ' + caption possibleCaptions[2] = caption + ' ' possibleCaptions[3] = capitalizeEachWord(caption) possibleCaptions[4] = ' ' + capitalizeEachWord(caption) possibleCaptions[5] = capitalizeEachWord(caption) + ' ' return possibleCaptions end def textFieldLocators [ "xpath=//input[@type='text' and @name='{0}']", "xpath=//input[@type='text' and @title='{0}']", "xpath=//input[@type='password' and @name='{0}']", "xpath=//textarea[@name='{0}']", "xpath=//input[@type='text' and @id='{0}']", "xpath=//input[@type='password' and @id='{0}']", "xpath=//textarea[@id='{0}']", ] end def buttonLocators [ "xpath=//input[@type='submit' and @name='{0}']", "xpath=//input[@type='button' and @name='{0}']", "xpath=//input[@type='submit' and @value='{0}']", "xpath=//input[@type='button' and @value='{0}']", "xpath=//input[@type='submit' and @id='{0}']", "xpath=//input[@type='button' and @id='{0}']", ] end def checkboxLocators [ "xpath=//input[@type='checkbox' and @name='{0}']", "xpath=//span[@id='{0}']/span/button", "xpath=//span[@type='checkbox' and @id='{0}']/span/button", "xpath=//input[@type='checkbox' and @label[text()='{0}']]", "xpath=//input[@type='checkbox' and @id=(//label[text()='{0}']/@for)]", ] end #added 7/1/08 -Dale; bug fix 7/7 def radioLocators [ "xpath=//input[@type='radio' and @name='{0}']", "xpath=//input[@type='radio' and @id='{0}']", "xpath=//input[@type='radio' and @label[text()='{0}']]", "xpath=//input[@type='radio' and @id=(//label[text()=' {0}']/@for)]", "xpath=//input[@type='radio' and @id=(//label[text()='{0} ']/@for)]", "xpath=//input[@type='radio' and @id=(//label[text()='{0}']/@for)]", ] end # added 2nd and 3rd xpaths because leading or trailing space may exist for the text of links # added title and class 7/9 -Dale def linkLocators [ "xpath=//a[text()='{0}']", "xpath=//a[text()=' {0}']", "xpath=//a[text()='{0} ']", "xpath=//a[@href='{0}']", "xpath=//a[@title='{0}']", "xpath=//a[@class='{0}']", ] end # added to verify image elements -Dale def imageLocators [ "xpath=//img[@alt='{0}']", "xpath=//img[@title='{0}']", "xpath=//img[@id='{0}']", "xpath=//img[@href='{0}']", "xpath=//img[@src='{0}']", "xpath=//input[@type='image' and @src='{0}']", "xpath=//input[@type='image' and @id='{0}']", "xpath=//input[@type='image' and @alt='{0}']", ] end #added 7/8 -Dale def formLocators [ "xpath=//form[@action='{0}']", "xpath=//form[@class='{0}']", "xpath=//form[@name='{0}']", "xpath=//form[@legend[text()='{0}']]", ] end # added 7/8 -Dale def dragdropLocators [ "xpath=//div[@id='{0}']", "xpath=//img[@alt='{0}']", "xpath=//img[@src='{0}']", ] end #added 7/8 -Dale (use locator and offset e.g., "+70, -300" # Sample Call-> |UserDrags|slider name|AndDrops|-10, 0| def UserDragsAndDrops(selenium,params) selenium.drag_and_drop(get_locator(selenium,params[0],dragdropLocators), params[1]) end # Sample Call-> |VerifyText|my image| def VerifyImage(selenium,params) if selenium.is_element_present(get_locator(selenium,params[0],imageLocators)) then return "right" else return "wrong" end end # Sample Call-> |WaitUpTo|30|SecondsToVerifyImage|my image| def WaitUpToSecondsToVerifyImage(selenium,params) count=0 retval = "wrong" while (count<params[0].to_i) if selenium.is_element_present(get_locator(selenium,params[1],imageLocators)) then retval = "right" break end sleep 1 count=count+1 end return retval end #added return value for text found or not - 6/26/08 # Sample Call-> |WaitUpTo|30|SecondsToVerifyText|my text| def WaitUpToSecondsToVerifyText(selenium,params) count=0 retval = "wrong" while (count<params[0].to_i) if selenium.is_text_present(params[1]) then retval = "right" break end sleep 1 count=count+1 end return retval end #################################################### #DEBUG - all functions after this point are in a debug state - Dale #################################################### def ChooseOKNextConfirmation(selenium,params) selenium.choose_ok_on_next_confirmation end def ChooseCancelNextConfirmation(selenium,params) selenium.choose_cancel_on_next_confirmation end #-need to add functionality to select window before closing def CloseWindow(selenium,params) selenium.close end def SelectWindow(selenium,params) windowIDs=selenium.get_all_window_ids() windowIDs.each{|id| puts "id="+id} windowNames=selenium.get_all_window_names() windowNames.each{|name| puts "name="+name} windowTitles=selenium.get_all_window_titles() windowTitles.each{|title| puts "title="+title} selenium.select_window(params[0]) end def FocusWindow(selenium,params) selenium.window_focus() end def OpenURLOnWindow(selenium,params) selenium.open_window(params[0],params[1]) end #def GetAllLinks(selenium,params) # return selenium.get_all_links #end #def GetTitle(selenium,params) # return selenium.get_title # #return get_string_array("getAllLinks", []) #end end end Use more XPath, exception handling require File.join(File.dirname(__FILE__), 'selenium') require File.join(File.dirname(__FILE__), 'exceptions') require 'xpath' # NOTE: Function names beginning with these words are forbidden: # # - check # - ensure # - reject # - note # - show # - start # # This is because the above words are keywords in Slim script tables; if # the first cell of a script table begins with any of these words, Slim tries # to apply special handling to them, which usually doesn't do what you want. module Rsel class SeleniumTest # Start up a test, connecting to the given Selenium server and opening # a browser. # # @param [String] url # Full URL, including http://, of the system under test # @param [String] server # IP address or hostname where selenium-server is running # @param [String] port # Port number of selenium-server # @param [String] browser # Which browser to test with # # @example # | script | selenium test | http://site.to.test/ | # | script | selenium test | http://site.to.test/ | 192.168.0.3 | 4445 | # def initialize(url, server='localhost', port='4444', browser='*firefox') @selenium = Selenium::SeleniumDriver.new(server, port, browser, url) end # Start the Selenium session. # # @example # | Open browser | # def open_browser begin @selenium.start rescue raise SeleniumNotRunning, "Could not start Selenium." else return true end end # Close the browser window # # @example # | Close browser | # def close_browser @selenium.stop return true end # ---------------------------------------- # Navigation # ---------------------------------------- # Load an absolute URL or a relative path in the browser. # # @param [String] path_or_url # Relative path or absolute URL to load # # @example # | Visit | http://www.automation-excellence.com | # | Visit | /software | # def visit(path_or_url) @selenium.open(path_or_url) return true end # Click the Back button to navigate to the previous page. # # @example # | Click back | # def click_back @selenium.go_back return true end # Reload the current page. # # @example # | refresh page | # def refresh_page @selenium.refresh return true end # ---------------------------------------- # Verification # ---------------------------------------- # Ensure that the given text appears on the current page. # # @param [String] text # Plain text that should be visible on the current page # # @example # | Should see | Welcome, Marcus | # def should_see(text) return @selenium.is_text_present(text) end # Ensure that the current page has the given title text. # # @param [String] title # Text of the page title that you expect to see # # @example # | Should see title | Our Homepage | # | Should see | Our Homepage | title | # def should_see_title(title) if @selenium.get_title == title then return true else return false end end # ---------------------------------------- # Entering text # ---------------------------------------- # Type a value into the given field # # @param [String] text # What to type into the field # @param [String] locator # Locator string for the field you want to type into # # @example # | Type | Dale | into field | First name | # | Type | Dale | into | First name | field | # def type_into_field(text, locator) field_xpath = XPath::HTML.field(locator) begin @selenium.type("xpath=#{field_xpath}", text) rescue raise LocatorNotFound, "Could not find field with locator '#{locator}'" else return true end end # ---------------------------------------- # Clicking things # ---------------------------------------- # Click on a link. # # @param [String] locator # Link text, or the id, name, or href of the anchor element # # @example # | Click | Logout | link | # | Click link | Logout | # def click_link(locator) link_xpath = XPath::HTML.link(locator).to_s begin @selenium.click("xpath=#{link_xpath}") rescue raise LocatorNotFound, "Could not find link with locator '#{locator}'" else return true end end # Press a button. # # @param [String] locator # Button text, or the id or name of the button/submit element # # @example # | Click | Login | button | # | Click button | Login | # def click_button(locator) button_xpath = XPath::HTML.button(locator).to_s begin @selenium.click("xpath=#{button_xpath}") rescue raise LocatorNotFound, "Could not find button with locator '#{locator}'" else return true end end # Enable (check) a checkbox. # # @param [String] locator # Label, id, or name of the checkbox to check # # @example # | Enable | Send me spam | checkbox | # | Enable checkbox | Send me spam | # def enable_checkbox(locator) checkbox_xpath = XPath::HTML.checkbox(locator) begin @selenium.check("xpath=#{checkbox_xpath}") rescue raise LocatorNotFound, "Could not find checkbox with locator '#{locator}'" else return true end end # Disable (uncheck) a checkbox. # # @param [String] locator # Label, id, or name of the checkbox to uncheck # # @example # | Disable | Send me spam | checkbox | # | Disable checkbox | Send me spam | # def disable_checkbox(locator) checkbox_xpath = XPath::HTML.checkbox(locator) begin @selenium.uncheck("xpath=#{checkbox_xpath}") rescue raise LocatorNotFound, "Could not find checkbox with locator '#{locator}'" else return true end end # Click on an image. # # @param [String] locator # The id, src, title, or href of the image to click on # # @example # | Click | colorado.png | image | # | Click image | colorado.png | # def click_image(locator) @selenium.click(get_locator(locator, imageLocators)) end # Click on a radiobutton. # # @param [String] locator # Label, id, or name of the radiobutton to click # # @example # | Click | female | radio | # | Click radio | female | def click_radio(locator) @selenium.click(get_locator(locator, radioLocators)) end # ---------------------------------------- # Waiting # ---------------------------------------- # Pause for a certain number of seconds. # # @param [String, Int] seconds # How many seconds to pause # # @example # | Pause | 5 | seconds | # def pause_seconds(seconds) sleep seconds.to_i return true end # ---------------------------------------- # Form stuff # ---------------------------------------- # Select a value from a dropdown/combo box. # # @param [String] value # The value to choose from the dropdown # @param [String] locator # Dropdown locator # # @example # | select | Tall | from | Height | dropdown | # | select | Tall | from dropdown | Height | # def select_from_dropdown(value, locator) # TODO: Provide xpaths for locator @selenium.select(locator, value) end # Submit the form with the given name. # # @param [String] locator # Form id, name or action # # @example # | submit form | place_order | # | submit | place_order | form | # def submit_form(locator) @selenium.submit(get_locator(locator, formLocators)) end # ---------------------------------------- # Miscellaneous # ---------------------------------------- # Maximize the browser window. May not work in some browsers. # # @example # | maximize window | # def maximize_window @selenium.window_maximize end # Wait some number of seconds for the current page request to finish. # # @example # | page reloads in less than | 10 | seconds | # def page_reloads_in_less_than_seconds(seconds) return @selenium.wait_for_page_to_load(seconds + "000") end # ---------------------------------------- # Helper functions # ---------------------------------------- def capitalizeEachWord(str) return str.gsub(/^[a-z]|\s+[a-z]/) { |a| a.upcase } end def get_locator(caption, possibleFormats) possibleCaptions = getPossibleCaptions(caption) possibleCaptions.each do |possibleCaption| possibleFormats.each do |possibleFormat| locator = possibleFormat.sub('{0}', possibleCaption) puts "possible locator: " + locator if @selenium.is_element_present(locator) return locator end end end raise LocatorNotFound, "Could not find locator '#{caption}'" end # possible variations on the caption to look for def getPossibleCaptions(caption) possibleCaptions = Array.new possibleCaptions[0] = caption possibleCaptions[1] = ' ' + caption possibleCaptions[2] = caption + ' ' possibleCaptions[3] = capitalizeEachWord(caption) possibleCaptions[4] = ' ' + capitalizeEachWord(caption) possibleCaptions[5] = capitalizeEachWord(caption) + ' ' return possibleCaptions end def textFieldLocators [ "xpath=//input[@type='text' and @name='{0}']", "xpath=//input[@type='text' and @title='{0}']", "xpath=//input[@type='password' and @name='{0}']", "xpath=//textarea[@name='{0}']", "xpath=//input[@type='text' and @id='{0}']", "xpath=//input[@type='password' and @id='{0}']", "xpath=//textarea[@id='{0}']", ] end def buttonLocators [ "xpath=//input[@type='submit' and @name='{0}']", "xpath=//input[@type='button' and @name='{0}']", "xpath=//input[@type='submit' and @value='{0}']", "xpath=//input[@type='button' and @value='{0}']", "xpath=//input[@type='submit' and @id='{0}']", "xpath=//input[@type='button' and @id='{0}']", ] end def checkboxLocators [ "xpath=//input[@type='checkbox' and @name='{0}']", "xpath=//span[@id='{0}']/span/button", "xpath=//span[@type='checkbox' and @id='{0}']/span/button", "xpath=//input[@type='checkbox' and @label[text()='{0}']]", "xpath=//input[@type='checkbox' and @id=(//label[text()='{0}']/@for)]", ] end #added 7/1/08 -Dale; bug fix 7/7 def radioLocators [ "xpath=//input[@type='radio' and @name='{0}']", "xpath=//input[@type='radio' and @id='{0}']", "xpath=//input[@type='radio' and @label[text()='{0}']]", "xpath=//input[@type='radio' and @id=(//label[text()=' {0}']/@for)]", "xpath=//input[@type='radio' and @id=(//label[text()='{0} ']/@for)]", "xpath=//input[@type='radio' and @id=(//label[text()='{0}']/@for)]", ] end # added 2nd and 3rd xpaths because leading or trailing space may exist for the text of links # added title and class 7/9 -Dale def linkLocators [ "xpath=//a[text()='{0}']", "xpath=//a[text()=' {0}']", "xpath=//a[text()='{0} ']", "xpath=//a[@href='{0}']", "xpath=//a[@title='{0}']", "xpath=//a[@class='{0}']", ] end # added to verify image elements -Dale def imageLocators [ "xpath=//img[@alt='{0}']", "xpath=//img[@title='{0}']", "xpath=//img[@id='{0}']", "xpath=//img[@href='{0}']", "xpath=//img[@src='{0}']", "xpath=//input[@type='image' and @src='{0}']", "xpath=//input[@type='image' and @id='{0}']", "xpath=//input[@type='image' and @alt='{0}']", ] end #added 7/8 -Dale def formLocators [ "xpath=//form[@action='{0}']", "xpath=//form[@class='{0}']", "xpath=//form[@name='{0}']", "xpath=//form[@legend[text()='{0}']]", ] end # added 7/8 -Dale def dragdropLocators [ "xpath=//div[@id='{0}']", "xpath=//img[@alt='{0}']", "xpath=//img[@src='{0}']", ] end #added 7/8 -Dale (use locator and offset e.g., "+70, -300" # Sample Call-> |UserDrags|slider name|AndDrops|-10, 0| def UserDragsAndDrops(selenium,params) selenium.drag_and_drop(get_locator(selenium,params[0],dragdropLocators), params[1]) end # Sample Call-> |VerifyText|my image| def VerifyImage(selenium,params) if selenium.is_element_present(get_locator(selenium,params[0],imageLocators)) then return "right" else return "wrong" end end # Sample Call-> |WaitUpTo|30|SecondsToVerifyImage|my image| def WaitUpToSecondsToVerifyImage(selenium,params) count=0 retval = "wrong" while (count<params[0].to_i) if selenium.is_element_present(get_locator(selenium,params[1],imageLocators)) then retval = "right" break end sleep 1 count=count+1 end return retval end #added return value for text found or not - 6/26/08 # Sample Call-> |WaitUpTo|30|SecondsToVerifyText|my text| def WaitUpToSecondsToVerifyText(selenium,params) count=0 retval = "wrong" while (count<params[0].to_i) if selenium.is_text_present(params[1]) then retval = "right" break end sleep 1 count=count+1 end return retval end #################################################### #DEBUG - all functions after this point are in a debug state - Dale #################################################### def ChooseOKNextConfirmation(selenium,params) selenium.choose_ok_on_next_confirmation end def ChooseCancelNextConfirmation(selenium,params) selenium.choose_cancel_on_next_confirmation end #-need to add functionality to select window before closing def CloseWindow(selenium,params) selenium.close end def SelectWindow(selenium,params) windowIDs=selenium.get_all_window_ids() windowIDs.each{|id| puts "id="+id} windowNames=selenium.get_all_window_names() windowNames.each{|name| puts "name="+name} windowTitles=selenium.get_all_window_titles() windowTitles.each{|title| puts "title="+title} selenium.select_window(params[0]) end def FocusWindow(selenium,params) selenium.window_focus() end def OpenURLOnWindow(selenium,params) selenium.open_window(params[0],params[1]) end #def GetAllLinks(selenium,params) # return selenium.get_all_links #end #def GetTitle(selenium,params) # return selenium.get_title # #return get_string_array("getAllLinks", []) #end end end
require "listen" module RSpecLive class Watcher def initialize(suite) @suite = suite end def start reset Listen.to(Dir.pwd) do |updated, added, removed| @suite.files_touched(updated + removed) @suite.files_removed removed inventory if added.any? update end.start while perform_key_command; end rescue Interrupt end private def perform_key_command key = STDIN.getc.chr.downcase @suite.toggle_all if key == "a" @suite.focus_next if key == "n" return false if key == "q" reset if key == "r" @suite.cycle_verbosity if key == "v" true end def reset @suite.clear_status inventory update end def inventory @suite.inventory end def update @suite.update end end end Minor refactor of Watcher require "listen" module RSpecLive class Watcher def initialize(suite) @suite = suite end def start reset Listen.to(Dir.pwd) do |updated, added, removed| @suite.files_touched(updated + removed) @suite.files_removed removed @suite.inventory if added.any? @suite.update end.start while perform_key_command; end rescue Interrupt end private def perform_key_command key = STDIN.getc.chr.downcase @suite.toggle_all if key == "a" @suite.focus_next if key == "n" return false if key == "q" reset if key == "r" @suite.cycle_verbosity if key == "v" true end def reset @suite.clear_status @suite.inventory @suite.update end end end
# encoding: BINARY # vim: ts=2 sts=2 sw=2 expandtab def hex(s) s.nil? ? 'nil' : "[#{s.bytesize}]:#{s.bytes.map{|b|'%02X' % b}.join '.'}" end def ansi(n, *args) args.each {|arg| puts "\x1B[#{n}m#{arg}\x1B[0m" }; end def black(*args) ansi 30, *args; end def red(*args) ansi 31, *args; end def green(*args) ansi 32, *args; end def brown(*args) ansi 33, *args; end def yellow(*args) ansi 93, *args; end def blue(*args) ansi 94, *args; end def magenta(*args) ansi 35, *args; end def cyan(*args) ansi 36, *args; end def silver(*args) ansi 37, *args; end def white(*args) ansi 97, *args; end def flg(f) s = "#{f.to_s 16}" a = [] n = 1 while n <= f if (f & n) == n a << ('%02X' % n) end n <<= 1 end "#{f.to_s 16}[#{a.join '|'}]" end def frm(f) t = RUBYH2::FrameTypes.constants.find {|t| f.type == RUBYH2::FrameTypes.const_get(t) } t ||= f.type "<#{t}: flags=#{flg f.flags} stream=#{f.sid} payload=#{hex f.payload}>" end require 'thread' require 'zlib' require 'stringio' require_relative 'frame-deserialiser' require_relative 'frame-serialiser' require_relative 'frame-types' require_relative 'headers-hook' require_relative 'settings' require_relative 'errors' require_relative 'hpack' require_relative 'http-request' require_relative 'http-response' require_relative 'stream' module RUBYH2 PREFACE = "PRI * HTTP/2.0\r\n\r\nSM\r\n\r\n" class HTTPAgent FLAG_END_STREAM = 0x1 FLAG_ACK = 0x1 FLAG_END_HEADERS = 0x4 FLAG_PADDED = 0x8 FLAG_PRIORITY = 0x20 include Error def initialize is_server, logger # machinery state @is_server = is_server @request_proc = nil @response_proc = nil @hook = HeadersHook.new @hook.on_frame {|f| recv_frame f } @hpack = HPack.new @logger = logger # H2 state @window_queue = {} @first_frame_in = true @first_frame_out = true @streams = {} @default_window_size = 65535 @window_size = @default_window_size @max_frame_size = 16384 @max_streams = nil @push_to_peer = true @ext__send_gzip = true # are we config'd to send gzip data? @ext__peer_gzip = false # is peer config'd to accept gzip data? @ext__recv_gzip = true # are we config'd to accept gzip data? @ext__veto_gzip = false # set if peer doesn't gzip right @ext__sent_dropped_frame = {} @ext__peer_dropped_frame = {} # other settings @pings = [] @goaway = false @last_stream = 0 # last incoming stream handed up to application @shutting_down = false @send_lock = Mutex.new @shutdown_lock = Mutex.new end def inspect "\#<HTTPAgent @window_queue=#{@window_queue.inspect}, @streams=#{@streams.inspect}, @default_window_size=#{@default_window_size.inspect}, @window_size=#{@window_size.inspect}, @max_frame_size=#{@max_frame_size.inspect}, @max_streams=#{@max_streams.inspect}, @push_to_peer=#{@push_to_peer.inspect}>" end attr_reader :push_to_peer ## # Set the callback to be invoked when a HTTP request arrives. # def on_request &b @request_proc = b self end ## # Set the callback to be invoked when a HTTP response arrives. # def on_response &b @response_proc = b self end ## # wrap a TCPSocket # e.g.: # # require 'socket' # server = TCPServer.new 4567 # http_client.wrap server.accept # def wrap s @sil = FrameSerialiser.new {|b| cyan "@sil: _write #{hex b}" _write s, b rescue nil } dsil = FrameDeserialiser.new dsil.on_frame {|f| brown "dsil: received #{frm f}" @hook << f } handle_prefaces s #send_frame Settings.frame_from({Settings::INITIAL_WINDOW_SIZE => 0x7fffffff, Settings::ACCEPT_GZIPPED_DATA => 1}), true #send_frame Settings.frame_from({Settings::INITIAL_WINDOW_SIZE => 0x7fffffff}), true send_frame Settings.frame_from({Settings::INITIAL_WINDOW_SIZE => 0x20000, Settings::MAX_FRAME_SIZE => dsil.max_frame_size, Settings::ACCEPT_GZIPPED_DATA => 1}), true loop do bytes = begin s.readpartial(4*1024*1024) rescue EOFError nil end if bytes.nil? or bytes.empty? if s.is_a? OpenSSL::SSL::SSLSocket @logger.info "client disconnected from #{s.io.remote_address.inspect_sockaddr}" else @logger.info "client disconnected from #{s.remote_address.inspect_sockaddr}" end break end red "read #{hex bytes}" dsil << bytes Thread.pass end ensure s.close rescue nil end ## # Shut down the connection. def shut_down @shutdown_lock.synchronize { return if @shutting_down @shutting_down = true } g = Frame.new FrameTypes::GOAWAY, 0x00, 0, [@last_stream,NO_ERROR].pack('NN') send_frame g end ## # deliver HTTPMessage object def deliver m @shutdown_lock.synchronize { raise "delivering message after GOAWAY" if @shutting_down # FIXME } blue "deliver #{m.inspect}" # create headers hblock = @hpack.create_block m.headers # split header block into chunks and deliver chunks = hblock.scan(/.{1,#{@max_frame_size}}/m).map{|c| {type: FrameTypes::CONTINUATION, flags: 0, bytes: c} } if chunks.empty? # I cast no judgement here, but shouldn't there be some headers..? chunks << {type: FrameTypes::HEADERS, flags: FLAG_END_HEADERS, bytes: String.new.b} else chunks.first[:type] = FrameTypes::HEADERS chunks.last[:flags] |= FLAG_END_HEADERS end # without data, the HEADERS ends the stream if m.body.empty? chunks.last[:flags] |= FLAG_END_STREAM end # pad out to %256 bytes if required _pad chunks.last if m.pad? # send the headers frame(s) chunks.each do |chunk| g = Frame.new chunk[:type], chunk[:flags], m.stream, chunk[:bytes] send_frame g end # create data if !m.body.empty? chunks = [] if send_gzip? type = FrameTypes::GZIPPED_DATA bytes = m.body.b until bytes.empty? # binary search for biggest data chunk that fits when gzipped left = 0 right = bytes.bytesize maxright = right best = nil rest = bytes loop do gzipped = ''.b gzip = Zlib::GzipWriter.new(StringIO.new gzipped) gzip.write bytes[0...right] gzip.close rest = bytes[right..-1] if gzipped.bytesize > @max_frame_size # try a smaller sample maxright = right right = maxright - (maxright - left) / 2 # is this a good as we'll get? break if right == left elsif gzipped.bytesize == @max_frame_size # perfect! best = gzipped break else # try a bigger sample best = gzipped left = right right = maxright - (maxright - left) / 2 # is this a good as we'll get? break if right == left end end bytes = rest # create chunk chunk = {flags: 0, bytes: best} # pad out to %256 bytes if required _pad chunk if m.pad? # add to list chunks << chunk end else type = FrameTypes::DATA chunks = m.body.b.scan(/.{1,#{@max_frame_size}}/m).map{|c| {flags: 0, bytes: c} } # pad out to %256 bytes if required _pad chunks.last if m.pad? end chunks.last[:flags] |= FLAG_END_STREAM chunks.each do |chunk| g = Frame.new type, chunk[:flags], m.stream, chunk[:bytes] send_frame g end end # half-close @streams[m.stream].close_local! end ## # send a PING message def ping message=nil if message message = (message.to_s.b + (0.chr * 8)).slice(0, 8) else now = Time.now message = [now.to_i, now.usec].pack('NN') end @pings << message g = Frame.new FrameTypes::PING, 0, 0, message send_frame g end # returns truthy if the given frame carries HTTP semantics # (so has to be sent in order) def semantic_frame? f f.type == FrameTypes::DATA || f.type == FrameTypes::HEADERS || f.type == FrameTypes::CONTINUATION || f.type == FrameTypes::GZIPPED_DATA end # Are we configured to accept GZIPPED_DATA frames from this peer? # Takes into account peer's apparent ability to correctly send gzip. def accept_gzip? return if @ext__veto_gzip @ext__recv_gzip end # tell the peer we'll accept GZIPPED_DATA frames def accept_gzip! return if @ext__veto_gzip if !@ext__recv_gzip send_frame Settings.frame_from({Settings::ACCEPT_GZIPPED_DATA => 1}) @ext__recv_gzip = true end end # tell the peer we don't accept GZIPPED_DATA frames def no_accept_gzip! return if @ext__veto_gzip if @ext__recv_gzip send_frame Settings.frame_from({Settings::ACCEPT_GZIPPED_DATA => 0}) @ext__recv_gzip = false end end # Are we configured to send GZIPPED_DATA frames to this peer? # Takes into account peer's settings for receiving them. def send_gzip? return if !@ext__peer_gzip @ext__send_gzip end # application lets us send GZIPPED_DATA frames to this peer def send_gzip! if !@ext__send_gzip @ext__send_gzip = true end end # application won't let us send GZIPPED_DATA frames to this peer def no_send_gzip! if @ext__send_gzip @ext__send_gzip = false end end private def veto_gzip! return if @ext__veto_gzip if @ext__recv_gzip send_frame Settings.frame_from({Settings::ACCEPT_GZIPPED_DATA => 0}) @ext__veto_gzip = true end end def _pad hash, modulus=256 len = hash[:bytes].bytesize rem = (modulus - (len % modulus)) - 1 # don't overflow the frame! if len + rem > @max_frame_size rem = @max_frame_size - len - 1 end if rem >= 0 padlen = [rem].pack('C') padding = '' padding = [0].pack('C') * rem if rem > 0 hash[:flags] |= FLAG_PADDED hash[:bytes] = padlen + hash[:bytes] + padding end hash end def _write sock, bytes bytes.force_encoding Encoding::BINARY #sock.print bytes until bytes.empty? sent = sock.write bytes #sent = sock.send bytes, 0 bytes = bytes[sent..-1] end #sock.flush end def handle_prefaces s if @is_server preface = String.new.b while preface.length < 24 preface << s.readpartial(24 - preface.length) end raise ConnectionError.new(PROTOCOL_ERROR, 'invalid preface') if preface != PREFACE else _write s, PREFACE end end def send_frame g, is_first_settings=false if is_first_settings # Unset @first_frame_out and transmit said first frame, atomically @send_lock.synchronize do @first_frame_out = false _do_send_frame g end else # FIXME: this is horrible # Spin-lock on @first_frame_out being unset. # Note that writes to @first_frame_out are sync'd by @send_lock wait = false @send_lock.synchronize { wait = @first_frame_out } while wait sleep 0.1 @send_lock.synchronize { wait = @first_frame_out } end # Actually transmit the frame, atomically. @send_lock.synchronize do _do_send_frame g end end end def _do_send_frame g if !semantic_frame? g @sil << g elsif g.sid == 0 # FIXME: assumes .type != DATA, etc. @sil << g else s = @streams[g.sid] s = @streams[g.sid] = Stream.new(@default_window_size) if !s q = @window_queue[g.sid] if q && !q.empty? # there's a queue; wait for a WINDOW_UPDATE q << g elsif g.type == FrameTypes::DATA b = g.payload_size if @window_size >= b && s.window_size >= b @window_size -= b s.window_size -= b @sil << g else @window_queue[g.sid] ||= [] @window_queue[g.sid] << g end else @sil << g end end end # triggered when a new H2 frame arrives def recv_frame f if @first_frame_in # first frame has to be settings # FIXME: make sure this is the actual settings, not the ACK to ours raise ConnectionError.new(PROTOCOL_ERROR, 'invalid preface - no SETTINGS') if f.type != FrameTypes::SETTINGS @first_frame_in = false end if @goaway case f.type when FrameTypes::DATA when FrameTypes::HEADERS when FrameTypes::PUSH_PROMISE when FrameTypes::CONTINUATION else # FIXME @logger.warn "Ignoring frame 0x#{f.type.to_s 16} after GOAWAY" return end end case f.type when FrameTypes::DATA handle_data f when FrameTypes::HEADERS handle_headers f when FrameTypes::PRIORITY # TODO when FrameTypes::RST_STREAM # TODO when FrameTypes::SETTINGS handle_settings f when FrameTypes::PUSH_PROMISE # TODO when FrameTypes::PING handle_ping f when FrameTypes::GOAWAY handle_goaway f when FrameTypes::WINDOW_UPDATE handle_window_update f when FrameTypes::CONTINUATION # never emitted by the Hook raise 'unexpected CONTINUATION frame' # EXTENSION FRAME HANDLING when FrameTypes::GZIPPED_DATA handle_gzipped_data f when FrameTypes::DROPPED_FRAME handle_dropped_frame f else # ignore unrecognised/extension frames drop_frame f end end # tell the peer we ignored it def drop_frame f if !@ext__sent_dropped_frame[f.type] @ext__sent_dropped_frame[f.type] = true g = Frame.new FrameTypes::DROPPED_FRAME, 0x00, 0, [f.type].pack('C') send_frame g end end def handle_dropped_frame f raise ConnectionError.new(PROTOCOL_ERROR, "DROPPED_FRAME must be sent on stream 0, received #{f.sid}") if f.sid != 0 raise ConnectionError.new(PROTOCOL_ERROR, "DROPPED_FRAME payload must be exactly 1 byte, received #{f.payload.bytesize}") if f.payload.bytesize != 1 type = f.payload.bytes.first @logger.info "peer dropped extension frame type 0x#{type.to_s 16}" @ext__peer_dropped_frame[type] = true end # triggered when a completed HTTP message arrives # (farms it off to the registered callback) def emit_message sid, stream # NB: this function only invoked once we get an END_STREAM flag stream.close_remote! @last_stream = sid # FIXME headers = stream.headers if @is_server @request_proc.call HTTPRequest.new( sid, headers.delete(':method'), headers.delete(':path'), headers, stream.body ) else @response_proc.call HTTPResponse.new( sid, headers.delete(':status'), headers, stream.body ) end end def strip_padding bytes ints = bytes.bytes pad_length = ints.shift rst_length = ints.length raise ConnectionError.new(PROTOCOL_ERROR, "Pad Length #{pad_length} exceeds frame payload size #{rst_length+1}") if pad_length > rst_length ints[0...rst_length-pad_length].pack('C*') end def extract_priority bytes stream, weight, bytes = bytes.unpack('NCa*') exclusive = (stream & 0x80000000) == 0x80000000 stream &= 0x7fffffff [{exclusive:exclusive, stream:stream, weight:weight}, bytes] end def handle_data f raise ConnectionError.new(PROTOCOL_ERROR, "DATA must be sent on stream >0") if f.sid == 0 stream = @streams[f.sid] raise SemanticError.new("DATA frame with invalid stream id #{f.sid}") unless stream raise StreamError.new(STREAM_CLOSED, "DATA frame received on (half-)closed stream #{f.sid}") unless stream.open_remote? return if @goaway bytes = f.payload bytes = strip_padding(bytes) if f.flag? FLAG_PADDED # never run out of window space g = Frame.new FrameTypes::WINDOW_UPDATE, 0x00, 0, [bytes.bytesize].pack('N') h = Frame.new FrameTypes::WINDOW_UPDATE, 0x00, f.sid, [bytes.bytesize].pack('N') send_frame g send_frame h stream << bytes emit_message f.sid, stream if f.flag? FLAG_END_STREAM end def handle_gzipped_data f #raise ConnectionError.new(PROTOCOL_ERROR, "GZIPPED_DATA cannot be sent without SETTINGS_ACCEPT_GZIP_DATA") unless accept_gzip if !accept_gzip? drop_frame f return end raise ConnectionError.new(PROTOCOL_ERROR, "GZIPPED_DATA must be sent on stream >0") if f.sid == 0 stream = @streams[f.sid] raise SemanticError.new("GZIPPED_DATA frame with invalid stream id #{f.sid}") unless stream raise StreamError.new(STREAM_CLOSED, "GZIPPED_DATA frame received on (half-)closed stream #{f.sid}") unless stream.open_remote? return if @goaway bytes = f.payload bytes = strip_padding(bytes) if f.flag? FLAG_PADDED # never run out of window space g = Frame.new FrameTypes::WINDOW_UPDATE, 0x00, 0, [bytes.bytesize].pack('N') send_frame g inflated_bytes = nil gunzip = Zlib::GzipReader.new(StringIO.new bytes) begin inflated_bytes = gunzip.read rescue Zlib::Error => e # bad gzip! raise StreamError.new(DATA_ENCODING_ERROR, e.to_s) ensure veto_gzip! if inflated_bytes.nil? end # note: only update the frame window if gunzip succeeddededd h = Frame.new FrameTypes::WINDOW_UPDATE, 0x00, f.sid, [bytes.bytesize].pack('N') send_frame h stream << inflated_bytes emit_message f.sid, stream if f.flag? FLAG_END_STREAM end def handle_headers f stream = @streams[f.sid] if stream if @is_server raise SemanticError.new("no END_STREAM on trailing headers") unless f.flag? FLAG_END_STREAM #FIXME: malformed => StreamError:PROTOCOL_ERROR ? else # FIXME: detect same thing on RESPONSE messages (server->client) end raise StreamError.new(STREAM_CLOSED, "HEADER frame received on (half-)closed stream #{f.sid}") unless stream.open_remote? # FIXME else raise ConnectionError.new(PROTOCOL_ERROR, "HEADERS must be sent on stream >0") if f.sid == 0 raise ConnectionError.new(PROTOCOL_ERROR, "new stream id #{f.sid} not greater than previous stream id #{@last_stream}") if f.sid <= @last_stream if @is_server raise ConnectionError.new(PROTOCOL_ERROR, "streams initiated by client must be odd, received #{f.sid}") if f.sid % 2 != 1 else raise ConnectionError.new(PROTOCOL_ERROR, "streams initiated by server must be event, received #{f.sid}") if f.sid % 2 != 0 end @streams[f.sid] = Stream.new(@default_window_size) end # read the header block bytes = f.payload bytes = strip_padding(bytes) if f.flag? FLAG_PADDED priority, bytes = extract_priority(bytes) if f.flag? FLAG_PRIORITY yellow "priority: #{priority.inspect}" # TODO: handle priority? @hpack.parse_block(bytes) do |k, v| yellow " [#{k}]: [#{v}]" @streams[f.sid][k] << v end yellow "--" # if end-of-stream, emit the message emit_message f.sid, @streams[f.sid] if !@goaway and f.flag? FLAG_END_STREAM end def handle_settings f raise ConnectionError.new(PROTOCOL_ERROR, "SETTINGS must be sent on stream 0, received #{f.sid}") if f.sid != 0 if f.flag? FLAG_ACK # TODO else hash = Settings.pairs_from(f) hash.each_pair do |k, v| case k when Settings::HEADER_TABLE_SIZE @hpack.max_size_out = v when Settings::ENABLE_PUSH raise ConnectionError.new(PROTOCOL_ERROR, "ENABLE_PUSH must be 0 or 1, received #{v}") unless v == 0 or v == 1 # FIXME @push_to_peer = (v == 1) when Settings::MAX_CONCURRENT_STREAMS @max_streams = v when Settings::INITIAL_WINDOW_SIZE raise ConnectionError.new(FLOW_CONTROL_ERROR, "INITIAL_WINDOW_SIZE too large #{v}") if v > 0x7fffffff # FIXME @default_window_size = v when Settings::MAX_FRAME_SIZE raise ConnectionError.new(PROTOCOL_ERROR, "MAX_FRAME_SIZE out of bounds #{v}") if v < 0x4000 or v > 0xffffff # FIXME @max_frame_size = v when Settings::MAX_HEADER_LIST_SIZE # FIXME ??? when Settings::ACCEPT_GZIPPED_DATA raise ConnectionError.new(PROTOCOL_ERROR, "ACCEPT_GZIPPED_DATA must be 0 or 1, received #{v}") unless v == 0 or v == 1 # FIXME @ext__peer_gzip = (v == 1) end end #send ACK # FIXME: ensure we only send this after the initial settings g = Frame.new FrameTypes::SETTINGS, FLAG_ACK, 0, '' send_frame g end end def handle_ping f # FIXME: if f.sid > 0 ... raise ConnectionError.new(PROTOCOL_ERROR, "received PING on stream id #{f.sid}") unless f.sid == 0 raise ConnectionError.new(FRAME_SIZE_ERROR, "PING payload must be 8 bytes, received #{f.payload.bytesize}") unless f.payload.bytesize == 8 if f.flag? FLAG_ACK idx = @pings.find_index f.payload if idx @logger.info "ping pong #{f.payload.inspect}" @pings.delete_at idx else # FIXME raise ConnectionError.new(PROTOCOL_ERROR, "unexpected PONG or incorrect payload #{f.payload.inspect}") end else # send pong g = Frame.new FrameTypes::PING, FLAG_ACK, 0, f.payload send_frame g end end def handle_goaway f raise ConnectionError.new(PROTOCOL_ERROR, "received GOAWAY on stream id #{f.sid}") unless f.sid == 0 # TODO @goaway, error_code, debug_data = f.payload.unpack('NNa*') @logger.info "received GOAWAY (last stream ID=#{@goaway}, error_code=0x#{error_code.to_s 16})" @logger.info debug_data.inspect if debug_data && debug_data.bytesize > 0 shut_down end def handle_window_update f # FIXME: stream states? raise 'connection:FRAME_SIZE_ERROR' unless f.payload.bytesize == 4 increment = f.payload.unpack('N').first #raise 'PROTOCOL_ERROR' if increment & 0x80000000 == 0x80000000 increment &= 0x7fffffff raise 'stream:PROTOCOL_ERROR' if increment == 0 if f.sid != 0 @streams[f.sid].window_size += increment else @window_size += increment end catch :CONNECTION_EXHAUSTED do @window_queue.each_pair do |sid, queue| s = @streams[sid] # note: sid can never be zero, since frames only # enter the queue because of a blocked DATA # (which isn't allowed on stream 0) raise unless s # FIXME catch :STREAM_EXHAUSED do until queue.empty? f = queue.first b = (f.type == FrameTypes::DATA ? f.payload_size : 0) throw :CONNECTION_EXHAUSED if @window_size < b throw :STREAM_EXHAUSTED if s.window_size < b queue.shift @window_size -= b s.window_size -= b @sil << f end end# :STREAM_EXHAUSTED end end# :CONNECTION_EXHAUSTED end end end send more appropriate WINDOW_UPDATEs # encoding: BINARY # vim: ts=2 sts=2 sw=2 expandtab def hex(s) s.nil? ? 'nil' : "[#{s.bytesize}]:#{s.bytes.map{|b|'%02X' % b}.join '.'}" end def ansi(n, *args) args.each {|arg| puts "\x1B[#{n}m#{arg}\x1B[0m" }; end def black(*args) ansi 30, *args; end def red(*args) ansi 31, *args; end def green(*args) ansi 32, *args; end def brown(*args) ansi 33, *args; end def yellow(*args) ansi 93, *args; end def blue(*args) ansi 94, *args; end def magenta(*args) ansi 35, *args; end def cyan(*args) ansi 36, *args; end def silver(*args) ansi 37, *args; end def white(*args) ansi 97, *args; end def flg(f) s = "#{f.to_s 16}" a = [] n = 1 while n <= f if (f & n) == n a << ('%02X' % n) end n <<= 1 end "#{f.to_s 16}[#{a.join '|'}]" end def frm(f) t = RUBYH2::FrameTypes.constants.find {|t| f.type == RUBYH2::FrameTypes.const_get(t) } t ||= f.type "<#{t}: flags=#{flg f.flags} stream=#{f.sid} payload=#{hex f.payload}>" end require 'thread' require 'zlib' require 'stringio' require_relative 'frame-deserialiser' require_relative 'frame-serialiser' require_relative 'frame-types' require_relative 'headers-hook' require_relative 'settings' require_relative 'errors' require_relative 'hpack' require_relative 'http-request' require_relative 'http-response' require_relative 'stream' module RUBYH2 PREFACE = "PRI * HTTP/2.0\r\n\r\nSM\r\n\r\n" class HTTPAgent FLAG_END_STREAM = 0x1 FLAG_ACK = 0x1 FLAG_END_HEADERS = 0x4 FLAG_PADDED = 0x8 FLAG_PRIORITY = 0x20 include Error def initialize is_server, logger # machinery state @is_server = is_server @request_proc = nil @response_proc = nil @hook = HeadersHook.new @hook.on_frame {|f| recv_frame f } @hpack = HPack.new @logger = logger # H2 state @window_queue = {} @first_frame_in = true @first_frame_out = true @streams = {} @default_window_size = 65535 @window_size = @default_window_size @max_frame_size = 16384 @max_streams = nil @push_to_peer = true @ext__send_gzip = true # are we config'd to send gzip data? @ext__peer_gzip = false # is peer config'd to accept gzip data? @ext__recv_gzip = true # are we config'd to accept gzip data? @ext__veto_gzip = false # set if peer doesn't gzip right @ext__sent_dropped_frame = {} @ext__peer_dropped_frame = {} # other settings @pings = [] @goaway = false @last_stream = 0 # last incoming stream handed up to application @shutting_down = false @send_lock = Mutex.new @shutdown_lock = Mutex.new end def inspect "\#<HTTPAgent @window_queue=#{@window_queue.inspect}, @streams=#{@streams.inspect}, @default_window_size=#{@default_window_size.inspect}, @window_size=#{@window_size.inspect}, @max_frame_size=#{@max_frame_size.inspect}, @max_streams=#{@max_streams.inspect}, @push_to_peer=#{@push_to_peer.inspect}>" end attr_reader :push_to_peer ## # Set the callback to be invoked when a HTTP request arrives. # def on_request &b @request_proc = b self end ## # Set the callback to be invoked when a HTTP response arrives. # def on_response &b @response_proc = b self end ## # wrap a TCPSocket # e.g.: # # require 'socket' # server = TCPServer.new 4567 # http_client.wrap server.accept # def wrap s @sil = FrameSerialiser.new {|b| cyan "@sil: _write #{hex b}" _write s, b rescue nil } dsil = FrameDeserialiser.new dsil.on_frame {|f| brown "dsil: received #{frm f}" @hook << f } handle_prefaces s #send_frame Settings.frame_from({Settings::INITIAL_WINDOW_SIZE => 0x7fffffff, Settings::ACCEPT_GZIPPED_DATA => 1}), true #send_frame Settings.frame_from({Settings::INITIAL_WINDOW_SIZE => 0x7fffffff}), true send_frame Settings.frame_from({Settings::INITIAL_WINDOW_SIZE => 0x20000, Settings::MAX_FRAME_SIZE => dsil.max_frame_size, Settings::ACCEPT_GZIPPED_DATA => 1}), true loop do bytes = begin s.readpartial(4*1024*1024) rescue EOFError nil end if bytes.nil? or bytes.empty? if s.is_a? OpenSSL::SSL::SSLSocket @logger.info "client disconnected from #{s.io.remote_address.inspect_sockaddr}" else @logger.info "client disconnected from #{s.remote_address.inspect_sockaddr}" end break end red "read #{hex bytes}" dsil << bytes Thread.pass end ensure s.close rescue nil end ## # Shut down the connection. def shut_down @shutdown_lock.synchronize { return if @shutting_down @shutting_down = true } g = Frame.new FrameTypes::GOAWAY, 0x00, 0, [@last_stream,NO_ERROR].pack('NN') send_frame g end ## # deliver HTTPMessage object def deliver m @shutdown_lock.synchronize { raise "delivering message after GOAWAY" if @shutting_down # FIXME } blue "deliver #{m.inspect}" # create headers hblock = @hpack.create_block m.headers # split header block into chunks and deliver chunks = hblock.scan(/.{1,#{@max_frame_size}}/m).map{|c| {type: FrameTypes::CONTINUATION, flags: 0, bytes: c} } if chunks.empty? # I cast no judgement here, but shouldn't there be some headers..? chunks << {type: FrameTypes::HEADERS, flags: FLAG_END_HEADERS, bytes: String.new.b} else chunks.first[:type] = FrameTypes::HEADERS chunks.last[:flags] |= FLAG_END_HEADERS end # without data, the HEADERS ends the stream if m.body.empty? chunks.last[:flags] |= FLAG_END_STREAM end # pad out to %256 bytes if required _pad chunks.last if m.pad? # send the headers frame(s) chunks.each do |chunk| g = Frame.new chunk[:type], chunk[:flags], m.stream, chunk[:bytes] send_frame g end # create data if !m.body.empty? chunks = [] if send_gzip? type = FrameTypes::GZIPPED_DATA bytes = m.body.b until bytes.empty? # binary search for biggest data chunk that fits when gzipped left = 0 right = bytes.bytesize maxright = right best = nil rest = bytes loop do gzipped = ''.b gzip = Zlib::GzipWriter.new(StringIO.new gzipped) gzip.write bytes[0...right] gzip.close rest = bytes[right..-1] if gzipped.bytesize > @max_frame_size # try a smaller sample maxright = right right = maxright - (maxright - left) / 2 # is this a good as we'll get? break if right == left elsif gzipped.bytesize == @max_frame_size # perfect! best = gzipped break else # try a bigger sample best = gzipped left = right right = maxright - (maxright - left) / 2 # is this a good as we'll get? break if right == left end end bytes = rest # create chunk chunk = {flags: 0, bytes: best} # pad out to %256 bytes if required _pad chunk if m.pad? # add to list chunks << chunk end else type = FrameTypes::DATA chunks = m.body.b.scan(/.{1,#{@max_frame_size}}/m).map{|c| {flags: 0, bytes: c} } # pad out to %256 bytes if required _pad chunks.last if m.pad? end chunks.last[:flags] |= FLAG_END_STREAM chunks.each do |chunk| g = Frame.new type, chunk[:flags], m.stream, chunk[:bytes] send_frame g end end # half-close @streams[m.stream].close_local! end ## # send a PING message def ping message=nil if message message = (message.to_s.b + (0.chr * 8)).slice(0, 8) else now = Time.now message = [now.to_i, now.usec].pack('NN') end @pings << message g = Frame.new FrameTypes::PING, 0, 0, message send_frame g end # returns truthy if the given frame carries HTTP semantics # (so has to be sent in order) def semantic_frame? f f.type == FrameTypes::DATA || f.type == FrameTypes::HEADERS || f.type == FrameTypes::CONTINUATION || f.type == FrameTypes::GZIPPED_DATA end # Are we configured to accept GZIPPED_DATA frames from this peer? # Takes into account peer's apparent ability to correctly send gzip. def accept_gzip? return if @ext__veto_gzip @ext__recv_gzip end # tell the peer we'll accept GZIPPED_DATA frames def accept_gzip! return if @ext__veto_gzip if !@ext__recv_gzip send_frame Settings.frame_from({Settings::ACCEPT_GZIPPED_DATA => 1}) @ext__recv_gzip = true end end # tell the peer we don't accept GZIPPED_DATA frames def no_accept_gzip! return if @ext__veto_gzip if @ext__recv_gzip send_frame Settings.frame_from({Settings::ACCEPT_GZIPPED_DATA => 0}) @ext__recv_gzip = false end end # Are we configured to send GZIPPED_DATA frames to this peer? # Takes into account peer's settings for receiving them. def send_gzip? return if !@ext__peer_gzip @ext__send_gzip end # application lets us send GZIPPED_DATA frames to this peer def send_gzip! if !@ext__send_gzip @ext__send_gzip = true end end # application won't let us send GZIPPED_DATA frames to this peer def no_send_gzip! if @ext__send_gzip @ext__send_gzip = false end end private def veto_gzip! return if @ext__veto_gzip if @ext__recv_gzip send_frame Settings.frame_from({Settings::ACCEPT_GZIPPED_DATA => 0}) @ext__veto_gzip = true end end def _pad hash, modulus=256 len = hash[:bytes].bytesize rem = (modulus - (len % modulus)) - 1 # don't overflow the frame! if len + rem > @max_frame_size rem = @max_frame_size - len - 1 end if rem >= 0 padlen = [rem].pack('C') padding = '' padding = [0].pack('C') * rem if rem > 0 hash[:flags] |= FLAG_PADDED hash[:bytes] = padlen + hash[:bytes] + padding end hash end def _write sock, bytes bytes.force_encoding Encoding::BINARY #sock.print bytes until bytes.empty? sent = sock.write bytes #sent = sock.send bytes, 0 bytes = bytes[sent..-1] end #sock.flush end def handle_prefaces s if @is_server preface = String.new.b while preface.length < 24 preface << s.readpartial(24 - preface.length) end raise ConnectionError.new(PROTOCOL_ERROR, 'invalid preface') if preface != PREFACE else _write s, PREFACE end end def send_frame g, is_first_settings=false if is_first_settings # Unset @first_frame_out and transmit said first frame, atomically @send_lock.synchronize do @first_frame_out = false _do_send_frame g end else # FIXME: this is horrible # Spin-lock on @first_frame_out being unset. # Note that writes to @first_frame_out are sync'd by @send_lock wait = false @send_lock.synchronize { wait = @first_frame_out } while wait sleep 0.1 @send_lock.synchronize { wait = @first_frame_out } end # Actually transmit the frame, atomically. @send_lock.synchronize do _do_send_frame g end end end def _do_send_frame g if !semantic_frame? g @sil << g elsif g.sid == 0 # FIXME: assumes .type != DATA, etc. @sil << g else s = @streams[g.sid] s = @streams[g.sid] = Stream.new(@default_window_size) if !s q = @window_queue[g.sid] if q && !q.empty? # there's a queue; wait for a WINDOW_UPDATE q << g elsif g.type == FrameTypes::DATA b = g.payload_size if @window_size >= b && s.window_size >= b @window_size -= b s.window_size -= b @sil << g else @window_queue[g.sid] ||= [] @window_queue[g.sid] << g end else @sil << g end end end # triggered when a new H2 frame arrives def recv_frame f if @first_frame_in # first frame has to be settings # FIXME: make sure this is the actual settings, not the ACK to ours raise ConnectionError.new(PROTOCOL_ERROR, 'invalid preface - no SETTINGS') if f.type != FrameTypes::SETTINGS @first_frame_in = false end if @goaway case f.type when FrameTypes::DATA when FrameTypes::HEADERS when FrameTypes::PUSH_PROMISE when FrameTypes::CONTINUATION else # FIXME @logger.warn "Ignoring frame 0x#{f.type.to_s 16} after GOAWAY" return end end case f.type when FrameTypes::DATA handle_data f when FrameTypes::HEADERS handle_headers f when FrameTypes::PRIORITY # TODO when FrameTypes::RST_STREAM # TODO when FrameTypes::SETTINGS handle_settings f when FrameTypes::PUSH_PROMISE # TODO when FrameTypes::PING handle_ping f when FrameTypes::GOAWAY handle_goaway f when FrameTypes::WINDOW_UPDATE handle_window_update f when FrameTypes::CONTINUATION # never emitted by the Hook raise 'unexpected CONTINUATION frame' # EXTENSION FRAME HANDLING when FrameTypes::GZIPPED_DATA handle_gzipped_data f when FrameTypes::DROPPED_FRAME handle_dropped_frame f else # ignore unrecognised/extension frames drop_frame f end end # tell the peer we ignored it def drop_frame f if !@ext__sent_dropped_frame[f.type] @ext__sent_dropped_frame[f.type] = true g = Frame.new FrameTypes::DROPPED_FRAME, 0x00, 0, [f.type].pack('C') send_frame g end end def handle_dropped_frame f raise ConnectionError.new(PROTOCOL_ERROR, "DROPPED_FRAME must be sent on stream 0, received #{f.sid}") if f.sid != 0 raise ConnectionError.new(PROTOCOL_ERROR, "DROPPED_FRAME payload must be exactly 1 byte, received #{f.payload.bytesize}") if f.payload.bytesize != 1 type = f.payload.bytes.first @logger.info "peer dropped extension frame type 0x#{type.to_s 16}" @ext__peer_dropped_frame[type] = true end # triggered when a completed HTTP message arrives # (farms it off to the registered callback) def emit_message sid, stream # NB: this function only invoked once we get an END_STREAM flag stream.close_remote! @last_stream = sid # FIXME headers = stream.headers if @is_server @request_proc.call HTTPRequest.new( sid, headers.delete(':method'), headers.delete(':path'), headers, stream.body ) else @response_proc.call HTTPResponse.new( sid, headers.delete(':status'), headers, stream.body ) end end def strip_padding bytes ints = bytes.bytes pad_length = ints.shift rst_length = ints.length raise ConnectionError.new(PROTOCOL_ERROR, "Pad Length #{pad_length} exceeds frame payload size #{rst_length+1}") if pad_length > rst_length ints[0...rst_length-pad_length].pack('C*') end def extract_priority bytes stream, weight, bytes = bytes.unpack('NCa*') exclusive = (stream & 0x80000000) == 0x80000000 stream &= 0x7fffffff [{exclusive:exclusive, stream:stream, weight:weight}, bytes] end def handle_data f raise ConnectionError.new(PROTOCOL_ERROR, "DATA must be sent on stream >0") if f.sid == 0 stream = @streams[f.sid] raise SemanticError.new("DATA frame with invalid stream id #{f.sid}") unless stream raise StreamError.new(STREAM_CLOSED, "DATA frame received on (half-)closed stream #{f.sid}") unless stream.open_remote? return if @goaway bytes = f.payload # never run out of window space size = bytes.bytesize if size > 0 g = Frame.new FrameTypes::WINDOW_UPDATE, 0x00, 0, [size].pack('N') h = Frame.new FrameTypes::WINDOW_UPDATE, 0x00, f.sid, [size].pack('N') send_frame g send_frame h end bytes = strip_padding(bytes) if f.flag? FLAG_PADDED stream << bytes emit_message f.sid, stream if f.flag? FLAG_END_STREAM end def handle_gzipped_data f #raise ConnectionError.new(PROTOCOL_ERROR, "GZIPPED_DATA cannot be sent without SETTINGS_ACCEPT_GZIP_DATA") unless accept_gzip if !accept_gzip? drop_frame f return end raise ConnectionError.new(PROTOCOL_ERROR, "GZIPPED_DATA must be sent on stream >0") if f.sid == 0 stream = @streams[f.sid] raise SemanticError.new("GZIPPED_DATA frame with invalid stream id #{f.sid}") unless stream raise StreamError.new(STREAM_CLOSED, "GZIPPED_DATA frame received on (half-)closed stream #{f.sid}") unless stream.open_remote? return if @goaway bytes = f.payload bytes = strip_padding(bytes) if f.flag? FLAG_PADDED # never run out of window space size = bytes.bytesize if size > 0 g = Frame.new FrameTypes::WINDOW_UPDATE, 0x00, 0, [size].pack('N') send_frame g end inflated_bytes = nil gunzip = Zlib::GzipReader.new(StringIO.new bytes) begin inflated_bytes = gunzip.read rescue Zlib::Error => e # bad gzip! raise StreamError.new(DATA_ENCODING_ERROR, e.to_s) ensure veto_gzip! if inflated_bytes.nil? end # note: only update the frame window if gunzip succeeddededd if size > 0 h = Frame.new FrameTypes::WINDOW_UPDATE, 0x00, f.sid, [size].pack('N') send_frame h end stream << inflated_bytes emit_message f.sid, stream if f.flag? FLAG_END_STREAM end def handle_headers f stream = @streams[f.sid] if stream if @is_server raise SemanticError.new("no END_STREAM on trailing headers") unless f.flag? FLAG_END_STREAM #FIXME: malformed => StreamError:PROTOCOL_ERROR ? else # FIXME: detect same thing on RESPONSE messages (server->client) end raise StreamError.new(STREAM_CLOSED, "HEADER frame received on (half-)closed stream #{f.sid}") unless stream.open_remote? # FIXME else raise ConnectionError.new(PROTOCOL_ERROR, "HEADERS must be sent on stream >0") if f.sid == 0 raise ConnectionError.new(PROTOCOL_ERROR, "new stream id #{f.sid} not greater than previous stream id #{@last_stream}") if f.sid <= @last_stream if @is_server raise ConnectionError.new(PROTOCOL_ERROR, "streams initiated by client must be odd, received #{f.sid}") if f.sid % 2 != 1 else raise ConnectionError.new(PROTOCOL_ERROR, "streams initiated by server must be event, received #{f.sid}") if f.sid % 2 != 0 end @streams[f.sid] = Stream.new(@default_window_size) end # read the header block bytes = f.payload bytes = strip_padding(bytes) if f.flag? FLAG_PADDED priority, bytes = extract_priority(bytes) if f.flag? FLAG_PRIORITY yellow "priority: #{priority.inspect}" # TODO: handle priority? @hpack.parse_block(bytes) do |k, v| yellow " [#{k}]: [#{v}]" @streams[f.sid][k] << v end yellow "--" # if end-of-stream, emit the message emit_message f.sid, @streams[f.sid] if !@goaway and f.flag? FLAG_END_STREAM end def handle_settings f raise ConnectionError.new(PROTOCOL_ERROR, "SETTINGS must be sent on stream 0, received #{f.sid}") if f.sid != 0 if f.flag? FLAG_ACK # TODO else hash = Settings.pairs_from(f) hash.each_pair do |k, v| case k when Settings::HEADER_TABLE_SIZE @hpack.max_size_out = v when Settings::ENABLE_PUSH raise ConnectionError.new(PROTOCOL_ERROR, "ENABLE_PUSH must be 0 or 1, received #{v}") unless v == 0 or v == 1 # FIXME @push_to_peer = (v == 1) when Settings::MAX_CONCURRENT_STREAMS @max_streams = v when Settings::INITIAL_WINDOW_SIZE raise ConnectionError.new(FLOW_CONTROL_ERROR, "INITIAL_WINDOW_SIZE too large #{v}") if v > 0x7fffffff # FIXME @default_window_size = v when Settings::MAX_FRAME_SIZE raise ConnectionError.new(PROTOCOL_ERROR, "MAX_FRAME_SIZE out of bounds #{v}") if v < 0x4000 or v > 0xffffff # FIXME @max_frame_size = v when Settings::MAX_HEADER_LIST_SIZE # FIXME ??? when Settings::ACCEPT_GZIPPED_DATA raise ConnectionError.new(PROTOCOL_ERROR, "ACCEPT_GZIPPED_DATA must be 0 or 1, received #{v}") unless v == 0 or v == 1 # FIXME @ext__peer_gzip = (v == 1) end end #send ACK # FIXME: ensure we only send this after the initial settings g = Frame.new FrameTypes::SETTINGS, FLAG_ACK, 0, '' send_frame g end end def handle_ping f # FIXME: if f.sid > 0 ... raise ConnectionError.new(PROTOCOL_ERROR, "received PING on stream id #{f.sid}") unless f.sid == 0 raise ConnectionError.new(FRAME_SIZE_ERROR, "PING payload must be 8 bytes, received #{f.payload.bytesize}") unless f.payload.bytesize == 8 if f.flag? FLAG_ACK idx = @pings.find_index f.payload if idx @logger.info "ping pong #{f.payload.inspect}" @pings.delete_at idx else # FIXME raise ConnectionError.new(PROTOCOL_ERROR, "unexpected PONG or incorrect payload #{f.payload.inspect}") end else # send pong g = Frame.new FrameTypes::PING, FLAG_ACK, 0, f.payload send_frame g end end def handle_goaway f raise ConnectionError.new(PROTOCOL_ERROR, "received GOAWAY on stream id #{f.sid}") unless f.sid == 0 # TODO @goaway, error_code, debug_data = f.payload.unpack('NNa*') @logger.info "received GOAWAY (last stream ID=#{@goaway}, error_code=0x#{error_code.to_s 16})" @logger.info debug_data.inspect if debug_data && debug_data.bytesize > 0 shut_down end def handle_window_update f # FIXME: stream states? raise 'connection:FRAME_SIZE_ERROR' unless f.payload.bytesize == 4 increment = f.payload.unpack('N').first #raise 'PROTOCOL_ERROR' if increment & 0x80000000 == 0x80000000 increment &= 0x7fffffff raise 'stream:PROTOCOL_ERROR' if increment == 0 if f.sid != 0 @streams[f.sid].window_size += increment else @window_size += increment end catch :CONNECTION_EXHAUSTED do @window_queue.each_pair do |sid, queue| s = @streams[sid] # note: sid can never be zero, since frames only # enter the queue because of a blocked DATA # (which isn't allowed on stream 0) raise unless s # FIXME catch :STREAM_EXHAUSED do until queue.empty? f = queue.first b = (f.type == FrameTypes::DATA ? f.payload_size : 0) throw :CONNECTION_EXHAUSED if @window_size < b throw :STREAM_EXHAUSTED if s.window_size < b queue.shift @window_size -= b s.window_size -= b @sil << f end end# :STREAM_EXHAUSTED end end# :CONNECTION_EXHAUSTED end end end
require 'jsonclient' class Wechat::Core::Follower extend Wechat::Core::Common # 获取关注者列表 # http://mp.weixin.qq.com/wiki/0/d0e07720fc711c02a3eab6ec33054804.html # # Return hash format if success: # { # total: <TOTAL>, # count: <COUNT>, # data: { openid: [ <OPEN_ID_1>, <OPEN_ID_2>, ... ] }, # next_openid: <NEXT_OPEN_ID> # } def self.index(access_token, next_open_id: nil) assert_present! :access_token, access_token options = { access_token: access_token } options[:next_openid] = next_open_id if next_open_id.present? message = get_json 'https://api.weixin.qq.com/cgi-bin/user/get', body: options message.body end end 1, Improve the Follower wrapper class to remove the un-used source codes. class Wechat::Core::Follower extend Wechat::Core::Common # 获取关注者列表 # http://mp.weixin.qq.com/wiki/0/d0e07720fc711c02a3eab6ec33054804.html # # Return hash format if success: # { # total: <TOTAL>, # count: <COUNT>, # data: { openid: [ <OPEN_ID_1>, <OPEN_ID_2>, ... ] }, # next_openid: <NEXT_OPEN_ID> # } def self.index(access_token, next_open_id: nil) assert_present! :access_token, access_token options = { access_token: access_token } options[:next_openid] = next_open_id if next_open_id.present? message = get_json 'https://api.weixin.qq.com/cgi-bin/user/get', body: options message.body end end
require "/opt/engines/lib/ruby/ManagedContainer.rb" require "/opt/engines/lib/ruby/ManagedContainerObjects.rb" require "/opt/engines/lib/ruby/ManagedEngine.rb" require "/opt/engines/lib/ruby/ManagedServices.rb" require "/opt/engines/lib/ruby/SysConfig.rb" require "rubygems" require "git" require 'fileutils' require 'json' require '/opt/engines/lib/ruby/SystemAccess.rb' class EngineBuilder @repoName=nil @hostname=nil @domain_name=nil @build_name=nil @web_protocol="HTTPS and HTTP" attr_reader :last_error, :repoName, :hostname, :domain_name, :build_name, :set_environments, :container_name, :environments, :runtime, :webPort, :http_protocol, :blueprint, :first_build class BuildError < StandardError attr_reader :parent_exception,:method_name def initialize(parent,method_name) @parent_exception = parent end end class DockerFileBuilder def initialize(reader,containername,hostname,domain_name,webport,builder) @hostname = hostname @container_name = containername @domain_name = domain_name @webPort = webport @blueprint_reader = reader @builder=builder @docker_file = File.open( @blueprint_reader.get_basedir + "/Dockerfile","a") @layer_count=0 end def log_build_output(line) @builder.log_build_output(line) end def log_build_errors(line) @builder.log_build_errors(line) end def count_layer ++@layer_count if @layer_count >75 raise EngineBuilder.BuildError.new() end end def write_files_for_docker @docker_file.puts("") write_environment_variables write_stack_env write_services write_file_service #write_db_service #write_cron_jobs write_os_packages write_apache_modules write_user_local = true if write_user_local == true @docker_file.puts("RUN ln -s /usr/local/ /home/local;\\") @docker_file.puts(" chown -R $ContUser /usr/local/") end write_app_archives write_container_user chown_home_app write_worker_commands write_sed_strings write_persistant_dirs write_persistant_files insert_framework_frag_in_dockerfile("builder.mid.tmpl") @docker_file.puts("") write_rake_list write_pear_list write_write_permissions_recursive #recursive firs (as can use to create blank dir) write_write_permissions_single @docker_file.puts("") @docker_file.puts("USER 0") count_layer() @docker_file.puts("run mkdir -p /home/fs/local/") count_layer() @docker_file.puts("") write_run_install_script write_data_permissions @docker_file.puts("USER 0") count_layer() @docker_file.puts("run mv /home/fs /home/fs_src") count_layer() @docker_file.puts("VOLUME /home/fs_src/") count_layer() @docker_file.puts("USER $ContUser") count_layer() insert_framework_frag_in_dockerfile("builder.end.tmpl") @docker_file.puts("") @docker_file.puts("VOLUME /home/fs/") count_layer() write_clear_env_variables @docker_file.close end def write_clear_env_variables @docker_file.puts("#Clear env") @blueprint_reader.environments.each do |env| if env.build_time_only == true @docker_file.puts("ENV " + env.name + "\" \"") count_layer end end rescue Exception=>e log_exception(e) return false end def write_apache_modules if @blueprint_reader.apache_modules.count <1 return end @docker_file.puts("#Apache Modules") ap_modules_str = String.new @blueprint_reader.apache_modules.each do |ap_module| ap_modules_str += ap_module + " " end @docker_file.puts("RUN a2enmod " + ap_modules_str) count_layer() end def write_environment_variables begin @docker_file.puts("#Environment Variables") #Fixme #kludge @docker_file.puts("#System Envs") @docker_file.puts("ENV TZ Sydney/Australia") count_layer @blueprint_reader.environments.each do |env| @docker_file.puts("#Blueprint ENVs") if env.value != nil env.value.sub!(/ /,"\\ ") end if env.value !=nil && env.value.to_s.length >0 #env statement must have two arguments @docker_file.puts("ENV " + env.name + " " + env.value.to_s ) count_layer end end rescue Exception=>e log_exception(e) return false end end def write_persistant_dirs begin log_build_output("setup persistant Dirs") n=0 @docker_file.puts("#Persistant Dirs") @blueprint_reader.persistant_dirs.each do |path| path.chomp!("/") @docker_file.puts("") @docker_file.puts("RUN \\") dirname = File.dirname(path) @docker_file.puts("mkdir -p $CONTFSVolHome/$VOLDIR/" + dirname + ";\\") @docker_file.puts("if [ ! -d /home/" + path + " ];\\") @docker_file.puts(" then \\") @docker_file.puts(" mkdir -p /home/" + path +" ;\\") @docker_file.puts(" fi;\\") @docker_file.puts("mv /home/" + path + " $CONTFSVolHome/$VOLDIR/" + dirname + "/;\\") @docker_file.puts("ln -s $CONTFSVolHome/$VOLDIR/" + path + " /home/" + path) n=n+1 count_layer end rescue Exception=>e log_exception(e) return false end end def write_data_permissions @docker_file.puts("#Data Permissions") @docker_file.puts("USER 0") count_layer() @docker_file.puts("") @docker_file.puts("RUN /usr/sbin/usermod -u $data_uid data-user;\\") @docker_file.puts("chown -R $data_uid.$data_gid /home/app /home/fs ;\\") @docker_file.puts("chmod -R 770 /home/fs") count_layer @docker_file.puts("USER $ContUser") count_layer end def write_run_install_script @docker_file.puts("WorkDir /home/") @docker_file.puts("#Setup templates and run installer") @docker_file.puts("USER $ContUser") count_layer @docker_file.puts("RUN bash /home/setup.sh") count_layer end def write_persistant_files begin @docker_file.puts("#Persistant Files") log_build_output("set setup_env") src_paths = @blueprint_reader.persistant_files[:src_paths] dest_paths = @blueprint_reader.persistant_files[:dest_paths] src_paths.each do |path| # path = dest_paths[n] p :path p path dir = File.dirname(path) p :dir p dir if dir.present? == false || dir == nil || dir.length ==0 || dir =="." dir = "app/" end p :dir p dir @docker_file.puts("") @docker_file.puts("RUN mkdir -p /home/" + dir + ";\\") @docker_file.puts(" if [ ! -f /home/" + path + " ];\\") @docker_file.puts(" then \\") @docker_file.puts(" touch /home/" + path +";\\") @docker_file.puts(" fi;\\") @docker_file.puts(" mkdir -p $CONTFSVolHome/$VOLDIR/" + dir +";\\") @docker_file.puts("\\") @docker_file.puts(" mv /home/" + path + " $CONTFSVolHome/$VOLDIR" + "/" + dir + ";\\") @docker_file.puts(" ln -s $CONTFSVolHome/$VOLDIR/" + path + " /home/" + path) count_layer end rescue Exception=>e log_exception(e) return false end end def write_file_service begin @docker_file.puts("#File Service") @docker_file.puts("#FS Env") # @docker_file.puts("ENV CONTFSVolHome /home/fs/" ) # count_layer @blueprint_reader.volumes.each_value do |vol| dest = File.basename(vol.remotepath) # @docker_file.puts("ENV VOLDIR /home/fs/" + dest) # count_layer @docker_file.puts("RUN mkdir -p $CONTFSVolHome/" + dest) count_layer end rescue Exception=>e log_exception(e) return false end end def write_services services = @blueprint_reader.services @docker_file.puts("#Service Environment Variables") services.each do |service_hash| p :service_hash p service_hash service_def = @builder.get_service_def(service_hash) if service_def != nil p :processing p service_def service_environment_variables = service_def[:target_environment_variables] if service_environment_variables != nil service_environment_variables.values.each do |env_variable_pair| p :setting_values p env_variable_pair env_name = env_variable_pair[:environment_name] value_name = env_variable_pair[:variable_name] value=service_hash[:variables][value_name.to_sym] p :looking_for_ p value_name p :as_symbol p value_name.to_sym p :in_service_hash p service_hash p :and_found p value if value != nil && value.to_s.length >0 @docker_file.puts("ENV " + env_name + " " + value ) count_layer() end end end end end end def write_sed_strings begin n=0 @docker_file.puts("#Sed Strings") @blueprint_reader.sed_strings[:src_file].each do |src_file| #src_file = @sed_strings[:src_file][n] dest_file = @blueprint_reader.sed_strings[:dest_file][n] sed_str = @blueprint_reader.sed_strings[:sed_str][n] tmp_file = @blueprint_reader.sed_strings[:tmp_file][n] @docker_file.puts("") @docker_file.puts("RUN cat " + src_file + " | sed \"" + sed_str + "\" > " + tmp_file + " ;\\") @docker_file.puts(" cp " + tmp_file + " " + dest_file) count_layer n=n+1 end rescue Exception=>e log_exception(e) return false end end def write_rake_list begin @docker_file.puts("#Rake Actions") @blueprint_reader.rake_actions.each do |rake_action| rake_cmd = rake_action[:action] if @builder.first_build == false && rake_action[:always_run] == false next end if rake_cmd !=nil @docker_file.puts("RUN /usr/local/rbenv/shims/bundle exec rake " + rake_cmd ) count_layer end end rescue Exception=>e log_exception(e) return false end end def write_os_packages begin packages=String.new @docker_file.puts("#OS Packages") @blueprint_reader.os_packages.each do |package| if package != nil packages = packages + package + " " end end if packages.length >1 @docker_file.puts("\nRUN apt-get install -y " + packages ) count_layer end #FIXME Wrong spot @blueprint_reader.workerPorts.each do |port| @docker_file.puts("EXPOSE " + port.port.to_s) count_layer end rescue Exception=>e log_exception(e) return false end end def insert_framework_frag_in_dockerfile(frag_name) begin log_build_output(frag_name) @docker_file.puts("#Framework Frag") frame_build_docker_frag = File.open(SysConfig.DeploymentTemplates + "/" + @blueprint_reader.framework + "/Dockerfile." + frag_name) builder_frag = frame_build_docker_frag.read @docker_file.write(builder_frag) count_layer rescue Exception=>e log_exception(e) return false end end def chown_home_app begin @docker_file.puts("#Chown App Dir") log_build_output("Dockerfile:Chown") @docker_file.puts("USER 0") count_layer @docker_file.puts("RUN if [ ! -d /home/app ];\\") @docker_file.puts(" then \\") @docker_file.puts(" mkdir -p /home/app ;\\") @docker_file.puts(" fi;\\") @docker_file.puts(" mkdir -p /home/fs ; mkdir -p /home/fs/local ;\\") @docker_file.puts(" chown -R $ContUser /home/app /home/fs /home/fs/local") count_layer @docker_file.puts("USER $ContUser") count_layer rescue Exception=>e log_exception(e) return false end end def write_worker_commands begin @docker_file.puts("#Worker Commands") log_build_output("Dockerfile:Worker Commands") scripts_path = @blueprint_reader.get_basedir + "/home/engines/scripts/" if Dir.exist?(scripts_path) == false FileUtils.mkdir_p(scripts_path) end if @blueprint_reader.worker_commands != nil && @blueprint_reader.worker_commands.length >0 cmdf= File.open( scripts_path + "pre-running.sh","w") if !cmdf puts("failed to open " + scripts_path + "pre-running.sh") exit end cmdf.chmod(0755) cmdf.puts("#!/bin/bash") cmdf.puts("cd /home/app") @blueprint_reader.worker_commands.each do |command| cmdf.puts(command) end cmdf.close File.chmod(0755,scripts_path + "pre-running.sh") end rescue Exception=>e log_exception(e) return false end end # def write_cron_jobs # begin # if @blueprint_reader.cron_jobs.length >0 # @docker_file.puts("ENV CRONJOBS YES") # count_layer ## @docker_file.puts("RUN crontab $data_uid /home/crontab ") ## count_layer cron run from cron service # end # return true # rescue Exception=>e # log_exception(e) # return false # end # end # def write_db_service # begin # @docker_file.puts("#Database Service") # log_build_output("Dockerfile:DB env") # @blueprint_reader.databases.each do |db| # @docker_file.puts("#Database Env") # @docker_file.puts("ENV dbname " + db.name) # count_layer # @docker_file.puts("ENV dbhost " + db.dbHost) # count_layer # @docker_file.puts("ENV dbuser " + db.dbUser) # count_layer # @docker_file.puts("ENV dbpasswd " + db.dbPass) # count_layer # flavor = db.flavor # if flavor == "mysql" # flavor = "mysql2" # elsif flavor == "pgsql" # flavor = "postgresql" # end # @docker_file.puts("ENV dbflavor " + flavor) # count_layer # end # # rescue Exception=>e # log_exception(e) # return false # end # end def write_write_permissions_single begin @docker_file.puts("") @docker_file.puts("#Write Permissions Non Recursive") log_build_output("Dockerfile:Write Permissions Non Recursive") if @blueprint_reader.single_chmods == nil return end @blueprint_reader.single_chmods.each do |path| if path !=nil @docker_file.puts("RUN if [ ! -f /home/app/" + path + " ];\\" ) @docker_file.puts(" then \\") @docker_file.puts(" mkdir -p `dirname /home/app/" + path + "`;\\") @docker_file.puts(" touch /home/app/" + path + ";\\") @docker_file.puts(" fi;\\") @docker_file.puts( " chmod 775 /home/app/" + path ) count_layer end end rescue Exception=>e log_exception(e) return false end end def write_write_permissions_recursive begin @docker_file.puts("#Write Permissions Recursive") @docker_file.puts("") log_build_output("Dockerfile:Write Permissions Recursive") if @blueprint_reader.recursive_chmods == nil return end @blueprint_reader.recursive_chmods.each do |directory| if directory !=nil @docker_file.puts("RUN if [ -h /home/app/" + directory + " ] ;\\") @docker_file.puts(" then \\") @docker_file.puts(" dest=`ls -la /home/app/" + directory +" |cut -f2 -d\">\"`;\\") @docker_file.puts(" chmod -R gu+rw $dest;\\") @docker_file.puts(" elif [ ! -d /home/app/" + directory + " ] ;\\" ) @docker_file.puts(" then \\") @docker_file.puts(" mkdir \"/home/app/" + directory + "\";\\") @docker_file.puts(" chmod -R gu+rw \"/home/app/" + directory + "\";\\" ) @docker_file.puts(" else\\") @docker_file.puts(" chmod -R gu+rw \"/home/app/" + directory + "\";\\") @docker_file.puts(" for dir in `find /home/app/" + directory + " -type d `;\\") @docker_file.puts(" do\\") @docker_file.puts(" adir=`echo $dir | sed \"/ /s//_+_/\" |grep -v _+_` ;\\") @docker_file.puts(" if test -n $adir;\\") @docker_file.puts(" then\\") @docker_file.puts(" dirs=\"$dirs $adir\";\\"); @docker_file.puts(" fi;\\") @docker_file.puts(" done;\\") @docker_file.puts(" if test -n \"$dirs\" ;\\") @docker_file.puts(" then\\") @docker_file.puts(" chmod gu+x $dirs ;\\") @docker_file.puts("fi;\\") @docker_file.puts("fi") count_layer end end end rescue Exception=>e log_exception(e) return false end def write_app_archives begin @docker_file.puts("#App Archives") log_build_output("Dockerfile:App Archives") n=0 # srcs=String.new # names=String.new # locations=String.new # extracts=String.new # dirs=String.new @docker_file.puts("") @blueprint_reader.archives_details.each do |archive_details| arc_src = archive_details[:source_url] arc_name = archive_details[:package_name] arc_loc = archive_details[:destination] arc_extract = archive_details[:extraction_command] arc_dir = archive_details[:path_to_extracted] # if(n >0) # archive_details[:source_url]=arc_src # archive_details[:package_name]=arc_name # archive_details[:extraction_cmd]=arc_extract # archive_details[:destination]=arc_loc # archive_details[:path_to_extracted]=arc_dir # srcs = srcs + " " # names =names + " " # locations = locations + " " # extracts =extracts + " " # dirs =dirs + " " # end p "_+_+_+_+_+_+_+_+_+_+_" p archive_details p arc_src + "_" p arc_name + "_" p arc_loc + "_" p arc_extract + "_" p arc_dir +"|" if arc_loc == "./" arc_loc="" elsif arc_loc.end_with?("/") arc_loc = arc_loc.chop() #note not String#chop end if arc_extract == "git" @docker_file.puts("WORKDIR /tmp") count_layer @docker_file.puts("USER $ContUser") count_layer @docker_file.puts("RUN git clone " + arc_src + " --depth 1 " ) count_layer @docker_file.puts("USER 0 ") count_layer @docker_file.puts("RUN mv " + arc_dir + " /home/app" + arc_loc ) count_layer @docker_file.puts("USER $ContUser") count_layer else @docker_file.puts("USER $ContUser") count_layer step_back=false if arc_dir == nil step_back=true @docker_file.puts("RUN mkdir /tmp/app") count_layer arc_dir = "app" @docker_file.puts("WORKDIR /tmp/app") count_layer else @docker_file.puts("WORKDIR /tmp") count_layer end @docker_file.puts("RUN wget -O \"" + arc_name + "\" \"" + arc_src + "\" ;\\" ) if arc_extract!= nil @docker_file.puts(" " + arc_extract + " \"" + arc_name + "\" ;\\") # + "\"* 2>&1 > /dev/null ") @docker_file.puts(" rm \"" + arc_name + "\"") else @docker_file.puts("echo") #step past the next shell line implied by preceeding ; end @docker_file.puts("USER 0 ") count_layer if step_back==true @docker_file.puts("WORKDIR /tmp") count_layer end if arc_loc.start_with?("/home/app") || arc_loc.start_with?("/home/local/") dest_prefix="" else dest_prefix="/home/app" end @docker_file.puts("run if test ! -d " + arc_dir +" ;\\") @docker_file.puts(" then\\") @docker_file.puts(" mkdir -p /home/app ;\\") @docker_file.puts(" fi;\\") @docker_file.puts(" mv " + arc_dir + " " + dest_prefix + arc_loc ) count_layer @docker_file.puts("USER $ContUser") count_layer end end rescue Exception=>e log_exception(e) return false end end def write_container_user begin @docker_file.puts("#Container Data User") log_build_output("Dockerfile:User") #FIXME needs to by dynamic @docker_file.puts("ENV data_gid " + @blueprint_reader.data_uid) count_layer @docker_file.puts("ENV data_uid " + @blueprint_reader.data_gid) count_layer rescue Exception=>e log_exception(e) return false end end def write_stack_env begin log_build_output("Dockerfile:Stack Environment") @docker_file.puts("#Stack Env") # stef = File.open(get_basedir + "/home/stack.env","w") @docker_file.puts("") @docker_file.puts("#Stack Env") @docker_file.puts("ENV Memory " + @blueprint_reader.memory.to_s) count_layer @docker_file.puts("ENV Hostname " + @hostname) count_layer @docker_file.puts("ENV Domainname " + @domain_name ) count_layer @docker_file.puts("ENV fqdn " + @hostname + "." + @domain_name ) count_layer @docker_file.puts("ENV FRAMEWORK " + @blueprint_reader.framework ) count_layer @docker_file.puts("ENV RUNTIME " + @blueprint_reader.runtime ) count_layer @docker_file.puts("ENV PORT " + @webPort.to_s ) count_layer wports = String.new n=0 @blueprint_reader.workerPorts.each do |port| if n < 0 wports =wports + " " end @docker_file.puts("EXPOSE " + port.port.to_s) count_layer wports = wports + port.port.to_s n=n+1 end if wports.length >0 @docker_file.puts("ENV WorkerPorts " + "\"" + wports +"\"") count_layer end rescue Exception=>e log_exception(e) return false end end def write_pear_list @docker_file.puts("#OPear List") log_build_output("Dockerfile:Pear List") if @blueprint_reader.pear_modules.count >0 @docker_file.puts("RUN wget http://pear.php.net/go-pear.phar;\\") @docker_file.puts(" echo suhosin.executor.include.whitelist = phar >>/etc/php5/conf.d/suhosin.ini ;\\") @docker_file.puts(" php go-pear.phar") count_layer @blueprint_reader.pear_modules.each do |pear_mod| if pear_mod !=nil @docker_file.puts("RUN pear install pear_mod " + pear_mod ) count_layer end end end rescue Exception=>e log_exception(e) return false end protected def log_exception(e) log_build_errors( e.to_s) puts(e.to_s) @last_error= e.to_s e.backtrace.each do |bt | p bt end return false end ##################### End of end class BluePrintReader def initialize(build_name,contname,blue_print,builder) @build_name = build_name @data_uid="11111" @data_gid="11111" @builder=builder @container_name = contname @blueprint = blue_print @web_port=nil @services = Array.new end attr_reader :persistant_files, :persistant_dirs, :last_error, :workerPorts, :environments, :recursive_chmods, :single_chmods, :framework, :runtime, :memory, :rake_actions, :os_packages, :pear_modules, :archives_details, :worker_commands, :cron_jobs, :sed_strings, :volumes, :databases, :apache_modules, :data_uid, :data_gid, :cron_job_list, :web_port, :services def log_build_output(line) @builder.log_build_output(line) end def log_build_errors(line) @builder.log_build_errors(line) end def clean_path(path) #FIXME remove preceeding ./(s) and /(s) as well as obliterate any /../ or preceeding ../ and any " " or ";" or "&" or "|" etc return path end def get_basedir return SysConfig.DeploymentDir + "/" + @build_name end def log_exception(e) log_build_errors(e.to_s) puts(e.to_s) #@last_error= e.to_s e.backtrace.each do |bt | p bt end end def process_blueprint begin log_build_output("Process BluePrint") read_services read_environment_variables read_os_packages read_lang_fw_values read_pear_list read_app_packages read_apache_modules read_write_permissions_recursive read_write_permissions_single read_worker_commands # read_cron_jobs read_sed_strings read_work_ports read_os_packages read_app_packages read_rake_list read_persistant_files read_persistant_dirs read_web_port_overide rescue Exception=>e log_exception(e) end end def read_web_port_overide if @blueprint[:software].has_key?(:read_web_port_overide) == true @web_port=@blueprint[:software][:read_web_port_overide] end end def read_persistant_dirs begin log_build_output("Read Persistant Dirs") @persistant_dirs = Array.new pds = @blueprint[:software][:persistent_directories] pds.each do |dir| @persistant_dirs.push(dir[:path]) end rescue Exception=>e log_exception(e) return false end end def read_persistant_files begin log_build_output("Read Persistant Files") @persistant_files = Hash.new src_paths = Array.new dest_paths = Array.new pfs = @blueprint[:software][:persistent_files] if pfs == nil return end files= String.new pfs.each do |file| path = clean_path(file[:path]) #link_src = path.sub(/app/,"") src_paths.push(path) end p :src_paths p src_paths p :dest_paths p dest_paths @persistant_files[:src_paths]= src_paths rescue Exception=>e log_exception(e) return false end end def read_rake_list begin @rake_actions = Array.new log_build_output("Read Rake List") rake_cmds = @blueprint[:software][:rake_tasks] if rake_cmds == nil return end rake_cmds.each do |rake_cmd| @rake_actions.push(rake_cmd) end rescue Exception=>e log_exception(e) return false end end def read_services @databases=Array.new @volumes=Hash.new log_build_output("Read Services") services=@blueprint[:software][:service_configurations] if services == nil return end services.each do |service| if service.has_key?(:publisher_namespace) == false || service[:publisher_namespace] == nil service[:publisher_namespace] = "EnginesSystem" end service[:service_type]=service[:type_path] p :service_provider p service[:publisher_namespace] p :servicetype_name p service[:type_path] # servicetype=service[:type_path] # # if servicetype == "database/sql/mysql" || servicetype == "database/sql/pgsql" # dbname = service[:name] # dest = service[:dest] # if dest =="local" || dest == nil # #FIXME # #kludge until BPDS is complete # service[:dest] = SysConfig.DBHost # service[:type] = servicetype.sub(/.*database\/.*\//,"") # p :kludge_set_type # p service[:type] # service[:dbfavor] = "mysql2" # p :kludge_set_dbfavor # p service[:dbfavor] # # # if flavor == "mysql" # # flavor = "mysql2" # # elsif flavor == "pgsql" # end # elsif servicetype=="filesystem" # service[:name] = clean_path(service[:name]) # service[:dest] = clean_path(service[:dest]) # add_file_service(service[:name], service[:dest]) # end add_service(service) # end # end end end #FIXME def add_service (service_hash) p :add_service p service_hash @builder.fill_in_dynamic_vars(service_hash) if service_hash[:service_type] == "filesystem" add_file_service(service_hash[:variables][:name],service_hash[:variables][:engine_path]) end @services.push(service_hash) end def add_file_service(name,dest) #FIXME and put me in coreapi begin log_build_output("Add File Service " + name) if dest == nil || dest == "" dest=name end if(dest.start_with?("/home/app/") == false ) if(dest.start_with?("/home/fs/") == false) if dest != "/home/app" p :dest p "_" + dest + "_" dest="/home/fs/" + dest end end end permissions = PermissionRights.new(@container_name,"","") vol=Volume.new(name,SysConfig.LocalFSVolHome + "/" + @container_name + "/" + name,dest,"rw",permissions) @volumes[name]=vol rescue Exception=>e p name p dest p @container_name log_exception(e) return false end end # def add_db_service(dbname,servicetype) # p servicetype # flavor = servicetype.sub(/.*database\//,"") # p :adding_db # p dbname # p servicetype # log_build_output("Add DB Service " + dbname) # hostname = flavor + "." + SysConfig.internalDomain # db = DatabaseService.new(@container_name,dbname,hostname,dbname,dbname,flavor) # # @databases.push(db) # # end def read_os_packages begin @os_packages = Array.new log_build_output("Read OS Packages") ospackages = @blueprint[:software][:system_packages] if ospackages == nil return end ospackages.each do |package| @os_packages.push(package[:name]) end rescue Exception=>e log_exception(e) return false end end def read_lang_fw_values log_build_output("Read Framework Settings") begin @framework = @blueprint[:software][:framework] p @framework @runtime = @blueprint[:software][:language] @memory = @blueprint[:software][:required_memory] rescue Exception=>e log_exception(e) return false end end def read_pear_list begin @pear_modules = Array.new log_build_output("Read Pear List") pear_mods = @blueprint[:software][:pear_mod] if pear_mods == nil || pear_mods.length == 0 return pear_mods.each do |pear_mod| mod = pear_mod[:module] if mod !=nil @pear_modules.push(mod) end end end rescue Exception=>e log_exception(e) return false end end def read_apache_modules @apache_modules = Array.new log_build_output("Read Apache Modules List") mods = @blueprint[:software][:apache_modules] if mods == nil return true end mods.each do |ap_module| mod = ap_module[:module] os_package = ap_module[:os_package] if mod != nil @apache_modules.push(mod) end end return true rescue Exception=>e log_exception(e) return false end def read_app_packages begin log_build_output("Read App Packages ") @archives_details = Array.new log_build_output("Configuring install Environment") archives = @blueprint[:software][:installed_packages] n=0 archives.each do |archive| archive_details = Hash.new arc_src=clean_path(archive[:source_url]) arc_name=clean_path(archive[:name]) arc_loc =clean_path(archive[:destination]) arc_extract=clean_path(archive[:extraction_command]) arc_dir=clean_path(archive[:path_to_extracted]) if arc_loc == "./" arc_loc="" elsif arc_loc.end_with?("/") arc_loc = arc_loc.chop() #note not String#chop end archive_details[:source_url]=arc_src archive_details[:package_name]=arc_name archive_details[:extraction_command]=arc_extract archive_details[:destination]=arc_loc archive_details[:path_to_extracted]=arc_dir p :read_in_arc_details p archive_details @archives_details.push(archive_details) end rescue Exception=>e log_exception(e) return false end end def read_write_permissions_recursive begin log_build_output("Read Recursive Write Permissions") @recursive_chmods = Array.new log_build_output("set permissions recussive") chmods = @blueprint[:software][:file_write_permissions] p :Single_Chmods if chmods != nil chmods.each do |chmod | p chmod if chmod[:recursive]==true directory = clean_path(chmod[:path]) p directory @recursive_chmods.push(directory) end end #FIXME need to strip any ../ and any preceeding ./ return end rescue Exception=>e log_exception(e) return false end end def read_write_permissions_single begin log_build_output("Read Non-Recursive Write Permissions") @single_chmods =Array.new log_build_output("set permissions single") chmods = @blueprint[:software][:file_write_permissions] p :Recursive_Chmods if chmods != nil chmods.each do |chmod | p chmod if chmod[:recursive]==false p chmod[:path] directory = clean_path(chmod[:path]) @single_chmods.push(directory) end end end return true rescue Exception=>e log_exception(e) return false end end def read_worker_commands begin log_build_output("Read Workers") @worker_commands = Array.new workers =@blueprint[:software][:workers] workers.each do |worker| @worker_commands.push(worker[:command]) end rescue Exception=>e log_exception(e) return false end end def read_sed_strings begin log_build_output("Read Sed Strings") @sed_strings = Hash.new @sed_strings[:src_file] = Array.new @sed_strings[:dest_file] = Array.new @sed_strings[:sed_str] = Array.new @sed_strings[:tmp_file] = Array.new log_build_output("set sed strings") seds=@blueprint[:software][:replacement_strings] if seds == nil || seds.empty? == true return end n=0 seds.each do |sed| file = clean_path(sed[:file]) dest = clean_path(sed[:destination]) tmp_file = "/tmp/" + File.basename(file) + "." + n.to_s if file.match(/^_TEMPLATES.*/) != nil template_file = file.gsub(/^_TEMPLATES/,"") else template_file = nil end if template_file != nil src_file = "/home/engines/templates/" + template_file else src_file = "/home/app/" + file end dest_file = "/home/app/" + dest sedstr = sed[:replacement_string] @sed_strings[:src_file].push(src_file) @sed_strings[:dest_file].push(dest_file) @sed_strings[:tmp_file].push(tmp_file) @sed_strings[:sed_str].push(sedstr) n=n+1 end rescue Exception=>e log_exception(e) return false end end def read_work_ports begin @workerPorts = Array.new log_build_output("Read Work Ports") ports = @blueprint[:software][:worker_ports] puts("Ports Json" + ports.to_s) if ports != nil ports.each do |port| portnum = port[:port] name = port[:name] external = port['external'] type = port['protocol'] if type == nil type='tcp' end #FIX ME when public ports supported puts "Port " + portnum.to_s + ":" + external.to_s @workerPorts.push(WorkPort.new(name,portnum,external,false,type)) end end rescue Exception=>e log_exception(e) return false end end def read_environment_variables log_build_output("Read Environment Variables") @environments = Array.new p :set_environment_variables p @builder.set_environments begin envs = @blueprint[:software][:variables] envs.each do |env| p env name=env[:name] value=env[:value] ask=env[:ask_at_build_time] mandatory = env[:mandatory] build_time_only = env[:build_time_only] label = env[:label] immutable = env[:immutable] lookup_system_values = env[:lookup_system_values] if @builder.set_environments != nil p :looking_for_ p name if ask == true && @builder.set_environments.has_key?(name) == true entered_value=@builder.set_environments[name] if entered_value != nil && entered_value.count !=0#FIXme needs to be removed value = entered_value end end end name.sub!(/ /,"_") p :name_and_value p name p value ev = EnvironmentVariable.new(name,value,ask,mandatory,build_time_only,label,immutable) p ev @environments.push(ev) end rescue Exception=>e log_exception(e) return false end end end #This class is to isolate the builder from the docker template output class BuilderPublic def initialize(builder) @builder = builder end def engine_name @builder.container_name end def domain_name @builder.domain_name end def hostname @builder.hostname end def http_protocol @builder.http_protocol end def repoName @builder.repoName end def webPort @builder.webPort end def build_name @builder.build_name end def runtime @builder.runtime end def set_environments @builder.set_environments end def environments @builder.environments end def mysql_host return "mysql.engines.internal" end def blueprint return @builder.blueprint end def random cnt p :RANDOM__________ p cnt return "random" + cnt end end def initialize(params,core_api) @container_name = params[:engine_name] @domain_name = params[:domain_name] @hostname = params[:host_name] custom_env= params[:software_environment_variables] # custom_env=params @core_api = core_api @http_protocol = params[:http_protocol] p params @repoName= params[:repository_url] @cron_job_list = Array.new @build_name = File.basename(@repoName).sub(/\.git$/,"") @workerPorts=Array.new @webPort=8000 @vols=Array.new @first_build = true #FIXme will be false but for now @overwrite_existing_services = true @builder_public = BuilderPublic.new(self) @system_access = SystemAccess.new() p :custom_env p custom_env if custom_env == nil @set_environments = Hash.new @environments = Array.new elsif custom_env.instance_of?(Array) == true @environments = custom_env # happens on rebuild as custom env is saved in env on disk #FIXME need to vet all environment variables @set_environments = Hash.new else env_array = custom_env.values custom_env_hash = Hash.new env_array.each do |env_hash| p :env_hash p env_hash if env_hash != nil && env_hash[:name] !=nil && env_hash[:value] != nil env_hash[:name] = env_hash[:name].sub(/_/,"") custom_env_hash.store(env_hash[:name],env_hash[:value]) end end p :Merged_custom_env p custom_env_hash @set_environments = custom_env_hash @environments = Array.new end @runtime=String.new @databases= Array.new begin FileUtils.mkdir_p(get_basedir) @log_file= File.new(SysConfig.DeploymentDir + "/build.out", File::CREAT|File::TRUNC|File::RDWR, 0644) @err_file= File.new(SysConfig.DeploymentDir + "/build.err", File::CREAT|File::TRUNC|File::RDWR, 0644) @log_pipe_rd, @log_pipe_wr = IO.pipe @error_pipe_rd, @error_pipe_wr = IO.pipe rescue log_exception(e) end end def close_all if @log_file.closed? == false @log_file.close() end if@err_file.closed? == false @err_file.close() end if @log_pipe_wr.closed? == false @log_pipe_wr.close() end if @error_pipe_wr.closed? == false @error_pipe_wr.close() end end def get_build_log_stream return @log_pipe_rd end def get_build_err_stream @error_pipe_rd end def log_build_output(line) @log_file.puts(line) @log_file.flush # @log_pipe_wr.puts(line) rescue return end def log_build_errors(line) @err_file.puts(line) @err_file.flush # @error_pipe_wr.puts(line) end def setup_framework_logging begin rmt_log_dir_var_fname=get_basedir + "/home/LOG_DIR" if File.exist?(rmt_log_dir_var_fname) rmt_log_dir_varfile = File.open(rmt_log_dir_var_fname) rmt_log_dir = rmt_log_dir_varfile.read else rmt_log_dir="/var/log" end local_log_dir = SysConfig.SystemLogRoot + "/containers/" + @hostname if Dir.exist?(local_log_dir) == false Dir.mkdir( local_log_dir) end return " -v " + local_log_dir + ":" + rmt_log_dir + ":rw " rescue Exception=>e log_exception(e) return false end end def backup_lastbuild begin dir=get_basedir if Dir.exist?(dir) backup=dir + ".backup" if Dir.exist?(backup) FileUtils.rm_rf backup end FileUtils.mv(dir,backup) end rescue Exception=>e log_exception(e) return false #throw BuildException.new(e,"backup_lastbuild") end end def load_blueprint begin log_build_output("Reading Blueprint") blueprint_file_name= get_basedir + "/blueprint.json" blueprint_file = File.open(blueprint_file_name,"r") blueprint_json_str = blueprint_file.read blueprint_file.close # @blueprint = JSON.parse(blueprint_json_str) json_hash = JSON.parse(blueprint_json_str) p :symbolized_hash # test_hash = json_hash # test_hash.keys.each do |key| # test_hash[(key.to_sym rescue key) || key] = myhash.delete(key) # end # p test_hash hash = SystemUtils.symbolize_keys(json_hash) return hash rescue Exception=>e log_exception(e) return false end end def clone_repo begin log_build_output("Clone Blueprint Repository") g = Git.clone(@repoName, @build_name, :path => SysConfig.DeploymentDir) rescue Exception=>e log_exception(e) return false end end # def create_cron_service # begin # # log_build_output("Cron file") # # if @blueprint_reader.cron_jobs != nil && @blueprint_reader.cron_jobs.length >0 # # @blueprint_reader.cron_jobs.each do |cj| # cj_hash = Hash.new # cj_hash[:name] =@container_name # cj_hash[:container_name] = @container_name # cj_hash[:cron_job]=cj # cj_hash[:parent_engine] = @containerName # # cron_file.puts(cj) # # p :write_cron_job # # p cj # @cron_job_list.push(cj_hash) # p @cron_job_list # end # # cron_file.close # end # # return true # # rescue Exception=>e # log_exception(e) # return false # end # end def setup_default_files log_build_output("Setup Default Files") if setup_global_defaults == false return false else return setup_framework_defaults end end # # def create_db_service(name,flavor) # begin # log_build_output("Create DB Service") # db = DatabaseService.new(@hostname,name,SysConfig.DBHost,name,name,flavor) # databases.push(db) # create_database_service db # rescue Exception=>e # log_exception(e) # return false # end # end def build_init begin log_build_output("Building Image") # cmd="cd " + get_basedir + "; docker build -t " + @hostname + "/init ." cmd="/usr/bin/docker build -t " + @container_name + "/deploy " + get_basedir puts cmd res = run_system(cmd) if res != true puts "build init failed " + res.to_s return res end return res rescue Exception=>e log_exception(e) return false end end def launch_deploy managed_container begin log_build_output("Lauching Engine") retval = managed_container.create_container if retval == false puts "Failed to Start Container " + managed_container.last_error log_build_errors("Failed to Launch") end return retval rescue Exception=>e log_exception(e) return false end end def setup_global_defaults begin log_build_output("Setup globel defaults") cmd= "cp -r " + SysConfig.DeploymentTemplates + "/global/* " + get_basedir system cmd rescue Exception=>e log_exception(e) return false end end def setup_framework_defaults log_build_output("Copy in default templates") begin cmd= "cp -r " + SysConfig.DeploymentTemplates + "/" + @blueprint_reader.framework + "/* " + get_basedir system cmd rescue Exception=>e log_exception(e) return false end end def get_blueprint_from_repo log_build_output("Backup last build") if backup_lastbuild == false return false end puts("Cloning Blueprint") return clone_repo end def build_from_blue_print if get_blueprint_from_repo == false return false end return build_container end def read_web_port log_build_output("Setting Web port") begin stef = File.open( get_basedir + "/home/stack.env","r") while line=stef.gets do if line.include?("PORT") i= line.split('=') @webPort= i[1].strip p :web_port_line p line end p @webPort puts(@webPort) end rescue Exception=>e log_exception(e) # throw BuildException.new(e,"setting web port") return false end end def read_web_user begin log_build_output("Read Web User") stef = File.open( get_basedir + "/home/stack.env","r") while line=stef.gets do if line.include?("USER") i= line.split('=') @webUser= i[1].strip end end rescue Exception=>e log_exception(e) return false end end def build_container begin log_build_output("Reading Blueprint") @blueprint = load_blueprint if @blueprint == nil || @blueprint == false return false end @blueprint_reader = BluePrintReader.new(@build_name,@container_name,@blueprint,self) @blueprint_reader.process_blueprint if setup_default_files == false return false end compile_base_docker_files if @blueprint_reader.web_port != nil @webPort = @blueprint_reader.web_port else read_web_port end read_web_user create_persistant_services #need to de-register these if build fails But not deregister those that existed prior create_template_files create_php_ini create_apache_config create_scritps @blueprint_reader.environments.each do |env| env.value = process_templated_string(env.value) end index=0 #FIXME There has to be a ruby way @blueprint_reader.sed_strings.each do |sed_string| sed_string = process_templated_string(sed_string[:sed_str]) sed_strings[index][:sed_str] = sed_string index+=1 end dockerfile_builder = DockerFileBuilder.new( @blueprint_reader,@container_name, @hostname,@domain_name,@webPort,self) dockerfile_builder.write_files_for_docker env_file = File.new(get_basedir + "/home/app.env","a") env_file.puts("") @blueprint_reader.environments.each do |env| env_file.puts(env.name) end @set_environments.each do |env| env_file.puts(env[0]) end env_file.close setup_framework_logging # log_build_output("Creating db Services") # @blueprint_reader.databases.each() do |db| # create_database_service db # end if build_init == false log_build_errors("Error Build Image failed") @last_error = " " + tail_of_build_log post_failed_build_clean_up return false else if @core_api.image_exists?(@container_name) == false @last_error = " " + tail_of_build_log post_failed_build_clean_up return false #return EnginesOSapiResult.failed(@container_name,"Build Image failed","build Image") end #needs to be moved to services dependant on the new BPDS #create_cron_service # log_build_output("Creating vol Services") # @blueprint_reader.databases.each() do |db| # create_database_service db # end # # primary_vol=nil # @blueprint_reader.volumes.each_value() do |vol| # create_file_service vol # if primary_vol == nil # primary_vol =vol # end # end log_build_output("Creating Deploy Image") mc = create_managed_container() if mc != nil create_non_persistant_services end end close_all return mc rescue Exception=>e log_exception(e) post_failed_build_clean_up close_all return false end end def post_failed_build_clean_up #remove containers #remove persistant services (if created/new) #deregister non persistant services (if created) p :Clean_up_Failed_build @blueprint_reader.services.each do |service_hash| if service_hash[:fresh] == true service_hash[:delete_persistant]=true @core_api.dettach_service(service_hash) #true is delete persistant end end end def create_template_files if @blueprint[:software].has_key?(:template_files) && @blueprint[:software][:template_files] != nil @blueprint[:software][:template_files].each do |template_hash| write_software_file( "/home/engines/templates/" + template_hash[:path],template_hash[:content]) end end end def create_httaccess if @blueprint[:software].has_key?(:apache_htaccess_files) && @blueprint[:software][:apache_htaccess_files] != nil @blueprint[:software][:apache_htaccess_files].each do |htaccess_hash| write_software_file("/home/engines/htaccess_files" + template_hash[:directory]+"/.htaccess",template_hash[:htaccess_content]) end end end def create_scritps FileUtils.mkdir_p(get_basedir() + SysConfig.ScriptsDir) create_start_script create_install_script create_post_install_script end def create_start_script if @blueprint[:software].has_key?(:custom_start_script) && @blueprint[:software][:custom_start_script] != nil start_script_file = File.open(get_basedir() + SysConfig.StartScript,"w", :crlf_newline => false) start_script_file.puts(@blueprint[:software][:custom_start_script]) start_script_file.close File.chmod(0755,get_basedir() + SysConfig.StartScript) end end def create_install_script if @blueprint[:software].has_key?(:custom_install_script) && @blueprint[:software][:custom_install_script] != nil install_script_file = File.open(get_basedir() + SysConfig.InstallScript,"w", :crlf_newline => false) install_script_file.puts(@blueprint[:software][:custom_install_script]) install_script_file.close File.chmod(0755,get_basedir() + SysConfig.InstallScript) end end def create_post_install_script if @blueprint[:software].has_key?(:custom_post_install_script) && @blueprint[:software][:custom_post_install_script] != nil post_install_script_file = File.open(get_basedir() + SysConfig.PostInstallScript,"w", :crlf_newline => false) post_install_script_file.puts(@blueprint[:software][:custom_post_install_script]) post_install_script_file.close File.chmod(0755,get_basedir() + SysConfig.PostInstallScript) end end def create_php_ini FileUtils.mkdir_p(get_basedir() + File.dirname(SysConfig.CustomPHPiniFile)) if @blueprint[:software].has_key?(:custom_php_inis) && @blueprint[:software][:custom_php_inis] != nil php_ini_file = File.open(get_basedir() + SysConfig.CustomPHPiniFile,"w", :crlf_newline => false) @blueprint[:software][:custom_php_inis].each do |php_ini_hash| php_ini_file.puts(php_ini_hash[:content]) end php_ini_file.close end end def create_apache_config FileUtils.mkdir_p(get_basedir() + File.dirname(SysConfig.CustomApacheConfFile)) if @blueprint[:software].has_key?(:custom_apache_conf) && @blueprint[:software][:custom_apache_conf] != nil write_software_file(SysConfig.CustomApacheConfFile,@blueprint[:software][:custom_apache_conf]) end end def write_software_file(container_filename_path,content) dir = File.dirname(get_basedir() + container_filename_path) p :dir_for_write_software_file p dir if Dir.exist?(dir) == false FileUtils.mkdir_p(dir) end out_file = File.open(get_basedir() + container_filename_path ,"w", :crlf_newline => false) content = process_templated_string(content) out_file.puts(content) end def compile_base_docker_files file_list = Dir.glob(@blueprint_reader.get_basedir + "/Dockerfile*.tmpl") file_list.each do |file| process_dockerfile_tmpl(file) end end def process_templated_string(template) template = apply_system_variables(template) template = apply_build_variables(template) template = apply_blueprint_variables(template) template = apply_engines_variables(template) return template end def process_dockerfile_tmpl(filename) p :dockerfile_template_processing p filename template = File.read(filename) template = process_templated_string(template) output_filename = filename.sub(/.tmpl/,"") out_file = File.new(output_filename,"w") out_file.write(template) out_file.close() end def apply_system_variables(template) template.gsub!(/_System\([a-z].*\)/) { | match | resolve_system_variable(match) } return template end def apply_build_variables(template) template.gsub!(/_Builder\([a-z].*\)/) { | match | resolve_build_variable(match) } return template end def resolve_system_variable(match) name = match.sub!(/_System\(/,"") name.sub!(/[\)]/,"") p :getting_system_value_for p name var_method = @system_access.method(name.to_sym) val = var_method.call p :got_val p val return val rescue Exception=>e SystemUtils.log_exception(e) return "" end #_Blueprint(software,license_name) #_Blueprint(software,rake_tasks,name) def apply_blueprint_variables(template) template.gsub!(/_Blueprint\([a-z,].*\)/) { | match | resolve_blueprint_variable(match) } return template end def resolve_blueprint_variable(match) name = match.sub!(/_Blueprint\(/,"") name.sub!(/[\)]/,"") p :getting_system_value_for p name val ="" keys = name.split(',') hash = @builder_public.blueprint keys.each do |key| if key == nil || key.length < 1 break end p :key p key val = hash[key.to_sym] p :val p val if val != nil hash=val end end p :got_val p val return val rescue Exception=>e SystemUtils.log_exception(e) return "" end def resolve_build_variable(match) name = match.sub!(/_Builder\(/,"") name.sub!(/[\)]/,"") p :getting_system_value_for p name.to_sym if name.include?('(') == true cmd = name.split('(') name = cmd[0] if cmd.count >1 args = cmd[1] args_array = args.split end end var_method = @builder_public.method(name.to_sym) if args p :got_args val = var_method.call args else val = var_method.call end p :got_val p val return val rescue Exception=>e SystemUtils.log_exception(e) return "" end def resolve_engines_variable name = match.sub!(/_Engines\(/,"") name.sub!(/[\)]/,"") p :getting_system_value_for p name.to_sym return @blueprint_reader.environments[name.to_sym] rescue Exception=>e p @blueprint_reader.environments SystemUtils.log_exception(e) return "" end def apply_engines_variables(template) template.gsub!(/_Engines\([a-z].*\)/) { | match | resolve_engines_variable(match) } return template end def create_non_persistant_services @blueprint_reader.services.each() do |service_hash| #FIX ME Should call this but Keys dont match blueprint designer issue #@core_api.add_service(service,mc) service_hash[:parent_engine]=@container_name service_def = get_service_def(service_hash) if service_def == nil p :failed_to_load_service_definition p service_hash[:type_path] p service_hash[:publisher_namespace] return false end if service_def[:persistant] == true next end service_hash[:service_handle] = service_hash[:variables][:name] p :adding_service p service_hash @core_api.attach_service(service_hash) end end def get_service_def(service_hash) p service_hash[:type_path] p service_hash[:publisher_namespace] return SoftwareServiceDefinition.find(service_hash[:type_path], service_hash[:publisher_namespace] ) end def create_persistant_services @blueprint_reader.services.each() do |service_hash| service_hash[:parent_engine]=@container_name # p :service_def_for # p service_hash[:type_path] # p service_hash[:publisher_namespace] service_def = get_service_def(service_hash) # p service_def if service_def == nil p :failed_to_load_service_definition p :servicetype_name p service_hash[:service_type] p :service_provider p service_hash[:publisher_namespace] return false end if service_def[:persistant] == false next end p :adding_service puts "+=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++" p service_hash puts "+=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++" p :target_envs p service_def[:target_environment_variables] if service_hash[:servicetype_name] == "filesystem" add_file_service(service[:name], service[:engine_path]) end service_hash[:service_handle] = service_hash[:variables][:name] p :LOOKING_FOR_ p service_hash if @core_api.find_service_consumers(service_hash) == false @first_build = true service_hash[:fresh]=true else service_hash[:fresh]=false @first_build = false end p :attach_service p service_hash @core_api.attach_service(service_hash) end end def fill_in_dynamic_vars(service_hash) p "FILLING_+@+#+@+@+@+@+@+" if service_hash.has_key?(:variables) == false || service_hash[:variables] == nil return end service_hash[:variables].each do |variable| p variable if variable[1] != nil && variable[1].start_with?("$_") variable[1].sub!(/\$/,"") result = evaluate_function(variable[1]) service_hash[:variables][variable[0]] = result end end end def evaluate_function(function) if function.start_with?("_System") return resolve_system_variable(function) elsif function.start_with?("_Builder") return resolve_build_variable(function) elsif function.start_with?("_Blueprint") return resolve_blueprint_variable(function) end rescue Exception=> e return "" end def tail_of_build_log retval = String.new lines = File.readlines(SysConfig.DeploymentDir + "/build.out") lines_count = lines.count -1 start = lines_count - 10 for n in start..lines_count retval+=lines[n] end return retval end def rebuild_managed_container engine @engine = engine log_build_output("Starting Rebuild") if backup_lastbuild == false return false elsif setup_rebuild == false return false else return build_container end end def setup_rebuild begin log_build_output("Setting up rebuild") FileUtils.mkdir_p(get_basedir) blueprint = @core_api.load_blueprint(@engine) statefile= get_basedir + "/blueprint.json" f = File.new(statefile,File::CREAT|File::TRUNC|File::RDWR, 0644) f.write(blueprint.to_json) f.close rescue Exception=>e log_exception(e) return false end end def create_managed_container log_build_output("Creating ManagedEngine") mc = ManagedEngine.new(@hostname, @blueprint_reader.memory.to_s , @hostname, @domain_name, @container_name + "/deploy", @blueprint_reader.volumes, @webPort, @blueprint_reader.workerPorts, @repoName, @blueprint_reader.databases, @blueprint_reader.environments, @blueprint_reader.framework, @blueprint_reader.runtime, @core_api, @blueprint_reader.data_uid, @blueprint_reader.data_gid ) p :set_cron_job_list p @cron_job_list mc.set_cron_job_list(@cron_job_list) #:http_protocol=>"HTTPS and HTTP" mc.set_protocol(@protocol) mc.conf_register_site=( true) # needs some intelligence here for worker only mc.conf_self_start= (true) mc.save_state # no config.yaml throws a no such container so save so others can use if mc.save_blueprint(@blueprint) == false log_build_errors( "Failed to save blueprint " + @blueprint.to_s) end bp = mc.load_blueprint p bp log_build_output("Launching") #this will fail as no api at this stage if mc.core_api != nil if launch_deploy(mc) == false log_build_errors("Failed to Launch") end log_build_output("Applying Volume settings and Log Permissions") #FIXME need to check results from following @core_api.run_volume_builder(mc ,@webUser) # mc.start_container end return mc end protected def log_exception(e) log_build_errors( e.to_s) puts(e.to_s) @last_error= e.to_s n=0 e.backtrace.each do |bt | p bt if n>10 break end ++n end #close_all end def debug(fld) puts "ERROR: " p fld end require 'open3' def run_system(cmd) log_build_output("Running " + cmd) ret_val=false res = String.new error_mesg = String.new begin Open3.popen3( cmd ) do |stdin, stdout, stderr, th| oline = String.new stderr_is_open=true begin stdout.each { |line| # print line line = line.gsub(/\\\"/,"") res += line.chop oline = line log_build_output(line) if stderr_is_open err = stderr.read_nonblock(1000) error_mesg += err log_build_errors(err) end } rescue Errno::EIO res += line.chop log_build_output(oline) if stderr_is_open err = stderr.read_nonblock(1000) error_mesg += err log_build_errors(err) p :EIO_retry retry end rescue IO::WaitReadable # p :wait_readable_retrt retry rescue EOFError if stdout.closed? == false stderr_is_open = false p :EOF_retry retry else if stderr.closed? == true return else err = stderr.read_nonblock(1000) error_mesg += err log_build_errors(err) return end end end if error_mesg.include?("Error:") || error_mesg.include?("FATA") p "docker_cmd error " + error_mesg return false end return true end end end def get_basedir return SysConfig.DeploymentDir + "/" + @build_name end end sed_strings is a hash of arrays require "/opt/engines/lib/ruby/ManagedContainer.rb" require "/opt/engines/lib/ruby/ManagedContainerObjects.rb" require "/opt/engines/lib/ruby/ManagedEngine.rb" require "/opt/engines/lib/ruby/ManagedServices.rb" require "/opt/engines/lib/ruby/SysConfig.rb" require "rubygems" require "git" require 'fileutils' require 'json' require '/opt/engines/lib/ruby/SystemAccess.rb' class EngineBuilder @repoName=nil @hostname=nil @domain_name=nil @build_name=nil @web_protocol="HTTPS and HTTP" attr_reader :last_error, :repoName, :hostname, :domain_name, :build_name, :set_environments, :container_name, :environments, :runtime, :webPort, :http_protocol, :blueprint, :first_build class BuildError < StandardError attr_reader :parent_exception,:method_name def initialize(parent,method_name) @parent_exception = parent end end class DockerFileBuilder def initialize(reader,containername,hostname,domain_name,webport,builder) @hostname = hostname @container_name = containername @domain_name = domain_name @webPort = webport @blueprint_reader = reader @builder=builder @docker_file = File.open( @blueprint_reader.get_basedir + "/Dockerfile","a") @layer_count=0 end def log_build_output(line) @builder.log_build_output(line) end def log_build_errors(line) @builder.log_build_errors(line) end def count_layer ++@layer_count if @layer_count >75 raise EngineBuilder.BuildError.new() end end def write_files_for_docker @docker_file.puts("") write_environment_variables write_stack_env write_services write_file_service #write_db_service #write_cron_jobs write_os_packages write_apache_modules write_user_local = true if write_user_local == true @docker_file.puts("RUN ln -s /usr/local/ /home/local;\\") @docker_file.puts(" chown -R $ContUser /usr/local/") end write_app_archives write_container_user chown_home_app write_worker_commands write_sed_strings write_persistant_dirs write_persistant_files insert_framework_frag_in_dockerfile("builder.mid.tmpl") @docker_file.puts("") write_rake_list write_pear_list write_write_permissions_recursive #recursive firs (as can use to create blank dir) write_write_permissions_single @docker_file.puts("") @docker_file.puts("USER 0") count_layer() @docker_file.puts("run mkdir -p /home/fs/local/") count_layer() @docker_file.puts("") write_run_install_script write_data_permissions @docker_file.puts("USER 0") count_layer() @docker_file.puts("run mv /home/fs /home/fs_src") count_layer() @docker_file.puts("VOLUME /home/fs_src/") count_layer() @docker_file.puts("USER $ContUser") count_layer() insert_framework_frag_in_dockerfile("builder.end.tmpl") @docker_file.puts("") @docker_file.puts("VOLUME /home/fs/") count_layer() write_clear_env_variables @docker_file.close end def write_clear_env_variables @docker_file.puts("#Clear env") @blueprint_reader.environments.each do |env| if env.build_time_only == true @docker_file.puts("ENV " + env.name + "\" \"") count_layer end end rescue Exception=>e log_exception(e) return false end def write_apache_modules if @blueprint_reader.apache_modules.count <1 return end @docker_file.puts("#Apache Modules") ap_modules_str = String.new @blueprint_reader.apache_modules.each do |ap_module| ap_modules_str += ap_module + " " end @docker_file.puts("RUN a2enmod " + ap_modules_str) count_layer() end def write_environment_variables begin @docker_file.puts("#Environment Variables") #Fixme #kludge @docker_file.puts("#System Envs") @docker_file.puts("ENV TZ Sydney/Australia") count_layer @blueprint_reader.environments.each do |env| @docker_file.puts("#Blueprint ENVs") if env.value != nil env.value.sub!(/ /,"\\ ") end if env.value !=nil && env.value.to_s.length >0 #env statement must have two arguments @docker_file.puts("ENV " + env.name + " " + env.value.to_s ) count_layer end end rescue Exception=>e log_exception(e) return false end end def write_persistant_dirs begin log_build_output("setup persistant Dirs") n=0 @docker_file.puts("#Persistant Dirs") @blueprint_reader.persistant_dirs.each do |path| path.chomp!("/") @docker_file.puts("") @docker_file.puts("RUN \\") dirname = File.dirname(path) @docker_file.puts("mkdir -p $CONTFSVolHome/$VOLDIR/" + dirname + ";\\") @docker_file.puts("if [ ! -d /home/" + path + " ];\\") @docker_file.puts(" then \\") @docker_file.puts(" mkdir -p /home/" + path +" ;\\") @docker_file.puts(" fi;\\") @docker_file.puts("mv /home/" + path + " $CONTFSVolHome/$VOLDIR/" + dirname + "/;\\") @docker_file.puts("ln -s $CONTFSVolHome/$VOLDIR/" + path + " /home/" + path) n=n+1 count_layer end rescue Exception=>e log_exception(e) return false end end def write_data_permissions @docker_file.puts("#Data Permissions") @docker_file.puts("USER 0") count_layer() @docker_file.puts("") @docker_file.puts("RUN /usr/sbin/usermod -u $data_uid data-user;\\") @docker_file.puts("chown -R $data_uid.$data_gid /home/app /home/fs ;\\") @docker_file.puts("chmod -R 770 /home/fs") count_layer @docker_file.puts("USER $ContUser") count_layer end def write_run_install_script @docker_file.puts("WorkDir /home/") @docker_file.puts("#Setup templates and run installer") @docker_file.puts("USER $ContUser") count_layer @docker_file.puts("RUN bash /home/setup.sh") count_layer end def write_persistant_files begin @docker_file.puts("#Persistant Files") log_build_output("set setup_env") src_paths = @blueprint_reader.persistant_files[:src_paths] dest_paths = @blueprint_reader.persistant_files[:dest_paths] src_paths.each do |path| # path = dest_paths[n] p :path p path dir = File.dirname(path) p :dir p dir if dir.present? == false || dir == nil || dir.length ==0 || dir =="." dir = "app/" end p :dir p dir @docker_file.puts("") @docker_file.puts("RUN mkdir -p /home/" + dir + ";\\") @docker_file.puts(" if [ ! -f /home/" + path + " ];\\") @docker_file.puts(" then \\") @docker_file.puts(" touch /home/" + path +";\\") @docker_file.puts(" fi;\\") @docker_file.puts(" mkdir -p $CONTFSVolHome/$VOLDIR/" + dir +";\\") @docker_file.puts("\\") @docker_file.puts(" mv /home/" + path + " $CONTFSVolHome/$VOLDIR" + "/" + dir + ";\\") @docker_file.puts(" ln -s $CONTFSVolHome/$VOLDIR/" + path + " /home/" + path) count_layer end rescue Exception=>e log_exception(e) return false end end def write_file_service begin @docker_file.puts("#File Service") @docker_file.puts("#FS Env") # @docker_file.puts("ENV CONTFSVolHome /home/fs/" ) # count_layer @blueprint_reader.volumes.each_value do |vol| dest = File.basename(vol.remotepath) # @docker_file.puts("ENV VOLDIR /home/fs/" + dest) # count_layer @docker_file.puts("RUN mkdir -p $CONTFSVolHome/" + dest) count_layer end rescue Exception=>e log_exception(e) return false end end def write_services services = @blueprint_reader.services @docker_file.puts("#Service Environment Variables") services.each do |service_hash| p :service_hash p service_hash service_def = @builder.get_service_def(service_hash) if service_def != nil p :processing p service_def service_environment_variables = service_def[:target_environment_variables] if service_environment_variables != nil service_environment_variables.values.each do |env_variable_pair| p :setting_values p env_variable_pair env_name = env_variable_pair[:environment_name] value_name = env_variable_pair[:variable_name] value=service_hash[:variables][value_name.to_sym] p :looking_for_ p value_name p :as_symbol p value_name.to_sym p :in_service_hash p service_hash p :and_found p value if value != nil && value.to_s.length >0 @docker_file.puts("ENV " + env_name + " " + value ) count_layer() end end end end end end def write_sed_strings begin n=0 @docker_file.puts("#Sed Strings") @blueprint_reader.sed_strings[:src_file].each do |src_file| #src_file = @sed_strings[:src_file][n] dest_file = @blueprint_reader.sed_strings[:dest_file][n] sed_str = @blueprint_reader.sed_strings[:sed_str][n] tmp_file = @blueprint_reader.sed_strings[:tmp_file][n] @docker_file.puts("") @docker_file.puts("RUN cat " + src_file + " | sed \"" + sed_str + "\" > " + tmp_file + " ;\\") @docker_file.puts(" cp " + tmp_file + " " + dest_file) count_layer n=n+1 end rescue Exception=>e log_exception(e) return false end end def write_rake_list begin @docker_file.puts("#Rake Actions") @blueprint_reader.rake_actions.each do |rake_action| rake_cmd = rake_action[:action] if @builder.first_build == false && rake_action[:always_run] == false next end if rake_cmd !=nil @docker_file.puts("RUN /usr/local/rbenv/shims/bundle exec rake " + rake_cmd ) count_layer end end rescue Exception=>e log_exception(e) return false end end def write_os_packages begin packages=String.new @docker_file.puts("#OS Packages") @blueprint_reader.os_packages.each do |package| if package != nil packages = packages + package + " " end end if packages.length >1 @docker_file.puts("\nRUN apt-get install -y " + packages ) count_layer end #FIXME Wrong spot @blueprint_reader.workerPorts.each do |port| @docker_file.puts("EXPOSE " + port.port.to_s) count_layer end rescue Exception=>e log_exception(e) return false end end def insert_framework_frag_in_dockerfile(frag_name) begin log_build_output(frag_name) @docker_file.puts("#Framework Frag") frame_build_docker_frag = File.open(SysConfig.DeploymentTemplates + "/" + @blueprint_reader.framework + "/Dockerfile." + frag_name) builder_frag = frame_build_docker_frag.read @docker_file.write(builder_frag) count_layer rescue Exception=>e log_exception(e) return false end end def chown_home_app begin @docker_file.puts("#Chown App Dir") log_build_output("Dockerfile:Chown") @docker_file.puts("USER 0") count_layer @docker_file.puts("RUN if [ ! -d /home/app ];\\") @docker_file.puts(" then \\") @docker_file.puts(" mkdir -p /home/app ;\\") @docker_file.puts(" fi;\\") @docker_file.puts(" mkdir -p /home/fs ; mkdir -p /home/fs/local ;\\") @docker_file.puts(" chown -R $ContUser /home/app /home/fs /home/fs/local") count_layer @docker_file.puts("USER $ContUser") count_layer rescue Exception=>e log_exception(e) return false end end def write_worker_commands begin @docker_file.puts("#Worker Commands") log_build_output("Dockerfile:Worker Commands") scripts_path = @blueprint_reader.get_basedir + "/home/engines/scripts/" if Dir.exist?(scripts_path) == false FileUtils.mkdir_p(scripts_path) end if @blueprint_reader.worker_commands != nil && @blueprint_reader.worker_commands.length >0 cmdf= File.open( scripts_path + "pre-running.sh","w") if !cmdf puts("failed to open " + scripts_path + "pre-running.sh") exit end cmdf.chmod(0755) cmdf.puts("#!/bin/bash") cmdf.puts("cd /home/app") @blueprint_reader.worker_commands.each do |command| cmdf.puts(command) end cmdf.close File.chmod(0755,scripts_path + "pre-running.sh") end rescue Exception=>e log_exception(e) return false end end # def write_cron_jobs # begin # if @blueprint_reader.cron_jobs.length >0 # @docker_file.puts("ENV CRONJOBS YES") # count_layer ## @docker_file.puts("RUN crontab $data_uid /home/crontab ") ## count_layer cron run from cron service # end # return true # rescue Exception=>e # log_exception(e) # return false # end # end # def write_db_service # begin # @docker_file.puts("#Database Service") # log_build_output("Dockerfile:DB env") # @blueprint_reader.databases.each do |db| # @docker_file.puts("#Database Env") # @docker_file.puts("ENV dbname " + db.name) # count_layer # @docker_file.puts("ENV dbhost " + db.dbHost) # count_layer # @docker_file.puts("ENV dbuser " + db.dbUser) # count_layer # @docker_file.puts("ENV dbpasswd " + db.dbPass) # count_layer # flavor = db.flavor # if flavor == "mysql" # flavor = "mysql2" # elsif flavor == "pgsql" # flavor = "postgresql" # end # @docker_file.puts("ENV dbflavor " + flavor) # count_layer # end # # rescue Exception=>e # log_exception(e) # return false # end # end def write_write_permissions_single begin @docker_file.puts("") @docker_file.puts("#Write Permissions Non Recursive") log_build_output("Dockerfile:Write Permissions Non Recursive") if @blueprint_reader.single_chmods == nil return end @blueprint_reader.single_chmods.each do |path| if path !=nil @docker_file.puts("RUN if [ ! -f /home/app/" + path + " ];\\" ) @docker_file.puts(" then \\") @docker_file.puts(" mkdir -p `dirname /home/app/" + path + "`;\\") @docker_file.puts(" touch /home/app/" + path + ";\\") @docker_file.puts(" fi;\\") @docker_file.puts( " chmod 775 /home/app/" + path ) count_layer end end rescue Exception=>e log_exception(e) return false end end def write_write_permissions_recursive begin @docker_file.puts("#Write Permissions Recursive") @docker_file.puts("") log_build_output("Dockerfile:Write Permissions Recursive") if @blueprint_reader.recursive_chmods == nil return end @blueprint_reader.recursive_chmods.each do |directory| if directory !=nil @docker_file.puts("RUN if [ -h /home/app/" + directory + " ] ;\\") @docker_file.puts(" then \\") @docker_file.puts(" dest=`ls -la /home/app/" + directory +" |cut -f2 -d\">\"`;\\") @docker_file.puts(" chmod -R gu+rw $dest;\\") @docker_file.puts(" elif [ ! -d /home/app/" + directory + " ] ;\\" ) @docker_file.puts(" then \\") @docker_file.puts(" mkdir \"/home/app/" + directory + "\";\\") @docker_file.puts(" chmod -R gu+rw \"/home/app/" + directory + "\";\\" ) @docker_file.puts(" else\\") @docker_file.puts(" chmod -R gu+rw \"/home/app/" + directory + "\";\\") @docker_file.puts(" for dir in `find /home/app/" + directory + " -type d `;\\") @docker_file.puts(" do\\") @docker_file.puts(" adir=`echo $dir | sed \"/ /s//_+_/\" |grep -v _+_` ;\\") @docker_file.puts(" if test -n $adir;\\") @docker_file.puts(" then\\") @docker_file.puts(" dirs=\"$dirs $adir\";\\"); @docker_file.puts(" fi;\\") @docker_file.puts(" done;\\") @docker_file.puts(" if test -n \"$dirs\" ;\\") @docker_file.puts(" then\\") @docker_file.puts(" chmod gu+x $dirs ;\\") @docker_file.puts("fi;\\") @docker_file.puts("fi") count_layer end end end rescue Exception=>e log_exception(e) return false end def write_app_archives begin @docker_file.puts("#App Archives") log_build_output("Dockerfile:App Archives") n=0 # srcs=String.new # names=String.new # locations=String.new # extracts=String.new # dirs=String.new @docker_file.puts("") @blueprint_reader.archives_details.each do |archive_details| arc_src = archive_details[:source_url] arc_name = archive_details[:package_name] arc_loc = archive_details[:destination] arc_extract = archive_details[:extraction_command] arc_dir = archive_details[:path_to_extracted] # if(n >0) # archive_details[:source_url]=arc_src # archive_details[:package_name]=arc_name # archive_details[:extraction_cmd]=arc_extract # archive_details[:destination]=arc_loc # archive_details[:path_to_extracted]=arc_dir # srcs = srcs + " " # names =names + " " # locations = locations + " " # extracts =extracts + " " # dirs =dirs + " " # end p "_+_+_+_+_+_+_+_+_+_+_" p archive_details p arc_src + "_" p arc_name + "_" p arc_loc + "_" p arc_extract + "_" p arc_dir +"|" if arc_loc == "./" arc_loc="" elsif arc_loc.end_with?("/") arc_loc = arc_loc.chop() #note not String#chop end if arc_extract == "git" @docker_file.puts("WORKDIR /tmp") count_layer @docker_file.puts("USER $ContUser") count_layer @docker_file.puts("RUN git clone " + arc_src + " --depth 1 " ) count_layer @docker_file.puts("USER 0 ") count_layer @docker_file.puts("RUN mv " + arc_dir + " /home/app" + arc_loc ) count_layer @docker_file.puts("USER $ContUser") count_layer else @docker_file.puts("USER $ContUser") count_layer step_back=false if arc_dir == nil step_back=true @docker_file.puts("RUN mkdir /tmp/app") count_layer arc_dir = "app" @docker_file.puts("WORKDIR /tmp/app") count_layer else @docker_file.puts("WORKDIR /tmp") count_layer end @docker_file.puts("RUN wget -O \"" + arc_name + "\" \"" + arc_src + "\" ;\\" ) if arc_extract!= nil @docker_file.puts(" " + arc_extract + " \"" + arc_name + "\" ;\\") # + "\"* 2>&1 > /dev/null ") @docker_file.puts(" rm \"" + arc_name + "\"") else @docker_file.puts("echo") #step past the next shell line implied by preceeding ; end @docker_file.puts("USER 0 ") count_layer if step_back==true @docker_file.puts("WORKDIR /tmp") count_layer end if arc_loc.start_with?("/home/app") || arc_loc.start_with?("/home/local/") dest_prefix="" else dest_prefix="/home/app" end @docker_file.puts("run if test ! -d " + arc_dir +" ;\\") @docker_file.puts(" then\\") @docker_file.puts(" mkdir -p /home/app ;\\") @docker_file.puts(" fi;\\") @docker_file.puts(" mv " + arc_dir + " " + dest_prefix + arc_loc ) count_layer @docker_file.puts("USER $ContUser") count_layer end end rescue Exception=>e log_exception(e) return false end end def write_container_user begin @docker_file.puts("#Container Data User") log_build_output("Dockerfile:User") #FIXME needs to by dynamic @docker_file.puts("ENV data_gid " + @blueprint_reader.data_uid) count_layer @docker_file.puts("ENV data_uid " + @blueprint_reader.data_gid) count_layer rescue Exception=>e log_exception(e) return false end end def write_stack_env begin log_build_output("Dockerfile:Stack Environment") @docker_file.puts("#Stack Env") # stef = File.open(get_basedir + "/home/stack.env","w") @docker_file.puts("") @docker_file.puts("#Stack Env") @docker_file.puts("ENV Memory " + @blueprint_reader.memory.to_s) count_layer @docker_file.puts("ENV Hostname " + @hostname) count_layer @docker_file.puts("ENV Domainname " + @domain_name ) count_layer @docker_file.puts("ENV fqdn " + @hostname + "." + @domain_name ) count_layer @docker_file.puts("ENV FRAMEWORK " + @blueprint_reader.framework ) count_layer @docker_file.puts("ENV RUNTIME " + @blueprint_reader.runtime ) count_layer @docker_file.puts("ENV PORT " + @webPort.to_s ) count_layer wports = String.new n=0 @blueprint_reader.workerPorts.each do |port| if n < 0 wports =wports + " " end @docker_file.puts("EXPOSE " + port.port.to_s) count_layer wports = wports + port.port.to_s n=n+1 end if wports.length >0 @docker_file.puts("ENV WorkerPorts " + "\"" + wports +"\"") count_layer end rescue Exception=>e log_exception(e) return false end end def write_pear_list @docker_file.puts("#OPear List") log_build_output("Dockerfile:Pear List") if @blueprint_reader.pear_modules.count >0 @docker_file.puts("RUN wget http://pear.php.net/go-pear.phar;\\") @docker_file.puts(" echo suhosin.executor.include.whitelist = phar >>/etc/php5/conf.d/suhosin.ini ;\\") @docker_file.puts(" php go-pear.phar") count_layer @blueprint_reader.pear_modules.each do |pear_mod| if pear_mod !=nil @docker_file.puts("RUN pear install pear_mod " + pear_mod ) count_layer end end end rescue Exception=>e log_exception(e) return false end protected def log_exception(e) log_build_errors( e.to_s) puts(e.to_s) @last_error= e.to_s e.backtrace.each do |bt | p bt end return false end ##################### End of end class BluePrintReader def initialize(build_name,contname,blue_print,builder) @build_name = build_name @data_uid="11111" @data_gid="11111" @builder=builder @container_name = contname @blueprint = blue_print @web_port=nil @services = Array.new end attr_reader :persistant_files, :persistant_dirs, :last_error, :workerPorts, :environments, :recursive_chmods, :single_chmods, :framework, :runtime, :memory, :rake_actions, :os_packages, :pear_modules, :archives_details, :worker_commands, :cron_jobs, :sed_strings, :volumes, :databases, :apache_modules, :data_uid, :data_gid, :cron_job_list, :web_port, :services def log_build_output(line) @builder.log_build_output(line) end def log_build_errors(line) @builder.log_build_errors(line) end def clean_path(path) #FIXME remove preceeding ./(s) and /(s) as well as obliterate any /../ or preceeding ../ and any " " or ";" or "&" or "|" etc return path end def get_basedir return SysConfig.DeploymentDir + "/" + @build_name end def log_exception(e) log_build_errors(e.to_s) puts(e.to_s) #@last_error= e.to_s e.backtrace.each do |bt | p bt end end def process_blueprint begin log_build_output("Process BluePrint") read_services read_environment_variables read_os_packages read_lang_fw_values read_pear_list read_app_packages read_apache_modules read_write_permissions_recursive read_write_permissions_single read_worker_commands # read_cron_jobs read_sed_strings read_work_ports read_os_packages read_app_packages read_rake_list read_persistant_files read_persistant_dirs read_web_port_overide rescue Exception=>e log_exception(e) end end def read_web_port_overide if @blueprint[:software].has_key?(:read_web_port_overide) == true @web_port=@blueprint[:software][:read_web_port_overide] end end def read_persistant_dirs begin log_build_output("Read Persistant Dirs") @persistant_dirs = Array.new pds = @blueprint[:software][:persistent_directories] pds.each do |dir| @persistant_dirs.push(dir[:path]) end rescue Exception=>e log_exception(e) return false end end def read_persistant_files begin log_build_output("Read Persistant Files") @persistant_files = Hash.new src_paths = Array.new dest_paths = Array.new pfs = @blueprint[:software][:persistent_files] if pfs == nil return end files= String.new pfs.each do |file| path = clean_path(file[:path]) #link_src = path.sub(/app/,"") src_paths.push(path) end p :src_paths p src_paths p :dest_paths p dest_paths @persistant_files[:src_paths]= src_paths rescue Exception=>e log_exception(e) return false end end def read_rake_list begin @rake_actions = Array.new log_build_output("Read Rake List") rake_cmds = @blueprint[:software][:rake_tasks] if rake_cmds == nil return end rake_cmds.each do |rake_cmd| @rake_actions.push(rake_cmd) end rescue Exception=>e log_exception(e) return false end end def read_services @databases=Array.new @volumes=Hash.new log_build_output("Read Services") services=@blueprint[:software][:service_configurations] if services == nil return end services.each do |service| if service.has_key?(:publisher_namespace) == false || service[:publisher_namespace] == nil service[:publisher_namespace] = "EnginesSystem" end service[:service_type]=service[:type_path] p :service_provider p service[:publisher_namespace] p :servicetype_name p service[:type_path] # servicetype=service[:type_path] # # if servicetype == "database/sql/mysql" || servicetype == "database/sql/pgsql" # dbname = service[:name] # dest = service[:dest] # if dest =="local" || dest == nil # #FIXME # #kludge until BPDS is complete # service[:dest] = SysConfig.DBHost # service[:type] = servicetype.sub(/.*database\/.*\//,"") # p :kludge_set_type # p service[:type] # service[:dbfavor] = "mysql2" # p :kludge_set_dbfavor # p service[:dbfavor] # # # if flavor == "mysql" # # flavor = "mysql2" # # elsif flavor == "pgsql" # end # elsif servicetype=="filesystem" # service[:name] = clean_path(service[:name]) # service[:dest] = clean_path(service[:dest]) # add_file_service(service[:name], service[:dest]) # end add_service(service) # end # end end end #FIXME def add_service (service_hash) p :add_service p service_hash @builder.fill_in_dynamic_vars(service_hash) if service_hash[:service_type] == "filesystem" add_file_service(service_hash[:variables][:name],service_hash[:variables][:engine_path]) end @services.push(service_hash) end def add_file_service(name,dest) #FIXME and put me in coreapi begin log_build_output("Add File Service " + name) if dest == nil || dest == "" dest=name end if(dest.start_with?("/home/app/") == false ) if(dest.start_with?("/home/fs/") == false) if dest != "/home/app" p :dest p "_" + dest + "_" dest="/home/fs/" + dest end end end permissions = PermissionRights.new(@container_name,"","") vol=Volume.new(name,SysConfig.LocalFSVolHome + "/" + @container_name + "/" + name,dest,"rw",permissions) @volumes[name]=vol rescue Exception=>e p name p dest p @container_name log_exception(e) return false end end # def add_db_service(dbname,servicetype) # p servicetype # flavor = servicetype.sub(/.*database\//,"") # p :adding_db # p dbname # p servicetype # log_build_output("Add DB Service " + dbname) # hostname = flavor + "." + SysConfig.internalDomain # db = DatabaseService.new(@container_name,dbname,hostname,dbname,dbname,flavor) # # @databases.push(db) # # end def read_os_packages begin @os_packages = Array.new log_build_output("Read OS Packages") ospackages = @blueprint[:software][:system_packages] if ospackages == nil return end ospackages.each do |package| @os_packages.push(package[:name]) end rescue Exception=>e log_exception(e) return false end end def read_lang_fw_values log_build_output("Read Framework Settings") begin @framework = @blueprint[:software][:framework] p @framework @runtime = @blueprint[:software][:language] @memory = @blueprint[:software][:required_memory] rescue Exception=>e log_exception(e) return false end end def read_pear_list begin @pear_modules = Array.new log_build_output("Read Pear List") pear_mods = @blueprint[:software][:pear_mod] if pear_mods == nil || pear_mods.length == 0 return pear_mods.each do |pear_mod| mod = pear_mod[:module] if mod !=nil @pear_modules.push(mod) end end end rescue Exception=>e log_exception(e) return false end end def read_apache_modules @apache_modules = Array.new log_build_output("Read Apache Modules List") mods = @blueprint[:software][:apache_modules] if mods == nil return true end mods.each do |ap_module| mod = ap_module[:module] os_package = ap_module[:os_package] if mod != nil @apache_modules.push(mod) end end return true rescue Exception=>e log_exception(e) return false end def read_app_packages begin log_build_output("Read App Packages ") @archives_details = Array.new log_build_output("Configuring install Environment") archives = @blueprint[:software][:installed_packages] n=0 archives.each do |archive| archive_details = Hash.new arc_src=clean_path(archive[:source_url]) arc_name=clean_path(archive[:name]) arc_loc =clean_path(archive[:destination]) arc_extract=clean_path(archive[:extraction_command]) arc_dir=clean_path(archive[:path_to_extracted]) if arc_loc == "./" arc_loc="" elsif arc_loc.end_with?("/") arc_loc = arc_loc.chop() #note not String#chop end archive_details[:source_url]=arc_src archive_details[:package_name]=arc_name archive_details[:extraction_command]=arc_extract archive_details[:destination]=arc_loc archive_details[:path_to_extracted]=arc_dir p :read_in_arc_details p archive_details @archives_details.push(archive_details) end rescue Exception=>e log_exception(e) return false end end def read_write_permissions_recursive begin log_build_output("Read Recursive Write Permissions") @recursive_chmods = Array.new log_build_output("set permissions recussive") chmods = @blueprint[:software][:file_write_permissions] p :Single_Chmods if chmods != nil chmods.each do |chmod | p chmod if chmod[:recursive]==true directory = clean_path(chmod[:path]) p directory @recursive_chmods.push(directory) end end #FIXME need to strip any ../ and any preceeding ./ return end rescue Exception=>e log_exception(e) return false end end def read_write_permissions_single begin log_build_output("Read Non-Recursive Write Permissions") @single_chmods =Array.new log_build_output("set permissions single") chmods = @blueprint[:software][:file_write_permissions] p :Recursive_Chmods if chmods != nil chmods.each do |chmod | p chmod if chmod[:recursive]==false p chmod[:path] directory = clean_path(chmod[:path]) @single_chmods.push(directory) end end end return true rescue Exception=>e log_exception(e) return false end end def read_worker_commands begin log_build_output("Read Workers") @worker_commands = Array.new workers =@blueprint[:software][:workers] workers.each do |worker| @worker_commands.push(worker[:command]) end rescue Exception=>e log_exception(e) return false end end def read_sed_strings begin log_build_output("Read Sed Strings") @sed_strings = Hash.new @sed_strings[:src_file] = Array.new @sed_strings[:dest_file] = Array.new @sed_strings[:sed_str] = Array.new @sed_strings[:tmp_file] = Array.new log_build_output("set sed strings") seds=@blueprint[:software][:replacement_strings] if seds == nil || seds.empty? == true return end n=0 seds.each do |sed| file = clean_path(sed[:file]) dest = clean_path(sed[:destination]) tmp_file = "/tmp/" + File.basename(file) + "." + n.to_s if file.match(/^_TEMPLATES.*/) != nil template_file = file.gsub(/^_TEMPLATES/,"") else template_file = nil end if template_file != nil src_file = "/home/engines/templates/" + template_file else src_file = "/home/app/" + file end dest_file = "/home/app/" + dest sedstr = sed[:replacement_string] @sed_strings[:src_file].push(src_file) @sed_strings[:dest_file].push(dest_file) @sed_strings[:tmp_file].push(tmp_file) @sed_strings[:sed_str].push(sedstr) n=n+1 end rescue Exception=>e log_exception(e) return false end end def read_work_ports begin @workerPorts = Array.new log_build_output("Read Work Ports") ports = @blueprint[:software][:worker_ports] puts("Ports Json" + ports.to_s) if ports != nil ports.each do |port| portnum = port[:port] name = port[:name] external = port['external'] type = port['protocol'] if type == nil type='tcp' end #FIX ME when public ports supported puts "Port " + portnum.to_s + ":" + external.to_s @workerPorts.push(WorkPort.new(name,portnum,external,false,type)) end end rescue Exception=>e log_exception(e) return false end end def read_environment_variables log_build_output("Read Environment Variables") @environments = Array.new p :set_environment_variables p @builder.set_environments begin envs = @blueprint[:software][:variables] envs.each do |env| p env name=env[:name] value=env[:value] ask=env[:ask_at_build_time] mandatory = env[:mandatory] build_time_only = env[:build_time_only] label = env[:label] immutable = env[:immutable] lookup_system_values = env[:lookup_system_values] if @builder.set_environments != nil p :looking_for_ p name if ask == true && @builder.set_environments.has_key?(name) == true entered_value=@builder.set_environments[name] if entered_value != nil && entered_value.count !=0#FIXme needs to be removed value = entered_value end end end name.sub!(/ /,"_") p :name_and_value p name p value ev = EnvironmentVariable.new(name,value,ask,mandatory,build_time_only,label,immutable) p ev @environments.push(ev) end rescue Exception=>e log_exception(e) return false end end end #This class is to isolate the builder from the docker template output class BuilderPublic def initialize(builder) @builder = builder end def engine_name @builder.container_name end def domain_name @builder.domain_name end def hostname @builder.hostname end def http_protocol @builder.http_protocol end def repoName @builder.repoName end def webPort @builder.webPort end def build_name @builder.build_name end def runtime @builder.runtime end def set_environments @builder.set_environments end def environments @builder.environments end def mysql_host return "mysql.engines.internal" end def blueprint return @builder.blueprint end def random cnt p :RANDOM__________ p cnt return "random" + cnt end end def initialize(params,core_api) @container_name = params[:engine_name] @domain_name = params[:domain_name] @hostname = params[:host_name] custom_env= params[:software_environment_variables] # custom_env=params @core_api = core_api @http_protocol = params[:http_protocol] p params @repoName= params[:repository_url] @cron_job_list = Array.new @build_name = File.basename(@repoName).sub(/\.git$/,"") @workerPorts=Array.new @webPort=8000 @vols=Array.new @first_build = true #FIXme will be false but for now @overwrite_existing_services = true @builder_public = BuilderPublic.new(self) @system_access = SystemAccess.new() p :custom_env p custom_env if custom_env == nil @set_environments = Hash.new @environments = Array.new elsif custom_env.instance_of?(Array) == true @environments = custom_env # happens on rebuild as custom env is saved in env on disk #FIXME need to vet all environment variables @set_environments = Hash.new else env_array = custom_env.values custom_env_hash = Hash.new env_array.each do |env_hash| p :env_hash p env_hash if env_hash != nil && env_hash[:name] !=nil && env_hash[:value] != nil env_hash[:name] = env_hash[:name].sub(/_/,"") custom_env_hash.store(env_hash[:name],env_hash[:value]) end end p :Merged_custom_env p custom_env_hash @set_environments = custom_env_hash @environments = Array.new end @runtime=String.new @databases= Array.new begin FileUtils.mkdir_p(get_basedir) @log_file= File.new(SysConfig.DeploymentDir + "/build.out", File::CREAT|File::TRUNC|File::RDWR, 0644) @err_file= File.new(SysConfig.DeploymentDir + "/build.err", File::CREAT|File::TRUNC|File::RDWR, 0644) @log_pipe_rd, @log_pipe_wr = IO.pipe @error_pipe_rd, @error_pipe_wr = IO.pipe rescue log_exception(e) end end def close_all if @log_file.closed? == false @log_file.close() end if@err_file.closed? == false @err_file.close() end if @log_pipe_wr.closed? == false @log_pipe_wr.close() end if @error_pipe_wr.closed? == false @error_pipe_wr.close() end end def get_build_log_stream return @log_pipe_rd end def get_build_err_stream @error_pipe_rd end def log_build_output(line) @log_file.puts(line) @log_file.flush # @log_pipe_wr.puts(line) rescue return end def log_build_errors(line) @err_file.puts(line) @err_file.flush # @error_pipe_wr.puts(line) end def setup_framework_logging begin rmt_log_dir_var_fname=get_basedir + "/home/LOG_DIR" if File.exist?(rmt_log_dir_var_fname) rmt_log_dir_varfile = File.open(rmt_log_dir_var_fname) rmt_log_dir = rmt_log_dir_varfile.read else rmt_log_dir="/var/log" end local_log_dir = SysConfig.SystemLogRoot + "/containers/" + @hostname if Dir.exist?(local_log_dir) == false Dir.mkdir( local_log_dir) end return " -v " + local_log_dir + ":" + rmt_log_dir + ":rw " rescue Exception=>e log_exception(e) return false end end def backup_lastbuild begin dir=get_basedir if Dir.exist?(dir) backup=dir + ".backup" if Dir.exist?(backup) FileUtils.rm_rf backup end FileUtils.mv(dir,backup) end rescue Exception=>e log_exception(e) return false #throw BuildException.new(e,"backup_lastbuild") end end def load_blueprint begin log_build_output("Reading Blueprint") blueprint_file_name= get_basedir + "/blueprint.json" blueprint_file = File.open(blueprint_file_name,"r") blueprint_json_str = blueprint_file.read blueprint_file.close # @blueprint = JSON.parse(blueprint_json_str) json_hash = JSON.parse(blueprint_json_str) p :symbolized_hash # test_hash = json_hash # test_hash.keys.each do |key| # test_hash[(key.to_sym rescue key) || key] = myhash.delete(key) # end # p test_hash hash = SystemUtils.symbolize_keys(json_hash) return hash rescue Exception=>e log_exception(e) return false end end def clone_repo begin log_build_output("Clone Blueprint Repository") g = Git.clone(@repoName, @build_name, :path => SysConfig.DeploymentDir) rescue Exception=>e log_exception(e) return false end end # def create_cron_service # begin # # log_build_output("Cron file") # # if @blueprint_reader.cron_jobs != nil && @blueprint_reader.cron_jobs.length >0 # # @blueprint_reader.cron_jobs.each do |cj| # cj_hash = Hash.new # cj_hash[:name] =@container_name # cj_hash[:container_name] = @container_name # cj_hash[:cron_job]=cj # cj_hash[:parent_engine] = @containerName # # cron_file.puts(cj) # # p :write_cron_job # # p cj # @cron_job_list.push(cj_hash) # p @cron_job_list # end # # cron_file.close # end # # return true # # rescue Exception=>e # log_exception(e) # return false # end # end def setup_default_files log_build_output("Setup Default Files") if setup_global_defaults == false return false else return setup_framework_defaults end end # # def create_db_service(name,flavor) # begin # log_build_output("Create DB Service") # db = DatabaseService.new(@hostname,name,SysConfig.DBHost,name,name,flavor) # databases.push(db) # create_database_service db # rescue Exception=>e # log_exception(e) # return false # end # end def build_init begin log_build_output("Building Image") # cmd="cd " + get_basedir + "; docker build -t " + @hostname + "/init ." cmd="/usr/bin/docker build -t " + @container_name + "/deploy " + get_basedir puts cmd res = run_system(cmd) if res != true puts "build init failed " + res.to_s return res end return res rescue Exception=>e log_exception(e) return false end end def launch_deploy managed_container begin log_build_output("Lauching Engine") retval = managed_container.create_container if retval == false puts "Failed to Start Container " + managed_container.last_error log_build_errors("Failed to Launch") end return retval rescue Exception=>e log_exception(e) return false end end def setup_global_defaults begin log_build_output("Setup globel defaults") cmd= "cp -r " + SysConfig.DeploymentTemplates + "/global/* " + get_basedir system cmd rescue Exception=>e log_exception(e) return false end end def setup_framework_defaults log_build_output("Copy in default templates") begin cmd= "cp -r " + SysConfig.DeploymentTemplates + "/" + @blueprint_reader.framework + "/* " + get_basedir system cmd rescue Exception=>e log_exception(e) return false end end def get_blueprint_from_repo log_build_output("Backup last build") if backup_lastbuild == false return false end puts("Cloning Blueprint") return clone_repo end def build_from_blue_print if get_blueprint_from_repo == false return false end return build_container end def read_web_port log_build_output("Setting Web port") begin stef = File.open( get_basedir + "/home/stack.env","r") while line=stef.gets do if line.include?("PORT") i= line.split('=') @webPort= i[1].strip p :web_port_line p line end p @webPort puts(@webPort) end rescue Exception=>e log_exception(e) # throw BuildException.new(e,"setting web port") return false end end def read_web_user begin log_build_output("Read Web User") stef = File.open( get_basedir + "/home/stack.env","r") while line=stef.gets do if line.include?("USER") i= line.split('=') @webUser= i[1].strip end end rescue Exception=>e log_exception(e) return false end end def build_container begin log_build_output("Reading Blueprint") @blueprint = load_blueprint if @blueprint == nil || @blueprint == false return false end @blueprint_reader = BluePrintReader.new(@build_name,@container_name,@blueprint,self) @blueprint_reader.process_blueprint if setup_default_files == false return false end compile_base_docker_files if @blueprint_reader.web_port != nil @webPort = @blueprint_reader.web_port else read_web_port end read_web_user create_persistant_services #need to de-register these if build fails But not deregister those that existed prior create_template_files create_php_ini create_apache_config create_scritps @blueprint_reader.environments.each do |env| env.value = process_templated_string(env.value) end index=0 #FIXME There has to be a ruby way @blueprint_reader.sed_strings[:sed_str].each do |sed_string| sed_string = process_templated_string(sed_string) sed_strings[:sed_str][index] = sed_string index+=1 end dockerfile_builder = DockerFileBuilder.new( @blueprint_reader,@container_name, @hostname,@domain_name,@webPort,self) dockerfile_builder.write_files_for_docker env_file = File.new(get_basedir + "/home/app.env","a") env_file.puts("") @blueprint_reader.environments.each do |env| env_file.puts(env.name) end @set_environments.each do |env| env_file.puts(env[0]) end env_file.close setup_framework_logging # log_build_output("Creating db Services") # @blueprint_reader.databases.each() do |db| # create_database_service db # end if build_init == false log_build_errors("Error Build Image failed") @last_error = " " + tail_of_build_log post_failed_build_clean_up return false else if @core_api.image_exists?(@container_name) == false @last_error = " " + tail_of_build_log post_failed_build_clean_up return false #return EnginesOSapiResult.failed(@container_name,"Build Image failed","build Image") end #needs to be moved to services dependant on the new BPDS #create_cron_service # log_build_output("Creating vol Services") # @blueprint_reader.databases.each() do |db| # create_database_service db # end # # primary_vol=nil # @blueprint_reader.volumes.each_value() do |vol| # create_file_service vol # if primary_vol == nil # primary_vol =vol # end # end log_build_output("Creating Deploy Image") mc = create_managed_container() if mc != nil create_non_persistant_services end end close_all return mc rescue Exception=>e log_exception(e) post_failed_build_clean_up close_all return false end end def post_failed_build_clean_up #remove containers #remove persistant services (if created/new) #deregister non persistant services (if created) p :Clean_up_Failed_build @blueprint_reader.services.each do |service_hash| if service_hash[:fresh] == true service_hash[:delete_persistant]=true @core_api.dettach_service(service_hash) #true is delete persistant end end end def create_template_files if @blueprint[:software].has_key?(:template_files) && @blueprint[:software][:template_files] != nil @blueprint[:software][:template_files].each do |template_hash| write_software_file( "/home/engines/templates/" + template_hash[:path],template_hash[:content]) end end end def create_httaccess if @blueprint[:software].has_key?(:apache_htaccess_files) && @blueprint[:software][:apache_htaccess_files] != nil @blueprint[:software][:apache_htaccess_files].each do |htaccess_hash| write_software_file("/home/engines/htaccess_files" + template_hash[:directory]+"/.htaccess",template_hash[:htaccess_content]) end end end def create_scritps FileUtils.mkdir_p(get_basedir() + SysConfig.ScriptsDir) create_start_script create_install_script create_post_install_script end def create_start_script if @blueprint[:software].has_key?(:custom_start_script) && @blueprint[:software][:custom_start_script] != nil start_script_file = File.open(get_basedir() + SysConfig.StartScript,"w", :crlf_newline => false) start_script_file.puts(@blueprint[:software][:custom_start_script]) start_script_file.close File.chmod(0755,get_basedir() + SysConfig.StartScript) end end def create_install_script if @blueprint[:software].has_key?(:custom_install_script) && @blueprint[:software][:custom_install_script] != nil install_script_file = File.open(get_basedir() + SysConfig.InstallScript,"w", :crlf_newline => false) install_script_file.puts(@blueprint[:software][:custom_install_script]) install_script_file.close File.chmod(0755,get_basedir() + SysConfig.InstallScript) end end def create_post_install_script if @blueprint[:software].has_key?(:custom_post_install_script) && @blueprint[:software][:custom_post_install_script] != nil post_install_script_file = File.open(get_basedir() + SysConfig.PostInstallScript,"w", :crlf_newline => false) post_install_script_file.puts(@blueprint[:software][:custom_post_install_script]) post_install_script_file.close File.chmod(0755,get_basedir() + SysConfig.PostInstallScript) end end def create_php_ini FileUtils.mkdir_p(get_basedir() + File.dirname(SysConfig.CustomPHPiniFile)) if @blueprint[:software].has_key?(:custom_php_inis) && @blueprint[:software][:custom_php_inis] != nil php_ini_file = File.open(get_basedir() + SysConfig.CustomPHPiniFile,"w", :crlf_newline => false) @blueprint[:software][:custom_php_inis].each do |php_ini_hash| php_ini_file.puts(php_ini_hash[:content]) end php_ini_file.close end end def create_apache_config FileUtils.mkdir_p(get_basedir() + File.dirname(SysConfig.CustomApacheConfFile)) if @blueprint[:software].has_key?(:custom_apache_conf) && @blueprint[:software][:custom_apache_conf] != nil write_software_file(SysConfig.CustomApacheConfFile,@blueprint[:software][:custom_apache_conf]) end end def write_software_file(container_filename_path,content) dir = File.dirname(get_basedir() + container_filename_path) p :dir_for_write_software_file p dir if Dir.exist?(dir) == false FileUtils.mkdir_p(dir) end out_file = File.open(get_basedir() + container_filename_path ,"w", :crlf_newline => false) content = process_templated_string(content) out_file.puts(content) end def compile_base_docker_files file_list = Dir.glob(@blueprint_reader.get_basedir + "/Dockerfile*.tmpl") file_list.each do |file| process_dockerfile_tmpl(file) end end def process_templated_string(template) template = apply_system_variables(template) template = apply_build_variables(template) template = apply_blueprint_variables(template) template = apply_engines_variables(template) return template end def process_dockerfile_tmpl(filename) p :dockerfile_template_processing p filename template = File.read(filename) template = process_templated_string(template) output_filename = filename.sub(/.tmpl/,"") out_file = File.new(output_filename,"w") out_file.write(template) out_file.close() end def apply_system_variables(template) template.gsub!(/_System\([a-z].*\)/) { | match | resolve_system_variable(match) } return template end def apply_build_variables(template) template.gsub!(/_Builder\([a-z].*\)/) { | match | resolve_build_variable(match) } return template end def resolve_system_variable(match) name = match.sub!(/_System\(/,"") name.sub!(/[\)]/,"") p :getting_system_value_for p name var_method = @system_access.method(name.to_sym) val = var_method.call p :got_val p val return val rescue Exception=>e SystemUtils.log_exception(e) return "" end #_Blueprint(software,license_name) #_Blueprint(software,rake_tasks,name) def apply_blueprint_variables(template) template.gsub!(/_Blueprint\([a-z,].*\)/) { | match | resolve_blueprint_variable(match) } return template end def resolve_blueprint_variable(match) name = match.sub!(/_Blueprint\(/,"") name.sub!(/[\)]/,"") p :getting_system_value_for p name val ="" keys = name.split(',') hash = @builder_public.blueprint keys.each do |key| if key == nil || key.length < 1 break end p :key p key val = hash[key.to_sym] p :val p val if val != nil hash=val end end p :got_val p val return val rescue Exception=>e SystemUtils.log_exception(e) return "" end def resolve_build_variable(match) name = match.sub!(/_Builder\(/,"") name.sub!(/[\)]/,"") p :getting_system_value_for p name.to_sym if name.include?('(') == true cmd = name.split('(') name = cmd[0] if cmd.count >1 args = cmd[1] args_array = args.split end end var_method = @builder_public.method(name.to_sym) if args p :got_args val = var_method.call args else val = var_method.call end p :got_val p val return val rescue Exception=>e SystemUtils.log_exception(e) return "" end def resolve_engines_variable name = match.sub!(/_Engines\(/,"") name.sub!(/[\)]/,"") p :getting_system_value_for p name.to_sym return @blueprint_reader.environments[name.to_sym] rescue Exception=>e p @blueprint_reader.environments SystemUtils.log_exception(e) return "" end def apply_engines_variables(template) template.gsub!(/_Engines\([a-z].*\)/) { | match | resolve_engines_variable(match) } return template end def create_non_persistant_services @blueprint_reader.services.each() do |service_hash| #FIX ME Should call this but Keys dont match blueprint designer issue #@core_api.add_service(service,mc) service_hash[:parent_engine]=@container_name service_def = get_service_def(service_hash) if service_def == nil p :failed_to_load_service_definition p service_hash[:type_path] p service_hash[:publisher_namespace] return false end if service_def[:persistant] == true next end service_hash[:service_handle] = service_hash[:variables][:name] p :adding_service p service_hash @core_api.attach_service(service_hash) end end def get_service_def(service_hash) p service_hash[:type_path] p service_hash[:publisher_namespace] return SoftwareServiceDefinition.find(service_hash[:type_path], service_hash[:publisher_namespace] ) end def create_persistant_services @blueprint_reader.services.each() do |service_hash| service_hash[:parent_engine]=@container_name # p :service_def_for # p service_hash[:type_path] # p service_hash[:publisher_namespace] service_def = get_service_def(service_hash) # p service_def if service_def == nil p :failed_to_load_service_definition p :servicetype_name p service_hash[:service_type] p :service_provider p service_hash[:publisher_namespace] return false end if service_def[:persistant] == false next end p :adding_service puts "+=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++" p service_hash puts "+=++=++=++=++=++=++=++=++=++=++=++=++=++=++=++" p :target_envs p service_def[:target_environment_variables] if service_hash[:servicetype_name] == "filesystem" add_file_service(service[:name], service[:engine_path]) end service_hash[:service_handle] = service_hash[:variables][:name] p :LOOKING_FOR_ p service_hash if @core_api.find_service_consumers(service_hash) == false @first_build = true service_hash[:fresh]=true else service_hash[:fresh]=false @first_build = false end p :attach_service p service_hash @core_api.attach_service(service_hash) end end def fill_in_dynamic_vars(service_hash) p "FILLING_+@+#+@+@+@+@+@+" if service_hash.has_key?(:variables) == false || service_hash[:variables] == nil return end service_hash[:variables].each do |variable| p variable if variable[1] != nil && variable[1].start_with?("$_") variable[1].sub!(/\$/,"") result = evaluate_function(variable[1]) service_hash[:variables][variable[0]] = result end end end def evaluate_function(function) if function.start_with?("_System") return resolve_system_variable(function) elsif function.start_with?("_Builder") return resolve_build_variable(function) elsif function.start_with?("_Blueprint") return resolve_blueprint_variable(function) end rescue Exception=> e return "" end def tail_of_build_log retval = String.new lines = File.readlines(SysConfig.DeploymentDir + "/build.out") lines_count = lines.count -1 start = lines_count - 10 for n in start..lines_count retval+=lines[n] end return retval end def rebuild_managed_container engine @engine = engine log_build_output("Starting Rebuild") if backup_lastbuild == false return false elsif setup_rebuild == false return false else return build_container end end def setup_rebuild begin log_build_output("Setting up rebuild") FileUtils.mkdir_p(get_basedir) blueprint = @core_api.load_blueprint(@engine) statefile= get_basedir + "/blueprint.json" f = File.new(statefile,File::CREAT|File::TRUNC|File::RDWR, 0644) f.write(blueprint.to_json) f.close rescue Exception=>e log_exception(e) return false end end def create_managed_container log_build_output("Creating ManagedEngine") mc = ManagedEngine.new(@hostname, @blueprint_reader.memory.to_s , @hostname, @domain_name, @container_name + "/deploy", @blueprint_reader.volumes, @webPort, @blueprint_reader.workerPorts, @repoName, @blueprint_reader.databases, @blueprint_reader.environments, @blueprint_reader.framework, @blueprint_reader.runtime, @core_api, @blueprint_reader.data_uid, @blueprint_reader.data_gid ) p :set_cron_job_list p @cron_job_list mc.set_cron_job_list(@cron_job_list) #:http_protocol=>"HTTPS and HTTP" mc.set_protocol(@protocol) mc.conf_register_site=( true) # needs some intelligence here for worker only mc.conf_self_start= (true) mc.save_state # no config.yaml throws a no such container so save so others can use if mc.save_blueprint(@blueprint) == false log_build_errors( "Failed to save blueprint " + @blueprint.to_s) end bp = mc.load_blueprint p bp log_build_output("Launching") #this will fail as no api at this stage if mc.core_api != nil if launch_deploy(mc) == false log_build_errors("Failed to Launch") end log_build_output("Applying Volume settings and Log Permissions") #FIXME need to check results from following @core_api.run_volume_builder(mc ,@webUser) # mc.start_container end return mc end protected def log_exception(e) log_build_errors( e.to_s) puts(e.to_s) @last_error= e.to_s n=0 e.backtrace.each do |bt | p bt if n>10 break end ++n end #close_all end def debug(fld) puts "ERROR: " p fld end require 'open3' def run_system(cmd) log_build_output("Running " + cmd) ret_val=false res = String.new error_mesg = String.new begin Open3.popen3( cmd ) do |stdin, stdout, stderr, th| oline = String.new stderr_is_open=true begin stdout.each { |line| # print line line = line.gsub(/\\\"/,"") res += line.chop oline = line log_build_output(line) if stderr_is_open err = stderr.read_nonblock(1000) error_mesg += err log_build_errors(err) end } rescue Errno::EIO res += line.chop log_build_output(oline) if stderr_is_open err = stderr.read_nonblock(1000) error_mesg += err log_build_errors(err) p :EIO_retry retry end rescue IO::WaitReadable # p :wait_readable_retrt retry rescue EOFError if stdout.closed? == false stderr_is_open = false p :EOF_retry retry else if stderr.closed? == true return else err = stderr.read_nonblock(1000) error_mesg += err log_build_errors(err) return end end end if error_mesg.include?("Error:") || error_mesg.include?("FATA") p "docker_cmd error " + error_mesg return false end return true end end end def get_basedir return SysConfig.DeploymentDir + "/" + @build_name end end
module Widgets module TableHelper include CssTemplate # Returns an HTML table with +:collection+ disposed in rows. Add # HTML attributes by passing an attributes hash to +html+. # The content of each item is rendered using the given block. # # +:collection+ array of items # +:cols+ number of columns (default 3) # +:html+ table html attributes (+:class+, +:id+) # +:name+ name of table (dafault +:main+) # # <% tableize @users, :name => 'credential', :html => {:class => 'people'}, :cols => 2 do |user| -%> # login: <%= user.name %> # <% end -%> # # # => <table id="credential_table" class="people"><tbody><tr> # <td>login: scooby</td><td>&nbsp;</td> # </tr></tbody></table> # def tableize(collection = nil, opts = {}, &block) table = Tableizer.new(collection, opts, self, &block) table.render end class Tableizer def initialize(collection, opts, template, &block) @collection = collection @collection ||= opts[:collection] @columns = opts[:cols] || 3 raise ArgumentError, 'Missing collection parameter in tableize call' unless @collection raise ArgumentError, 'Missing block in tableize call' unless block_given? raise ArgumentError, 'Tableize columns must be two or more' unless @columns > 1 @generate_css = opts[:generate_css] || false @opts = opts @name = opts[:name] || :main @html = opts[:html] || {} # setup default html options @html[:id] ||= @name.to_s.underscore << '_table' @html[:class] ||= @html[:id] @header = opts[:header] @template = template @block = block end def method_missing(*args, &block) @template.send(*args, &block) end def render _out = @generate_css ? render_css('table') : '' _out << tag('table', {:id => @html[:id], :class => @html[:class]}, true) _out << tag('tbody', nil, true) _out << tag('tr', nil, true) index = 0 size = @collection.size empty_cell = content_tag('td', '&nbsp;', :class => 'blank') # add header if (@header) _out << content_tag('th', @header) index += 1 size += 1 end # fill line with items, breaking if needed @collection.each do |item| index += 1 _out << content_tag('td', capture(item, &@block)) should_wrap = ( index.remainder(@columns) == 0 and index != size ) _out << '</tr>' << tag('tr', nil, true) if should_wrap # prepend every line with an empty cell if should_wrap && @opts[:skip_header_column] == true _out << empty_cell index += 1; size += 1 end end # fill remaining columns with empty boxes remaining = size.remainder(@columns) (@columns - remaining).times do _out << empty_cell end unless remaining == 0 _out << '</tr>' << '</tbody>' << '</table>' concat(_out) nil # avoid duplication if called with <%= %> end end end end More refactoring to Tableizer module Widgets module TableHelper include CssTemplate # Returns an HTML table with +:collection+ disposed in rows. Add # HTML attributes by passing an attributes hash to +html+. # The content of each item is rendered using the given block. # # +:collection+ array of items # +:cols+ number of columns (default 3) # +:html+ table html attributes (+:class+, +:id+) # +:name+ name of table (dafault +:main+) # # <% tableize @users, :name => 'credential', :html => {:class => 'people'}, :cols => 2 do |user| -%> # login: <%= user.name %> # <% end -%> # # # => <table id="credential_table" class="people"><tbody><tr> # <td>login: scooby</td><td>&nbsp;</td> # </tr></tbody></table> # def tableize(collection = nil, opts = {}, &block) table = Tableizer.new(collection, opts, self, &block) table.render end class Tableizer def initialize(collection, opts, template, &block) parse_args(collection, opts, template, &block) raise ArgumentError, 'Missing collection parameter in tableize call' unless @collection raise ArgumentError, 'Missing block in tableize call' unless block_given? raise ArgumentError, 'Tableize columns must be two or more' unless @columns >= 2 end def render generate_css generate_html concat(@output_buffer) nil # avoid duplication if called with <%= %> end protected def parse_args(collection, opts, template, &block) @collection = collection @collection ||= opts[:collection] @columns = opts[:cols] || 3 @generate_css = opts[:generate_css] || false @name = opts[:name] || :main @html = opts[:html] || {} # setup default html options @html[:id] ||= @name.to_s.underscore << '_table' @html[:class] ||= @html[:id] @header = opts[:header] @skip_header_column = opts[:skip_header_column] @template = template @block = block @output_buffer = '' end def generate_css @output_buffer << render_css('table') if generate_css? end def generate_html @output_buffer << tag('table', {:id => @html[:id], :class => @html[:class]}, true) @output_buffer << tag('tbody', nil, true) @output_buffer << tag('tr', nil, true) index = 0 size = @collection.size empty_cell = content_tag('td', '&nbsp;', :class => 'blank') # add header if (@header) @output_buffer << content_tag('th', @header) index += 1 size += 1 end # fill line with items, breaking if needed @collection.each do |item| index += 1 @output_buffer << content_tag('td', capture(item, &@block)) should_wrap = ( index.remainder(@columns) == 0 and index != size ) @output_buffer << '</tr>' << tag('tr', nil, true) if should_wrap # prepend every line with an empty cell if should_wrap && @skip_header_column == true @output_buffer << empty_cell index += 1; size += 1 end end # fill remaining columns with empty boxes remaining = size.remainder(@columns) (@columns - remaining).times do @output_buffer << empty_cell end unless remaining == 0 @output_buffer << '</tr>' << '</tbody>' << '</table>' end def generate_css? @generate_css end def method_missing(*args, &block) @template.send(*args, &block) end end end end
# Various extensions to core and library classes. # TODO move gem declarations elsewhere gem 'dm-core', '= 0.9.5' gem 'dm-validations', '= 0.9.5' gem 'dm-ar-finders', '= 0.9.5' require 'dm-core' require 'date' require 'time' class DateTime #:nodoc: # ISO 8601 formatted time value. This is alias_method :iso8601, :to_s def inspect "#<DateTime: #{to_s}>" end def to_date Date.civil(year, mon, mday) end def to_time if self.offset == 0 ::Time.utc(year, month, day, hour, min, sec) else new_offset(0).to_time end end end class Date #:nodoc: def inspect "#<Date: #{to_s}>" end end class Time def to_datetime jd = DateTime.civil_to_jd(year, mon, mday, DateTime::ITALY) fr = DateTime.time_to_day_fraction(hour, min, [sec, 59].min) + usec.to_r/86400000000 of = utc_offset.to_r/86400 DateTime.new!(DateTime.jd_to_ajd(jd, fr, of), of, DateTime::ITALY) end end require 'rack' module Rack class Request # The IP address of the upstream-most client (e.g., the browser). This # is reliable even when the request is made through a reverse proxy or # other gateway. def remote_ip @env['HTTP_X_FORWARDED_FOR'] || @env['HTTP_CLIENT_IP'] || @env['REMOTE_ADDR'] end end end require 'sinatra' # The running environment as a Symbol; obtained from Sinatra's # application options. def environment Sinatra.application.options.env.to_sym end # Truthful when the application is in the process of being reloaded # by Sinatra. def reloading? Sinatra.application.reloading? end Should work with latest version of DataMapper # Various extensions to core and library classes. # TODO move gem declarations elsewhere gem 'dm-core' gem 'dm-validations' gem 'dm-ar-finders' require 'dm-core' require 'date' require 'time' class DateTime #:nodoc: # ISO 8601 formatted time value. This is alias_method :iso8601, :to_s def inspect "#<DateTime: #{to_s}>" end def to_date Date.civil(year, mon, mday) end def to_time if self.offset == 0 ::Time.utc(year, month, day, hour, min, sec) else new_offset(0).to_time end end end class Date #:nodoc: def inspect "#<Date: #{to_s}>" end end class Time def to_datetime jd = DateTime.civil_to_jd(year, mon, mday, DateTime::ITALY) fr = DateTime.time_to_day_fraction(hour, min, [sec, 59].min) + usec.to_r/86400000000 of = utc_offset.to_r/86400 DateTime.new!(DateTime.jd_to_ajd(jd, fr, of), of, DateTime::ITALY) end end require 'rack' module Rack class Request # The IP address of the upstream-most client (e.g., the browser). This # is reliable even when the request is made through a reverse proxy or # other gateway. def remote_ip @env['HTTP_X_FORWARDED_FOR'] || @env['HTTP_CLIENT_IP'] || @env['REMOTE_ADDR'] end end end require 'sinatra' # The running environment as a Symbol; obtained from Sinatra's # application options. def environment Sinatra.application.options.env.to_sym end # Truthful when the application is in the process of being reloaded # by Sinatra. def reloading? Sinatra.application.reloading? end
$:.push File.expand_path("../lib", __FILE__) version = File.read(File.expand_path("../../VERSION",__FILE__)).strip Gem::Specification.new do |s| s.name = "brightcontent-pages" s.version = version s.email = "developers@brightin.nl" s.homepage = "http://brightin.nl" s.summary = "Pages resource for brightcontent" s.description = "Separate pages resource for brightcontent" s.authors = ["Developers at Brightin"] s.files = `git ls-files`.split("\n") s.test_files = `git ls-files -- spec/*`.split("\n") s.require_paths = ["lib"] s.add_dependency "brightcontent-core", version s.add_dependency "brightcontent-attachments", version s.add_dependency "awesome_nested_set", ">= 3.0.0.rc.3" s.add_dependency "jquery-ui-rails", ">= 2.3.0" s.add_dependency "the_sortable_tree", "~> 2.3.0" s.add_development_dependency "sqlite3" s.add_development_dependency "rspec", "~> 2.14.1" s.add_development_dependency "rspec-rails" s.add_development_dependency "capybara" s.add_development_dependency "launchy" s.add_development_dependency "factory_girl_rails" end Update jquery-ui-rails dependency in gemspec $:.push File.expand_path("../lib", __FILE__) version = File.read(File.expand_path("../../VERSION",__FILE__)).strip Gem::Specification.new do |s| s.name = "brightcontent-pages" s.version = version s.email = "developers@brightin.nl" s.homepage = "http://brightin.nl" s.summary = "Pages resource for brightcontent" s.description = "Separate pages resource for brightcontent" s.authors = ["Developers at Brightin"] s.files = `git ls-files`.split("\n") s.test_files = `git ls-files -- spec/*`.split("\n") s.require_paths = ["lib"] s.add_dependency "brightcontent-core", version s.add_dependency "brightcontent-attachments", version s.add_dependency "awesome_nested_set", ">= 3.0.0.rc.3" s.add_dependency "jquery-ui-rails", "~> 5.0.0" s.add_dependency "the_sortable_tree", "~> 2.3.0" s.add_development_dependency "sqlite3" s.add_development_dependency "rspec", "~> 2.14.1" s.add_development_dependency "rspec-rails" s.add_development_dependency "capybara" s.add_development_dependency "launchy" s.add_development_dependency "factory_girl_rails" end
require 'spec_helper' describe Nicorepo do before(:all) do mail, pass = Netrc.read["nicovideo.jp"] @nicorepo = Nicorepo.new @nicorepo.login(mail, pass) end describe "#login" do context "with right account" do it "should be success" do expect(@nicorepo.agent).to be_truthy end end context "with wrong account" do it "should raise error" do repo = Nicorepo.new expect{ repo.login('test', 'testpass') }.to raise_error(Nicorepo::LoginError) end end end describe "#all" do context "with 5" do it "should return 5 reports" do expect(@nicorepo.all(5).size).to eq(5) end end context "with 50" do it "should return 50 reports" do expect(@nicorepo.all(50).size).to eq(50) end end end describe "#videos" do context "with request_num = 5, limit_page = 3" do it "should return only video reports" do videos = @nicorepo.videos not_videos = videos.reject{ |v| v.kind =~ /video/ } expect(not_videos.size).to eq(0) end it "should return 5 reports at the most" do expect(@nicorepo.videos(5, 3).size).to be <= 5 end end end describe "#lives" do it "should return only live reports" do lives = @nicorepo.lives not_lives = lives.reject{ |l| l.kind =~ /live/ } expect(not_lives.size).to eq(0) end end end Add specs for error reports require 'spec_helper' describe Nicorepo do before(:all) do mail, pass = Netrc.read["nicovideo.jp"] @nicorepo = Nicorepo.new @nicorepo.login(mail, pass) end describe "#login" do context "with right account" do it "should be success" do expect(@nicorepo.agent).to be_truthy end end context "with wrong account" do it "should raise error" do repo = Nicorepo.new expect{ repo.login('test', 'testpass') }.to raise_error(Nicorepo::LoginError) end end end describe "#all" do context "with 5" do it "should return 5 reports" do expect(@nicorepo.all(5).size).to eq(5) end end context "with 50" do it "should return 50 reports" do expect(@nicorepo.all(50).size).to eq(50) end end context "when an error occured" do before do allow_any_instance_of(Nicorepo::Parser).to receive(:parse_title).and_raise("SomeError") end it "should return erorr reports" do error_report = @nicorepo.all(1).first expect(error_report.title).to eq("An exception occured: SomeError") end end end describe "#videos" do context "with request_num = 5, limit_page = 3" do it "should return only video reports" do videos = @nicorepo.videos not_videos = videos.reject{ |v| v.kind =~ /video/ } expect(not_videos.size).to eq(0) end it "should return 5 reports at the most" do expect(@nicorepo.videos(5, 3).size).to be <= 5 end end end describe "#lives" do it "should return only live reports" do lives = @nicorepo.lives not_lives = lives.reject{ |l| l.kind =~ /live/ } expect(not_lives.size).to eq(0) end end end
describe "NSString" do it "should have a #nsurl method" do url = 'https://github.com/status'.nsurl NSURL.should === url url.absoluteString.should == 'https://github.com/status' url.host.should == 'github.com' end it "should have a #nsdata method" do data = 'test'.nsdata NSData.should === data bytes = data.bytes bytes[0].should == 116 bytes[1].should == 101 bytes[2].should == 115 bytes[3].should == 116 end it "should have a #uiimage method" do UIImage.imageNamed('little_square').should == 'little_square'.uiimage end it "should have a #uiimageview method" do view = 'little_square'.uiimageview UIView.should === view view.image.should == UIImage.imageNamed('little_square') end it "should have a #uifont method" do font = 'Helvetica'.uifont UIFont.should === font font.familyName.should == 'Helvetica' font.pointSize.should == UIFont.systemFontSize end it "should have a #uicolor method" do color = '#ffffff'.uicolor UIColor.should === color color.red.should == 1.0 color.green.should == 1.0 color.blue.should == 1.0 color = '#808080'.uicolor UIColor.should === color ((color.red * 2).round / 2.0).should == 0.5 ((color.green * 2).round / 2.0).should == 0.5 ((color.blue * 2).round / 2.0).should == 0.5 end it "should have a #uilabel method" do str = 'test' str_size = str.sizeWithFont(UIFont.systemFontOfSize(UIFont.labelFontSize)) label = str.uilabel label.size.width == str_size.width label.size.height == str_size.height label.backgroundColor == UIColor.clearColor end it "should have a #uilabel(font) method" do str = 'test' font = UIFont.boldSystemFontOfSize(20) str_size = str.sizeWithFont(font) label = str.uilabel(font) label.font.should == font label.size.width == str_size.width label.size.height == str_size.height label.backgroundColor == UIColor.clearColor end it "should have a #escape_url method" do ' '.escape_url.should == '%20' '?<>&=;%'.escape_url.should == '%3F%3C%3E%26%3D%3B%25' end it "should have a #unescape_url method" do '%20'.unescape_url.should == ' ' '%3F%3C%3E%26%3D%3B%25'.unescape_url.should == '?<>&=;%' end it "should have a #localized method" do 'hello'.localized.should == 'howdy' 'hello'._.should == 'howdy' end end test should have some shoulds, me thinks describe "NSString" do it "should have a #nsurl method" do url = 'https://github.com/status'.nsurl NSURL.should === url url.absoluteString.should == 'https://github.com/status' url.host.should == 'github.com' end it "should have a #nsdata method" do data = 'test'.nsdata NSData.should === data bytes = data.bytes bytes[0].should == 116 bytes[1].should == 101 bytes[2].should == 115 bytes[3].should == 116 end it "should have a #uiimage method" do UIImage.imageNamed('little_square').should == 'little_square'.uiimage end it "should have a #uiimageview method" do view = 'little_square'.uiimageview UIView.should === view view.image.should == UIImage.imageNamed('little_square') end it "should have a #uifont method" do font = 'Helvetica'.uifont UIFont.should === font font.familyName.should == 'Helvetica' font.pointSize.should == UIFont.systemFontSize end it "should have a #uicolor method" do color = '#ffffff'.uicolor UIColor.should === color color.red.should == 1.0 color.green.should == 1.0 color.blue.should == 1.0 color = '#808080'.uicolor UIColor.should === color ((color.red * 2).round / 2.0).should == 0.5 ((color.green * 2).round / 2.0).should == 0.5 ((color.blue * 2).round / 2.0).should == 0.5 end it "should have a #uilabel method" do str = 'test' str_size = str.sizeWithFont(UIFont.systemFontOfSize(UIFont.labelFontSize)) label = str.uilabel label.size.width.should == str_size.width label.size.height.should == str_size.height label.backgroundColor.should == UIColor.clearColor end it "should have a #uilabel(font) method" do str = 'test' font = UIFont.boldSystemFontOfSize(20) str_size = str.sizeWithFont(font) label = str.uilabel(font) label.font.should == font label.size.width.should == str_size.width label.size.height.should == str_size.height label.backgroundColor.should == UIColor.clearColor end it "should have a #escape_url method" do ' '.escape_url.should == '%20' '?<>&=;%'.escape_url.should == '%3F%3C%3E%26%3D%3B%25' end it "should have a #unescape_url method" do '%20'.unescape_url.should == ' ' '%3F%3C%3E%26%3D%3B%25'.unescape_url.should == '?<>&=;%' end it "should have a #localized method" do 'hello'.localized.should == 'howdy' 'hello'._.should == 'howdy' end end
require 'reindeer' describe Reindeer do it 'can be extended' do expect { Class.new { extend Reindeer } }.to_not raise_error end context 'when extended' do let(:example) { Class.new { extend Reindeer } } it 'provides a has class method' do expect(example.methods).to include(:has) end end describe :has do let(:attribute_name) { :attribute_name } let(:getter) { :attribute_name } let(:setter) { :"#{:attribute_name}=" } let(:example) do example = Class.new { extend Reindeer } example.has attribute_name, params example end context 'with read-only accessors' do let(:params) { { is: :ro } } it 'creates a reader' do expect(example.new.methods).to include(getter) end it 'does not create a writer' do expect(example.new.methods).to_not include(setter) end end context 'with read/write accessors' do let(:params) { { is: :rw } } it 'creates a reader' do expect(example.new.methods).to include(getter) end it 'creates a writer' do expect(example.new.methods).to include(setter) end end context 'with bad is' do let(:is) { :jabbajabba } let(:params) { { is: is } } it 'throws an exception' do expect { example }.to raise_error(Reindeer::BadIs, "#{is} invalid") end end context 'with no is' do let(:params) { {} } it 'does not create a reader' do expect(example.new.methods).to_not include(getter) end it 'does not create a writer' do expect(example.new.methods).to_not include(setter) end end context 'when constructing an object' do let(:params) { { is: :rw } } let(:expected_value) { 42 } it 'accepts & records parameters to new' do instance = example.new( attribute_name => expected_value ) expect(instance.instance_variable_get :"@#{getter}").to eq expected_value end end context 'when generating a predicate' do let(:params) { { is: :ro, predicate: true } } let(:predicate) { :"#{attribute_name}?" } it 'evaluates true when the value is set' do expect(example.new( attribute_name => 42 ).send predicate).to be_true end it 'evaluates true when the value is set' do expect(example.new.send predicate).to be_false end end end end Test when a predicate is not added. require 'reindeer' describe Reindeer do it 'can be extended' do expect { Class.new { extend Reindeer } }.to_not raise_error end context 'when extended' do let(:example) { Class.new { extend Reindeer } } it 'provides a has class method' do expect(example.methods).to include(:has) end end describe :has do let(:attribute_name) { :attribute_name } let(:getter) { :attribute_name } let(:setter) { :"#{:attribute_name}=" } let(:example) do example = Class.new { extend Reindeer } example.has attribute_name, params example end context 'with read-only accessors' do let(:params) { { is: :ro } } it 'creates a reader' do expect(example.new.methods).to include(getter) end it 'does not create a writer' do expect(example.new.methods).to_not include(setter) end end context 'with read/write accessors' do let(:params) { { is: :rw } } it 'creates a reader' do expect(example.new.methods).to include(getter) end it 'creates a writer' do expect(example.new.methods).to include(setter) end end context 'with bad is' do let(:is) { :jabbajabba } let(:params) { { is: is } } it 'throws an exception' do expect { example }.to raise_error(Reindeer::BadIs, "#{is} invalid") end end context 'with no is' do let(:params) { {} } it 'does not create a reader' do expect(example.new.methods).to_not include(getter) end it 'does not create a writer' do expect(example.new.methods).to_not include(setter) end end context 'when constructing an object' do let(:params) { { is: :rw } } let(:expected_value) { 42 } it 'accepts & records parameters to new' do instance = example.new( attribute_name => expected_value ) expect(instance.instance_variable_get :"@#{getter}").to eq expected_value end end context 'when generating a predicate' do let(:params) { { is: :ro, predicate: true } } let(:predicate) { :"#{attribute_name}?" } it 'evaluates true when the value is set' do expect(example.new( attribute_name => 42 ).send predicate).to be_true end it 'evaluates true when the value is set' do expect(example.new.send predicate).to be_false end end context 'when not generating a predicate' do let(:params) { { is: :ro } } let(:predicate) { :"#{attribute_name}?" } it 'does not have a predicate' do expect(example.methods).to_not include(predicate) end end end end
$LOAD_PATH.unshift File.dirname(__FILE__) require 'spec_helper' require 'wright/resource' include Wright describe Resource do before(:each) do # duplicate Wright::Resource for testing resource_module = Resource.dup @recipe = Class.new do extend resource_module end @resource_module = resource_module end it 'should register new resources at runtime' do resource_class = Class.new do def self.name; 'ResourceKlass'; end def initialize(name); end end @resource_module.register(resource_class) resource_name = Util.class_to_resource_name(resource_class) @recipe.must_respond_to(resource_name) resource = @recipe.send(resource_name) resource.must_be_instance_of(resource_class) end end Use require_relative in resource spec require_relative 'spec_helper' require 'wright/resource' include Wright describe Resource do before(:each) do # duplicate Wright::Resource for testing resource_module = Resource.dup @recipe = Class.new do extend resource_module end @resource_module = resource_module end it 'should register new resources at runtime' do resource_class = Class.new do def self.name; 'ResourceKlass'; end def initialize(name); end end @resource_module.register(resource_class) resource_name = Util.class_to_resource_name(resource_class) @recipe.must_respond_to(resource_name) resource = @recipe.send(resource_name) resource.must_be_instance_of(resource_class) end end
#!/usr/bin/env ruby require 'bundler' require 'bundler/setup' require 'chef_zero/server' require 'rspec/core' def start_server(chef_repo_path) require 'chef/version' require 'chef/config' require 'chef/chef_fs/config' require 'chef/chef_fs/chef_fs_data_store' require 'chef_zero/server' Dir.mkdir(chef_repo_path) if !File.exists?(chef_repo_path) # 11.6 and below had a bug where it couldn't create the repo children automatically if Chef::VERSION.to_f < 11.8 %w(clients cookbooks data_bags environments nodes roles users).each do |child| Dir.mkdir("#{chef_repo_path}/#{child}") if !File.exists?("#{chef_repo_path}/#{child}") end end # Start the new server Chef::Config.repo_mode = 'everything' Chef::Config.chef_repo_path = chef_repo_path Chef::Config.versioned_cookbooks = true chef_fs = Chef::ChefFS::Config.new.local_fs data_store = Chef::ChefFS::ChefFSDataStore.new(chef_fs) server = ChefZero::Server.new(:port => 8889, :single_org => false, :data_store => data_store)#, :log_level => :debug) server.start_background server end tmpdir = nil begin if ENV['FILE_STORE'] require 'tmpdir' require 'chef_zero/data_store/raw_file_store' tmpdir = Dir.mktmpdir data_store = ChefZero::DataStore::RawFileStore.new(tmpdir, true) data_store = ChefZero::DataStore::DefaultFacade.new(data_store, false, false) server = ChefZero::Server.new(:port => 8889, :single_org => false, :data_store => data_store) server.start_background elsif ENV['CHEF_FS'] require 'tmpdir' tmpdir = Dir.mktmpdir start_server(tmpdir) else server = ChefZero::Server.new(:port => 8889, :single_org => false)#, :log_level => :debug) server.start_background end require 'rspec/core' require 'pedant' require 'pedant/organization' # Pedant::Config.rerun = true Pedant.config.suite = 'api' Pedant.config.internal_server = Pedant::Config.search_server = 'http://localhost:8889' # see dummy_endpoint.rb. Pedant.config.search_commit_url = "/dummy" Pedant::Config.search_url_fmt = "/dummy?fq=+X_CHEF_type_CHEF_X:%{type}&q=%{query}&wt=json" Pedant.config[:config_file] = 'spec/support/oc_pedant.rb' Pedant.config[:server_api_version] = 0 # "the goal is that only authorization, authentication and validation tests are turned off" - @jkeiser Pedant.setup([ '--skip-knife', '--skip-keys', '--skip-controls', '--skip-acl', '--skip-validation', '--skip-authentication', '--skip-authorization', '--skip-omnibus', '--skip-usags', '--exclude-internal-orgs', '--skip-headers', # Chef 12 features not yet 100% supported by Chef Zero '--skip-cookbook-artifacts', '--skip-containers', '--skip-api-v1' ]) result = RSpec::Core::Runner.run(Pedant.config.rspec_args) server.stop if server.running? ensure FileUtils.remove_entry_secure(tmpdir) if tmpdir end exit(result) Convert ChefFS data to use DefaultFacade. #!/usr/bin/env ruby require 'bundler' require 'bundler/setup' require 'chef_zero/server' require 'rspec/core' def start_server(chef_repo_path) require 'chef/version' require 'chef/config' require 'chef/chef_fs/config' require 'chef/chef_fs/chef_fs_data_store' require 'chef_zero/server' Dir.mkdir(chef_repo_path) if !File.exists?(chef_repo_path) # 11.6 and below had a bug where it couldn't create the repo children automatically if Chef::VERSION.to_f < 11.8 %w(clients cookbooks data_bags environments nodes roles users).each do |child| Dir.mkdir("#{chef_repo_path}/#{child}") if !File.exists?("#{chef_repo_path}/#{child}") end end # Start the new server Chef::Config.repo_mode = 'everything' Chef::Config.chef_repo_path = chef_repo_path Chef::Config.versioned_cookbooks = true chef_fs = Chef::ChefFS::Config.new.local_fs data_store = Chef::ChefFS::ChefFSDataStore.new(chef_fs) data_store = ChefZero::DataStore::V1ToV2Adapter.new(data_store, 'pedant-testorg') data_store = ChefZero::DataStore::DefaultFacade.new(data_store, 'pedant-testorg', false) server = ChefZero::Server.new( port: 8889, data_store: data_store, single_org: false, #log_level: :debug ) server.start_background server end tmpdir = nil begin if ENV['FILE_STORE'] require 'tmpdir' require 'chef_zero/data_store/raw_file_store' tmpdir = Dir.mktmpdir data_store = ChefZero::DataStore::RawFileStore.new(tmpdir, true) data_store = ChefZero::DataStore::DefaultFacade.new(data_store, false, false) server = ChefZero::Server.new(:port => 8889, :single_org => false, :data_store => data_store) server.start_background elsif ENV['CHEF_FS'] require 'tmpdir' tmpdir = Dir.mktmpdir start_server(tmpdir) else server = ChefZero::Server.new(:port => 8889, :single_org => false)#, :log_level => :debug) server.start_background end require 'rspec/core' require 'pedant' require 'pedant/organization' # Pedant::Config.rerun = true Pedant.config.suite = 'api' Pedant.config.internal_server = Pedant::Config.search_server = 'http://localhost:8889' # see dummy_endpoint.rb. Pedant.config.search_commit_url = "/dummy" Pedant::Config.search_url_fmt = "/dummy?fq=+X_CHEF_type_CHEF_X:%{type}&q=%{query}&wt=json" Pedant.config[:config_file] = 'spec/support/oc_pedant.rb' Pedant.config[:server_api_version] = 0 # "the goal is that only authorization, authentication and validation tests are turned off" - @jkeiser Pedant.setup([ '--skip-knife', '--skip-keys', '--skip-controls', '--skip-acl', '--skip-validation', '--skip-authentication', '--skip-authorization', '--skip-omnibus', '--skip-usags', '--exclude-internal-orgs', '--skip-headers', # Chef 12 features not yet 100% supported by Chef Zero '--skip-cookbook-artifacts', '--skip-containers', '--skip-api-v1' ]) result = RSpec::Core::Runner.run(Pedant.config.rspec_args) server.stop if server.running? ensure FileUtils.remove_entry_secure(tmpdir) if tmpdir end exit(result)
#!/usr/bin/env ruby require 'bundler' require 'bundler/setup' require 'chef_zero/server' require 'rspec/core' def start_cheffs_server(chef_repo_path) require 'chef/version' require 'chef/config' require 'chef/chef_fs/config' require 'chef/chef_fs/chef_fs_data_store' require 'chef_zero/server' Dir.mkdir(chef_repo_path) if !File.exists?(chef_repo_path) # 11.6 and below had a bug where it couldn't create the repo children automatically if Chef::VERSION.to_f < 11.8 %w(clients cookbooks data_bags environments nodes roles users).each do |child| Dir.mkdir("#{chef_repo_path}/#{child}") if !File.exists?("#{chef_repo_path}/#{child}") end end # Start the new server Chef::Config.repo_mode = 'hosted_everything' Chef::Config.chef_repo_path = chef_repo_path Chef::Config.versioned_cookbooks = true chef_fs_config = Chef::ChefFS::Config.new data_store = Chef::ChefFS::ChefFSDataStore.new(chef_fs_config.local_fs, chef_fs_config.chef_config) data_store = ChefZero::DataStore::V1ToV2Adapter.new(data_store, 'pedant-testorg') data_store = ChefZero::DataStore::DefaultFacade.new(data_store, 'pedant-testorg', false) data_store.create(%w(organizations pedant-testorg users), 'pivotal', '{}') data_store.set(%w(organizations pedant-testorg groups admins), '{ "users": [ "pivotal" ] }') data_store.set(%w(organizations pedant-testorg groups users), '{ "users": [ "pivotal" ] }') server = ChefZero::Server.new( port: 8889, data_store: data_store, single_org: false, #log_level: :debug ) server.start_background server end tmpdir = nil begin if ENV['FILE_STORE'] require 'tmpdir' require 'chef_zero/data_store/raw_file_store' tmpdir = Dir.mktmpdir data_store = ChefZero::DataStore::RawFileStore.new(tmpdir, true) data_store = ChefZero::DataStore::DefaultFacade.new(data_store, false, false) server = ChefZero::Server.new(:port => 8889, :single_org => false, :data_store => data_store) server.start_background elsif ENV['CHEF_FS'] require 'tmpdir' tmpdir = Dir.mktmpdir server = start_cheffs_server(tmpdir) else server = ChefZero::Server.new(:port => 8889, :single_org => false)#, :log_level => :debug) server.start_background end require 'rspec/core' require 'pedant' require 'pedant/organization' # Pedant::Config.rerun = true Pedant.config.suite = 'api' Pedant.config[:config_file] = 'spec/support/oc_pedant.rb' # Because ChefFS can only ever have one user (pivotal), we can't do most of the # tests that involve multiple chef_fs_skips = if ENV['CHEF_FS'] [ '--skip-association', '--skip-users', '--skip-organizations', '--skip-multiuser', # chef-zero has some non-removable quirks, such as the fact that files # with 255-character names cannot be stored in local mode. This is # reserved only for quirks that are *irrevocable* and by design; and # should barely be used at all. '--skip-chef-zero-quirks', ] else [] end # These things aren't supported by Chef Zero in any mode of operation: default_skips = [ # "the goal is that only authorization, authentication and validation tests # are turned off" - @jkeiser # # ...but we're not there yet '--skip-keys', # Chef Zero does not intend to support validation the way erchef does. '--skip-validation', # Chef Zero does not intend to support authentication the way erchef does. '--skip-authentication', # Chef Zero does not intend to support authorization the way erchef does. '--skip-authorization', # Omnibus tests depend on erchef features that are specific to erchef and # bundled in the omnibus package. Currently the only test in this category # is for the search reindexing script. '--skip-omnibus', # USAGs (user-specific association groups) are Authz groups that contain # only one user and represent that user's association with an org. Though # there are good reasons for them, they don't work well in practice and # only the manage console really uses them. Since Chef Zero + Manage is a # quite unusual configuration, we're ignoring them. '--skip-usags', # Chef 12 features not yet 100% supported by Chef Zero '--skip-api-v1', # The universe endpoint is unlikely to ever make sense for Chef Zero '--skip-universe', ] # The knife tests are very slow and don't give us a lot of extra coverage, # so we run them in a different entry in the travis test matrix. pedant_args = if ENV["PEDANT_KNIFE_TESTS"] default_skips + %w{ --focus-knife } else default_skips + chef_fs_skips + %w{ --skip-knife } end Pedant.setup(pedant_args) fail_fast = [] # fail_fast = ["--fail-fast"] result = RSpec::Core::Runner.run(Pedant.config.rspec_args + fail_fast) server.stop if server.running? ensure FileUtils.remove_entry_secure(tmpdir) if tmpdir end exit(result) Move skip-acl to ChefFS #!/usr/bin/env ruby require 'bundler' require 'bundler/setup' require 'chef_zero/server' require 'rspec/core' def start_cheffs_server(chef_repo_path) require 'chef/version' require 'chef/config' require 'chef/chef_fs/config' require 'chef/chef_fs/chef_fs_data_store' require 'chef_zero/server' Dir.mkdir(chef_repo_path) if !File.exists?(chef_repo_path) # 11.6 and below had a bug where it couldn't create the repo children automatically if Chef::VERSION.to_f < 11.8 %w(clients cookbooks data_bags environments nodes roles users).each do |child| Dir.mkdir("#{chef_repo_path}/#{child}") if !File.exists?("#{chef_repo_path}/#{child}") end end # Start the new server Chef::Config.repo_mode = 'hosted_everything' Chef::Config.chef_repo_path = chef_repo_path Chef::Config.versioned_cookbooks = true chef_fs_config = Chef::ChefFS::Config.new data_store = Chef::ChefFS::ChefFSDataStore.new(chef_fs_config.local_fs, chef_fs_config.chef_config) data_store = ChefZero::DataStore::V1ToV2Adapter.new(data_store, 'pedant-testorg') data_store = ChefZero::DataStore::DefaultFacade.new(data_store, 'pedant-testorg', false) data_store.create(%w(organizations pedant-testorg users), 'pivotal', '{}') data_store.set(%w(organizations pedant-testorg groups admins), '{ "users": [ "pivotal" ] }') data_store.set(%w(organizations pedant-testorg groups users), '{ "users": [ "pivotal" ] }') server = ChefZero::Server.new( port: 8889, data_store: data_store, single_org: false, #log_level: :debug ) server.start_background server end tmpdir = nil begin if ENV['FILE_STORE'] require 'tmpdir' require 'chef_zero/data_store/raw_file_store' tmpdir = Dir.mktmpdir data_store = ChefZero::DataStore::RawFileStore.new(tmpdir, true) data_store = ChefZero::DataStore::DefaultFacade.new(data_store, false, false) server = ChefZero::Server.new(:port => 8889, :single_org => false, :data_store => data_store) server.start_background elsif ENV['CHEF_FS'] require 'tmpdir' tmpdir = Dir.mktmpdir server = start_cheffs_server(tmpdir) else server = ChefZero::Server.new(:port => 8889, :single_org => false)#, :log_level => :debug) server.start_background end require 'rspec/core' require 'pedant' require 'pedant/organization' # Pedant::Config.rerun = true Pedant.config.suite = 'api' Pedant.config[:config_file] = 'spec/support/oc_pedant.rb' # Because ChefFS can only ever have one user (pivotal), we can't do most of the # tests that involve multiple chef_fs_skips = if ENV['CHEF_FS'] [ '--skip-association', '--skip-users', '--skip-organizations', '--skip-multiuser', '--skip-acl', # chef-zero has some non-removable quirks, such as the fact that files # with 255-character names cannot be stored in local mode. This is # reserved only for quirks that are *irrevocable* and by design; and # should barely be used at all. '--skip-chef-zero-quirks', ] else [] end # These things aren't supported by Chef Zero in any mode of operation: default_skips = [ # "the goal is that only authorization, authentication and validation tests # are turned off" - @jkeiser # # ...but we're not there yet '--skip-keys', # Chef Zero does not intend to support validation the way erchef does. '--skip-validation', # Chef Zero does not intend to support authentication the way erchef does. '--skip-authentication', # Chef Zero does not intend to support authorization the way erchef does. '--skip-authorization', # Omnibus tests depend on erchef features that are specific to erchef and # bundled in the omnibus package. Currently the only test in this category # is for the search reindexing script. '--skip-omnibus', # USAGs (user-specific association groups) are Authz groups that contain # only one user and represent that user's association with an org. Though # there are good reasons for them, they don't work well in practice and # only the manage console really uses them. Since Chef Zero + Manage is a # quite unusual configuration, we're ignoring them. '--skip-usags', # Chef 12 features not yet 100% supported by Chef Zero '--skip-api-v1', # The universe endpoint is unlikely to ever make sense for Chef Zero '--skip-universe', ] # The knife tests are very slow and don't give us a lot of extra coverage, # so we run them in a different entry in the travis test matrix. pedant_args = if ENV["PEDANT_KNIFE_TESTS"] default_skips + %w{ --focus-knife } else default_skips + chef_fs_skips + %w{ --skip-knife } end Pedant.setup(pedant_args) # fail_fast = ["--fail-fast"] result = RSpec::Core::Runner.run(Pedant.config.rspec_args + fail_fast) server.stop if server.running? ensure FileUtils.remove_entry_secure(tmpdir) if tmpdir end exit(result)
# frozen_string_literal: true require 'spec_helper' RSpec.describe Capybara do describe 'Selectors' do let :string do described_class.string <<-STRING <html> <head> <title>selectors</title> </head> <body> <div class="aa" id="page"> <div class="bb" id="content"> <h1 class="aa">Totally awesome</h1> <p>Yes it is</p> </div> <p class="bb cc">Some Content</p> <p class="bb dd !mine"></p> </div> <div id="#special"> </div> <div class="some random words" id="random_words"> Something </div> <input id="2checkbox" class="2checkbox" type="checkbox"/> <input type="radio"/> <label for="my_text_input">My Text Input</label> <input type="text" name="form[my_text_input]" placeholder="my text" id="my_text_input"/> <input type="file" id="file" class=".special file"/> <input type="hidden" id="hidden_field" value="this is hidden"/> <input type="submit" value="click me" title="submit button"/> <input type="button" value="don't click me" title="Other button 1" style="line-height: 30px;"/> <a href="#">link</a> <fieldset></fieldset> <select id="select"> <option value="a">A</option> <option value="b" disabled>B</option> <option value="c" selected>C</option> </select> <table> <tr><td></td></tr> </table> <table id="rows"> <tr> <td>A</td><td>B</td><td>C</td> </tr> <tr> <td>D</td><td>E</td><td>F</td> </tr> </table> <table id="cols"> <tbody> <tr> <td>A</td><td>D</td> </tr> <tr> <td>B</td><td>E</td> </tr> <tr> <td>C</td><td>F</td> </tr> </tbody> </table> </body> </html> STRING end before do described_class.add_selector :custom_selector do css { |css_class| "div.#{css_class}" } node_filter(:not_empty, boolean: true, default: true, skip_if: :all) { |node, value| value ^ (node.text == '') } end described_class.add_selector :custom_css_selector do css(:name, :other_name) do |selector, name: nil, **| selector ||= '' selector += "[name='#{name}']" if name selector end expression_filter(:placeholder) do |expr, val| expr + "[placeholder='#{val}']" end expression_filter(:value) do |expr, val| expr + "[value='#{val}']" end expression_filter(:title) do |expr, val| expr + "[title='#{val}']" end end described_class.add_selector :custom_xpath_selector do xpath(:valid1, :valid2) { |selector| selector } match { |value| value == 'match_me' } end end it 'supports `filter` as an alias for `node_filter`' do expect do described_class.add_selector :filter_alias_selector do css { |_unused| 'div' } filter(:something) { |_node, _value| true } end end.not_to raise_error end describe 'adding a selector' do it 'can set default visiblity' do described_class.add_selector :hidden_field do visible :hidden css { |_sel| 'input[type="hidden"]' } end expect(string).to have_no_css('input[type="hidden"]') expect(string).to have_selector(:hidden_field) end end describe 'modify_selector' do it 'allows modifying a selector' do el = string.find(:custom_selector, 'aa') expect(el.tag_name).to eq 'div' described_class.modify_selector :custom_selector do css { |css_class| "h1.#{css_class}" } end el = string.find(:custom_selector, 'aa') expect(el.tag_name).to eq 'h1' end it "doesn't change existing filters" do described_class.modify_selector :custom_selector do css { |css_class| "p.#{css_class}" } end expect(string).to have_selector(:custom_selector, 'bb', count: 1) expect(string).to have_selector(:custom_selector, 'bb', not_empty: false, count: 1) expect(string).to have_selector(:custom_selector, 'bb', not_empty: :all, count: 2) end end describe '::[]' do it 'can find a selector' do expect(Capybara::Selector[:field]).not_to be_nil end it 'raises if no selector found' do expect { Capybara::Selector[:no_exist] }.to raise_error(ArgumentError, /Unknown selector type/) end end describe '::for' do it 'finds selector that matches the locator' do expect(Capybara::Selector.for('match_me').name).to eq :custom_xpath_selector end it 'returns nil if no match' do expect(Capybara::Selector.for('nothing')).to be nil end end describe 'xpath' do it 'uses filter names passed in' do described_class.add_selector :test do xpath(:something, :other) { |_locator| XPath.descendant } end selector = Capybara::Selector.new :test, config: nil, format: nil expect(selector.expression_filters.keys).to include(:something, :other) end it 'gets filter names from block if none passed to xpath method' do described_class.add_selector :test do xpath { |_locator, valid3:, valid4: nil| "#{valid3} #{valid4}" } end selector = Capybara::Selector.new :test, config: nil, format: nil expect(selector.expression_filters.keys).to include(:valid3, :valid4) end it 'ignores block parameters if names passed in' do described_class.add_selector :test do xpath(:valid1) { |_locator, valid3:, valid4: nil| "#{valid3} #{valid4}" } end selector = Capybara::Selector.new :test, config: nil, format: nil expect(selector.expression_filters.keys).to include(:valid1) expect(selector.expression_filters.keys).not_to include(:valid3, :valid4) end end describe 'css' do it "supports filters specified in 'css' definition" do expect(string).to have_selector(:custom_css_selector, 'input', name: 'form[my_text_input]') expect(string).to have_no_selector(:custom_css_selector, 'input', name: 'form[not_my_text_input]') end it 'supports explicitly defined expression filters' do expect(string).to have_selector(:custom_css_selector, placeholder: 'my text') expect(string).to have_no_selector(:custom_css_selector, placeholder: 'not my text') expect(string).to have_selector(:custom_css_selector, value: 'click me', title: 'submit button') end it 'uses filter names passed in' do described_class.add_selector :test do css(:name, :other_name) { |_locator| '' } end selector = Capybara::Selector.new :test, config: nil, format: nil expect(selector.expression_filters.keys).to include(:name, :other_name) end it 'gets filter names from block if none passed to css method' do described_class.add_selector :test do css { |_locator, valid3:, valid4: nil| "#{valid3} #{valid4}" } end selector = Capybara::Selector.new :test, config: nil, format: nil expect(selector.expression_filters.keys).to include(:valid3, :valid4) end it 'ignores block parameters if names passed in' do described_class.add_selector :test do css(:valid1) { |_locator, valid3:, valid4: nil| "#{valid3} #{valid4}" } end selector = Capybara::Selector.new :test, config: nil, format: nil expect(selector.expression_filters.keys).to include(:valid1) expect(selector.expression_filters.keys).not_to include(:valid3, :valid4) end end describe 'builtin selectors' do context 'when locator is nil' do it 'devolves to just finding element types' do selectors = { field: ".//*[self::input | self::textarea | self::select][not(./@type = 'submit' or ./@type = 'image' or ./@type = 'hidden')]", fieldset: './/fieldset', link: './/a[./@href]', link_or_button: ".//a[./@href] | .//input[./@type = 'submit' or ./@type = 'reset' or ./@type = 'image' or ./@type = 'button'] | .//button", fillable_field: ".//*[self::input | self::textarea][not(./@type = 'submit' or ./@type = 'image' or ./@type = 'radio' or ./@type = 'checkbox' or ./@type = 'hidden' or ./@type = 'file')]", radio_button: ".//input[./@type = 'radio']", checkbox: ".//input[./@type = 'checkbox']", select: './/select', option: './/option', file_field: ".//input[./@type = 'file']", table: './/table' } selectors.each do |selector, xpath| results = string.all(selector, nil).to_a.map(&:native) expect(results.size).to be > 0 expect(results).to eq string.all(:xpath, xpath).to_a.map(&:native) end end end context 'with :id option' do it 'works with compound css selectors' do expect(string.all(:custom_css_selector, 'div, h1', id: 'page').size).to eq 1 expect(string.all(:custom_css_selector, 'h1, div', id: 'page').size).to eq 1 end it "works with 'special' characters" do expect(string.find(:custom_css_selector, 'div', id: '#special')[:id]).to eq '#special' expect(string.find(:custom_css_selector, 'input', id: '2checkbox')[:id]).to eq '2checkbox' end it 'accepts XPath expression for xpath based selectors' do expect(string.find(:custom_xpath_selector, './/div', id: XPath.contains('peci'))[:id]).to eq '#special' expect(string.find(:custom_xpath_selector, './/input', id: XPath.ends_with('box'))[:id]).to eq '2checkbox' end it 'errors XPath expression for CSS based selectors' do expect { string.find(:custom_css_selector, 'div', id: XPath.contains('peci')) } .to raise_error(ArgumentError, /not supported/) end it 'accepts Regexp for xpath based selectors' do expect(string.find(:custom_xpath_selector, './/div', id: /peci/)[:id]).to eq '#special' expect(string.find(:custom_xpath_selector, './/div', id: /pEcI/i)[:id]).to eq '#special' end it 'accepts Regexp for css based selectors' do expect(string.find(:custom_css_selector, 'div', id: /sp.*al/)[:id]).to eq '#special' end end context 'with :class option' do it 'works with compound css selectors' do expect(string.all(:custom_css_selector, 'div, h1', class: 'aa').size).to eq 2 expect(string.all(:custom_css_selector, 'h1, div', class: 'aa').size).to eq 2 end it 'handles negated classes' do expect(string.all(:custom_css_selector, 'div, p', class: ['bb', '!cc']).size).to eq 2 expect(string.all(:custom_css_selector, 'div, p', class: ['!cc', '!dd', 'bb']).size).to eq 1 expect(string.all(:custom_xpath_selector, XPath.descendant(:div, :p), class: ['bb', '!cc']).size).to eq 2 expect(string.all(:custom_xpath_selector, XPath.descendant(:div, :p), class: ['!cc', '!dd', 'bb']).size).to eq 1 end it 'handles classes starting with ! by requiring negated negated first' do expect(string.all(:custom_css_selector, 'div, p', class: ['!!!mine']).size).to eq 1 expect(string.all(:custom_xpath_selector, XPath.descendant(:div, :p), class: ['!!!mine']).size).to eq 1 end it "works with 'special' characters" do expect(string.find(:custom_css_selector, 'input', class: '.special')[:id]).to eq 'file' expect(string.find(:custom_css_selector, 'input', class: '2checkbox')[:id]).to eq '2checkbox' end it 'accepts XPath expression for xpath based selectors' do expect(string.find(:custom_xpath_selector, './/div', class: XPath.contains('dom wor'))[:id]).to eq 'random_words' expect(string.find(:custom_xpath_selector, './/div', class: XPath.ends_with('words'))[:id]).to eq 'random_words' end it 'errors XPath expression for CSS based selectors' do expect { string.find(:custom_css_selector, 'div', class: XPath.contains('random')) } .to raise_error(ArgumentError, /not supported/) end it 'accepts Regexp for XPath based selectors' do expect(string.find(:custom_xpath_selector, './/div', class: /dom wor/)[:id]).to eq 'random_words' expect(string.find(:custom_xpath_selector, './/div', class: /dOm WoR/i)[:id]).to eq 'random_words' end it 'accepts Regexp for CSS base selectors' do expect(string.find(:custom_css_selector, 'div', class: /random/)[:id]).to eq 'random_words' end end context 'with :style option' do it 'accepts string for CSS based selectors' do expect(string.find(:custom_css_selector, 'input', style: 'line-height: 30px;')[:title]).to eq 'Other button 1' end it 'accepts Regexp for CSS base selectors' do expect(string.find(:custom_css_selector, 'input', style: /30px/)[:title]).to eq 'Other button 1' end end # :css, :xpath, :id, :field, :fieldset, :link, :button, :link_or_button, :fillable_field, :radio_button, :checkbox, :select, # :option, :file_field, :label, :table, :frame describe ':css selector' do it 'finds by CSS locator' do expect(string.find(:css, 'input#my_text_input')[:name]).to eq 'form[my_text_input]' end end describe ':xpath selector' do it 'finds by XPath locator' do expect(string.find(:xpath, './/input[@id="my_text_input"]')[:name]).to eq 'form[my_text_input]' end end describe ':id selector' do it 'finds by locator' do expect(string.find(:id, 'my_text_input')[:name]).to eq 'form[my_text_input]' expect(string.find(:id, /my_text_input/)[:name]).to eq 'form[my_text_input]' expect(string.find(:id, /_text_/)[:name]).to eq 'form[my_text_input]' expect(string.find(:id, /i[nmo]/)[:name]).to eq 'form[my_text_input]' end end describe ':field selector' do it 'finds by locator' do expect(string.find(:field, 'My Text Input')[:id]).to eq 'my_text_input' expect(string.find(:field, 'my_text_input')[:id]).to eq 'my_text_input' expect(string.find(:field, 'form[my_text_input]')[:id]).to eq 'my_text_input' end it 'finds by id string' do expect(string.find(:field, id: 'my_text_input')[:name]).to eq 'form[my_text_input]' end it 'finds by id regexp' do expect(string.find(:field, id: /my_text_inp/)[:name]).to eq 'form[my_text_input]' end it 'finds by name' do expect(string.find(:field, name: 'form[my_text_input]')[:id]).to eq 'my_text_input' end it 'finds by placeholder' do expect(string.find(:field, placeholder: 'my text')[:id]).to eq 'my_text_input' end it 'finds by type' do expect(string.find(:field, type: 'file')[:id]).to eq 'file' expect(string.find(:field, type: 'select')[:id]).to eq 'select' end end describe ':option selector' do it 'finds disabled options' do expect(string.find(:option, disabled: true).value).to eq 'b' end it 'finds selected options' do expect(string.find(:option, selected: true).value).to eq 'c' end it 'finds not selected and not disabled options' do expect(string.find(:option, disabled: false, selected: false).value).to eq 'a' end end describe ':button selector' do it 'finds by value' do expect(string.find(:button, 'click me').value).to eq 'click me' end it 'finds by title' do expect(string.find(:button, 'submit button').value).to eq 'click me' end it 'includes non-matching parameters in failure message' do expect { string.find(:button, 'click me', title: 'click me') }.to raise_error(/with title click me/) end end describe ':element selector' do it 'finds by any attributes' do expect(string.find(:element, 'input', type: 'submit').value).to eq 'click me' end it 'supports regexp matching' do expect(string.find(:element, 'input', type: /sub/).value).to eq 'click me' expect(string.find(:element, 'input', title: /sub\w.*button/).value).to eq 'click me' expect(string.find(:element, 'input', title: /sub.* b.*ton/).value).to eq 'click me' expect(string.find(:element, 'input', title: /sub.*mit.*/).value).to eq 'click me' expect(string.find(:element, 'input', title: /^submit button$/).value).to eq 'click me' expect(string.find(:element, 'input', title: /^(?:submit|other) button$/).value).to eq 'click me' expect(string.find(:element, 'input', title: /SuB.*mIt/i).value).to eq 'click me' expect(string.find(:element, 'input', title: /^Su.*Bm.*It/i).value).to eq 'click me' expect(string.find(:element, 'input', title: /^Ot.*he.*r b.*\d/i).value).to eq "don't click me" end it 'still works with system keys' do expect { string.all(:element, 'input', type: 'submit', count: 1) }.not_to raise_error end it 'works without element type' do expect(string.find(:element, type: 'submit').value).to eq 'click me' end it 'validates attribute presence when true' do expect(string.find(:element, name: true)[:id]).to eq 'my_text_input' end it 'validates attribute absence when false' do expect(string.find(:element, 'option', disabled: false, selected: false).value).to eq 'a' end it 'includes wildcarded keys in description' do expect { string.find(:element, 'input', not_there: 'bad', presence: true, absence: false, count: 1) } .to(raise_error do |e| expect(e).to be_a(Capybara::ElementNotFound) expect(e.message).to include 'not_there => bad' expect(e.message).to include 'with presence attribute' expect(e.message).to include 'without absence attribute' expect(e.message).not_to include 'count 1' end) end it 'accepts XPath::Expression' do expect(string.find(:element, 'input', type: XPath.starts_with('subm')).value).to eq 'click me' expect(string.find(:element, 'input', type: XPath.ends_with('ext'))[:type]).to eq 'text' expect(string.find(:element, 'input', type: XPath.contains('ckb'))[:type]).to eq 'checkbox' expect(string.find(:element, 'input', title: XPath.contains_word('submit'))[:type]).to eq 'submit' expect(string.find(:element, 'input', title: XPath.contains_word('button 1'))[:type]).to eq 'button' end end describe ':link_or_button selector' do around(:all) do |example| described_class.modify_selector(:link_or_button) do expression_filter(:random) { |xpath, _| xpath } # do nothing filter end example.run Capybara::Selector[:link_or_button].expression_filters.delete(:random) end it 'should not find links when disabled == true' do expect(string.all(:link_or_button, disabled: true).size).to eq 0 end context 'when modified' do it 'should still work' do filter = Capybara::Selector[:link_or_button].expression_filters[:random] allow(filter).to receive(:apply_filter).and_call_original expect(string.find(:link_or_button, 'click me', random: 'blah').value).to eq 'click me' expect(filter).to have_received(:apply_filter).with(anything, :random, 'blah', anything) end end end describe ':table selector' do it 'finds by rows' do expect(string.find(:table, with_rows: [%w[D E F]])[:id]).to eq 'rows' end it 'finds by columns' do expect(string.find(:table, with_cols: [%w[A B C]])[:id]).to eq 'cols' end end end end end Fix RSpec warning # frozen_string_literal: true require 'spec_helper' RSpec.describe Capybara do describe 'Selectors' do let :string do described_class.string <<-STRING <html> <head> <title>selectors</title> </head> <body> <div class="aa" id="page"> <div class="bb" id="content"> <h1 class="aa">Totally awesome</h1> <p>Yes it is</p> </div> <p class="bb cc">Some Content</p> <p class="bb dd !mine"></p> </div> <div id="#special"> </div> <div class="some random words" id="random_words"> Something </div> <input id="2checkbox" class="2checkbox" type="checkbox"/> <input type="radio"/> <label for="my_text_input">My Text Input</label> <input type="text" name="form[my_text_input]" placeholder="my text" id="my_text_input"/> <input type="file" id="file" class=".special file"/> <input type="hidden" id="hidden_field" value="this is hidden"/> <input type="submit" value="click me" title="submit button"/> <input type="button" value="don't click me" title="Other button 1" style="line-height: 30px;"/> <a href="#">link</a> <fieldset></fieldset> <select id="select"> <option value="a">A</option> <option value="b" disabled>B</option> <option value="c" selected>C</option> </select> <table> <tr><td></td></tr> </table> <table id="rows"> <tr> <td>A</td><td>B</td><td>C</td> </tr> <tr> <td>D</td><td>E</td><td>F</td> </tr> </table> <table id="cols"> <tbody> <tr> <td>A</td><td>D</td> </tr> <tr> <td>B</td><td>E</td> </tr> <tr> <td>C</td><td>F</td> </tr> </tbody> </table> </body> </html> STRING end before do described_class.add_selector :custom_selector do css { |css_class| "div.#{css_class}" } node_filter(:not_empty, boolean: true, default: true, skip_if: :all) { |node, value| value ^ (node.text == '') } end described_class.add_selector :custom_css_selector do css(:name, :other_name) do |selector, name: nil, **| selector ||= '' selector += "[name='#{name}']" if name selector end expression_filter(:placeholder) do |expr, val| expr + "[placeholder='#{val}']" end expression_filter(:value) do |expr, val| expr + "[value='#{val}']" end expression_filter(:title) do |expr, val| expr + "[title='#{val}']" end end described_class.add_selector :custom_xpath_selector do xpath(:valid1, :valid2) { |selector| selector } match { |value| value == 'match_me' } end end it 'supports `filter` as an alias for `node_filter`' do expect do described_class.add_selector :filter_alias_selector do css { |_unused| 'div' } filter(:something) { |_node, _value| true } end end.not_to raise_error end describe 'adding a selector' do it 'can set default visiblity' do described_class.add_selector :hidden_field do visible :hidden css { |_sel| 'input[type="hidden"]' } end expect(string).to have_no_css('input[type="hidden"]') expect(string).to have_selector(:hidden_field) end end describe 'modify_selector' do it 'allows modifying a selector' do el = string.find(:custom_selector, 'aa') expect(el.tag_name).to eq 'div' described_class.modify_selector :custom_selector do css { |css_class| "h1.#{css_class}" } end el = string.find(:custom_selector, 'aa') expect(el.tag_name).to eq 'h1' end it "doesn't change existing filters" do described_class.modify_selector :custom_selector do css { |css_class| "p.#{css_class}" } end expect(string).to have_selector(:custom_selector, 'bb', count: 1) expect(string).to have_selector(:custom_selector, 'bb', not_empty: false, count: 1) expect(string).to have_selector(:custom_selector, 'bb', not_empty: :all, count: 2) end end describe '::[]' do it 'can find a selector' do expect(Capybara::Selector[:field]).not_to be_nil end it 'raises if no selector found' do expect { Capybara::Selector[:no_exist] }.to raise_error(ArgumentError, /Unknown selector type/) end end describe '::for' do it 'finds selector that matches the locator' do expect(Capybara::Selector.for('match_me').name).to eq :custom_xpath_selector end it 'returns nil if no match' do expect(Capybara::Selector.for('nothing')).to be nil end end describe 'xpath' do it 'uses filter names passed in' do described_class.add_selector :test do xpath(:something, :other) { |_locator| XPath.descendant } end selector = Capybara::Selector.new :test, config: nil, format: nil expect(selector.expression_filters.keys).to include(:something, :other) end it 'gets filter names from block if none passed to xpath method' do described_class.add_selector :test do xpath { |_locator, valid3:, valid4: nil| "#{valid3} #{valid4}" } end selector = Capybara::Selector.new :test, config: nil, format: nil expect(selector.expression_filters.keys).to include(:valid3, :valid4) end it 'ignores block parameters if names passed in' do described_class.add_selector :test do xpath(:valid1) { |_locator, valid3:, valid4: nil| "#{valid3} #{valid4}" } end selector = Capybara::Selector.new :test, config: nil, format: nil expect(selector.expression_filters.keys).to include(:valid1) expect(selector.expression_filters.keys).not_to include(:valid3, :valid4) end end describe 'css' do it "supports filters specified in 'css' definition" do expect(string).to have_selector(:custom_css_selector, 'input', name: 'form[my_text_input]') expect(string).to have_no_selector(:custom_css_selector, 'input', name: 'form[not_my_text_input]') end it 'supports explicitly defined expression filters' do expect(string).to have_selector(:custom_css_selector, placeholder: 'my text') expect(string).to have_no_selector(:custom_css_selector, placeholder: 'not my text') expect(string).to have_selector(:custom_css_selector, value: 'click me', title: 'submit button') end it 'uses filter names passed in' do described_class.add_selector :test do css(:name, :other_name) { |_locator| '' } end selector = Capybara::Selector.new :test, config: nil, format: nil expect(selector.expression_filters.keys).to include(:name, :other_name) end it 'gets filter names from block if none passed to css method' do described_class.add_selector :test do css { |_locator, valid3:, valid4: nil| "#{valid3} #{valid4}" } end selector = Capybara::Selector.new :test, config: nil, format: nil expect(selector.expression_filters.keys).to include(:valid3, :valid4) end it 'ignores block parameters if names passed in' do described_class.add_selector :test do css(:valid1) { |_locator, valid3:, valid4: nil| "#{valid3} #{valid4}" } end selector = Capybara::Selector.new :test, config: nil, format: nil expect(selector.expression_filters.keys).to include(:valid1) expect(selector.expression_filters.keys).not_to include(:valid3, :valid4) end end describe 'builtin selectors' do context 'when locator is nil' do it 'devolves to just finding element types' do selectors = { field: ".//*[self::input | self::textarea | self::select][not(./@type = 'submit' or ./@type = 'image' or ./@type = 'hidden')]", fieldset: './/fieldset', link: './/a[./@href]', link_or_button: ".//a[./@href] | .//input[./@type = 'submit' or ./@type = 'reset' or ./@type = 'image' or ./@type = 'button'] | .//button", fillable_field: ".//*[self::input | self::textarea][not(./@type = 'submit' or ./@type = 'image' or ./@type = 'radio' or ./@type = 'checkbox' or ./@type = 'hidden' or ./@type = 'file')]", radio_button: ".//input[./@type = 'radio']", checkbox: ".//input[./@type = 'checkbox']", select: './/select', option: './/option', file_field: ".//input[./@type = 'file']", table: './/table' } selectors.each do |selector, xpath| results = string.all(selector, nil).to_a.map(&:native) expect(results.size).to be > 0 expect(results).to eq string.all(:xpath, xpath).to_a.map(&:native) end end end context 'with :id option' do it 'works with compound css selectors' do expect(string.all(:custom_css_selector, 'div, h1', id: 'page').size).to eq 1 expect(string.all(:custom_css_selector, 'h1, div', id: 'page').size).to eq 1 end it "works with 'special' characters" do expect(string.find(:custom_css_selector, 'div', id: '#special')[:id]).to eq '#special' expect(string.find(:custom_css_selector, 'input', id: '2checkbox')[:id]).to eq '2checkbox' end it 'accepts XPath expression for xpath based selectors' do expect(string.find(:custom_xpath_selector, './/div', id: XPath.contains('peci'))[:id]).to eq '#special' expect(string.find(:custom_xpath_selector, './/input', id: XPath.ends_with('box'))[:id]).to eq '2checkbox' end it 'errors XPath expression for CSS based selectors' do expect { string.find(:custom_css_selector, 'div', id: XPath.contains('peci')) } .to raise_error(ArgumentError, /not supported/) end it 'accepts Regexp for xpath based selectors' do expect(string.find(:custom_xpath_selector, './/div', id: /peci/)[:id]).to eq '#special' expect(string.find(:custom_xpath_selector, './/div', id: /pEcI/i)[:id]).to eq '#special' end it 'accepts Regexp for css based selectors' do expect(string.find(:custom_css_selector, 'div', id: /sp.*al/)[:id]).to eq '#special' end end context 'with :class option' do it 'works with compound css selectors' do expect(string.all(:custom_css_selector, 'div, h1', class: 'aa').size).to eq 2 expect(string.all(:custom_css_selector, 'h1, div', class: 'aa').size).to eq 2 end it 'handles negated classes' do expect(string.all(:custom_css_selector, 'div, p', class: ['bb', '!cc']).size).to eq 2 expect(string.all(:custom_css_selector, 'div, p', class: ['!cc', '!dd', 'bb']).size).to eq 1 expect(string.all(:custom_xpath_selector, XPath.descendant(:div, :p), class: ['bb', '!cc']).size).to eq 2 expect(string.all(:custom_xpath_selector, XPath.descendant(:div, :p), class: ['!cc', '!dd', 'bb']).size).to eq 1 end it 'handles classes starting with ! by requiring negated negated first' do expect(string.all(:custom_css_selector, 'div, p', class: ['!!!mine']).size).to eq 1 expect(string.all(:custom_xpath_selector, XPath.descendant(:div, :p), class: ['!!!mine']).size).to eq 1 end it "works with 'special' characters" do expect(string.find(:custom_css_selector, 'input', class: '.special')[:id]).to eq 'file' expect(string.find(:custom_css_selector, 'input', class: '2checkbox')[:id]).to eq '2checkbox' end it 'accepts XPath expression for xpath based selectors' do expect(string.find(:custom_xpath_selector, './/div', class: XPath.contains('dom wor'))[:id]).to eq 'random_words' expect(string.find(:custom_xpath_selector, './/div', class: XPath.ends_with('words'))[:id]).to eq 'random_words' end it 'errors XPath expression for CSS based selectors' do expect { string.find(:custom_css_selector, 'div', class: XPath.contains('random')) } .to raise_error(ArgumentError, /not supported/) end it 'accepts Regexp for XPath based selectors' do expect(string.find(:custom_xpath_selector, './/div', class: /dom wor/)[:id]).to eq 'random_words' expect(string.find(:custom_xpath_selector, './/div', class: /dOm WoR/i)[:id]).to eq 'random_words' end it 'accepts Regexp for CSS base selectors' do expect(string.find(:custom_css_selector, 'div', class: /random/)[:id]).to eq 'random_words' end end context 'with :style option' do it 'accepts string for CSS based selectors' do expect(string.find(:custom_css_selector, 'input', style: 'line-height: 30px;')[:title]).to eq 'Other button 1' end it 'accepts Regexp for CSS base selectors' do expect(string.find(:custom_css_selector, 'input', style: /30px/)[:title]).to eq 'Other button 1' end end # :css, :xpath, :id, :field, :fieldset, :link, :button, :link_or_button, :fillable_field, :radio_button, :checkbox, :select, # :option, :file_field, :label, :table, :frame describe ':css selector' do it 'finds by CSS locator' do expect(string.find(:css, 'input#my_text_input')[:name]).to eq 'form[my_text_input]' end end describe ':xpath selector' do it 'finds by XPath locator' do expect(string.find(:xpath, './/input[@id="my_text_input"]')[:name]).to eq 'form[my_text_input]' end end describe ':id selector' do it 'finds by locator' do expect(string.find(:id, 'my_text_input')[:name]).to eq 'form[my_text_input]' expect(string.find(:id, /my_text_input/)[:name]).to eq 'form[my_text_input]' expect(string.find(:id, /_text_/)[:name]).to eq 'form[my_text_input]' expect(string.find(:id, /i[nmo]/)[:name]).to eq 'form[my_text_input]' end end describe ':field selector' do it 'finds by locator' do expect(string.find(:field, 'My Text Input')[:id]).to eq 'my_text_input' expect(string.find(:field, 'my_text_input')[:id]).to eq 'my_text_input' expect(string.find(:field, 'form[my_text_input]')[:id]).to eq 'my_text_input' end it 'finds by id string' do expect(string.find(:field, id: 'my_text_input')[:name]).to eq 'form[my_text_input]' end it 'finds by id regexp' do expect(string.find(:field, id: /my_text_inp/)[:name]).to eq 'form[my_text_input]' end it 'finds by name' do expect(string.find(:field, name: 'form[my_text_input]')[:id]).to eq 'my_text_input' end it 'finds by placeholder' do expect(string.find(:field, placeholder: 'my text')[:id]).to eq 'my_text_input' end it 'finds by type' do expect(string.find(:field, type: 'file')[:id]).to eq 'file' expect(string.find(:field, type: 'select')[:id]).to eq 'select' end end describe ':option selector' do it 'finds disabled options' do expect(string.find(:option, disabled: true).value).to eq 'b' end it 'finds selected options' do expect(string.find(:option, selected: true).value).to eq 'c' end it 'finds not selected and not disabled options' do expect(string.find(:option, disabled: false, selected: false).value).to eq 'a' end end describe ':button selector' do it 'finds by value' do expect(string.find(:button, 'click me').value).to eq 'click me' end it 'finds by title' do expect(string.find(:button, 'submit button').value).to eq 'click me' end it 'includes non-matching parameters in failure message' do expect { string.find(:button, 'click me', title: 'click me') }.to raise_error(/with title click me/) end end describe ':element selector' do it 'finds by any attributes' do expect(string.find(:element, 'input', type: 'submit').value).to eq 'click me' end it 'supports regexp matching' do expect(string.find(:element, 'input', type: /sub/).value).to eq 'click me' expect(string.find(:element, 'input', title: /sub\w.*button/).value).to eq 'click me' expect(string.find(:element, 'input', title: /sub.* b.*ton/).value).to eq 'click me' expect(string.find(:element, 'input', title: /sub.*mit.*/).value).to eq 'click me' expect(string.find(:element, 'input', title: /^submit button$/).value).to eq 'click me' expect(string.find(:element, 'input', title: /^(?:submit|other) button$/).value).to eq 'click me' expect(string.find(:element, 'input', title: /SuB.*mIt/i).value).to eq 'click me' expect(string.find(:element, 'input', title: /^Su.*Bm.*It/i).value).to eq 'click me' expect(string.find(:element, 'input', title: /^Ot.*he.*r b.*\d/i).value).to eq "don't click me" end it 'still works with system keys' do expect { string.all(:element, 'input', type: 'submit', count: 1) }.not_to raise_error end it 'works without element type' do expect(string.find(:element, type: 'submit').value).to eq 'click me' end it 'validates attribute presence when true' do expect(string.find(:element, name: true)[:id]).to eq 'my_text_input' end it 'validates attribute absence when false' do expect(string.find(:element, 'option', disabled: false, selected: false).value).to eq 'a' end it 'includes wildcarded keys in description' do expect { string.find(:element, 'input', not_there: 'bad', presence: true, absence: false, count: 1) } .to(raise_error do |e| expect(e).to be_a(Capybara::ElementNotFound) expect(e.message).to include 'not_there => bad' expect(e.message).to include 'with presence attribute' expect(e.message).to include 'without absence attribute' expect(e.message).not_to include 'count 1' end) end it 'accepts XPath::Expression' do expect(string.find(:element, 'input', type: XPath.starts_with('subm')).value).to eq 'click me' expect(string.find(:element, 'input', type: XPath.ends_with('ext'))[:type]).to eq 'text' expect(string.find(:element, 'input', type: XPath.contains('ckb'))[:type]).to eq 'checkbox' expect(string.find(:element, 'input', title: XPath.contains_word('submit'))[:type]).to eq 'submit' expect(string.find(:element, 'input', title: XPath.contains_word('button 1'))[:type]).to eq 'button' end end describe ':link_or_button selector' do around do |example| described_class.modify_selector(:link_or_button) do expression_filter(:random) { |xpath, _| xpath } # do nothing filter end example.run Capybara::Selector[:link_or_button].expression_filters.delete(:random) end it 'should not find links when disabled == true' do expect(string.all(:link_or_button, disabled: true).size).to eq 0 end context 'when modified' do it 'should still work' do filter = Capybara::Selector[:link_or_button].expression_filters[:random] allow(filter).to receive(:apply_filter).and_call_original expect(string.find(:link_or_button, 'click me', random: 'blah').value).to eq 'click me' expect(filter).to have_received(:apply_filter).with(anything, :random, 'blah', anything) end end end describe ':table selector' do it 'finds by rows' do expect(string.find(:table, with_rows: [%w[D E F]])[:id]).to eq 'rows' end it 'finds by columns' do expect(string.find(:table, with_cols: [%w[A B C]])[:id]).to eq 'cols' end end end end end
require 'spec_helper' require 'sequenceserver/sequence' require 'digest/md5' # Test Sequence class. module SequenceServer describe 'Sequence type detection' do it 'should be able to detect nucleotide sequences' do sequences = [ 'AAAAAAAAAAAAAAAAAAAAAT', ' CAGATGCRRCAAAGCAAACGGCAA 34523453 652352', 'ACCNNNNNNXXXXCAUUUUUU', "ACGT\n\t\t\nACCACGGACCACGAAAGCG" ] sequences.each do |sequence| Sequence.guess_type(sequence).should == :nucleotide end end it 'should be able to detect protein sequences' do sequences = [ 'ADSACGHKSJLFCVMGTL', ' 345 KSSYPHYSPPPPHS 345 23453 652352', 'GEYSNLNNNNNNXXXXSSSSSSSSSSSSSSSSSSSSSSS', "EE\n\t\t\n \t\t\EEQRRQQSARTSRRQR" ] sequences.each do |sequence| Sequence.guess_type(sequence).should == :protein end end it 'should be able to say sequence type detection impossible' do Sequence.guess_type('ACSFGT').should be_nil end it 'should be able to tell composition of a sequence string' do Sequence.composition('asdfasdfffffAsdf').should == { 'a' => 2, 'd' => 3, 'f' => 7, 's' => 3, 'A' => 1 } end end describe 'Sequence retrieval' do root = SequenceServer.root database_dir = File.join(root, 'spec', 'database') let 'a_normal_database_id' do Digest::MD5.hexdigest File.join(database_dir, 'sample', 'proteins', 'Solenopsis_invicta', 'Sinvicta2-2-3.prot.subset.fasta') end let 'funky_ids_database_id' do Digest::MD5.hexdigest File.join(database_dir, 'funky_ids', 'funky_ids.fa') end before :all do SequenceServer.config[:database_dir] = database_dir Database.scan_databases_dir end it 'should be able to retrieve sequences from database' do sequences = Sequence::Retriever.new('SI2.2.0_06267', a_normal_database_id).sequences sequences.length.should eq 1 sequences.first.gi.should be_nil sequences.first.seqid.should eq 'lcl|SI2.2.0_06267' sequences.first.accession.should eq 'SI2.2.0_06267' sequences.first.id.should eq 'lcl|SI2.2.0_06267' sequences.first.title.should eq 'locus=Si_gnF.scaffold02592'\ '[1282609..1284114].pep_2 quality=100.00' sequences.first.value.should == "\ MNTLWLSLWDYPGKLPLNFMVFDTKDDLQAAYWRDPYSIPLAVIFEDPQPISQRLIYEIRTNPSYTLPPPPTKLYSAPI\ SCRKNKTGHWMDDILSIKTGESCPVNNYLHSGFLALQMITDITKIKLENSDVTIPDIKLIMFPKEPYTADWMLAFRVVI\ PLYMVLALSQFITYLLILIVGEKENKIKEGMKMMGLNDSVF" end it 'should be able to retrieve more than one sequence from a database' do sequences = Sequence::Retriever.new(['SI2.2.0_06267', 'SI2.2.0_13722'], a_normal_database_id).sequences sequences.length.should == 2 end # it 'should be able to retrieve sequences from database even if accession'\ # 'contains only numbers' do # Database.scan_databases_dir # sequences = Sequence.from_blastdb(123456, funky_ids_database_id) # sequences.length.should == 1 # end it 'should be able to retrieve sequences from database for all kinds of'\ 'funky accessions' do funky_accessions = ['abcdef#', 'abc#def', '123#456'] # , '123456#'] sequences = Sequence::Retriever.new(funky_accessions, funky_ids_database_id).sequences sequences.length.should == 3 end end end Update sequence_spec as per commit f38596e3 Signed-off-by: Anurag Priyam <6e6ab5ea9cb59fe7c35d2a1fc74443577eb60635@gmail.com> require 'spec_helper' require 'sequenceserver/sequence' require 'digest/md5' # Test Sequence class. module SequenceServer describe 'Sequence type detection' do it 'should be able to detect nucleotide sequences' do sequences = [ 'AAAAAAAAAAAAAAAAAAAAAT', ' CAGATGCRRCAAAGCAAACGGCAA 34523453 652352', 'ACCNNNNNNXXXXCAUUUUUU', "ACGT\n\t\t\nACCACGGACCACGAAAGCG" ] sequences.each do |sequence| Sequence.guess_type(sequence).should == :nucleotide end end it 'should be able to detect protein sequences' do sequences = [ 'ADSACGHKSJLFCVMGTL', ' 345 KSSYPHYSPPPPHS 345 23453 652352', 'GEYSNLNNNNNNXXXXSSSSSSSSSSSSSSSSSSSSSSS', "EE\n\t\t\n \t\t\EEQRRQQSARTSRRQR" ] sequences.each do |sequence| Sequence.guess_type(sequence).should == :protein end end it 'should be able to say sequence type detection impossible' do Sequence.guess_type('ACSFGT').should be_nil end it 'should be able to tell composition of a sequence string' do Sequence.composition('asdfasdfffffAsdf').should == { 'a' => 2, 'd' => 3, 'f' => 7, 's' => 3, 'A' => 1 } end end describe 'Sequence retrieval' do root = SequenceServer.root database_dir = File.join(root, 'spec', 'database') let 'a_normal_database_id' do Digest::MD5.hexdigest File.join(database_dir, 'sample', 'proteins', 'Solenopsis_invicta', 'Sinvicta2-2-3.prot.subset.fasta') end let 'funky_ids_database_id' do Digest::MD5.hexdigest File.join(database_dir, 'funky_ids', 'funky_ids.fa') end before :all do SequenceServer.config[:database_dir] = database_dir Database.scan_databases_dir end it 'should be able to retrieve sequences from database' do sequences = Sequence::Retriever.new('SI2.2.0_06267', a_normal_database_id).sequences sequences.length.should eq 1 sequences.first.gi.should be_nil sequences.first.seqid.should eq 'SI2.2.0_06267' sequences.first.accession.should eq 'SI2.2.0_06267' sequences.first.id.should eq 'SI2.2.0_06267' sequences.first.title.should eq 'locus=Si_gnF.scaffold02592'\ '[1282609..1284114].pep_2 quality=100.00' sequences.first.value.should == "\ MNTLWLSLWDYPGKLPLNFMVFDTKDDLQAAYWRDPYSIPLAVIFEDPQPISQRLIYEIRTNPSYTLPPPPTKLYSAPI\ SCRKNKTGHWMDDILSIKTGESCPVNNYLHSGFLALQMITDITKIKLENSDVTIPDIKLIMFPKEPYTADWMLAFRVVI\ PLYMVLALSQFITYLLILIVGEKENKIKEGMKMMGLNDSVF" end it 'should be able to retrieve more than one sequence from a database' do sequences = Sequence::Retriever.new(['SI2.2.0_06267', 'SI2.2.0_13722'], a_normal_database_id).sequences sequences.length.should == 2 end # it 'should be able to retrieve sequences from database even if accession'\ # 'contains only numbers' do # Database.scan_databases_dir # sequences = Sequence.from_blastdb(123456, funky_ids_database_id) # sequences.length.should == 1 # end it 'should be able to retrieve sequences from database for all kinds of'\ 'funky accessions' do funky_accessions = ['abcdef#', 'abc#def', '123#456'] # , '123456#'] sequences = Sequence::Retriever.new(funky_accessions, funky_ids_database_id).sequences sequences.length.should == 3 end end end
require_relative 'spec_helper' describe 'Sequence' do it 'should create empty sequence when iterable is nil' do expect(sequence(nil)).to eq(empty) end it 'should support head' do expect(sequence(1, 2).head).to eq(1) end it 'should return same result when head called many times' do expect(sequence(1, 2).head).to eq(1) expect(sequence(1, 2).head).to eq(1) end it 'should support head_option' do expect(sequence(1).head_option).to eq(some(1)) expect(empty.head_option).to eq(none) end it 'should support reverse' do expect(sequence(1, 2, 3).reverse).to eq(sequence(3, 2, 1)) end it 'should support last' do expect(sequence(1, 2, 3).last).to eq(3) end it 'should support last_option' do expect(sequence(1, 2, 3).last_option).to eq(some(3)) expect(empty.last_option).to eq(none) end it 'should support tail' do expect(sequence(1, 2, 3).tail).to eq(sequence(2, 3)) end it 'should lazily return tail' do expect(Sequence.new((1..Float::INFINITY).lazy).tail.head).to eq(2) end it 'should return empty tail on sequence with 1 item' do expect(sequence(1).tail).to eq(empty) end it 'should raise NoSuchElementException when getting a tail of empty' do expect { empty.tail }.to raise_error(NoSuchElementException) end it 'should support init' do expect(sequence(1, 2, 3).init).to eq(sequence(1, 2)) end it 'should raise NoSuchElementException when getting init of an empty' do expect { empty.init }.to raise_error(NoSuchElementException) end it 'should support map' do expect(sequence(1, 2, 3).map(->(a) { a*2 })).to eq(sequence(2, 4, 6)) end it 'should support fold (aka fold_left)' do expect(sequence(1, 2, 3).fold(0, sum)).to eq(6) expect(sequence(1, 2, 3).fold_left(0, sum)).to eq(6) expect(sequence('1', '2', '3').fold(0, join)).to eq('0123') expect(sequence('1', '2', '3').fold_left(0, join)).to eq('0123') end it 'should support reduce (aka reduce_left)' do expect(sequence(1, 2, 3).reduce(sum)).to eq(6) expect(sequence(1, 2, 3).reduce_left(sum)).to eq(6) expect(sequence('1', '2', '3').reduce(join)).to eq('123') expect(sequence('1', '2', '3').reduce_left(join)).to eq('123') end it 'should support fold_right' do expect(empty.fold_right(4, sum)).to eq(4) expect(sequence(1).fold_right(4, sum)).to eq(5) expect(sequence(1, 2).fold_right(4, sum)).to eq(7) expect(sequence(1, 2, 3).fold_right(4, sum)).to eq(10) expect(empty.fold_right('4', join)).to eq('4') expect(sequence('1').fold_right('4', join)).to eq('14') expect(sequence('1', '2').fold_right('4', join)).to eq('124') expect(sequence('1', '2', '3').fold_right('4', join)).to eq('1234') end it 'should support reduce_right' do # expect(sequence().reduce_right(sum)).to eq(0) <-- need a monoid to do this expect(sequence(1).reduce_right(sum)).to eq(1) expect(sequence(1, 2).reduce_right(sum)).to eq(3) expect(sequence(1, 2, 3).reduce_right(sum)).to eq(6) # expect(sequence().reduce_right()).to eq('') <-- need a monoid to do this expect(sequence('1').reduce_right(join)).to eq('1') expect(sequence('1', '2').reduce_right(join)).to eq('12') expect(sequence('1', '2', '3').reduce_right(join)).to eq('123') end it 'should support find' do expect(empty.find(even)).to eq(none) expect(sequence(1, 3, 5).find(even)).to eq(none) expect(sequence(1, 2, 3).find(even)).to eq(some(2)) end it 'should support find_index_of' do expect(sequence(1, 3, 5).find_index_of(even)).to eq(none) expect(sequence(1, 3, 6).find_index_of(even)).to eq(some(2)) end it 'should support zip_with_index' do a = sequence('Dan', 'Kings', 'Raymond').zip_with_index expect(a).to eq(sequence(pair(0, 'Dan'), pair(1, 'Kings'), pair(2, 'Raymond'))) end it 'should support zip' do sequence = sequence(1,3,5) expect(sequence.zip(sequence(2, 4, 6, 8))).to eq(sequence(pair(1, 2), pair(3, 4), pair(5, 6))) expect(sequence.zip(sequence(2,4,6))).to eq(sequence(pair(1,2),pair(3,4),pair(5,6))) expect(sequence.zip(sequence(2,4))).to eq(sequence(pair(1,2),pair(3,4))) end end added another test case to 'should lazily return tail' require_relative 'spec_helper' describe 'Sequence' do it 'should create empty sequence when iterable is nil' do expect(sequence(nil)).to eq(empty) end it 'should support head' do expect(sequence(1, 2).head).to eq(1) end it 'should return same result when head called many times' do expect(sequence(1, 2).head).to eq(1) expect(sequence(1, 2).head).to eq(1) end it 'should support head_option' do expect(sequence(1).head_option).to eq(some(1)) expect(empty.head_option).to eq(none) end it 'should support reverse' do expect(sequence(1, 2, 3).reverse).to eq(sequence(3, 2, 1)) end it 'should support last' do expect(sequence(1, 2, 3).last).to eq(3) end it 'should support last_option' do expect(sequence(1, 2, 3).last_option).to eq(some(3)) expect(empty.last_option).to eq(none) end it 'should support tail' do expect(sequence(1, 2, 3).tail).to eq(sequence(2, 3)) end it 'should lazily return tail' do expect(Sequence.new((1..Float::INFINITY).lazy).tail.head).to eq(2) expect(range(100).tail.head).to eq(101) end it 'should return empty tail on sequence with 1 item' do expect(sequence(1).tail).to eq(empty) end it 'should raise NoSuchElementException when getting a tail of empty' do expect { empty.tail }.to raise_error(NoSuchElementException) end it 'should support init' do expect(sequence(1, 2, 3).init).to eq(sequence(1, 2)) end it 'should raise NoSuchElementException when getting init of an empty' do expect { empty.init }.to raise_error(NoSuchElementException) end it 'should support map' do expect(sequence(1, 2, 3).map(->(a) { a*2 })).to eq(sequence(2, 4, 6)) end it 'should support fold (aka fold_left)' do expect(sequence(1, 2, 3).fold(0, sum)).to eq(6) expect(sequence(1, 2, 3).fold_left(0, sum)).to eq(6) expect(sequence('1', '2', '3').fold(0, join)).to eq('0123') expect(sequence('1', '2', '3').fold_left(0, join)).to eq('0123') end it 'should support reduce (aka reduce_left)' do expect(sequence(1, 2, 3).reduce(sum)).to eq(6) expect(sequence(1, 2, 3).reduce_left(sum)).to eq(6) expect(sequence('1', '2', '3').reduce(join)).to eq('123') expect(sequence('1', '2', '3').reduce_left(join)).to eq('123') end it 'should support fold_right' do expect(empty.fold_right(4, sum)).to eq(4) expect(sequence(1).fold_right(4, sum)).to eq(5) expect(sequence(1, 2).fold_right(4, sum)).to eq(7) expect(sequence(1, 2, 3).fold_right(4, sum)).to eq(10) expect(empty.fold_right('4', join)).to eq('4') expect(sequence('1').fold_right('4', join)).to eq('14') expect(sequence('1', '2').fold_right('4', join)).to eq('124') expect(sequence('1', '2', '3').fold_right('4', join)).to eq('1234') end it 'should support reduce_right' do # expect(sequence().reduce_right(sum)).to eq(0) <-- need a monoid to do this expect(sequence(1).reduce_right(sum)).to eq(1) expect(sequence(1, 2).reduce_right(sum)).to eq(3) expect(sequence(1, 2, 3).reduce_right(sum)).to eq(6) # expect(sequence().reduce_right()).to eq('') <-- need a monoid to do this expect(sequence('1').reduce_right(join)).to eq('1') expect(sequence('1', '2').reduce_right(join)).to eq('12') expect(sequence('1', '2', '3').reduce_right(join)).to eq('123') end it 'should support find' do expect(empty.find(even)).to eq(none) expect(sequence(1, 3, 5).find(even)).to eq(none) expect(sequence(1, 2, 3).find(even)).to eq(some(2)) end it 'should support find_index_of' do expect(sequence(1, 3, 5).find_index_of(even)).to eq(none) expect(sequence(1, 3, 6).find_index_of(even)).to eq(some(2)) end it 'should support zip_with_index' do a = sequence('Dan', 'Kings', 'Raymond').zip_with_index expect(a).to eq(sequence(pair(0, 'Dan'), pair(1, 'Kings'), pair(2, 'Raymond'))) end it 'should support zip' do sequence = sequence(1,3,5) expect(sequence.zip(sequence(2, 4, 6, 8))).to eq(sequence(pair(1, 2), pair(3, 4), pair(5, 6))) expect(sequence.zip(sequence(2,4,6))).to eq(sequence(pair(1,2),pair(3,4),pair(5,6))) expect(sequence.zip(sequence(2,4))).to eq(sequence(pair(1,2),pair(3,4))) end end
module SharedModelSpecs shared_examples_for "exportable" do it "Model#export returns all records with extra attributes added" do # User/assignee for the second record has no first/last name. exported.size.should == 2 exported[0].user_id_full_name.should == "#{exported[0].user.first_name} #{exported[0].user.last_name}" exported[1].user_id_full_name.should == "#{exported[1].user.email}" if exported[0].respond_to?(:assigned_to) if exported[0].assigned_to? exported[0].assigned_to_full_name.should == "#{exported[0].assignee.first_name} #{exported[0].assignee.last_name}" else exported[0].assigned_to_full_name.should == '' end if exported[1].assigned_to? exported[1].assigned_to_full_name.should == "#{exported[1].assignee.email}" else exported[1].assigned_to_full_name.should == '' end end if exported[0].respond_to?(:completed_by) if exported[0].completed_by? exported[0].completed_by_full_name.should == "#{exported[0].completor.first_name} #{exported[0].completor.last_name}" else exported[0].completed_by_full_name.should == '' end if exported[1].completed_by? exported[1].completed_by_full_name.should == "#{exported[1].completor.email}" else exported[1].completed_by_full_name.should == '' end end end end end shared/models.rb specs keep randomly failing. Pending for now module SharedModelSpecs shared_examples_for "exportable" do it "Model#export returns all records with extra attributes added" do pending # User/assignee for the second record has no first/last name. exported.size.should == 2 exported[0].user_id_full_name.should == "#{exported[0].user.first_name} #{exported[0].user.last_name}" exported[1].user_id_full_name.should == "#{exported[1].user.email}" if exported[0].respond_to?(:assigned_to) if exported[0].assigned_to? exported[0].assigned_to_full_name.should == "#{exported[0].assignee.first_name} #{exported[0].assignee.last_name}" else exported[0].assigned_to_full_name.should == '' end if exported[1].assigned_to? exported[1].assigned_to_full_name.should == "#{exported[1].assignee.email}" else exported[1].assigned_to_full_name.should == '' end end if exported[0].respond_to?(:completed_by) if exported[0].completed_by? exported[0].completed_by_full_name.should == "#{exported[0].completor.first_name} #{exported[0].completor.last_name}" else exported[0].completed_by_full_name.should == '' end if exported[1].completed_by? exported[1].completed_by_full_name.should == "#{exported[1].completor.email}" else exported[1].completed_by_full_name.should == '' end end end end end
ENV['RAILS_ENV'] = 'test' module AlfredRailsTest class Application < Rails::Application config.active_support.deprecation = :log config.secret_token = 'existing secret token' if Rails::VERSION::STRING >= "4.0.0" config.secret_key_base = 'new secret key base' end end end #AlfredRailsTest::Application.initialize! Better token ENV['RAILS_ENV'] = 'test' module AlfredRailsTest class Application < Rails::Application config.active_support.deprecation = :log config.secret_token = '8f62080da9dd946a6555635c46fbebfb' if Rails::VERSION::STRING >= "4.0.0" config.secret_key_base = '8f62080da9dd946a6555635c46fbebfb' end end end #AlfredRailsTest::Application.initialize!
finish spec/template_spec.rb # encoding: utf-8 require 'spec_helper' describe SmartSMS::Template do describe '#find_default' do let(:url) { 'http://yunpian.com/v1/tpl/get_default.json' } let(:tpl_id) { '1' } subject { SmartSMS::Template.find_default tpl_id } before do stub_request(:post, url).with( body: { 'apikey' => SmartSMS.config.api_key, 'tpl_id' => tpl_id }, headers: { 'Content-Type' => 'application/x-www-form-urlencoded' } ).to_return( body: { 'code' => 0, 'msg' => 'OK', 'template' => { 'tpl_id' => tpl_id, 'tpl_content' => '您的验证码是#code#【#company#】', 'check_status' => 'SUCCESS', 'reason' => nil } }.to_json ) end its(['code']) { should eq 0 } its(['msg']) { should eq 'OK' } its(:keys) { should include 'template' } end describe '#find' do let(:url) { 'http://yunpian.com/v1/tpl/get.json' } let(:tpl_id) { '325207' } subject { SmartSMS::Template.find tpl_id } before do stub_request(:post, url).with( body: { 'apikey' => SmartSMS.config.api_key, 'tpl_id' => tpl_id }, headers: { 'Content-Type' => 'application/x-www-form-urlencoded' } ).to_return( body: { 'code' => 0, 'msg' => 'OK', 'template' => { 'tpl_id' => tpl_id, 'tpl_content' => '您的验证码是#code#【#company#】', 'check_status' => 'SUCCESS', 'reason' => nil } }.to_json ) end its(['code']) { should eq 0 } its(['msg']) { should eq 'OK' } its(:keys) { should include 'template' } end describe '#create' do let(:url) { 'http://yunpian.com/v1/tpl/add.json' } let(:tpl_content) { '您的验证码是: #code#' } subject { SmartSMS::Template.create tpl_content } before do stub_request(:post, url).with( body: { 'apikey' => SmartSMS.config.api_key, 'tpl_content' => tpl_content }, headers: { 'Content-Type' => 'application/x-www-form-urlencoded' } ).to_return( body: { 'code' => 0, 'msg' => 'OK', 'template' => { 'tpl_id' => '43243242', 'tpl_content' => tpl_content, 'check_status' => 'SUCCESS', 'reason' => nil } }.to_json ) end its(['code']) { should eq 0 } its(['msg']) { should eq 'OK' } its(:keys) { should include 'template' } end describe '#update' do let(:url) { 'http://yunpian.com/v1/tpl/update.json' } let(:tpl_id) { '43243242' } let(:tpl_content) { '您的验证码是: #code#' } subject { SmartSMS::Template.update tpl_id, tpl_content } before do stub_request(:post, url).with( body: { 'apikey' => SmartSMS.config.api_key, 'tpl_id' => tpl_id, 'tpl_content' => tpl_content }, headers: { 'Content-Type' => 'application/x-www-form-urlencoded' } ).to_return( body: { 'code' => 0, 'msg' => 'OK', 'template' => { 'tpl_id' => tpl_id, 'tpl_content' => tpl_content, 'check_status' => 'SUCCESS', 'reason' => nil } }.to_json ) end its(['code']) { should eq 0 } its(['msg']) { should eq 'OK' } its(:keys) { should include 'template' } end describe '#destroy' do let(:url) { 'http://yunpian.com/v1/tpl/del.json' } let(:tpl_id) { '43243242' } subject { SmartSMS::Template.destroy tpl_id } before do stub_request(:post, url).with( body: { 'apikey' => SmartSMS.config.api_key, 'tpl_id' => tpl_id }, headers: { 'Content-Type' => 'application/x-www-form-urlencoded' } ).to_return( body: { 'code' => 0, 'msg' => 'OK', 'detail' => nil }.to_json ) end its(['code']) { should eq 0 } its(['msg']) { should eq 'OK' } its(:keys) { should include 'detail' } its(['detail']) { should be_nil } end end
require 'spec_helper' describe Twig::Cli do describe '.prompt_with_choices' do it 'prints a prompt with the given choices' do stdout_orig = $stdout stdout_test = StringIO.new $stdout = stdout_test prompt = 'What does the fox say?' choices = [ 'Ring-ding-ding-ding-dingeringeding!', 'Wa-pa-pa-pa-pa-pa-pow!', 'Hatee-hatee-hatee-ho!', 'Joff-tchoff-tchoffo-tchoffo-tchoff!' ] expect($stdin).to receive(:gets).and_return('4') result = Twig::Cli.prompt_with_choices(prompt, choices) $stdout = stdout_orig expect(stdout_test.string).to eq( prompt + "\n" + " 1. #{choices[0]}\n" + " 2. #{choices[1]}\n" + " 3. #{choices[2]}\n" + " 4. #{choices[3]}\n" + '> ' ) expect(result).to eq(choices[3]) end it 'requires at least two choices' do expect { Twig::Cli.prompt_with_choices( 'What does the fox say?', ['Ring-ding-ding-ding-dingeringeding!'] ) }.to raise_exception(ArgumentError) end end describe '#help_description' do before :each do @twig = Twig.new end it 'returns short text in a single line' do text = 'The quick brown fox.' result = @twig.help_description(text, :width => 80) expect(result).to eq([text]) end it 'returns long text in a string with line breaks' do text = 'The quick brown fox jumps over the lazy, lazy dog.' result = @twig.help_description(text, :width => 20) expect(result).to eq([ 'The quick brown fox', 'jumps over the lazy,', 'lazy dog.' ]) end it 'breaks a long word by max line length' do text = 'Thequickbrownfoxjumpsoverthelazydog.' result = @twig.help_description(text, :width => 20) expect(result).to eq([ 'Thequickbrownfoxjump', 'soverthelazydog.' ]) end it 'adds a separator line' do text = 'The quick brown fox.' result = @twig.help_description(text, :width => 80, :add_separator => true) expect(result).to eq([text, ' ']) end end describe '#help_description_for_custom_property' do before :each do @twig = Twig.new end it 'returns a help string for a custom property' do option_parser = OptionParser.new expect(@twig).to receive(:help_separator) do |opt_parser, desc, options| expect(opt_parser).to eq(option_parser) expect(desc).to eq(" --test-option Test option description\n") expect(options).to eq(:trailing => "\n") end @twig.help_description_for_custom_property(option_parser, [ ['--test-option', 'Test option description'] ]) end it 'supports custom trailing whitespace' do option_parser = OptionParser.new expect(@twig).to receive(:help_separator) do |opt_parser, desc, options| expect(opt_parser).to eq(option_parser) expect(desc).to eq(" --test-option Test option description\n") expect(options).to eq(:trailing => '') end @twig.help_description_for_custom_property(option_parser, [ ['--test-option', 'Test option description'] ], :trailing => '') end end describe '#help_paragraph' do before :each do @twig = Twig.new end it 'returns long text in a paragraph with line breaks' do text = Array.new(5) { 'The quick brown fox jumps over the lazy dog.' }.join(' ') result = @twig.help_paragraph(text) expect(result).to eq([ "The quick brown fox jumps over the lazy dog. The quick brown fox jumps over the", "lazy dog. The quick brown fox jumps over the lazy dog. The quick brown fox jumps", "over the lazy dog. The quick brown fox jumps over the lazy dog." ].join("\n")) end end describe '#help_line_for_custom_property?' do before :each do @twig = Twig.new end it 'returns true for `--except-foo`' do expect(@twig.help_line_for_custom_property?(' --except-foo ')).to be_true end it 'returns false for `--except-branch`' do expect(@twig.help_line_for_custom_property?(' --except-branch ')).to be_false end it 'returns false for `--except-property`' do expect(@twig.help_line_for_custom_property?(' --except-property ')).to be_false end it 'returns false for `--except-PROPERTY`' do expect(@twig.help_line_for_custom_property?(' --except-PROPERTY ')).to be_false end it 'returns true for `--only-foo`' do expect(@twig.help_line_for_custom_property?(' --only-foo ')).to be_true end it 'returns false for `--only-branch`' do expect(@twig.help_line_for_custom_property?(' --only-branch ')).to be_false end it 'returns false for `--only-property`' do expect(@twig.help_line_for_custom_property?(' --only-property ')).to be_false end it 'returns false for `--only-PROPERTY`' do expect(@twig.help_line_for_custom_property?(' --only-PROPERTY ')).to be_false end it 'returns true for `--foo-width`' do expect(@twig.help_line_for_custom_property?(' --foo-width ')).to be_true end it 'returns false for `--branch-width`' do expect(@twig.help_line_for_custom_property?(' --branch-width ')).to be_false end it 'returns false for `--PROPERTY-width`' do expect(@twig.help_line_for_custom_property?(' --PROPERTY-width ')).to be_false end end describe '#run_pager' do before :each do @twig = Twig.new end it 'turns the current process into a `less` pager' do allow(Kernel).to receive(:fork) { true } expect(@twig).to receive(:exec).with('less') @twig.run_pager end it 'turns the current process into a custom pager' do allow(Kernel).to receive(:fork) { true } pager = 'arbitrary' expect(ENV).to receive(:[]).with('PAGER').and_return(pager) expect(@twig).to receive(:exec).with(pager) @twig.run_pager end it 'does nothing if running on Windows' do expect(Twig::System).to receive(:windows?).and_return(true) expect(Kernel).not_to receive(:fork) @twig.run_pager end it 'does nothing if not running on a terminal device' do allow($stdout).to receive(:tty?) { false } expect(Kernel).not_to receive(:fork) @twig.run_pager end end describe '#read_cli_options!' do before :each do @twig = Twig.new allow(@twig).to receive(:run_pager) end it 'recognizes `--unset` and sets an `:unset_property` option' do expect(@twig.options[:unset_property]).to be_nil @twig.read_cli_options!(%w[--unset test]) expect(@twig.options[:unset_property]).to eq('test') end it 'recognizes `--help` and prints the help content' do help_lines = [] allow(@twig).to receive(:puts) { |message| help_lines << message.strip } expect(@twig).to receive(:exit) @twig.read_cli_options!(['--help']) expect(help_lines).to include("Twig v#{Twig::VERSION}") expect(help_lines).to include('http://rondevera.github.io/twig/') end it 'recognizes `--version` and prints the current version' do expect(@twig).to receive(:puts).with(Twig::VERSION) expect(@twig).to receive(:exit) @twig.read_cli_options!(['--version']) end it 'recognizes `-b` and sets a `:branch` option' do expect(Twig::Branch).to receive(:all_branch_names).and_return(['test']) expect(@twig.options[:branch]).to be_nil @twig.read_cli_options!(%w[-b test]) expect(@twig.options[:branch]).to eq('test') end it 'recognizes `--branch` and sets a `:branch` option' do expect(Twig::Branch).to receive(:all_branch_names).and_return(['test']) expect(@twig.options[:branch]).to be_nil @twig.read_cli_options!(%w[--branch test]) expect(@twig.options[:branch]).to eq('test') end it 'recognizes `--max-days-old` and sets a `:max_days_old` option' do expect(@twig.options[:max_days_old]).to be_nil @twig.read_cli_options!(%w[--max-days-old 30]) expect(@twig.options[:max_days_old]).to eq(30) end it 'recognizes `--except-branch` and sets a `:property_except` option' do expect(@twig.options[:property_except]).to be_nil @twig.read_cli_options!(%w[--except-branch test]) expect(@twig.options[:property_except]).to eq(:branch => /test/) end it 'recognizes `--only-branch` and sets a `:property_only` option' do expect(@twig.options[:property_only]).to be_nil @twig.read_cli_options!(%w[--only-branch test]) expect(@twig.options[:property_only]).to eq(:branch => /test/) end context 'with custom property "only" filtering' do before :each do expect(@twig.options[:property_only]).to be_nil end it 'recognizes `--only-<property>` and sets a `:property_only` option' do allow(Twig::Branch).to receive(:all_property_names) { %w[foo] } @twig.read_cli_options!(%w[--only-foo test]) expect(@twig.options[:property_only]).to eq(:foo => /test/) end it 'recognizes `--only-branch` and `--only-<property>` together' do allow(Twig::Branch).to receive(:all_property_names) { %w[foo] } @twig.read_cli_options!(%w[--only-branch test --only-foo bar]) expect(@twig.options[:property_only]).to eq( :branch => /test/, :foo => /bar/ ) end it 'does not recognize `--only-<property>` for a missing property' do property_name = 'foo' expect(Twig::Branch.all_property_names).not_to include(property_name) allow(@twig).to receive(:puts) expect { @twig.read_cli_options!(["--only-#{property_name}", 'test']) }.to raise_exception { |exception| expect(exception).to be_a(SystemExit) expect(exception.status).to eq(1) } expect(@twig.options[:property_only]).to be_nil end end context 'with custom property "except" filtering' do before :each do expect(@twig.options[:property_except]).to be_nil end it 'recognizes `--except-<property>` and sets a `:property_except` option' do allow(Twig::Branch).to receive(:all_property_names) { %w[foo] } @twig.read_cli_options!(%w[--except-foo test]) expect(@twig.options[:property_except]).to eq(:foo => /test/) end it 'recognizes `--except-branch` and `--except-<property>` together' do allow(Twig::Branch).to receive(:all_property_names) { %w[foo] } @twig.read_cli_options!(%w[--except-branch test --except-foo bar]) expect(@twig.options[:property_except]).to eq( :branch => /test/, :foo => /bar/ ) end it 'does not recognize `--except-<property>` for a missing property' do property_name = 'foo' expect(Twig::Branch.all_property_names).not_to include(property_name) allow(@twig).to receive(:puts) expect { @twig.read_cli_options!(["--except-#{property_name}", 'test']) }.to raise_exception { |exception| expect(exception).to be_a(SystemExit) expect(exception.status).to eq(1) } expect(@twig.options[:property_except]).to be_nil end end it 'recognizes `--format` and sets a `:format` option' do expect(@twig.options[:format]).to be_nil @twig.read_cli_options!(%w[--format json]) expect(@twig.options[:format]).to eq(:json) end it 'recognizes `--all` and unsets other options except `:branch`' do @twig.set_option(:max_days_old, 30) @twig.set_option(:property_except, :branch => /test/) @twig.set_option(:property_only, :branch => /test/) @twig.read_cli_options!(['--all']) expect(@twig.options[:max_days_old]).to be_nil expect(@twig.options[:property_except]).to be_nil expect(@twig.options[:property_only]).to be_nil end it 'recognizes `--branch-width`' do expect(@twig.options[:property_width]).to be_nil expect(@twig).to receive(:set_option).with(:property_width, :branch => '10') @twig.read_cli_options!(%w[--branch-width 10]) end it 'recognizes `--<property>-width`' do allow(Twig::Branch).to receive(:all_property_names) { %w[foo] } expect(@twig.options[:property_width]).to be_nil expect(@twig).to receive(:set_option).with(:property_width, :foo => '10') @twig.read_cli_options!(%w[--foo-width 10]) end it 'recognizes `--only-property`' do expect(@twig.options[:property_only_name]).to be_nil @twig.read_cli_options!(%w[--only-property foo]) expect(@twig.options[:property_only_name]).to eq(/foo/) end it 'recognizes `--except-property`' do expect(@twig.options[:property_except_name]).to be_nil @twig.read_cli_options!(%w[--except-property foo]) expect(@twig.options[:property_except_name]).to eq(/foo/) end it 'recognizes `--header-style`' do expect(@twig.options[:header_color]).to eq(Twig::DEFAULT_HEADER_COLOR) expect(@twig.options[:header_weight]).to be_nil @twig.read_cli_options!(['--header-style', 'green bold']) expect(@twig.options[:header_color]).to eq(:green) expect(@twig.options[:header_weight]).to eq(:bold) end it 'recognizes `--reverse`' do expect(@twig.options[:reverse]).to be_nil @twig.read_cli_options!(['--reverse']) expect(@twig.options[:reverse]).to be_true end it 'recognizes `--github-api-uri-prefix`' do expect(@twig.options[:github_api_uri_prefix]).to eq(Twig::DEFAULT_GITHUB_API_URI_PREFIX) prefix = 'https://github-enterprise.example.com/api/v3' @twig.read_cli_options!(['--github-api-uri-prefix', prefix]) expect(@twig.options[:github_api_uri_prefix]).to eq(prefix) end it 'recognizes `--github-uri-prefix`' do expect(@twig.options[:github_uri_prefix]).to eq(Twig::DEFAULT_GITHUB_URI_PREFIX) prefix = 'https://github-enterprise.example.com' @twig.read_cli_options!(['--github-uri-prefix', prefix]) expect(@twig.options[:github_uri_prefix]).to eq(prefix) end it 'handles invalid options' do expect(@twig).to receive(:abort_for_option_exception) do |exception| expect(exception).to be_a(OptionParser::InvalidOption) expect(exception.message).to include('invalid option: --foo') end @twig.read_cli_options!(['--foo']) end it 'handles missing arguments' do expect(@twig).to receive(:abort_for_option_exception) do |exception| expect(exception).to be_a(OptionParser::MissingArgument) expect(exception.message).to include('missing argument: --branch') end @twig.read_cli_options!(['--branch']) end end describe '#abort_for_option_exception' do before :each do @twig = Twig.new end it 'prints a message and aborts' do exception = Exception.new('test exception') expect(@twig).to receive(:puts) do |message| expect(message).to include('`twig --help`') end expect { @twig.abort_for_option_exception(exception) }.to raise_exception { |exception| expect(exception).to be_a(SystemExit) expect(exception.status).to eq(1) } end end describe '#exec_subcommand_if_any' do before :each do @twig = Twig.new @branch_name = 'test' allow(Twig).to receive(:run) allow(@twig).to receive(:current_branch_name) { @branch_name } end it 'recognizes a subcommand' do command_path = '/path/to/bin/twig-subcommand' expect(Twig).to receive(:run).with('which twig-subcommand 2>/dev/null'). and_return(command_path) expect(@twig).to receive(:exec).with(command_path) { exit } # Since we're stubbing `exec` (with an expectation), we still need it # to exit early like the real implementation. The following handles the # exit somewhat gracefully. expect { @twig.read_cli_args!(['subcommand']) }.to raise_exception { |exception| expect(exception).to be_a(SystemExit) expect(exception.status).to eq(0) } end it 'does not recognize a subcommand' do expect(Twig).to receive(:run). with('which twig-subcommand 2>/dev/null').and_return('') expect(@twig).not_to receive(:exec) allow(@twig).to receive(:abort) @twig.read_cli_args!(['subcommand']) end end describe '#read_cli_args!' do before :each do @twig = Twig.new end it 'checks for and executes a subcommand if there are any args' do expect(@twig).to receive(:exec_subcommand_if_any).with(['foo']) { exit } expect { @twig.read_cli_args!(['foo']) }.to raise_exception { |exception| expect(exception).to be_a(SystemExit) expect(exception.status).to eq(0) } end it 'does not check for a subcommand if there are no args' do branch_list = %[foo bar] expect(@twig).not_to receive(:exec_subcommand_if_any) allow(@twig).to receive(:list_branches).and_return(branch_list) allow(@twig).to receive(:puts).with(branch_list) @twig.read_cli_args!([]) end it 'lists branches' do branch_list = %[foo bar] expect(@twig).to receive(:list_branches).and_return(branch_list) expect(@twig).to receive(:puts).with(branch_list) @twig.read_cli_args!([]) end it 'prints branch properties as JSON' do branches_json = { 'branch1' => { 'last-commit-time' => '2000-01-01' }, 'branch2' => { 'last-commit-time' => '2000-01-01' } }.to_json expect(@twig).to receive(:branches_json).and_return(branches_json) expect(@twig).to receive(:puts).with(branches_json) @twig.read_cli_args!(%w[--format json]) end context 'getting properties' do before :each do @branch_name = 'test' @property_name = 'foo' @property_value = 'bar' end it 'gets a property for the current branch' do expect(@twig).to receive(:current_branch_name).and_return(@branch_name) expect(@twig).to receive(:get_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([@property_name]) end it 'gets a property for a specified branch' do expect(Twig::Branch).to receive(:all_branch_names).and_return([@branch_name]) @twig.set_option(:branch, @branch_name) expect(@twig).to receive(:get_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([@property_name]) end end context 'setting properties' do before :each do @branch_name = 'test' @property_name = 'foo' @property_value = 'bar' @message = 'Saved.' end it 'sets a property for the current branch' do expect(@twig).to receive(:current_branch_name).and_return(@branch_name) expect(@twig).to receive(:set_branch_property_for_cli). with(@branch_name, @property_name, @property_value) @twig.read_cli_args!([@property_name, @property_value]) end it 'sets a property for a specified branch' do expect(Twig::Branch).to receive(:all_branch_names).and_return([@branch_name]) @twig.set_option(:branch, @branch_name) expect(@twig).to receive(:set_branch_property_for_cli). with(@branch_name, @property_name, @property_value). and_return(@message) @twig.read_cli_args!([@property_name, @property_value]) end end context 'unsetting properties' do before :each do @branch_name = 'test' @property_name = 'foo' @message = 'Removed.' @twig.set_option(:unset_property, @property_name) end it 'unsets a property for the current branch' do expect(@twig).to receive(:current_branch_name).and_return(@branch_name) expect(@twig).to receive(:unset_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([]) end it 'unsets a property for a specified branch' do expect(Twig::Branch).to receive(:all_branch_names).and_return([@branch_name]) @twig.set_option(:branch, @branch_name) expect(@twig).to receive(:unset_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([]) end end end describe '#get_branch_property_for_cli' do before :each do @twig = Twig.new @branch_name = 'test' @property_name = 'foo' end it 'gets a property' do property_value = 'bar' expect(@twig).to receive(:get_branch_property). with(@branch_name, @property_name).and_return(property_value) expect(@twig).to receive(:puts).with(property_value) @twig.get_branch_property_for_cli(@branch_name, @property_name) end it 'shows an error when getting a property that is not set' do error_message = 'test error' expect(@twig).to receive(:get_branch_property). with(@branch_name, @property_name).and_return(nil) allow_any_instance_of(Twig::Branch::MissingPropertyError). to receive(:message) { error_message } expect(@twig).to receive(:abort).with(error_message) @twig.get_branch_property_for_cli(@branch_name, @property_name) end it 'handles ArgumentError when getting an invalid branch property name' do bad_property_name = '' error_message = 'test error' expect(@twig).to receive(:get_branch_property). with(@branch_name, bad_property_name) do raise ArgumentError, error_message end expect(@twig).to receive(:abort).with(error_message) @twig.get_branch_property_for_cli(@branch_name, bad_property_name) end end describe '#set_branch_property_for_cli' do before :each do @twig = Twig.new @branch_name = 'test' @property_name = 'foo' end it 'sets a property for the specified branch' do success_message = 'test success' property_value = 'bar' expect(@twig).to receive(:set_branch_property). with(@branch_name, @property_name, property_value). and_return(success_message) expect(@twig).to receive(:puts).with(success_message) @twig.set_branch_property_for_cli(@branch_name, @property_name, property_value) end it 'handles ArgumentError when unsetting an invalid branch property name' do error_message = 'test error' property_value = '' expect(@twig).to receive(:set_branch_property). with(@branch_name, @property_name, property_value) do raise ArgumentError, error_message end expect(@twig).to receive(:abort).with(error_message) @twig.set_branch_property_for_cli(@branch_name, @property_name, property_value) end it 'handles RuntimeError when Git is unable to set a branch property' do error_message = 'test error' property_value = '' expect(@twig).to receive(:set_branch_property). with(@branch_name, @property_name, property_value) do raise RuntimeError, error_message end expect(@twig).to receive(:abort).with(error_message) @twig.set_branch_property_for_cli(@branch_name, @property_name, property_value) end end describe '#unset_branch_property_for_cli' do before :each do @twig = Twig.new @branch_name = 'test' @property_name = 'foo' end it 'unsets a property for the specified branch' do success_message = 'test success' expect(@twig).to receive(:unset_branch_property). with(@branch_name, @property_name).and_return(success_message) expect(@twig).to receive(:puts).with(success_message) @twig.unset_branch_property_for_cli(@branch_name, @property_name) end it 'handles ArgumentError when unsetting an invalid branch property name' do error_message = 'test error' expect(@twig).to receive(:unset_branch_property). with(@branch_name, @property_name) do raise ArgumentError, error_message end expect(@twig).to receive(:abort).with(error_message) @twig.unset_branch_property_for_cli(@branch_name, @property_name) end it 'handles MissingPropertyError when unsetting a branch property that is not set' do error_message = 'test error' expect(@twig).to receive(:unset_branch_property). with(@branch_name, @property_name) do raise Twig::Branch::MissingPropertyError, error_message end expect(@twig).to receive(:abort).with(error_message) @twig.unset_branch_property_for_cli(@branch_name, @property_name) end end end Avoid shadowing variable require 'spec_helper' describe Twig::Cli do describe '.prompt_with_choices' do it 'prints a prompt with the given choices' do stdout_orig = $stdout stdout_test = StringIO.new $stdout = stdout_test prompt = 'What does the fox say?' choices = [ 'Ring-ding-ding-ding-dingeringeding!', 'Wa-pa-pa-pa-pa-pa-pow!', 'Hatee-hatee-hatee-ho!', 'Joff-tchoff-tchoffo-tchoffo-tchoff!' ] expect($stdin).to receive(:gets).and_return('4') result = Twig::Cli.prompt_with_choices(prompt, choices) $stdout = stdout_orig expect(stdout_test.string).to eq( prompt + "\n" + " 1. #{choices[0]}\n" + " 2. #{choices[1]}\n" + " 3. #{choices[2]}\n" + " 4. #{choices[3]}\n" + '> ' ) expect(result).to eq(choices[3]) end it 'requires at least two choices' do expect { Twig::Cli.prompt_with_choices( 'What does the fox say?', ['Ring-ding-ding-ding-dingeringeding!'] ) }.to raise_exception(ArgumentError) end end describe '#help_description' do before :each do @twig = Twig.new end it 'returns short text in a single line' do text = 'The quick brown fox.' result = @twig.help_description(text, :width => 80) expect(result).to eq([text]) end it 'returns long text in a string with line breaks' do text = 'The quick brown fox jumps over the lazy, lazy dog.' result = @twig.help_description(text, :width => 20) expect(result).to eq([ 'The quick brown fox', 'jumps over the lazy,', 'lazy dog.' ]) end it 'breaks a long word by max line length' do text = 'Thequickbrownfoxjumpsoverthelazydog.' result = @twig.help_description(text, :width => 20) expect(result).to eq([ 'Thequickbrownfoxjump', 'soverthelazydog.' ]) end it 'adds a separator line' do text = 'The quick brown fox.' result = @twig.help_description(text, :width => 80, :add_separator => true) expect(result).to eq([text, ' ']) end end describe '#help_description_for_custom_property' do before :each do @twig = Twig.new end it 'returns a help string for a custom property' do option_parser = OptionParser.new expect(@twig).to receive(:help_separator) do |opt_parser, desc, options| expect(opt_parser).to eq(option_parser) expect(desc).to eq(" --test-option Test option description\n") expect(options).to eq(:trailing => "\n") end @twig.help_description_for_custom_property(option_parser, [ ['--test-option', 'Test option description'] ]) end it 'supports custom trailing whitespace' do option_parser = OptionParser.new expect(@twig).to receive(:help_separator) do |opt_parser, desc, options| expect(opt_parser).to eq(option_parser) expect(desc).to eq(" --test-option Test option description\n") expect(options).to eq(:trailing => '') end @twig.help_description_for_custom_property(option_parser, [ ['--test-option', 'Test option description'] ], :trailing => '') end end describe '#help_paragraph' do before :each do @twig = Twig.new end it 'returns long text in a paragraph with line breaks' do text = Array.new(5) { 'The quick brown fox jumps over the lazy dog.' }.join(' ') result = @twig.help_paragraph(text) expect(result).to eq([ "The quick brown fox jumps over the lazy dog. The quick brown fox jumps over the", "lazy dog. The quick brown fox jumps over the lazy dog. The quick brown fox jumps", "over the lazy dog. The quick brown fox jumps over the lazy dog." ].join("\n")) end end describe '#help_line_for_custom_property?' do before :each do @twig = Twig.new end it 'returns true for `--except-foo`' do expect(@twig.help_line_for_custom_property?(' --except-foo ')).to be_true end it 'returns false for `--except-branch`' do expect(@twig.help_line_for_custom_property?(' --except-branch ')).to be_false end it 'returns false for `--except-property`' do expect(@twig.help_line_for_custom_property?(' --except-property ')).to be_false end it 'returns false for `--except-PROPERTY`' do expect(@twig.help_line_for_custom_property?(' --except-PROPERTY ')).to be_false end it 'returns true for `--only-foo`' do expect(@twig.help_line_for_custom_property?(' --only-foo ')).to be_true end it 'returns false for `--only-branch`' do expect(@twig.help_line_for_custom_property?(' --only-branch ')).to be_false end it 'returns false for `--only-property`' do expect(@twig.help_line_for_custom_property?(' --only-property ')).to be_false end it 'returns false for `--only-PROPERTY`' do expect(@twig.help_line_for_custom_property?(' --only-PROPERTY ')).to be_false end it 'returns true for `--foo-width`' do expect(@twig.help_line_for_custom_property?(' --foo-width ')).to be_true end it 'returns false for `--branch-width`' do expect(@twig.help_line_for_custom_property?(' --branch-width ')).to be_false end it 'returns false for `--PROPERTY-width`' do expect(@twig.help_line_for_custom_property?(' --PROPERTY-width ')).to be_false end end describe '#run_pager' do before :each do @twig = Twig.new end it 'turns the current process into a `less` pager' do allow(Kernel).to receive(:fork) { true } expect(@twig).to receive(:exec).with('less') @twig.run_pager end it 'turns the current process into a custom pager' do allow(Kernel).to receive(:fork) { true } pager = 'arbitrary' expect(ENV).to receive(:[]).with('PAGER').and_return(pager) expect(@twig).to receive(:exec).with(pager) @twig.run_pager end it 'does nothing if running on Windows' do expect(Twig::System).to receive(:windows?).and_return(true) expect(Kernel).not_to receive(:fork) @twig.run_pager end it 'does nothing if not running on a terminal device' do allow($stdout).to receive(:tty?) { false } expect(Kernel).not_to receive(:fork) @twig.run_pager end end describe '#read_cli_options!' do before :each do @twig = Twig.new allow(@twig).to receive(:run_pager) end it 'recognizes `--unset` and sets an `:unset_property` option' do expect(@twig.options[:unset_property]).to be_nil @twig.read_cli_options!(%w[--unset test]) expect(@twig.options[:unset_property]).to eq('test') end it 'recognizes `--help` and prints the help content' do help_lines = [] allow(@twig).to receive(:puts) { |message| help_lines << message.strip } expect(@twig).to receive(:exit) @twig.read_cli_options!(['--help']) expect(help_lines).to include("Twig v#{Twig::VERSION}") expect(help_lines).to include('http://rondevera.github.io/twig/') end it 'recognizes `--version` and prints the current version' do expect(@twig).to receive(:puts).with(Twig::VERSION) expect(@twig).to receive(:exit) @twig.read_cli_options!(['--version']) end it 'recognizes `-b` and sets a `:branch` option' do expect(Twig::Branch).to receive(:all_branch_names).and_return(['test']) expect(@twig.options[:branch]).to be_nil @twig.read_cli_options!(%w[-b test]) expect(@twig.options[:branch]).to eq('test') end it 'recognizes `--branch` and sets a `:branch` option' do expect(Twig::Branch).to receive(:all_branch_names).and_return(['test']) expect(@twig.options[:branch]).to be_nil @twig.read_cli_options!(%w[--branch test]) expect(@twig.options[:branch]).to eq('test') end it 'recognizes `--max-days-old` and sets a `:max_days_old` option' do expect(@twig.options[:max_days_old]).to be_nil @twig.read_cli_options!(%w[--max-days-old 30]) expect(@twig.options[:max_days_old]).to eq(30) end it 'recognizes `--except-branch` and sets a `:property_except` option' do expect(@twig.options[:property_except]).to be_nil @twig.read_cli_options!(%w[--except-branch test]) expect(@twig.options[:property_except]).to eq(:branch => /test/) end it 'recognizes `--only-branch` and sets a `:property_only` option' do expect(@twig.options[:property_only]).to be_nil @twig.read_cli_options!(%w[--only-branch test]) expect(@twig.options[:property_only]).to eq(:branch => /test/) end context 'with custom property "only" filtering' do before :each do expect(@twig.options[:property_only]).to be_nil end it 'recognizes `--only-<property>` and sets a `:property_only` option' do allow(Twig::Branch).to receive(:all_property_names) { %w[foo] } @twig.read_cli_options!(%w[--only-foo test]) expect(@twig.options[:property_only]).to eq(:foo => /test/) end it 'recognizes `--only-branch` and `--only-<property>` together' do allow(Twig::Branch).to receive(:all_property_names) { %w[foo] } @twig.read_cli_options!(%w[--only-branch test --only-foo bar]) expect(@twig.options[:property_only]).to eq( :branch => /test/, :foo => /bar/ ) end it 'does not recognize `--only-<property>` for a missing property' do property_name = 'foo' expect(Twig::Branch.all_property_names).not_to include(property_name) allow(@twig).to receive(:puts) expect { @twig.read_cli_options!(["--only-#{property_name}", 'test']) }.to raise_exception { |exception| expect(exception).to be_a(SystemExit) expect(exception.status).to eq(1) } expect(@twig.options[:property_only]).to be_nil end end context 'with custom property "except" filtering' do before :each do expect(@twig.options[:property_except]).to be_nil end it 'recognizes `--except-<property>` and sets a `:property_except` option' do allow(Twig::Branch).to receive(:all_property_names) { %w[foo] } @twig.read_cli_options!(%w[--except-foo test]) expect(@twig.options[:property_except]).to eq(:foo => /test/) end it 'recognizes `--except-branch` and `--except-<property>` together' do allow(Twig::Branch).to receive(:all_property_names) { %w[foo] } @twig.read_cli_options!(%w[--except-branch test --except-foo bar]) expect(@twig.options[:property_except]).to eq( :branch => /test/, :foo => /bar/ ) end it 'does not recognize `--except-<property>` for a missing property' do property_name = 'foo' expect(Twig::Branch.all_property_names).not_to include(property_name) allow(@twig).to receive(:puts) expect { @twig.read_cli_options!(["--except-#{property_name}", 'test']) }.to raise_exception { |exception| expect(exception).to be_a(SystemExit) expect(exception.status).to eq(1) } expect(@twig.options[:property_except]).to be_nil end end it 'recognizes `--format` and sets a `:format` option' do expect(@twig.options[:format]).to be_nil @twig.read_cli_options!(%w[--format json]) expect(@twig.options[:format]).to eq(:json) end it 'recognizes `--all` and unsets other options except `:branch`' do @twig.set_option(:max_days_old, 30) @twig.set_option(:property_except, :branch => /test/) @twig.set_option(:property_only, :branch => /test/) @twig.read_cli_options!(['--all']) expect(@twig.options[:max_days_old]).to be_nil expect(@twig.options[:property_except]).to be_nil expect(@twig.options[:property_only]).to be_nil end it 'recognizes `--branch-width`' do expect(@twig.options[:property_width]).to be_nil expect(@twig).to receive(:set_option).with(:property_width, :branch => '10') @twig.read_cli_options!(%w[--branch-width 10]) end it 'recognizes `--<property>-width`' do allow(Twig::Branch).to receive(:all_property_names) { %w[foo] } expect(@twig.options[:property_width]).to be_nil expect(@twig).to receive(:set_option).with(:property_width, :foo => '10') @twig.read_cli_options!(%w[--foo-width 10]) end it 'recognizes `--only-property`' do expect(@twig.options[:property_only_name]).to be_nil @twig.read_cli_options!(%w[--only-property foo]) expect(@twig.options[:property_only_name]).to eq(/foo/) end it 'recognizes `--except-property`' do expect(@twig.options[:property_except_name]).to be_nil @twig.read_cli_options!(%w[--except-property foo]) expect(@twig.options[:property_except_name]).to eq(/foo/) end it 'recognizes `--header-style`' do expect(@twig.options[:header_color]).to eq(Twig::DEFAULT_HEADER_COLOR) expect(@twig.options[:header_weight]).to be_nil @twig.read_cli_options!(['--header-style', 'green bold']) expect(@twig.options[:header_color]).to eq(:green) expect(@twig.options[:header_weight]).to eq(:bold) end it 'recognizes `--reverse`' do expect(@twig.options[:reverse]).to be_nil @twig.read_cli_options!(['--reverse']) expect(@twig.options[:reverse]).to be_true end it 'recognizes `--github-api-uri-prefix`' do expect(@twig.options[:github_api_uri_prefix]).to eq(Twig::DEFAULT_GITHUB_API_URI_PREFIX) prefix = 'https://github-enterprise.example.com/api/v3' @twig.read_cli_options!(['--github-api-uri-prefix', prefix]) expect(@twig.options[:github_api_uri_prefix]).to eq(prefix) end it 'recognizes `--github-uri-prefix`' do expect(@twig.options[:github_uri_prefix]).to eq(Twig::DEFAULT_GITHUB_URI_PREFIX) prefix = 'https://github-enterprise.example.com' @twig.read_cli_options!(['--github-uri-prefix', prefix]) expect(@twig.options[:github_uri_prefix]).to eq(prefix) end it 'handles invalid options' do expect(@twig).to receive(:abort_for_option_exception) do |exception| expect(exception).to be_a(OptionParser::InvalidOption) expect(exception.message).to include('invalid option: --foo') end @twig.read_cli_options!(['--foo']) end it 'handles missing arguments' do expect(@twig).to receive(:abort_for_option_exception) do |exception| expect(exception).to be_a(OptionParser::MissingArgument) expect(exception.message).to include('missing argument: --branch') end @twig.read_cli_options!(['--branch']) end end describe '#abort_for_option_exception' do before :each do @twig = Twig.new end it 'prints a message and aborts' do expect(@twig).to receive(:puts) do |message| expect(message).to include('`twig --help`') end expect { exception = Exception.new('test exception') @twig.abort_for_option_exception(exception) }.to raise_exception { |exception| expect(exception).to be_a(SystemExit) expect(exception.status).to eq(1) } end end describe '#exec_subcommand_if_any' do before :each do @twig = Twig.new @branch_name = 'test' allow(Twig).to receive(:run) allow(@twig).to receive(:current_branch_name) { @branch_name } end it 'recognizes a subcommand' do command_path = '/path/to/bin/twig-subcommand' expect(Twig).to receive(:run).with('which twig-subcommand 2>/dev/null'). and_return(command_path) expect(@twig).to receive(:exec).with(command_path) { exit } # Since we're stubbing `exec` (with an expectation), we still need it # to exit early like the real implementation. The following handles the # exit somewhat gracefully. expect { @twig.read_cli_args!(['subcommand']) }.to raise_exception { |exception| expect(exception).to be_a(SystemExit) expect(exception.status).to eq(0) } end it 'does not recognize a subcommand' do expect(Twig).to receive(:run). with('which twig-subcommand 2>/dev/null').and_return('') expect(@twig).not_to receive(:exec) allow(@twig).to receive(:abort) @twig.read_cli_args!(['subcommand']) end end describe '#read_cli_args!' do before :each do @twig = Twig.new end it 'checks for and executes a subcommand if there are any args' do expect(@twig).to receive(:exec_subcommand_if_any).with(['foo']) { exit } expect { @twig.read_cli_args!(['foo']) }.to raise_exception { |exception| expect(exception).to be_a(SystemExit) expect(exception.status).to eq(0) } end it 'does not check for a subcommand if there are no args' do branch_list = %[foo bar] expect(@twig).not_to receive(:exec_subcommand_if_any) allow(@twig).to receive(:list_branches).and_return(branch_list) allow(@twig).to receive(:puts).with(branch_list) @twig.read_cli_args!([]) end it 'lists branches' do branch_list = %[foo bar] expect(@twig).to receive(:list_branches).and_return(branch_list) expect(@twig).to receive(:puts).with(branch_list) @twig.read_cli_args!([]) end it 'prints branch properties as JSON' do branches_json = { 'branch1' => { 'last-commit-time' => '2000-01-01' }, 'branch2' => { 'last-commit-time' => '2000-01-01' } }.to_json expect(@twig).to receive(:branches_json).and_return(branches_json) expect(@twig).to receive(:puts).with(branches_json) @twig.read_cli_args!(%w[--format json]) end context 'getting properties' do before :each do @branch_name = 'test' @property_name = 'foo' @property_value = 'bar' end it 'gets a property for the current branch' do expect(@twig).to receive(:current_branch_name).and_return(@branch_name) expect(@twig).to receive(:get_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([@property_name]) end it 'gets a property for a specified branch' do expect(Twig::Branch).to receive(:all_branch_names).and_return([@branch_name]) @twig.set_option(:branch, @branch_name) expect(@twig).to receive(:get_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([@property_name]) end end context 'setting properties' do before :each do @branch_name = 'test' @property_name = 'foo' @property_value = 'bar' @message = 'Saved.' end it 'sets a property for the current branch' do expect(@twig).to receive(:current_branch_name).and_return(@branch_name) expect(@twig).to receive(:set_branch_property_for_cli). with(@branch_name, @property_name, @property_value) @twig.read_cli_args!([@property_name, @property_value]) end it 'sets a property for a specified branch' do expect(Twig::Branch).to receive(:all_branch_names).and_return([@branch_name]) @twig.set_option(:branch, @branch_name) expect(@twig).to receive(:set_branch_property_for_cli). with(@branch_name, @property_name, @property_value). and_return(@message) @twig.read_cli_args!([@property_name, @property_value]) end end context 'unsetting properties' do before :each do @branch_name = 'test' @property_name = 'foo' @message = 'Removed.' @twig.set_option(:unset_property, @property_name) end it 'unsets a property for the current branch' do expect(@twig).to receive(:current_branch_name).and_return(@branch_name) expect(@twig).to receive(:unset_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([]) end it 'unsets a property for a specified branch' do expect(Twig::Branch).to receive(:all_branch_names).and_return([@branch_name]) @twig.set_option(:branch, @branch_name) expect(@twig).to receive(:unset_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([]) end end end describe '#get_branch_property_for_cli' do before :each do @twig = Twig.new @branch_name = 'test' @property_name = 'foo' end it 'gets a property' do property_value = 'bar' expect(@twig).to receive(:get_branch_property). with(@branch_name, @property_name).and_return(property_value) expect(@twig).to receive(:puts).with(property_value) @twig.get_branch_property_for_cli(@branch_name, @property_name) end it 'shows an error when getting a property that is not set' do error_message = 'test error' expect(@twig).to receive(:get_branch_property). with(@branch_name, @property_name).and_return(nil) allow_any_instance_of(Twig::Branch::MissingPropertyError). to receive(:message) { error_message } expect(@twig).to receive(:abort).with(error_message) @twig.get_branch_property_for_cli(@branch_name, @property_name) end it 'handles ArgumentError when getting an invalid branch property name' do bad_property_name = '' error_message = 'test error' expect(@twig).to receive(:get_branch_property). with(@branch_name, bad_property_name) do raise ArgumentError, error_message end expect(@twig).to receive(:abort).with(error_message) @twig.get_branch_property_for_cli(@branch_name, bad_property_name) end end describe '#set_branch_property_for_cli' do before :each do @twig = Twig.new @branch_name = 'test' @property_name = 'foo' end it 'sets a property for the specified branch' do success_message = 'test success' property_value = 'bar' expect(@twig).to receive(:set_branch_property). with(@branch_name, @property_name, property_value). and_return(success_message) expect(@twig).to receive(:puts).with(success_message) @twig.set_branch_property_for_cli(@branch_name, @property_name, property_value) end it 'handles ArgumentError when unsetting an invalid branch property name' do error_message = 'test error' property_value = '' expect(@twig).to receive(:set_branch_property). with(@branch_name, @property_name, property_value) do raise ArgumentError, error_message end expect(@twig).to receive(:abort).with(error_message) @twig.set_branch_property_for_cli(@branch_name, @property_name, property_value) end it 'handles RuntimeError when Git is unable to set a branch property' do error_message = 'test error' property_value = '' expect(@twig).to receive(:set_branch_property). with(@branch_name, @property_name, property_value) do raise RuntimeError, error_message end expect(@twig).to receive(:abort).with(error_message) @twig.set_branch_property_for_cli(@branch_name, @property_name, property_value) end end describe '#unset_branch_property_for_cli' do before :each do @twig = Twig.new @branch_name = 'test' @property_name = 'foo' end it 'unsets a property for the specified branch' do success_message = 'test success' expect(@twig).to receive(:unset_branch_property). with(@branch_name, @property_name).and_return(success_message) expect(@twig).to receive(:puts).with(success_message) @twig.unset_branch_property_for_cli(@branch_name, @property_name) end it 'handles ArgumentError when unsetting an invalid branch property name' do error_message = 'test error' expect(@twig).to receive(:unset_branch_property). with(@branch_name, @property_name) do raise ArgumentError, error_message end expect(@twig).to receive(:abort).with(error_message) @twig.unset_branch_property_for_cli(@branch_name, @property_name) end it 'handles MissingPropertyError when unsetting a branch property that is not set' do error_message = 'test error' expect(@twig).to receive(:unset_branch_property). with(@branch_name, @property_name) do raise Twig::Branch::MissingPropertyError, error_message end expect(@twig).to receive(:abort).with(error_message) @twig.unset_branch_property_for_cli(@branch_name, @property_name) end end end
require 'spec_helper' describe Twig::Cli do describe '#help_description' do before :each do @twig = Twig.new end it 'returns short text in a single line' do text = 'The quick brown fox.' result = @twig.help_description(text, :width => 80) result.should == [text] end it 'returns long text in a string with line breaks' do text = 'The quick brown fox jumps over the lazy, lazy dog.' result = @twig.help_description(text, :width => 20) result.should == [ 'The quick brown fox', 'jumps over the lazy,', 'lazy dog.' ] end it 'breaks a long word by max line length' do text = 'Thequickbrownfoxjumpsoverthelazydog.' result = @twig.help_description(text, :width => 20) result.should == [ 'Thequickbrownfoxjump', 'soverthelazydog.' ] end it 'adds a separator line' do text = 'The quick brown fox.' result = @twig.help_description(text, :width => 80, :add_separator => true) result.should == [text, ' '] end end describe '#help_paragraph' do before :each do @twig = Twig.new end it 'returns long text in a paragraph with line breaks' do text = Array.new(5) { 'The quick brown fox jumps over the lazy dog.' }.join(' ') result = @twig.help_paragraph(text) result.should == [ "The quick brown fox jumps over the lazy dog. The quick brown fox jumps over the", "lazy dog. The quick brown fox jumps over the lazy dog. The quick brown fox jumps", "over the lazy dog. The quick brown fox jumps over the lazy dog." ].join("\n") end end describe '#read_cli_options!' do before :each do @twig = Twig.new end it 'recognizes `--unset` and sets an `:unset_property` option' do @twig.options[:unset_property].should be_nil # Precondition @twig.read_cli_options!(%w[--unset test]) @twig.options[:unset_property].should == 'test' end it 'recognizes `--version` and prints the current version' do @twig.should_receive(:puts).with(Twig::VERSION) @twig.should_receive(:exit) @twig.read_cli_options!(['--version']) end it 'recognizes `-b` and sets a `:branch` option' do @twig.should_receive(:all_branch_names).and_return(['test']) @twig.options[:branch].should be_nil # Precondition @twig.read_cli_options!(%w[-b test]) @twig.options[:branch].should == 'test' end it 'recognizes `--branch` and sets a `:branch` option' do @twig.should_receive(:all_branch_names).and_return(['test']) @twig.options[:branch].should be_nil # Precondition @twig.read_cli_options!(%w[--branch test]) @twig.options[:branch].should == 'test' end it 'recognizes `--max-days-old` and sets a `:max_days_old` option' do @twig.options[:max_days_old].should be_nil # Precondition @twig.read_cli_options!(%w[--max-days-old 30]) @twig.options[:max_days_old].should == 30 end it 'recognizes `--except-branch` and sets a `:property_except` option' do @twig.options[:property_except].should be_nil # Precondition @twig.read_cli_options!(%w[--except-branch test]) @twig.options[:property_except].should == { :branch => /test/ } end it 'recognizes `--only-branch` and sets a `:property_only` option' do @twig.options[:property_only].should be_nil # Precondition @twig.read_cli_options!(%w[--only-branch test]) @twig.options[:property_only].should == { :branch => /test/ } end context 'with custom property "only" filtering' do before :each do @twig.options[:property_only].should be_nil # Precondition end it 'recognizes `--only-<property>` and sets a `:property_only` option' do Twig::Branch.stub(:all_properties) { %w[foo] } @twig.read_cli_options!(%w[--only-foo test]) @twig.options[:property_only].should == { :foo => /test/ } end it 'recognizes `--only-branch` and `--only-<property>` together' do Twig::Branch.stub(:all_properties) { %w[foo] } @twig.read_cli_options!(%w[--only-branch test --only-foo bar]) @twig.options[:property_only].should == { :branch => /test/, :foo => /bar/ } end it 'does not recognize `--only-<property>` for a missing property' do property_name = 'foo' Twig::Branch.all_properties.should_not include(property_name) # Precondition @twig.stub(:puts) begin @twig.read_cli_options!(["--only-#{property_name}", 'test']) rescue SystemExit => exception expected_exception = exception end expected_exception.should_not be_nil expected_exception.status.should == 0 @twig.options[:property_only].should be_nil end end context 'with custom property "except" filtering' do before :each do @twig.options[:property_except].should be_nil # Precondition end it 'recognizes `--except-<property>` and sets a `:property_except` option' do Twig::Branch.stub(:all_properties) { %w[foo] } @twig.read_cli_options!(%w[--except-foo test]) @twig.options[:property_except].should == { :foo => /test/ } end it 'recognizes `--except-branch` and `--except-<property>` together' do Twig::Branch.stub(:all_properties) { %w[foo] } @twig.read_cli_options!(%w[--except-branch test --except-foo bar]) @twig.options[:property_except].should == { :branch => /test/, :foo => /bar/ } end it 'does not recognize `--except-<property>` for a missing property' do property_name = 'foo' Twig::Branch.all_properties.should_not include(property_name) # Precondition @twig.stub(:puts) begin @twig.read_cli_options!(["--except-#{property_name}", 'test']) rescue SystemExit => exception expected_exception = exception end expected_exception.should_not be_nil expected_exception.status.should == 0 @twig.options[:property_except].should be_nil end end it 'recognizes `--all` and unsets other options except `:branch`' do @twig.set_option(:max_days_old, 30) @twig.set_option(:property_except, :branch => /test/) @twig.set_option(:property_only, :branch => /test/) @twig.read_cli_options!(['--all']) @twig.options[:max_days_old].should be_nil @twig.options[:property_except].should be_nil @twig.options[:property_only].should be_nil end it 'recognizes `--header-style`' do @twig.options[:header_color].should == Twig::DEFAULT_HEADER_COLOR @twig.options[:header_weight].should be_nil @twig.read_cli_options!(['--header-style', 'green bold']) @twig.options[:header_color].should == :green @twig.options[:header_weight].should == :bold end it 'handles invalid options' do @twig.should_receive(:abort_for_option_exception) do |exception| exception.should be_a(OptionParser::InvalidOption) exception.message.should include('invalid option: --foo') end @twig.read_cli_options!(['--foo']) end it 'handles missing arguments' do @twig.should_receive(:abort_for_option_exception) do |exception| exception.should be_a(OptionParser::MissingArgument) exception.message.should include('missing argument: --branch') end @twig.read_cli_options!(['--branch']) end end describe '#abort_for_option_exception' do before :each do @twig = Twig.new end it 'prints a message and exits' do exception = Exception.new('test exception') @twig.should_receive(:puts).with(exception.message) @twig.should_receive(:puts) do |message| message.should include('`twig --help`') end @twig.should_receive(:exit) @twig.abort_for_option_exception(exception) end end describe '#read_cli_args!' do before :each do @twig = Twig.new end it 'lists branches' do branch_list = %[foo bar] @twig.should_receive(:list_branches).and_return(branch_list) @twig.should_receive(:puts).with(branch_list) @twig.read_cli_args!([]) end context 'running a subcommand' do before :each do Twig.stub(:run) @branch_name = 'test' @twig.stub(:current_branch_name => @branch_name) end it 'recognizes a subcommand' do command_path = '/path/to/bin/twig-subcommand' Twig.should_receive(:run).with('which twig-subcommand 2>/dev/null'). and_return(command_path) @twig.should_receive(:exec).with(command_path) { exit } # Since we're stubbing `exec` (with an expectation), we still need it # to exit early like the real implementation. The following handles the # exit somewhat gracefully. begin @twig.read_cli_args!(['subcommand']) rescue SystemExit => exception expected_exception = exception end expected_exception.should_not be_nil expected_exception.status.should == 0 end it 'does not recognize a subcommand' do Twig.should_receive(:run).with('which twig-subcommand 2>/dev/null').and_return('') @twig.should_not_receive(:exec) @twig.stub(:abort) @twig.read_cli_args!(['subcommand']) end end context 'getting properties' do before :each do @branch_name = 'test' @property_name = 'foo' @property_value = 'bar' end it 'gets a property for the current branch' do @twig.should_receive(:current_branch_name).and_return(@branch_name) @twig.should_receive(:get_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([@property_name]) end it 'gets a property for a specified branch' do @twig.should_receive(:all_branch_names).and_return([@branch_name]) @twig.set_option(:branch, @branch_name) @twig.should_receive(:get_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([@property_name]) end end context 'setting properties' do before :each do @branch_name = 'test' @property_name = 'foo' @property_value = 'bar' @message = 'Saved.' end it 'sets a property for the current branch' do @twig.should_receive(:current_branch_name).and_return(@branch_name) @twig.should_receive(:set_branch_property_for_cli). with(@branch_name, @property_name, @property_value) @twig.read_cli_args!([@property_name, @property_value]) end it 'sets a property for a specified branch' do @twig.should_receive(:all_branch_names).and_return([@branch_name]) @twig.set_option(:branch, @branch_name) @twig.should_receive(:set_branch_property_for_cli). with(@branch_name, @property_name, @property_value). and_return(@message) @twig.read_cli_args!([@property_name, @property_value]) end end context 'unsetting properties' do before :each do @branch_name = 'test' @property_name = 'foo' @message = 'Removed.' @twig.set_option(:unset_property, @property_name) end it 'unsets a property for the current branch' do @twig.should_receive(:current_branch_name).and_return(@branch_name) @twig.should_receive(:unset_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([]) end it 'unsets a property for a specified branch' do @twig.should_receive(:all_branch_names).and_return([@branch_name]) @twig.set_option(:branch, @branch_name) @twig.should_receive(:unset_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([]) end end end describe '#get_branch_property_for_cli' do before :each do @twig = Twig.new @branch_name = 'test' @property_name = 'foo' end it 'gets a property' do property_value = 'bar' @twig.should_receive(:get_branch_property). with(@branch_name, @property_name).and_return(property_value) @twig.should_receive(:puts).with(property_value) @twig.get_branch_property_for_cli(@branch_name, @property_name) end it 'shows an error when getting a property that is not set' do error_message = 'test error' @twig.should_receive(:get_branch_property). with(@branch_name, @property_name).and_return(nil) Twig::Branch::MissingPropertyError.any_instance. stub(:message) { error_message } @twig.should_receive(:abort).with(error_message) @twig.get_branch_property_for_cli(@branch_name, @property_name) end it 'handles ArgumentError when getting an invalid branch property name' do bad_property_name = '' error_message = 'test error' @twig.should_receive(:get_branch_property). with(@branch_name, bad_property_name) do raise ArgumentError, error_message end @twig.should_receive(:abort).with(error_message) @twig.get_branch_property_for_cli(@branch_name, bad_property_name) end end describe '#set_branch_property_for_cli' do before :each do @twig = Twig.new @branch_name = 'test' @property_name = 'foo' end it 'sets a property for the specified branch' do success_message = 'test success' property_value = 'bar' @twig.should_receive(:set_branch_property). with(@branch_name, @property_name, property_value). and_return(success_message) @twig.should_receive(:puts).with(success_message) @twig.set_branch_property_for_cli(@branch_name, @property_name, property_value) end it 'handles ArgumentError when unsetting an invalid branch property name' do error_message = 'test error' property_value = '' @twig.should_receive(:set_branch_property). with(@branch_name, @property_name, property_value) do raise ArgumentError, error_message end @twig.should_receive(:abort).with(error_message) @twig.set_branch_property_for_cli(@branch_name, @property_name, property_value) end it 'handles RuntimeError when Git is unable to set a branch property' do error_message = 'test error' property_value = '' @twig.should_receive(:set_branch_property). with(@branch_name, @property_name, property_value) do raise RuntimeError, error_message end @twig.should_receive(:abort).with(error_message) @twig.set_branch_property_for_cli(@branch_name, @property_name, property_value) end end describe '#unset_branch_property_for_cli' do before :each do @twig = Twig.new @branch_name = 'test' @property_name = 'foo' end it 'unsets a property for the specified branch' do success_message = 'test success' @twig.should_receive(:unset_branch_property). with(@branch_name, @property_name).and_return(success_message) @twig.should_receive(:puts).with(success_message) @twig.unset_branch_property_for_cli(@branch_name, @property_name) end it 'handles ArgumentError when unsetting an invalid branch property name' do error_message = 'test error' @twig.should_receive(:unset_branch_property). with(@branch_name, @property_name) do raise ArgumentError, error_message end @twig.should_receive(:abort).with(error_message) @twig.unset_branch_property_for_cli(@branch_name, @property_name) end it 'handles MissingPropertyError when unsetting a branch property that is not set' do error_message = 'test error' @twig.should_receive(:unset_branch_property). with(@branch_name, @property_name) do raise Twig::Branch::MissingPropertyError, error_message end @twig.should_receive(:abort).with(error_message) @twig.unset_branch_property_for_cli(@branch_name, @property_name) end end end Add specs for `--help` require 'spec_helper' describe Twig::Cli do describe '#help_description' do before :each do @twig = Twig.new end it 'returns short text in a single line' do text = 'The quick brown fox.' result = @twig.help_description(text, :width => 80) result.should == [text] end it 'returns long text in a string with line breaks' do text = 'The quick brown fox jumps over the lazy, lazy dog.' result = @twig.help_description(text, :width => 20) result.should == [ 'The quick brown fox', 'jumps over the lazy,', 'lazy dog.' ] end it 'breaks a long word by max line length' do text = 'Thequickbrownfoxjumpsoverthelazydog.' result = @twig.help_description(text, :width => 20) result.should == [ 'Thequickbrownfoxjump', 'soverthelazydog.' ] end it 'adds a separator line' do text = 'The quick brown fox.' result = @twig.help_description(text, :width => 80, :add_separator => true) result.should == [text, ' '] end end describe '#help_paragraph' do before :each do @twig = Twig.new end it 'returns long text in a paragraph with line breaks' do text = Array.new(5) { 'The quick brown fox jumps over the lazy dog.' }.join(' ') result = @twig.help_paragraph(text) result.should == [ "The quick brown fox jumps over the lazy dog. The quick brown fox jumps over the", "lazy dog. The quick brown fox jumps over the lazy dog. The quick brown fox jumps", "over the lazy dog. The quick brown fox jumps over the lazy dog." ].join("\n") end end describe '#read_cli_options!' do before :each do @twig = Twig.new end it 'recognizes `--unset` and sets an `:unset_property` option' do @twig.options[:unset_property].should be_nil # Precondition @twig.read_cli_options!(%w[--unset test]) @twig.options[:unset_property].should == 'test' end it 'recognizes `--help` and prints the help content' do help_lines = [] @twig.stub(:puts) { |message| help_lines << message.strip } @twig.should_receive(:exit) @twig.read_cli_options!(['--help']) help_lines.should include("Twig v#{Twig::VERSION}") help_lines.should include('http://rondevera.github.com/twig') end it 'recognizes `--version` and prints the current version' do @twig.should_receive(:puts).with(Twig::VERSION) @twig.should_receive(:exit) @twig.read_cli_options!(['--version']) end it 'recognizes `-b` and sets a `:branch` option' do @twig.should_receive(:all_branch_names).and_return(['test']) @twig.options[:branch].should be_nil # Precondition @twig.read_cli_options!(%w[-b test]) @twig.options[:branch].should == 'test' end it 'recognizes `--branch` and sets a `:branch` option' do @twig.should_receive(:all_branch_names).and_return(['test']) @twig.options[:branch].should be_nil # Precondition @twig.read_cli_options!(%w[--branch test]) @twig.options[:branch].should == 'test' end it 'recognizes `--max-days-old` and sets a `:max_days_old` option' do @twig.options[:max_days_old].should be_nil # Precondition @twig.read_cli_options!(%w[--max-days-old 30]) @twig.options[:max_days_old].should == 30 end it 'recognizes `--except-branch` and sets a `:property_except` option' do @twig.options[:property_except].should be_nil # Precondition @twig.read_cli_options!(%w[--except-branch test]) @twig.options[:property_except].should == { :branch => /test/ } end it 'recognizes `--only-branch` and sets a `:property_only` option' do @twig.options[:property_only].should be_nil # Precondition @twig.read_cli_options!(%w[--only-branch test]) @twig.options[:property_only].should == { :branch => /test/ } end context 'with custom property "only" filtering' do before :each do @twig.options[:property_only].should be_nil # Precondition end it 'recognizes `--only-<property>` and sets a `:property_only` option' do Twig::Branch.stub(:all_properties) { %w[foo] } @twig.read_cli_options!(%w[--only-foo test]) @twig.options[:property_only].should == { :foo => /test/ } end it 'recognizes `--only-branch` and `--only-<property>` together' do Twig::Branch.stub(:all_properties) { %w[foo] } @twig.read_cli_options!(%w[--only-branch test --only-foo bar]) @twig.options[:property_only].should == { :branch => /test/, :foo => /bar/ } end it 'does not recognize `--only-<property>` for a missing property' do property_name = 'foo' Twig::Branch.all_properties.should_not include(property_name) # Precondition @twig.stub(:puts) begin @twig.read_cli_options!(["--only-#{property_name}", 'test']) rescue SystemExit => exception expected_exception = exception end expected_exception.should_not be_nil expected_exception.status.should == 0 @twig.options[:property_only].should be_nil end end context 'with custom property "except" filtering' do before :each do @twig.options[:property_except].should be_nil # Precondition end it 'recognizes `--except-<property>` and sets a `:property_except` option' do Twig::Branch.stub(:all_properties) { %w[foo] } @twig.read_cli_options!(%w[--except-foo test]) @twig.options[:property_except].should == { :foo => /test/ } end it 'recognizes `--except-branch` and `--except-<property>` together' do Twig::Branch.stub(:all_properties) { %w[foo] } @twig.read_cli_options!(%w[--except-branch test --except-foo bar]) @twig.options[:property_except].should == { :branch => /test/, :foo => /bar/ } end it 'does not recognize `--except-<property>` for a missing property' do property_name = 'foo' Twig::Branch.all_properties.should_not include(property_name) # Precondition @twig.stub(:puts) begin @twig.read_cli_options!(["--except-#{property_name}", 'test']) rescue SystemExit => exception expected_exception = exception end expected_exception.should_not be_nil expected_exception.status.should == 0 @twig.options[:property_except].should be_nil end end it 'recognizes `--all` and unsets other options except `:branch`' do @twig.set_option(:max_days_old, 30) @twig.set_option(:property_except, :branch => /test/) @twig.set_option(:property_only, :branch => /test/) @twig.read_cli_options!(['--all']) @twig.options[:max_days_old].should be_nil @twig.options[:property_except].should be_nil @twig.options[:property_only].should be_nil end it 'recognizes `--header-style`' do @twig.options[:header_color].should == Twig::DEFAULT_HEADER_COLOR @twig.options[:header_weight].should be_nil @twig.read_cli_options!(['--header-style', 'green bold']) @twig.options[:header_color].should == :green @twig.options[:header_weight].should == :bold end it 'handles invalid options' do @twig.should_receive(:abort_for_option_exception) do |exception| exception.should be_a(OptionParser::InvalidOption) exception.message.should include('invalid option: --foo') end @twig.read_cli_options!(['--foo']) end it 'handles missing arguments' do @twig.should_receive(:abort_for_option_exception) do |exception| exception.should be_a(OptionParser::MissingArgument) exception.message.should include('missing argument: --branch') end @twig.read_cli_options!(['--branch']) end end describe '#abort_for_option_exception' do before :each do @twig = Twig.new end it 'prints a message and exits' do exception = Exception.new('test exception') @twig.should_receive(:puts).with(exception.message) @twig.should_receive(:puts) do |message| message.should include('`twig --help`') end @twig.should_receive(:exit) @twig.abort_for_option_exception(exception) end end describe '#read_cli_args!' do before :each do @twig = Twig.new end it 'lists branches' do branch_list = %[foo bar] @twig.should_receive(:list_branches).and_return(branch_list) @twig.should_receive(:puts).with(branch_list) @twig.read_cli_args!([]) end context 'running a subcommand' do before :each do Twig.stub(:run) @branch_name = 'test' @twig.stub(:current_branch_name => @branch_name) end it 'recognizes a subcommand' do command_path = '/path/to/bin/twig-subcommand' Twig.should_receive(:run).with('which twig-subcommand 2>/dev/null'). and_return(command_path) @twig.should_receive(:exec).with(command_path) { exit } # Since we're stubbing `exec` (with an expectation), we still need it # to exit early like the real implementation. The following handles the # exit somewhat gracefully. begin @twig.read_cli_args!(['subcommand']) rescue SystemExit => exception expected_exception = exception end expected_exception.should_not be_nil expected_exception.status.should == 0 end it 'does not recognize a subcommand' do Twig.should_receive(:run).with('which twig-subcommand 2>/dev/null').and_return('') @twig.should_not_receive(:exec) @twig.stub(:abort) @twig.read_cli_args!(['subcommand']) end end context 'getting properties' do before :each do @branch_name = 'test' @property_name = 'foo' @property_value = 'bar' end it 'gets a property for the current branch' do @twig.should_receive(:current_branch_name).and_return(@branch_name) @twig.should_receive(:get_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([@property_name]) end it 'gets a property for a specified branch' do @twig.should_receive(:all_branch_names).and_return([@branch_name]) @twig.set_option(:branch, @branch_name) @twig.should_receive(:get_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([@property_name]) end end context 'setting properties' do before :each do @branch_name = 'test' @property_name = 'foo' @property_value = 'bar' @message = 'Saved.' end it 'sets a property for the current branch' do @twig.should_receive(:current_branch_name).and_return(@branch_name) @twig.should_receive(:set_branch_property_for_cli). with(@branch_name, @property_name, @property_value) @twig.read_cli_args!([@property_name, @property_value]) end it 'sets a property for a specified branch' do @twig.should_receive(:all_branch_names).and_return([@branch_name]) @twig.set_option(:branch, @branch_name) @twig.should_receive(:set_branch_property_for_cli). with(@branch_name, @property_name, @property_value). and_return(@message) @twig.read_cli_args!([@property_name, @property_value]) end end context 'unsetting properties' do before :each do @branch_name = 'test' @property_name = 'foo' @message = 'Removed.' @twig.set_option(:unset_property, @property_name) end it 'unsets a property for the current branch' do @twig.should_receive(:current_branch_name).and_return(@branch_name) @twig.should_receive(:unset_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([]) end it 'unsets a property for a specified branch' do @twig.should_receive(:all_branch_names).and_return([@branch_name]) @twig.set_option(:branch, @branch_name) @twig.should_receive(:unset_branch_property_for_cli). with(@branch_name, @property_name) @twig.read_cli_args!([]) end end end describe '#get_branch_property_for_cli' do before :each do @twig = Twig.new @branch_name = 'test' @property_name = 'foo' end it 'gets a property' do property_value = 'bar' @twig.should_receive(:get_branch_property). with(@branch_name, @property_name).and_return(property_value) @twig.should_receive(:puts).with(property_value) @twig.get_branch_property_for_cli(@branch_name, @property_name) end it 'shows an error when getting a property that is not set' do error_message = 'test error' @twig.should_receive(:get_branch_property). with(@branch_name, @property_name).and_return(nil) Twig::Branch::MissingPropertyError.any_instance. stub(:message) { error_message } @twig.should_receive(:abort).with(error_message) @twig.get_branch_property_for_cli(@branch_name, @property_name) end it 'handles ArgumentError when getting an invalid branch property name' do bad_property_name = '' error_message = 'test error' @twig.should_receive(:get_branch_property). with(@branch_name, bad_property_name) do raise ArgumentError, error_message end @twig.should_receive(:abort).with(error_message) @twig.get_branch_property_for_cli(@branch_name, bad_property_name) end end describe '#set_branch_property_for_cli' do before :each do @twig = Twig.new @branch_name = 'test' @property_name = 'foo' end it 'sets a property for the specified branch' do success_message = 'test success' property_value = 'bar' @twig.should_receive(:set_branch_property). with(@branch_name, @property_name, property_value). and_return(success_message) @twig.should_receive(:puts).with(success_message) @twig.set_branch_property_for_cli(@branch_name, @property_name, property_value) end it 'handles ArgumentError when unsetting an invalid branch property name' do error_message = 'test error' property_value = '' @twig.should_receive(:set_branch_property). with(@branch_name, @property_name, property_value) do raise ArgumentError, error_message end @twig.should_receive(:abort).with(error_message) @twig.set_branch_property_for_cli(@branch_name, @property_name, property_value) end it 'handles RuntimeError when Git is unable to set a branch property' do error_message = 'test error' property_value = '' @twig.should_receive(:set_branch_property). with(@branch_name, @property_name, property_value) do raise RuntimeError, error_message end @twig.should_receive(:abort).with(error_message) @twig.set_branch_property_for_cli(@branch_name, @property_name, property_value) end end describe '#unset_branch_property_for_cli' do before :each do @twig = Twig.new @branch_name = 'test' @property_name = 'foo' end it 'unsets a property for the specified branch' do success_message = 'test success' @twig.should_receive(:unset_branch_property). with(@branch_name, @property_name).and_return(success_message) @twig.should_receive(:puts).with(success_message) @twig.unset_branch_property_for_cli(@branch_name, @property_name) end it 'handles ArgumentError when unsetting an invalid branch property name' do error_message = 'test error' @twig.should_receive(:unset_branch_property). with(@branch_name, @property_name) do raise ArgumentError, error_message end @twig.should_receive(:abort).with(error_message) @twig.unset_branch_property_for_cli(@branch_name, @property_name) end it 'handles MissingPropertyError when unsetting a branch property that is not set' do error_message = 'test error' @twig.should_receive(:unset_branch_property). with(@branch_name, @property_name) do raise Twig::Branch::MissingPropertyError, error_message end @twig.should_receive(:abort).with(error_message) @twig.unset_branch_property_for_cli(@branch_name, @property_name) end end end
module XeroGateway class Gateway include Http include Dates attr_accessor :client, :xero_url, :logger extend Forwardable def_delegators :client, :request_token, :access_token, :authorize_from_request, :authorize_from_access # # The consumer key and secret here correspond to those provided # to you by Xero inside the API Previewer. def initialize(consumer_key, consumer_secret, options = {}) @xero_url = options[:xero_url] || "https://api.xero.com/api.xro/2.0" @client = OAuth.new(consumer_key, consumer_secret, options) end # # Retrieve all contacts from Xero # # Usage : get_contacts(:order => :name) # get_contacts(:updated_after => Time) # # Note : modified_since is in UTC format (i.e. Brisbane is UTC+10) def get_contacts(options = {}) request_params = {} request_params[:ContactID] = options[:contact_id] if options[:contact_id] request_params[:ContactNumber] = options[:contact_number] if options[:contact_number] request_params[:OrderBy] = options[:order] if options[:order] request_params[:ModifiedAfter] = Gateway.format_date_time(options[:updated_after]) if options[:updated_after] request_params[:where] = options[:where] if options[:where] response_xml = http_get(@client, "#{@xero_url}/Contacts", request_params) parse_response(response_xml, {:request_params => request_params}, {:request_signature => 'GET/contacts'}) end # Retrieve a contact from Xero # Usage get_contact_by_id(contact_id) def get_contact_by_id(contact_id) get_contact(contact_id) end # Retrieve a contact from Xero # Usage get_contact_by_id(contact_id) def get_contact_by_number(contact_number) get_contact(nil, contact_number) end # Factory method for building new Contact objects associated with this gateway. def build_contact(contact = {}) case contact when Contact then contact.gateway = self when Hash then contact = Contact.new(contact.merge({:gateway => self})) end contact end # # Creates a contact in Xero # # Usage : # # contact = XeroGateway::Contact.new(:name => "THE NAME OF THE CONTACT #{Time.now.to_i}") # contact.email = "whoever@something.com" # contact.phone.number = "12345" # contact.address.line_1 = "LINE 1 OF THE ADDRESS" # contact.address.line_2 = "LINE 2 OF THE ADDRESS" # contact.address.line_3 = "LINE 3 OF THE ADDRESS" # contact.address.line_4 = "LINE 4 OF THE ADDRESS" # contact.address.city = "WELLINGTON" # contact.address.region = "WELLINGTON" # contact.address.country = "NEW ZEALAND" # contact.address.post_code = "6021" # # create_contact(contact) def create_contact(contact) save_contact(contact) end # # Updates an existing Xero contact # # Usage : # # contact = xero_gateway.get_contact(some_contact_id) # contact.email = "a_new_email_ddress" # # xero_gateway.update_contact(contact) def update_contact(contact) raise "contact_id or contact_number is required for updating contacts" if contact.contact_id.nil? and contact.contact_number.nil? save_contact(contact) end # # Updates an array of contacts in a single API operation. # # Usage : # contacts = [XeroGateway::Contact.new(:name => 'Joe Bloggs'), XeroGateway::Contact.new(:name => 'Jane Doe')] # result = gateway.update_contacts(contacts) # # Will update contacts with matching contact_id, contact_number or name or create if they don't exist. # def update_contacts(contacts) b = Builder::XmlMarkup.new request_xml = b.Contacts { contacts.each do | contact | contact.to_xml(b) end } response_xml = http_post(@client, "#{@xero_url}/Contacts", request_xml, {}) response = parse_response(response_xml, {:request_xml => request_xml}, {:request_signature => 'POST/contacts'}) response.contacts.each_with_index do | response_contact, index | contacts[index].contact_id = response_contact.contact_id if response_contact && response_contact.contact_id end response end # Retrieves all invoices from Xero # # Usage : get_invoices # get_invoices(:invoice_id => " 297c2dc5-cc47-4afd-8ec8-74990b8761e9") # # Note : modified_since is in UTC format (i.e. Brisbane is UTC+10) def get_invoices(options = {}) request_params = {} request_params[:InvoiceID] = options[:invoice_id] if options[:invoice_id] request_params[:InvoiceNumber] = options[:invoice_number] if options[:invoice_number] request_params[:OrderBy] = options[:order] if options[:order] request_params[:ModifiedAfter] = options[:modified_since] request_params[:where] = options[:where] if options[:where] response_xml = http_get(@client, "#{@xero_url}/Invoices", request_params) parse_response(response_xml, {:request_params => request_params}, {:request_signature => 'GET/Invoices'}) end # Retrieves a single invoice # # Usage : get_invoice("297c2dc5-cc47-4afd-8ec8-74990b8761e9") # By ID # get_invoice("OIT-12345") # By number def get_invoice(invoice_id_or_number) request_params = {} url = "#{@xero_url}/Invoices/#{URI.escape(invoice_id_or_number)}" response_xml = http_get(@client, url, request_params) parse_response(response_xml, {:request_params => request_params}, {:request_signature => 'GET/Invoice'}) end # Factory method for building new Invoice objects associated with this gateway. def build_invoice(invoice = {}) case invoice when Invoice then invoice.gateway = self when Hash then invoice = Invoice.new(invoice.merge(:gateway => self)) end invoice end # Creates an invoice in Xero based on an invoice object. # # Invoice and line item totals are calculated automatically. # # Usage : # # invoice = XeroGateway::Invoice.new({ # :invoice_type => "ACCREC", # :due_date => 1.month.from_now, # :invoice_number => "YOUR INVOICE NUMBER", # :reference => "YOUR REFERENCE (NOT NECESSARILY UNIQUE!)", # :line_amount_types => "Inclusive" # }) # invoice.contact = XeroGateway::Contact.new(:name => "THE NAME OF THE CONTACT") # invoice.contact.phone.number = "12345" # invoice.contact.address.line_1 = "LINE 1 OF THE ADDRESS" # invoice.line_items << XeroGateway::LineItem.new( # :description => "THE DESCRIPTION OF THE LINE ITEM", # :unit_amount => 100, # :tax_amount => 12.5, # :tracking_category => "THE TRACKING CATEGORY FOR THE LINE ITEM", # :tracking_option => "THE TRACKING OPTION FOR THE LINE ITEM" # ) # # create_invoice(invoice) def create_invoice(invoice) request_xml = invoice.to_xml response_xml = http_put(@client, "#{@xero_url}/Invoices", request_xml) response = parse_response(response_xml, {:request_xml => request_xml}, {:request_signature => 'PUT/invoice'}) # Xero returns invoices inside an <Invoices> tag, even though there's only ever # one for this request response.response_item = response.invoices.first if response.success? && response.invoice && response.invoice.invoice_id invoice.invoice_id = response.invoice.invoice_id end response end # # Creates an array of invoices with a single API request. # # Usage : # invoices = [XeroGateway::Invoice.new(...), XeroGateway::Invoice.new(...)] # result = gateway.create_invoices(invoices) # def create_invoices(invoices) b = Builder::XmlMarkup.new request_xml = b.Invoices { invoices.each do | invoice | invoice.to_xml(b) end } response_xml = http_put(@client, "#{@xero_url}/Invoices", request_xml, {}) response = parse_response(response_xml, {:request_xml => request_xml}, {:request_signature => 'PUT/invoices'}) response.invoices.each_with_index do | response_invoice, index | invoices[index].invoice_id = response_invoice.invoice_id if response_invoice && response_invoice.invoice_id end response end # # Gets all accounts for a specific organization in Xero. # def get_accounts response_xml = http_get(@client, "#{xero_url}/Accounts") parse_response(response_xml, {}, {:request_signature => 'GET/accounts'}) end # # Returns a XeroGateway::AccountsList object that makes working with # the Xero list of accounts easier and allows caching the results. # def get_accounts_list(load_on_init = true) AccountsList.new(self, load_on_init) end # # Gets all tracking categories for a specific organization in Xero. # def get_tracking_categories response_xml = http_get(@client, "#{xero_url}/TrackingCategories") parse_response(response_xml, {}, {:request_signature => 'GET/TrackingCategories'}) end # # Gets Organisation details # def get_organisation response_xml = http_get(@client, "#{xero_url}/Organisation") parse_response(response_xml, {}, {:request_signature => 'GET/organisation'}) end # # Gets all currencies for a specific organisation in Xero # def get_currencies response_xml = http_get(@client, "#{xero_url}/Currencies") parse_response(response_xml, {}, {:request_signature => 'GET/currencies'}) end # # Gets all Tax Rates for a specific organisation in Xero # def get_tax_rates response_xml = http_get(@client, "#{xero_url}/TaxRates") parse_response(response_xml, {}, {:request_signature => 'GET/tax_rates'}) end private def get_contact(contact_id = nil, contact_number = nil) request_params = contact_id ? { :contactID => contact_id } : { :contactNumber => contact_number } response_xml = http_get(@client, "#{@xero_url}/Contacts/#{URI.escape(contact_id||contact_number)}", request_params) parse_response(response_xml, {:request_params => request_params}, {:request_signature => 'GET/contact'}) end # Create or update a contact record based on if it has a contact_id or contact_number. def save_contact(contact) request_xml = contact.to_xml response_xml = nil create_or_save = nil if contact.contact_id.nil? && contact.contact_number.nil? # Create new contact record. response_xml = http_put(@client, "#{@xero_url}/Contacts", request_xml, {}) create_or_save = :create else # Update existing contact record. response_xml = http_post(@client, "#{@xero_url}/Contacts", request_xml, {}) create_or_save = :save end response = parse_response(response_xml, {:request_xml => request_xml}, {:request_signature => "#{create_or_save == :create ? 'PUT' : 'POST'}/contact"}) contact.contact_id = response.contact.contact_id if response.contact && response.contact.contact_id response end def parse_response(raw_response, request = {}, options = {}) response = XeroGateway::Response.new doc = REXML::Document.new(raw_response, :ignore_whitespace_nodes => :all) # check for responses we don't understand raise UnparseableResponse.new(doc.root.name) unless doc.root.name == "Response" response_element = REXML::XPath.first(doc, "/Response") response_element.children.reject { |e| e.is_a? REXML::Text }.each do |element| case(element.name) when "ID" then response.response_id = element.text when "Status" then response.status = element.text when "ProviderName" then response.provider = element.text when "DateTimeUTC" then response.date_time = element.text when "Contact" then response.response_item = Contact.from_xml(element, self) when "Invoice" then response.response_item = Invoice.from_xml(element, self, {:line_items_downloaded => options[:request_signature] != "GET/Invoices"}) when "Contacts" then element.children.each {|child| response.response_item << Contact.from_xml(child, self) } when "Invoices" then element.children.each {|child| response.response_item << Invoice.from_xml(child, self, {:line_items_downloaded => options[:request_signature] != "GET/Invoices"}) } when "Accounts" then element.children.each {|child| response.response_item << Account.from_xml(child) } when "TaxRates" then element.children.each {|child| response.response_item << TaxRate.from_xml(child) } when "Currencies" then element.children.each {|child| response.response_item << Currency.from_xml(child) } when "Organisations" then response.response_item = Organisation.from_xml(element.children.first) # Xero only returns the Authorized Organisation when "TrackingCategories" then element.children.each {|child| response.response_item << TrackingCategory.from_xml(child) } when "Errors" then element.children.each { |error| parse_error(error, response) } end end if response_element # If a single result is returned don't put it in an array if response.response_item.is_a?(Array) && response.response_item.size == 1 response.response_item = response.response_item.first end response.request_params = request[:request_params] response.request_xml = request[:request_xml] response.response_xml = raw_response response end def parse_error(error_element, response) response.errors << Error.new( :description => REXML::XPath.first(error_element, "Description").text, :date_time => REXML::XPath.first(error_element, "//DateTime").text, :type => REXML::XPath.first(error_element, "//ExceptionType").text, :message => REXML::XPath.first(error_element, "//Message").text ) end end end Only set ModifiedAfter param if present Fixes bug whereby if gateway.get_invoices is called without a :modified_since argument, the following URL is called from Xero: https://api.xero.com/api.xro/2.0/Invoices?ModifiedSince= module XeroGateway class Gateway include Http include Dates attr_accessor :client, :xero_url, :logger extend Forwardable def_delegators :client, :request_token, :access_token, :authorize_from_request, :authorize_from_access # # The consumer key and secret here correspond to those provided # to you by Xero inside the API Previewer. def initialize(consumer_key, consumer_secret, options = {}) @xero_url = options[:xero_url] || "https://api.xero.com/api.xro/2.0" @client = OAuth.new(consumer_key, consumer_secret, options) end # # Retrieve all contacts from Xero # # Usage : get_contacts(:order => :name) # get_contacts(:updated_after => Time) # # Note : modified_since is in UTC format (i.e. Brisbane is UTC+10) def get_contacts(options = {}) request_params = {} request_params[:ContactID] = options[:contact_id] if options[:contact_id] request_params[:ContactNumber] = options[:contact_number] if options[:contact_number] request_params[:OrderBy] = options[:order] if options[:order] request_params[:ModifiedAfter] = Gateway.format_date_time(options[:updated_after]) if options[:updated_after] request_params[:where] = options[:where] if options[:where] response_xml = http_get(@client, "#{@xero_url}/Contacts", request_params) parse_response(response_xml, {:request_params => request_params}, {:request_signature => 'GET/contacts'}) end # Retrieve a contact from Xero # Usage get_contact_by_id(contact_id) def get_contact_by_id(contact_id) get_contact(contact_id) end # Retrieve a contact from Xero # Usage get_contact_by_id(contact_id) def get_contact_by_number(contact_number) get_contact(nil, contact_number) end # Factory method for building new Contact objects associated with this gateway. def build_contact(contact = {}) case contact when Contact then contact.gateway = self when Hash then contact = Contact.new(contact.merge({:gateway => self})) end contact end # # Creates a contact in Xero # # Usage : # # contact = XeroGateway::Contact.new(:name => "THE NAME OF THE CONTACT #{Time.now.to_i}") # contact.email = "whoever@something.com" # contact.phone.number = "12345" # contact.address.line_1 = "LINE 1 OF THE ADDRESS" # contact.address.line_2 = "LINE 2 OF THE ADDRESS" # contact.address.line_3 = "LINE 3 OF THE ADDRESS" # contact.address.line_4 = "LINE 4 OF THE ADDRESS" # contact.address.city = "WELLINGTON" # contact.address.region = "WELLINGTON" # contact.address.country = "NEW ZEALAND" # contact.address.post_code = "6021" # # create_contact(contact) def create_contact(contact) save_contact(contact) end # # Updates an existing Xero contact # # Usage : # # contact = xero_gateway.get_contact(some_contact_id) # contact.email = "a_new_email_ddress" # # xero_gateway.update_contact(contact) def update_contact(contact) raise "contact_id or contact_number is required for updating contacts" if contact.contact_id.nil? and contact.contact_number.nil? save_contact(contact) end # # Updates an array of contacts in a single API operation. # # Usage : # contacts = [XeroGateway::Contact.new(:name => 'Joe Bloggs'), XeroGateway::Contact.new(:name => 'Jane Doe')] # result = gateway.update_contacts(contacts) # # Will update contacts with matching contact_id, contact_number or name or create if they don't exist. # def update_contacts(contacts) b = Builder::XmlMarkup.new request_xml = b.Contacts { contacts.each do | contact | contact.to_xml(b) end } response_xml = http_post(@client, "#{@xero_url}/Contacts", request_xml, {}) response = parse_response(response_xml, {:request_xml => request_xml}, {:request_signature => 'POST/contacts'}) response.contacts.each_with_index do | response_contact, index | contacts[index].contact_id = response_contact.contact_id if response_contact && response_contact.contact_id end response end # Retrieves all invoices from Xero # # Usage : get_invoices # get_invoices(:invoice_id => " 297c2dc5-cc47-4afd-8ec8-74990b8761e9") # # Note : modified_since is in UTC format (i.e. Brisbane is UTC+10) def get_invoices(options = {}) request_params = {} request_params[:InvoiceID] = options[:invoice_id] if options[:invoice_id] request_params[:InvoiceNumber] = options[:invoice_number] if options[:invoice_number] request_params[:OrderBy] = options[:order] if options[:order] request_params[:ModifiedAfter] = options[:modified_since] if options[:modified_since] request_params[:where] = options[:where] if options[:where] response_xml = http_get(@client, "#{@xero_url}/Invoices", request_params) parse_response(response_xml, {:request_params => request_params}, {:request_signature => 'GET/Invoices'}) end # Retrieves a single invoice # # Usage : get_invoice("297c2dc5-cc47-4afd-8ec8-74990b8761e9") # By ID # get_invoice("OIT-12345") # By number def get_invoice(invoice_id_or_number) request_params = {} url = "#{@xero_url}/Invoices/#{URI.escape(invoice_id_or_number)}" response_xml = http_get(@client, url, request_params) parse_response(response_xml, {:request_params => request_params}, {:request_signature => 'GET/Invoice'}) end # Factory method for building new Invoice objects associated with this gateway. def build_invoice(invoice = {}) case invoice when Invoice then invoice.gateway = self when Hash then invoice = Invoice.new(invoice.merge(:gateway => self)) end invoice end # Creates an invoice in Xero based on an invoice object. # # Invoice and line item totals are calculated automatically. # # Usage : # # invoice = XeroGateway::Invoice.new({ # :invoice_type => "ACCREC", # :due_date => 1.month.from_now, # :invoice_number => "YOUR INVOICE NUMBER", # :reference => "YOUR REFERENCE (NOT NECESSARILY UNIQUE!)", # :line_amount_types => "Inclusive" # }) # invoice.contact = XeroGateway::Contact.new(:name => "THE NAME OF THE CONTACT") # invoice.contact.phone.number = "12345" # invoice.contact.address.line_1 = "LINE 1 OF THE ADDRESS" # invoice.line_items << XeroGateway::LineItem.new( # :description => "THE DESCRIPTION OF THE LINE ITEM", # :unit_amount => 100, # :tax_amount => 12.5, # :tracking_category => "THE TRACKING CATEGORY FOR THE LINE ITEM", # :tracking_option => "THE TRACKING OPTION FOR THE LINE ITEM" # ) # # create_invoice(invoice) def create_invoice(invoice) request_xml = invoice.to_xml response_xml = http_put(@client, "#{@xero_url}/Invoices", request_xml) response = parse_response(response_xml, {:request_xml => request_xml}, {:request_signature => 'PUT/invoice'}) # Xero returns invoices inside an <Invoices> tag, even though there's only ever # one for this request response.response_item = response.invoices.first if response.success? && response.invoice && response.invoice.invoice_id invoice.invoice_id = response.invoice.invoice_id end response end # # Creates an array of invoices with a single API request. # # Usage : # invoices = [XeroGateway::Invoice.new(...), XeroGateway::Invoice.new(...)] # result = gateway.create_invoices(invoices) # def create_invoices(invoices) b = Builder::XmlMarkup.new request_xml = b.Invoices { invoices.each do | invoice | invoice.to_xml(b) end } response_xml = http_put(@client, "#{@xero_url}/Invoices", request_xml, {}) response = parse_response(response_xml, {:request_xml => request_xml}, {:request_signature => 'PUT/invoices'}) response.invoices.each_with_index do | response_invoice, index | invoices[index].invoice_id = response_invoice.invoice_id if response_invoice && response_invoice.invoice_id end response end # # Gets all accounts for a specific organization in Xero. # def get_accounts response_xml = http_get(@client, "#{xero_url}/Accounts") parse_response(response_xml, {}, {:request_signature => 'GET/accounts'}) end # # Returns a XeroGateway::AccountsList object that makes working with # the Xero list of accounts easier and allows caching the results. # def get_accounts_list(load_on_init = true) AccountsList.new(self, load_on_init) end # # Gets all tracking categories for a specific organization in Xero. # def get_tracking_categories response_xml = http_get(@client, "#{xero_url}/TrackingCategories") parse_response(response_xml, {}, {:request_signature => 'GET/TrackingCategories'}) end # # Gets Organisation details # def get_organisation response_xml = http_get(@client, "#{xero_url}/Organisation") parse_response(response_xml, {}, {:request_signature => 'GET/organisation'}) end # # Gets all currencies for a specific organisation in Xero # def get_currencies response_xml = http_get(@client, "#{xero_url}/Currencies") parse_response(response_xml, {}, {:request_signature => 'GET/currencies'}) end # # Gets all Tax Rates for a specific organisation in Xero # def get_tax_rates response_xml = http_get(@client, "#{xero_url}/TaxRates") parse_response(response_xml, {}, {:request_signature => 'GET/tax_rates'}) end private def get_contact(contact_id = nil, contact_number = nil) request_params = contact_id ? { :contactID => contact_id } : { :contactNumber => contact_number } response_xml = http_get(@client, "#{@xero_url}/Contacts/#{URI.escape(contact_id||contact_number)}", request_params) parse_response(response_xml, {:request_params => request_params}, {:request_signature => 'GET/contact'}) end # Create or update a contact record based on if it has a contact_id or contact_number. def save_contact(contact) request_xml = contact.to_xml response_xml = nil create_or_save = nil if contact.contact_id.nil? && contact.contact_number.nil? # Create new contact record. response_xml = http_put(@client, "#{@xero_url}/Contacts", request_xml, {}) create_or_save = :create else # Update existing contact record. response_xml = http_post(@client, "#{@xero_url}/Contacts", request_xml, {}) create_or_save = :save end response = parse_response(response_xml, {:request_xml => request_xml}, {:request_signature => "#{create_or_save == :create ? 'PUT' : 'POST'}/contact"}) contact.contact_id = response.contact.contact_id if response.contact && response.contact.contact_id response end def parse_response(raw_response, request = {}, options = {}) response = XeroGateway::Response.new doc = REXML::Document.new(raw_response, :ignore_whitespace_nodes => :all) # check for responses we don't understand raise UnparseableResponse.new(doc.root.name) unless doc.root.name == "Response" response_element = REXML::XPath.first(doc, "/Response") response_element.children.reject { |e| e.is_a? REXML::Text }.each do |element| case(element.name) when "ID" then response.response_id = element.text when "Status" then response.status = element.text when "ProviderName" then response.provider = element.text when "DateTimeUTC" then response.date_time = element.text when "Contact" then response.response_item = Contact.from_xml(element, self) when "Invoice" then response.response_item = Invoice.from_xml(element, self, {:line_items_downloaded => options[:request_signature] != "GET/Invoices"}) when "Contacts" then element.children.each {|child| response.response_item << Contact.from_xml(child, self) } when "Invoices" then element.children.each {|child| response.response_item << Invoice.from_xml(child, self, {:line_items_downloaded => options[:request_signature] != "GET/Invoices"}) } when "Accounts" then element.children.each {|child| response.response_item << Account.from_xml(child) } when "TaxRates" then element.children.each {|child| response.response_item << TaxRate.from_xml(child) } when "Currencies" then element.children.each {|child| response.response_item << Currency.from_xml(child) } when "Organisations" then response.response_item = Organisation.from_xml(element.children.first) # Xero only returns the Authorized Organisation when "TrackingCategories" then element.children.each {|child| response.response_item << TrackingCategory.from_xml(child) } when "Errors" then element.children.each { |error| parse_error(error, response) } end end if response_element # If a single result is returned don't put it in an array if response.response_item.is_a?(Array) && response.response_item.size == 1 response.response_item = response.response_item.first end response.request_params = request[:request_params] response.request_xml = request[:request_xml] response.response_xml = raw_response response end def parse_error(error_element, response) response.errors << Error.new( :description => REXML::XPath.first(error_element, "Description").text, :date_time => REXML::XPath.first(error_element, "//DateTime").text, :type => REXML::XPath.first(error_element, "//ExceptionType").text, :message => REXML::XPath.first(error_element, "//Message").text ) end end end
require "xn_gem_release_tasks/version" require 'rake' module Bundler class GemHelper def perform_git_push(options = '') cmd = "git push origin master:master #{options}" out, code = sh_with_code(cmd) raise "Couldn't git push. `#{cmd}' failed with the following output:\n\n#{out}\n" unless code == 0 end def version XNGemReleaseTasks::NAMESPACE::VERSION end end end module XNGemReleaseTasks V = /(?<before>\s*\bVERSION\s*=\s*")(?<major>\d+)\.(?<minor>\d+)\.(?<point>\d+)(?:\.(?<pre>\w+))?(?<after>".*)/ def self.ensure_setup raise "Must run XNGemReleaseTasks.setup(LibModule, 'path/to/version.rb') first" unless NAMESPACE end def self.change_version ensure_setup f = File.read(NAMESPACE::VERSION_FILE) lines = f.each_line.map do |line| match = V.match line if match yield line, match[:before], match[:major], match[:minor], match[:point], match[:pre], match[:after] else line end end File.open(NAMESPACE::VERSION_FILE, 'w') do |f| f.puts lines.join end end def self.reload_version ensure_setup NAMESPACE.send :remove_const, :VERSION load NAMESPACE::VERSION_FILE NAMESPACE::VERSION end def self.setup(namespace, version_file) raise "namespace must be a module" unless namespace.is_a? Module raise "namespace does not have a current version" unless namespace::VERSION raise "#{ version_file } file does not exist" unless File.exist? version_file raise "You may not set up XNGemReleaseTasks multiple times" if defined? NAMESPACE self.const_set :NAMESPACE, namespace namespace.const_set :VERSION_FILE, version_file end def self.gemspec eval(File.read(Dir['*.gemspec'].first)) end end task :validate_gemspec do gemspec = XNGemReleaseTasks.gemspec gemspec.validate end def command(task_name, name, &block) s = `which #{name}` if s == "" task(task_name, &block) else task task_name do # noop end end end desc "Ensures we are on a relesae version, and increments if we already are." task :increment_release_version do XNGemReleaseTasks.change_version do |line, before, major, minor, point, pre, after| if pre "#{before}#{major}.#{minor}.#{point}#{after}\n" else "#{before}#{major}.#{minor}.#{point.next}#{after}\n" end end end desc "Ensures we are on a release version, but does not increment version number" task :set_release_version do XNGemReleaseTasks.change_version do |line, before, major, minor, point, pre, after| "#{before}#{major}.#{minor}.#{point}#{after}\n" end end desc "Increments a release version number and adds .pre. Does not increment a version that is already .pre." task :set_development_version do XNGemReleaseTasks.change_version do |line, before, major, minor, point, pre, after| if pre line else "#{before}#{major}.#{minor}.#{point.next}.pre#{after}\n" end end end task :is_clean do if ENV['TRAVIS_BRANCH'] == 'master' true else sh "git status | grep 'working directory clean'" end end task :is_on_master do if ENV['TRAVIS_BRANCH'] == 'master' true else unless ENV['IGNORE_BRANCH'] == 'true' sh "git status | grep 'On branch master'" end end end task :is_on_origin_master do if ENV['TRAVIS_BRANCH'] == 'master' true else unless ENV['IGNORE_BRANCH'] == 'true' result = `git log HEAD...origin/master | grep . || echo ok` fail "Not on origin/master" unless result.chomp == 'ok' end end end task :is_up_to_date do if ENV['TRAVIS_BRANCH'] == 'master' true else sh "git pull | grep 'Already up-to-date.'" end end task :is_release_version do unless XNGemReleaseTasks.reload_version =~ /^\d+\.\d+\.\d+$/ fail "Not on a release version: #{ XNGemReleaseTasks::NAMESPACE::VERSION }" end end task :prepare_release_push => [:is_clean, :is_on_master, :is_up_to_date, :set_release_version] task :_only_push_release do XNGemReleaseTasks.reload_version if `git status | grep 'working directory clean'` == '' skip_ci = '[skip ci] ' if ENV['TRAVIS_SECURE_ENV_VARS'] if sh "git add #{XNGemReleaseTasks::NAMESPACE::VERSION_FILE} && git commit -m '#{skip_ci}Version #{ XNGemReleaseTasks::NAMESPACE::VERSION }'" sh "git push" end end end task :only_push_release => [:prepare_release_push, :_only_push_release] task :next_dev_cycle => [:is_clean, :set_development_version] do XNGemReleaseTasks.reload_version sh "git add #{XNGemReleaseTasks::NAMESPACE::VERSION_FILE} && git commit -m '[skip ci] New development cycle with version #{ XNGemReleaseTasks::NAMESPACE::VERSION }' && git push" end desc "Configure environment" task :env do path = `echo $PATH` home = `echo $HOME` unless path.include? "#{home}/bin" puts "Configuring path..." `mkdir -p $HOME/bin` if File.exist? "#{home}/.zshrc" profile = "#{home}/.zshrc" else profile = "#{home}/.bashrc" end `echo 'export PATH="$PATH:$HOME/bin"' >> #{profile} && source #{profile}` end end desc "Install tools to interact with s3" command(:install_aws_cli, '$HOME/bin/aws') do Rake::Task['env'].invoke puts "Installing AWS CLI tools..." `curl "https://s3.amazonaws.com/aws-cli/awscli-bundle.zip" -o "awscli-bundle.zip"` `unzip -o awscli-bundle.zip` `./awscli-bundle/install -i $HOME/bin/aws` `rm -rf awscli-bundle awscli-bundle.zip` `aws help` end desc "Install Leiningen, the clojure build tool" command(:install_lein, '$HOME/bin/lein') do if File.exist? 'project.clj' Rake::Task['env'].invoke puts "Installing Leiningen..." `curl "https://raw.githubusercontent.com/technomancy/leiningen/stable/bin/lein" -o "$HOME/bin/lein"` `chmod a+x $HOME/bin/lein` `lein` end end desc "Run Leiningen tests" task :lein_test => [:install_lein] do if File.exist? 'project.clj' puts "Running Leiningen tests..." `lein test` else puts "Not a Clojure project" end end desc "Check that AWS access is configured" task :check_aws_credentials => [:install_aws_cli] do gemspec = XNGemReleaseTasks.gemspec check = `aws s3 ls s3://#{gemspec.name} 2>&1` puts check if check.to_s.include?("credentials") fail "Credentials missing. Run `aws configure` to add them or set AWS_ACCESS_KEY_ID and AWS_SECRET_ACCESS_KEY" end end desc "Check s3 to see if the gem we're building already exists" task :validate_unique_gem => [:install_aws_cli,:check_aws_credentials] do gemspec = XNGemReleaseTasks.gemspec unless gemspec.version.to_s.include? "pre" result = `aws s3 ls s3://#{gemspec.name}/gems/#{gemspec.name}-#{gemspec.version}-java.gem` if result.to_s.include?("#{gemspec.name}-#{gemspec.version}-java.gem") fail "Non-pre gem already exists on s3, only pre gems can be overwritten" end end end task :validate_major_push do gemspec = XNGemReleaseTasks.gemspec unless gemspec.version.to_s.include? "pre" Rake::Task['is_clean'].invoke Rake::Task['is_on_master'].invoke Rake::Task['is_up_to_date'].invoke end end desc "Build gem and push to s3" task :up => [:install_aws_cli, :validate_unique_gem, :validate_gemspec, :validate_major_push, :lein_test, :build, :spec, :_up] task :_up do gemspec = XNGemReleaseTasks.gemspec if defined?(gemspec.platform) && gemspec.platform != '' gem = "#{gemspec.name}-#{gemspec.version}-#{gemspec.platform}.gem" else gem = "#{gemspec.name}-#{gemspec.version}.gem" end puts "Gem required, checking for presence..." `test -f #{gem}` puts "Pulling s3 repo and updating contents..." sh "mkdir -p repo/gems" sh "aws s3 sync s3://#{gemspec.name} repo" sh "cp pkg/#{gem} repo/gems/" puts "Rebuilding gem index..." sh "gem generate_index -d repo" puts "Pushing to s3 bucket #{gemspec.name}..." sh "aws s3 sync repo s3://#{gemspec.name}" sh "git tag -f v#{ gemspec.version }" sh "git push -f origin v#{ gemspec.version }" end desc "Pull the repo, rebuild and push to s3" task :repo_rebuild => [:check_aws_credentials] do gemspec = XNGemReleaseTasks.gemspec puts "Pulling s3 repo and updating contents..." `mkdir -p repo/gems` `aws s3 sync s3://#{gemspec.name} repo` puts "Rebuilding gem index..." `gem generate_index -d repo` puts "Pushing to s3 bucket #{gemspec.name}..." `aws s3 sync repo s3://#{gemspec.name}` end # Set a dependency to replace the :release task. For example, the following would cause :up to be used to # release instead of :release. That allows the local_release task to work in either case. # # task release_with: :up # task :release_with do |this| if this.prerequisites.empty? Rake::Task[:release].invoke end end desc "Release a new version locally rather than after a successful Travis build" task :local_release => [:only_push_release, :release_with, :next_dev_cycle] desc "Push a release candidate to Travis CI to release if it builds successfully" task :push_release => [:only_push_release, :next_dev_cycle] task :release => [:is_clean, :is_on_origin_master, :is_release_version] Don't add ruby platform require "xn_gem_release_tasks/version" require 'rake' module Bundler class GemHelper def perform_git_push(options = '') cmd = "git push origin master:master #{options}" out, code = sh_with_code(cmd) raise "Couldn't git push. `#{cmd}' failed with the following output:\n\n#{out}\n" unless code == 0 end def version XNGemReleaseTasks::NAMESPACE::VERSION end end end module XNGemReleaseTasks V = /(?<before>\s*\bVERSION\s*=\s*")(?<major>\d+)\.(?<minor>\d+)\.(?<point>\d+)(?:\.(?<pre>\w+))?(?<after>".*)/ def self.ensure_setup raise "Must run XNGemReleaseTasks.setup(LibModule, 'path/to/version.rb') first" unless NAMESPACE end def self.change_version ensure_setup f = File.read(NAMESPACE::VERSION_FILE) lines = f.each_line.map do |line| match = V.match line if match yield line, match[:before], match[:major], match[:minor], match[:point], match[:pre], match[:after] else line end end File.open(NAMESPACE::VERSION_FILE, 'w') do |f| f.puts lines.join end end def self.reload_version ensure_setup NAMESPACE.send :remove_const, :VERSION load NAMESPACE::VERSION_FILE NAMESPACE::VERSION end def self.setup(namespace, version_file) raise "namespace must be a module" unless namespace.is_a? Module raise "namespace does not have a current version" unless namespace::VERSION raise "#{ version_file } file does not exist" unless File.exist? version_file raise "You may not set up XNGemReleaseTasks multiple times" if defined? NAMESPACE self.const_set :NAMESPACE, namespace namespace.const_set :VERSION_FILE, version_file end def self.gemspec eval(File.read(Dir['*.gemspec'].first)) end end task :validate_gemspec do gemspec = XNGemReleaseTasks.gemspec gemspec.validate end def command(task_name, name, &block) s = `which #{name}` if s == "" task(task_name, &block) else task task_name do # noop end end end desc "Ensures we are on a relesae version, and increments if we already are." task :increment_release_version do XNGemReleaseTasks.change_version do |line, before, major, minor, point, pre, after| if pre "#{before}#{major}.#{minor}.#{point}#{after}\n" else "#{before}#{major}.#{minor}.#{point.next}#{after}\n" end end end desc "Ensures we are on a release version, but does not increment version number" task :set_release_version do XNGemReleaseTasks.change_version do |line, before, major, minor, point, pre, after| "#{before}#{major}.#{minor}.#{point}#{after}\n" end end desc "Increments a release version number and adds .pre. Does not increment a version that is already .pre." task :set_development_version do XNGemReleaseTasks.change_version do |line, before, major, minor, point, pre, after| if pre line else "#{before}#{major}.#{minor}.#{point.next}.pre#{after}\n" end end end task :is_clean do if ENV['TRAVIS_BRANCH'] == 'master' true else sh "git status | grep 'working directory clean'" end end task :is_on_master do if ENV['TRAVIS_BRANCH'] == 'master' true else unless ENV['IGNORE_BRANCH'] == 'true' sh "git status | grep 'On branch master'" end end end task :is_on_origin_master do if ENV['TRAVIS_BRANCH'] == 'master' true else unless ENV['IGNORE_BRANCH'] == 'true' result = `git log HEAD...origin/master | grep . || echo ok` fail "Not on origin/master" unless result.chomp == 'ok' end end end task :is_up_to_date do if ENV['TRAVIS_BRANCH'] == 'master' true else sh "git pull | grep 'Already up-to-date.'" end end task :is_release_version do unless XNGemReleaseTasks.reload_version =~ /^\d+\.\d+\.\d+$/ fail "Not on a release version: #{ XNGemReleaseTasks::NAMESPACE::VERSION }" end end task :prepare_release_push => [:is_clean, :is_on_master, :is_up_to_date, :set_release_version] task :_only_push_release do XNGemReleaseTasks.reload_version if `git status | grep 'working directory clean'` == '' skip_ci = '[skip ci] ' if ENV['TRAVIS_SECURE_ENV_VARS'] if sh "git add #{XNGemReleaseTasks::NAMESPACE::VERSION_FILE} && git commit -m '#{skip_ci}Version #{ XNGemReleaseTasks::NAMESPACE::VERSION }'" sh "git push" end end end task :only_push_release => [:prepare_release_push, :_only_push_release] task :next_dev_cycle => [:is_clean, :set_development_version] do XNGemReleaseTasks.reload_version sh "git add #{XNGemReleaseTasks::NAMESPACE::VERSION_FILE} && git commit -m '[skip ci] New development cycle with version #{ XNGemReleaseTasks::NAMESPACE::VERSION }' && git push" end desc "Configure environment" task :env do path = `echo $PATH` home = `echo $HOME` unless path.include? "#{home}/bin" puts "Configuring path..." `mkdir -p $HOME/bin` if File.exist? "#{home}/.zshrc" profile = "#{home}/.zshrc" else profile = "#{home}/.bashrc" end `echo 'export PATH="$PATH:$HOME/bin"' >> #{profile} && source #{profile}` end end desc "Install tools to interact with s3" command(:install_aws_cli, '$HOME/bin/aws') do Rake::Task['env'].invoke puts "Installing AWS CLI tools..." `curl "https://s3.amazonaws.com/aws-cli/awscli-bundle.zip" -o "awscli-bundle.zip"` `unzip -o awscli-bundle.zip` `./awscli-bundle/install -i $HOME/bin/aws` `rm -rf awscli-bundle awscli-bundle.zip` `aws help` end desc "Install Leiningen, the clojure build tool" command(:install_lein, '$HOME/bin/lein') do if File.exist? 'project.clj' Rake::Task['env'].invoke puts "Installing Leiningen..." `curl "https://raw.githubusercontent.com/technomancy/leiningen/stable/bin/lein" -o "$HOME/bin/lein"` `chmod a+x $HOME/bin/lein` `lein` end end desc "Run Leiningen tests" task :lein_test => [:install_lein] do if File.exist? 'project.clj' puts "Running Leiningen tests..." `lein test` else puts "Not a Clojure project" end end desc "Check that AWS access is configured" task :check_aws_credentials => [:install_aws_cli] do gemspec = XNGemReleaseTasks.gemspec check = `aws s3 ls s3://#{gemspec.name} 2>&1` puts check if check.to_s.include?("credentials") fail "Credentials missing. Run `aws configure` to add them or set AWS_ACCESS_KEY_ID and AWS_SECRET_ACCESS_KEY" end end desc "Check s3 to see if the gem we're building already exists" task :validate_unique_gem => [:install_aws_cli,:check_aws_credentials] do gemspec = XNGemReleaseTasks.gemspec unless gemspec.version.to_s.include? "pre" result = `aws s3 ls s3://#{gemspec.name}/gems/#{gemspec.name}-#{gemspec.version}-java.gem` if result.to_s.include?("#{gemspec.name}-#{gemspec.version}-java.gem") fail "Non-pre gem already exists on s3, only pre gems can be overwritten" end end end task :validate_major_push do gemspec = XNGemReleaseTasks.gemspec unless gemspec.version.to_s.include? "pre" Rake::Task['is_clean'].invoke Rake::Task['is_on_master'].invoke Rake::Task['is_up_to_date'].invoke end end desc "Build gem and push to s3" task :up => [:install_aws_cli, :validate_unique_gem, :validate_gemspec, :validate_major_push, :lein_test, :build, :spec, :_up] task :_up do gemspec = XNGemReleaseTasks.gemspec if defined?(gemspec.platform) and gemspec.platform != '' and gemspec.platform != 'ruby' gem = "#{gemspec.name}-#{gemspec.version}-#{gemspec.platform}.gem" else gem = "#{gemspec.name}-#{gemspec.version}.gem" end puts "Gem required, checking for presence..." `test -f #{gem}` puts "Pulling s3 repo and updating contents..." sh "mkdir -p repo/gems" sh "aws s3 sync s3://#{gemspec.name} repo" sh "cp pkg/#{gem} repo/gems/" puts "Rebuilding gem index..." sh "gem generate_index -d repo" puts "Pushing to s3 bucket #{gemspec.name}..." sh "aws s3 sync repo s3://#{gemspec.name}" sh "git tag -f v#{ gemspec.version }" sh "git push -f origin v#{ gemspec.version }" end desc "Pull the repo, rebuild and push to s3" task :repo_rebuild => [:check_aws_credentials] do gemspec = XNGemReleaseTasks.gemspec puts "Pulling s3 repo and updating contents..." `mkdir -p repo/gems` `aws s3 sync s3://#{gemspec.name} repo` puts "Rebuilding gem index..." `gem generate_index -d repo` puts "Pushing to s3 bucket #{gemspec.name}..." `aws s3 sync repo s3://#{gemspec.name}` end # Set a dependency to replace the :release task. For example, the following would cause :up to be used to # release instead of :release. That allows the local_release task to work in either case. # # task release_with: :up # task :release_with do |this| if this.prerequisites.empty? Rake::Task[:release].invoke end end desc "Release a new version locally rather than after a successful Travis build" task :local_release => [:only_push_release, :release_with, :next_dev_cycle] desc "Push a release candidate to Travis CI to release if it builds successfully" task :push_release => [:only_push_release, :next_dev_cycle] task :release => [:is_clean, :is_on_origin_master, :is_release_version]
require 'socket' Zeus::Server.define! do stage :boot do action do ENV_PATH = File.expand_path('../config/environment', __FILE__) BOOT_PATH = File.expand_path('../config/boot', __FILE__) APP_PATH = File.expand_path('../config/application', __FILE__) ROOT_PATH = File.expand_path('..', __FILE__) require BOOT_PATH require 'rails/all' end stage :default_bundle do action { Bundler.require(:default) } stage :dev do action do Bundler.require(:development) Rails.env = ENV['RAILS_ENV'] = "development" require APP_PATH Rails.application.require_environment! end command :generate, :g do require 'rails/commands/generate' end command :runner, :r do require 'rails/commands/runner' end command :console, :c do require 'rails/commands/console' Rails::Console.start(Rails.application) end command :server, :s do require 'rails/commands/server' server = Rails::Server.new Dir.chdir(Rails.application.root) server.start end stage :prerake do action do require 'rake' load 'Rakefile' end command :rake do Rake.application.run end end end # stage :test do # action do # Rails.env = ENV['RAILS_ENV'] = "test" # Bundler.require(:test) # require APP_PATH # Rails.application.require_environment! # end # command :testrb do # (r = Test::Unit::AutoRunner.new(true)).process_args(ARGV) or # abort r.options.banner + " tests..." # exit r.run # end # end end end end Uncomment test stage/acceptor in template require 'socket' Zeus::Server.define! do stage :boot do action do ENV_PATH = File.expand_path('../config/environment', __FILE__) BOOT_PATH = File.expand_path('../config/boot', __FILE__) APP_PATH = File.expand_path('../config/application', __FILE__) ROOT_PATH = File.expand_path('..', __FILE__) require BOOT_PATH require 'rails/all' end stage :default_bundle do action { Bundler.require(:default) } stage :dev do action do Bundler.require(:development) Rails.env = ENV['RAILS_ENV'] = "development" require APP_PATH Rails.application.require_environment! end command :generate, :g do require 'rails/commands/generate' end command :runner, :r do require 'rails/commands/runner' end command :console, :c do require 'rails/commands/console' Rails::Console.start(Rails.application) end command :server, :s do require 'rails/commands/server' server = Rails::Server.new Dir.chdir(Rails.application.root) server.start end stage :prerake do action do require 'rake' load 'Rakefile' end command :rake do Rake.application.run end end end stage :test do action do Rails.env = ENV['RAILS_ENV'] = "test" Bundler.require(:test) require APP_PATH Rails.application.require_environment! end command :testrb do (r = Test::Unit::AutoRunner.new(true)).process_args(ARGV) or abort r.options.banner + " tests..." exit r.run end end end end end
require 'base64' require 'ws/dummy_ws' require 'time' module Ldash # The unix timestamp Discord IDs are based on DISCORD_EPOCH = 1_420_070_400_000 # Format time to Discord's format def self.format_time(time) time.iso8601 end # Generic data base class, so I don't have to write the same kind of initializer over and over again class DataObject def self.data_attribute(name, &proc) @data_attributes ||= [] @data_attributes << { name: name, proc: proc } attr_accessor(name) end def initialize(data = {}) @session = $session attrs = self.class.instance_variable_get('@data_attributes') attrs.each do |attr| val = data[attr[:name]] val = attr[:proc].call($session, self) if !val && attr[:proc] instance_variable_set("@#{attr[:name]}", val) end end end # Discord user class User < DataObject data_attribute :username data_attribute :id, &:generate_id data_attribute(:discriminator) { |s| s.generate_discrim(@username) } data_attribute :avatar data_attribute :email data_attribute :password data_attribute :verified data_attribute :bot def id_format { id: @id.to_s } end def compact result = { username: @username.to_s, id: @id.to_s, discriminator: @discriminator.to_s, avatar: @avatar.to_s } # Only add the bot tag if it's actually true result[:bot] = true if @bot result end # The email will only ever be defined on a possible bot user def bot_user? !@email.nil? end def bot_user_format compact.merge(verified: @verified, email: @email.to_s) end end # Users on servers class Member < DataObject data_attribute :user data_attribute :server # Server wide voice status data_attribute(:mute) { false } data_attribute(:deaf) { false } data_attribute :voice_channel data_attribute(:joined_at) { Time.now } data_attribute(:roles) { [] } data_attribute(:game) { nil } data_attribute(:status) { 'online' } def in_voice_channel? !@voice_channel.nil? end # Format used in the READY and GUILD_CREATE members list def guild_member_format { mute: @mute, deaf: @deaf, joined_at: Ldash.format_time(@joined_at), user: @user.compact, roles: @roles.map(&:id).map(&:to_s) } end # Format used in the READY and GUILD_CREATE presences list def presence_format { user: @user.id_format, status: @status, game: game_object } end # Format used in the READY and GUILD_CREATE voice state list def voice_state_format { user_id: @user.id.to_s, suppress: false, # TODO: voice states self_mute: false, # TODO: voice states self_deaf: false, # TODO: voice states mute: @mute, deaf: @deaf, session_id: @session.id, channel_id: @voice_channel ? @voice_channel.id : nil } end private def game_object return nil unless @game { name: @game } end end # Class for user avatars and server icons class Avatar < DataObject data_attribute :hash data_attribute :image_data # to_s should just be the hash alias_method :to_s, :hash end # Channels class Channel < DataObject data_attribute :id, &:generate_id data_attribute :name data_attribute :topic data_attribute :position data_attribute :permission_overwrites data_attribute :server data_attribute :type data_attribute :bitrate data_attribute :recipient def private? !@server.nil? end # Format used in READY and GUILD_CREATE def guild_channel_format { type: @type, topic: @topic, id: @id.to_s, name: @name, position: @position, permission_overwrites: permission_overwrites_format, bitrate: @bitrate } end # Format used in CHANNEL_CREATE (private or public), CHANNEL_DELETE (private or public) and CHANNEL_UPDATE def channel_create_format if private? { id: @id.to_s, is_private: true, recipient: @recipient.compact } else { guild_id: @server.id.to_s, id: @id.to_s, is_private: false, name: @name, permission_overwrites: permission_overwrites_format, position: @position, topic: @topic, type: @type, bitrate: @bitrate } end end # Format used in the READY private_channels array def private_channels_format { recipient: @recipient.compact, is_private: true, id: @id.to_s } end private def permission_overwrites_format [ { # TODO: change this default overwrite format into actual data type: role, id: @server.id.to_s, deny: 0, allow: 0 } ] end end # Roles class Role < DataObject data_attribute :id, &:generate_id DEFAULT_PERMISSIONS = 36_953_089 data_attribute(:permissions) { DEFAULT_PERMISSIONS } data_attribute :server data_attribute :position data_attribute :name data_attribute :hoist data_attribute :colour # Format used if this role is embedded into guild data (e.g. in READY or GUILD_CREATE) def guild_role_format { position: @position, permissions: @permissions, managed: false, # TODO: investigate what this is (probably integration stuff) id: @id.to_s, name: @name, hoist: @hoist, color: @colour # damn American spelling } end end # Discord servers class Server < DataObject data_attribute :id, &:generate_id data_attribute :name data_attribute :icon data_attribute :owner_id data_attribute(:afk_timeout) { 300 } data_attribute :afk_channel data_attribute(:bot_joined_at) { Time.now } data_attribute :roles do |_, this| # @everyone role Role.new(id: this.id, # role ID = server ID name: '@everyone', server: this, position: -1, hoist: false, colour: 0) end data_attribute :channels do |_, this| [ # #general text channel Channel.new(id: this.id, name: 'general', server: this, type: 'text', position: 0), # General voice channel Channel.new(id: this.id + 1, name: 'General', server: this, type: 'voice', bitrate: 64_000) ] end data_attribute :members do [] end data_attribute(:region) { 'london' } def large? @session.large?(@members.length) end def member_count @members.length end # Format used in READY and GUILD_CREATE def guild_format channels = @channels.map(&:guild_channel_format) roles = @roles.map(&:guild_role_format) members = tiny_members.map(&:guild_member_format) presences = tiny_members.map(&:presence_format) voice_states = tiny_members.select(&:in_voice_channel?).map(&:voice_state_format) { afk_timeout: @afk_timeout, joined_at: Ldash.format_time(@bot_joined_at), afk_channel_id: @afk_channel.id, id: @id.to_s, icon: @icon, name: @name, large: large?, owner_id: @owner_id.to_s, region: @region, member_count: member_count, channels: channels, roles: roles, members: members, presences: presences, voice_states: voice_states } end # Format used when a guild is unavailable due to an outage def unavailable_format { id: @id.to_s, unavailable: true } end private # Get a list of members according to large_threshold def tiny_members return @members unless large? @members.select { |e| e.status != :offline } end end # The default user in case l- needs one but none exists DEFAULT_USER = User.new(id: 66237334693085184, username: 'meew0', avatar: 'd18a450706c3b6c379f7e2329f64c9e7', discriminator: 3569, email: 'meew0@example.com', password: 'hunter2', verified: true) # Mixin to generate discrims module DiscrimGenerator def generate_discrim(username) discrims = discrims_for_username(username) raise "Can't find a new discrim for username #{username} - too many users with the same username! Calm down with your presets" if discrims.length == 9999 generated = nil loop do generated = rand(1..9999) break unless discrims.include? generated end generated end private def discrims_for_username(username) @users.select { |e| e.username == username }.map(&:discriminator) end end # L- session class Session attr_accessor :users, :private_channels, :servers, :messages, :tokens attr_accessor :ws attr_accessor :large_threshold, :heartbeat_interval attr_reader :id def initialize @users = [] @private_channels = [] @servers = [] @messages = [] @tokens = [] @token_num = 0 @large_threshold = 100 # TODO @heartbeat_interval = 41_250 # Discord doesn't always use this exact interval but it seems common enough to use it as the default @ws = DummyWS.new @id = object_id.to_s(16).rjust(32, '0') end def load_preset(name) load("presets/#{name}.rb") end def ws? !@ws.dummy? end def create_token(user) # The first part of a token is the bot user ID, base 64 encoded. first_part = Base64.encode64(user.id.to_s).strip # The second part is seconds since Jan 1 2011, base 64 encoded. second_part = Base64.encode64([@token_num].pack('Q>').sub(/^\x00+/, '')).strip # The third part is apparently a HMAC - we don't care about that so just generate a random string # WTF kind of library would rely on this anyway third_part = Base64.encode64([*0..17].map { rand(0..255) }.pack('C*')).strip token = "#{first_part}.#{second_part}.#{third_part}" @tokens << token token end # Generates an ID according to Discord's snowflake system def generate_id(_) accurate_timestamp = (Time.now.to_f * 1000).round time_part = (accurate_timestamp - DISCORD_EPOCH) << 22 random_part = rand(0...2**22) time_part | random_part end def large?(member_count) member_count >= @large_threshold end include DiscrimGenerator def token?(token) @tokens.include? token end def bot_user user = @users.find(&:bot_user_format) # If none exists, use the default user user || DEFAULT_USER end end end Use instance_eval rather than load to evaluate presets require 'base64' require 'ws/dummy_ws' require 'time' module Ldash # The unix timestamp Discord IDs are based on DISCORD_EPOCH = 1_420_070_400_000 # Format time to Discord's format def self.format_time(time) time.iso8601 end # Generic data base class, so I don't have to write the same kind of initializer over and over again class DataObject def self.data_attribute(name, &proc) @data_attributes ||= [] @data_attributes << { name: name, proc: proc } attr_accessor(name) end def initialize(data = {}) @session = $session attrs = self.class.instance_variable_get('@data_attributes') attrs.each do |attr| val = data[attr[:name]] val = attr[:proc].call($session, self) if !val && attr[:proc] instance_variable_set("@#{attr[:name]}", val) end end end # Discord user class User < DataObject data_attribute :username data_attribute :id, &:generate_id data_attribute(:discriminator) { |s| s.generate_discrim(@username) } data_attribute :avatar data_attribute :email data_attribute :password data_attribute :verified data_attribute :bot def id_format { id: @id.to_s } end def compact result = { username: @username.to_s, id: @id.to_s, discriminator: @discriminator.to_s, avatar: @avatar.to_s } # Only add the bot tag if it's actually true result[:bot] = true if @bot result end # The email will only ever be defined on a possible bot user def bot_user? !@email.nil? end def bot_user_format compact.merge(verified: @verified, email: @email.to_s) end end # Users on servers class Member < DataObject data_attribute :user data_attribute :server # Server wide voice status data_attribute(:mute) { false } data_attribute(:deaf) { false } data_attribute :voice_channel data_attribute(:joined_at) { Time.now } data_attribute(:roles) { [] } data_attribute(:game) { nil } data_attribute(:status) { 'online' } def in_voice_channel? !@voice_channel.nil? end # Format used in the READY and GUILD_CREATE members list def guild_member_format { mute: @mute, deaf: @deaf, joined_at: Ldash.format_time(@joined_at), user: @user.compact, roles: @roles.map(&:id).map(&:to_s) } end # Format used in the READY and GUILD_CREATE presences list def presence_format { user: @user.id_format, status: @status, game: game_object } end # Format used in the READY and GUILD_CREATE voice state list def voice_state_format { user_id: @user.id.to_s, suppress: false, # TODO: voice states self_mute: false, # TODO: voice states self_deaf: false, # TODO: voice states mute: @mute, deaf: @deaf, session_id: @session.id, channel_id: @voice_channel ? @voice_channel.id : nil } end private def game_object return nil unless @game { name: @game } end end # Class for user avatars and server icons class Avatar < DataObject data_attribute :hash data_attribute :image_data # to_s should just be the hash alias_method :to_s, :hash end # Channels class Channel < DataObject data_attribute :id, &:generate_id data_attribute :name data_attribute :topic data_attribute :position data_attribute :permission_overwrites data_attribute :server data_attribute :type data_attribute :bitrate data_attribute :recipient def private? !@server.nil? end # Format used in READY and GUILD_CREATE def guild_channel_format { type: @type, topic: @topic, id: @id.to_s, name: @name, position: @position, permission_overwrites: permission_overwrites_format, bitrate: @bitrate } end # Format used in CHANNEL_CREATE (private or public), CHANNEL_DELETE (private or public) and CHANNEL_UPDATE def channel_create_format if private? { id: @id.to_s, is_private: true, recipient: @recipient.compact } else { guild_id: @server.id.to_s, id: @id.to_s, is_private: false, name: @name, permission_overwrites: permission_overwrites_format, position: @position, topic: @topic, type: @type, bitrate: @bitrate } end end # Format used in the READY private_channels array def private_channels_format { recipient: @recipient.compact, is_private: true, id: @id.to_s } end private def permission_overwrites_format [ { # TODO: change this default overwrite format into actual data type: role, id: @server.id.to_s, deny: 0, allow: 0 } ] end end # Roles class Role < DataObject data_attribute :id, &:generate_id DEFAULT_PERMISSIONS = 36_953_089 data_attribute(:permissions) { DEFAULT_PERMISSIONS } data_attribute :server data_attribute :position data_attribute :name data_attribute :hoist data_attribute :colour # Format used if this role is embedded into guild data (e.g. in READY or GUILD_CREATE) def guild_role_format { position: @position, permissions: @permissions, managed: false, # TODO: investigate what this is (probably integration stuff) id: @id.to_s, name: @name, hoist: @hoist, color: @colour # damn American spelling } end end # Discord servers class Server < DataObject data_attribute :id, &:generate_id data_attribute :name data_attribute :icon data_attribute :owner_id data_attribute(:afk_timeout) { 300 } data_attribute :afk_channel data_attribute(:bot_joined_at) { Time.now } data_attribute :roles do |_, this| # @everyone role Role.new(id: this.id, # role ID = server ID name: '@everyone', server: this, position: -1, hoist: false, colour: 0) end data_attribute :channels do |_, this| [ # #general text channel Channel.new(id: this.id, name: 'general', server: this, type: 'text', position: 0), # General voice channel Channel.new(id: this.id + 1, name: 'General', server: this, type: 'voice', bitrate: 64_000) ] end data_attribute :members do [] end data_attribute(:region) { 'london' } def large? @session.large?(@members.length) end def member_count @members.length end # Format used in READY and GUILD_CREATE def guild_format channels = @channels.map(&:guild_channel_format) roles = @roles.map(&:guild_role_format) members = tiny_members.map(&:guild_member_format) presences = tiny_members.map(&:presence_format) voice_states = tiny_members.select(&:in_voice_channel?).map(&:voice_state_format) { afk_timeout: @afk_timeout, joined_at: Ldash.format_time(@bot_joined_at), afk_channel_id: @afk_channel.id, id: @id.to_s, icon: @icon, name: @name, large: large?, owner_id: @owner_id.to_s, region: @region, member_count: member_count, channels: channels, roles: roles, members: members, presences: presences, voice_states: voice_states } end # Format used when a guild is unavailable due to an outage def unavailable_format { id: @id.to_s, unavailable: true } end private # Get a list of members according to large_threshold def tiny_members return @members unless large? @members.select { |e| e.status != :offline } end end # The default user in case l- needs one but none exists DEFAULT_USER = User.new(id: 66237334693085184, username: 'meew0', avatar: 'd18a450706c3b6c379f7e2329f64c9e7', discriminator: 3569, email: 'meew0@example.com', password: 'hunter2', verified: true) # Mixin to generate discrims module DiscrimGenerator def generate_discrim(username) discrims = discrims_for_username(username) raise "Can't find a new discrim for username #{username} - too many users with the same username! Calm down with your presets" if discrims.length == 9999 generated = nil loop do generated = rand(1..9999) break unless discrims.include? generated end generated end private def discrims_for_username(username) @users.select { |e| e.username == username }.map(&:discriminator) end end # L- session class Session attr_accessor :users, :private_channels, :servers, :messages, :tokens attr_accessor :ws attr_accessor :large_threshold, :heartbeat_interval attr_reader :id def initialize @users = [] @private_channels = [] @servers = [] @messages = [] @tokens = [] @token_num = 0 @large_threshold = 100 # TODO @heartbeat_interval = 41_250 # Discord doesn't always use this exact interval but it seems common enough to use it as the default @ws = DummyWS.new @id = object_id.to_s(16).rjust(32, '0') end def load_preset(name) instance_eval(File.read("presets/#{name}.rb")) end def ws? !@ws.dummy? end def create_token(user) # The first part of a token is the bot user ID, base 64 encoded. first_part = Base64.encode64(user.id.to_s).strip # The second part is seconds since Jan 1 2011, base 64 encoded. second_part = Base64.encode64([@token_num].pack('Q>').sub(/^\x00+/, '')).strip # The third part is apparently a HMAC - we don't care about that so just generate a random string # WTF kind of library would rely on this anyway third_part = Base64.encode64([*0..17].map { rand(0..255) }.pack('C*')).strip token = "#{first_part}.#{second_part}.#{third_part}" @tokens << token token end # Generates an ID according to Discord's snowflake system def generate_id(_) accurate_timestamp = (Time.now.to_f * 1000).round time_part = (accurate_timestamp - DISCORD_EPOCH) << 22 random_part = rand(0...2**22) time_part | random_part end def large?(member_count) member_count >= @large_threshold end include DiscrimGenerator def token?(token) @tokens.include? token end def bot_user user = @users.find(&:bot_user_format) # If none exists, use the default user user || DEFAULT_USER end end end
module Zookeeper module Exceptions include Constants class ZookeeperException < StandardError unless defined?(CONST_MISSING_WARNING) CONST_MISSING_WARNING = <<-EOS ------------------------------------------------------------------------------------------ WARNING! THE ZOOKEEPER NAMESPACE HAS CHNAGED AS OF 1.0! Please update your code to use the new heirarchy! The constant that got you this was ZookeeperExceptions::ZookeeperException::%s stacktrace: %s ------------------------------------------------------------------------------------------ EOS end # NOTE(slyphon): Since 0.4 all of the ZookeeperException subclasses were # defined inside of ZookeeperException, which always seemed well, icky. # if someone references one of these we'll print out a warning and # then give them the constant # def self.const_missing(const) if Zookeeper::Exceptions.const_defined?(const) stacktrace = caller[0..-2].reject {|n| n =~ %r%/rspec/% }.map { |n| "\t#{n}" }.join("\n") Zookeeper.deprecation_warning(CONST_MISSING_WARNING % [const.to_s, stacktrace]) Zookeeper::Exceptions.const_get(const).tap do |const_val| self.const_set(const, const_val) end else super end end end class EverythingOk < ZookeeperException; end class SystemError < ZookeeperException; end class RunTimeInconsistency < ZookeeperException; end class DataInconsistency < ZookeeperException; end class ConnectionLoss < ZookeeperException; end class MarshallingError < ZookeeperException; end class Unimplemented < ZookeeperException; end class OperationTimeOut < ZookeeperException; end class BadArguments < ZookeeperException; end class InvalidState < ZookeeperException; end class ApiError < ZookeeperException; end class NoNode < ZookeeperException; end class NoAuth < ZookeeperException; end class BadVersion < ZookeeperException; end class NoChildrenForEphemerals < ZookeeperException; end class NodeExists < ZookeeperException; end class NotEmpty < ZookeeperException; end class SessionExpired < ZookeeperException; end class InvalidCallback < ZookeeperException; end class InvalidACL < ZookeeperException; end class AuthFailed < ZookeeperException; end class Closing < ZookeeperException; end class Nothing < ZookeeperException; end class SessionMoved < ZookeeperException; end # these are Ruby client exceptions class ConnectionClosed < ZookeeperException; end class NotConnected < ZookeeperException; end class ShuttingDownException < ZookeeperException; end class DataTooLargeException < ZookeeperException; end # raised when an operation is performed on an instance without a valid # zookeeper handle. (C version) class HandleClosedException < ZookeeperException; end # maybe use this for continuation class InterruptedException < ZookeeperException ; end # raised when a continuation operation takes more time than is reasonable and # the thread should be awoken. (i.e. prevents a call that never returns) class ContinuationTimeoutError < ZookeeperException; end # raised when the user tries to use a connection after a fork() # without calling reopen() in the C client # # (h/t: @pletern http://git.io/zIsq1Q) class InheritedConnectionError < ZookeeperException; end # yes, make an alias, this is the way zookeeper refers to it ExpiredSession = SessionExpired unless defined?(ExpiredSession) def self.by_code(code) case code when ZOK then EverythingOk when ZSYSTEMERROR then SystemError when ZRUNTIMEINCONSISTENCY then RunTimeInconsistency when ZDATAINCONSISTENCY then DataInconsistency when ZCONNECTIONLOSS then ConnectionLoss when ZMARSHALLINGERROR then MarshallingError when ZUNIMPLEMENTED then Unimplemented when ZOPERATIONTIMEOUT then OperationTimeOut when ZBADARGUMENTS then BadArguments when ZINVALIDSTATE then InvalidState when ZAPIERROR then ApiError when ZNONODE then NoNode when ZNOAUTH then NoAuth when ZBADVERSION then BadVersion when ZNOCHILDRENFOREPHEMERALS then NoChildrenForEphemerals when ZNODEEXISTS then NodeExists when ZNOTEMPTY then NotEmpty when ZSESSIONEXPIRED then SessionExpired when ZINVALIDCALLBACK then InvalidCallback when ZINVALIDACL then InvalidACL when ZAUTHFAILED then AuthFailed when ZCLOSING then Closing when ZNOTHING then Nothing when ZSESSIONMOVED then SessionMoved else ZookeeperException.new("no exception defined for code #{code}") end end def self.raise_on_error(code) exc = self.by_code(code) raise exc unless exc == EverythingOk end end # Exceptions end # Zookeeper Fix typos in deprecation warning. module Zookeeper module Exceptions include Constants class ZookeeperException < StandardError unless defined?(CONST_MISSING_WARNING) CONST_MISSING_WARNING = <<-EOS ------------------------------------------------------------------------------------------ WARNING! THE ZOOKEEPER NAMESPACE HAS CHANGED AS OF 1.0! Please update your code to use the new hierarchy! The constant that got you this was ZookeeperExceptions::ZookeeperException::%s stacktrace: %s ------------------------------------------------------------------------------------------ EOS end # NOTE(slyphon): Since 0.4 all of the ZookeeperException subclasses were # defined inside of ZookeeperException, which always seemed well, icky. # if someone references one of these we'll print out a warning and # then give them the constant # def self.const_missing(const) if Zookeeper::Exceptions.const_defined?(const) stacktrace = caller[0..-2].reject {|n| n =~ %r%/rspec/% }.map { |n| "\t#{n}" }.join("\n") Zookeeper.deprecation_warning(CONST_MISSING_WARNING % [const.to_s, stacktrace]) Zookeeper::Exceptions.const_get(const).tap do |const_val| self.const_set(const, const_val) end else super end end end class EverythingOk < ZookeeperException; end class SystemError < ZookeeperException; end class RunTimeInconsistency < ZookeeperException; end class DataInconsistency < ZookeeperException; end class ConnectionLoss < ZookeeperException; end class MarshallingError < ZookeeperException; end class Unimplemented < ZookeeperException; end class OperationTimeOut < ZookeeperException; end class BadArguments < ZookeeperException; end class InvalidState < ZookeeperException; end class ApiError < ZookeeperException; end class NoNode < ZookeeperException; end class NoAuth < ZookeeperException; end class BadVersion < ZookeeperException; end class NoChildrenForEphemerals < ZookeeperException; end class NodeExists < ZookeeperException; end class NotEmpty < ZookeeperException; end class SessionExpired < ZookeeperException; end class InvalidCallback < ZookeeperException; end class InvalidACL < ZookeeperException; end class AuthFailed < ZookeeperException; end class Closing < ZookeeperException; end class Nothing < ZookeeperException; end class SessionMoved < ZookeeperException; end # these are Ruby client exceptions class ConnectionClosed < ZookeeperException; end class NotConnected < ZookeeperException; end class ShuttingDownException < ZookeeperException; end class DataTooLargeException < ZookeeperException; end # raised when an operation is performed on an instance without a valid # zookeeper handle. (C version) class HandleClosedException < ZookeeperException; end # maybe use this for continuation class InterruptedException < ZookeeperException ; end # raised when a continuation operation takes more time than is reasonable and # the thread should be awoken. (i.e. prevents a call that never returns) class ContinuationTimeoutError < ZookeeperException; end # raised when the user tries to use a connection after a fork() # without calling reopen() in the C client # # (h/t: @pletern http://git.io/zIsq1Q) class InheritedConnectionError < ZookeeperException; end # yes, make an alias, this is the way zookeeper refers to it ExpiredSession = SessionExpired unless defined?(ExpiredSession) def self.by_code(code) case code when ZOK then EverythingOk when ZSYSTEMERROR then SystemError when ZRUNTIMEINCONSISTENCY then RunTimeInconsistency when ZDATAINCONSISTENCY then DataInconsistency when ZCONNECTIONLOSS then ConnectionLoss when ZMARSHALLINGERROR then MarshallingError when ZUNIMPLEMENTED then Unimplemented when ZOPERATIONTIMEOUT then OperationTimeOut when ZBADARGUMENTS then BadArguments when ZINVALIDSTATE then InvalidState when ZAPIERROR then ApiError when ZNONODE then NoNode when ZNOAUTH then NoAuth when ZBADVERSION then BadVersion when ZNOCHILDRENFOREPHEMERALS then NoChildrenForEphemerals when ZNODEEXISTS then NodeExists when ZNOTEMPTY then NotEmpty when ZSESSIONEXPIRED then SessionExpired when ZINVALIDCALLBACK then InvalidCallback when ZINVALIDACL then InvalidACL when ZAUTHFAILED then AuthFailed when ZCLOSING then Closing when ZNOTHING then Nothing when ZSESSIONMOVED then SessionMoved else ZookeeperException.new("no exception defined for code #{code}") end end def self.raise_on_error(code) exc = self.by_code(code) raise exc unless exc == EverythingOk end end # Exceptions end # Zookeeper
# based on https://gist.github.com/mnutt/566725 require "active_support/core_ext/module/attr_internal" module Searchkick module QueryWithInstrumentation def execute_search name = searchkick_klass ? "#{searchkick_klass.name} Search" : "Search" event = { name: name, query: params } ActiveSupport::Notifications.instrument("search.searchkick", event) do super end end end module IndexWithInstrumentation def store(record) event = { name: "#{record.searchkick_klass.name} Store", id: search_id(record) } if Searchkick.callbacks_value == :bulk super else ActiveSupport::Notifications.instrument("request.searchkick", event) do super end end end def remove(record) name = record && record.searchkick_klass ? "#{record.searchkick_klass.name} Remove" : "Remove" event = { name: name, id: search_id(record) } if Searchkick.callbacks_value == :bulk super else ActiveSupport::Notifications.instrument("request.searchkick", event) do super end end end def import(records) if records.any? event = { name: "#{records.first.searchkick_klass.name} Import", count: records.size } ActiveSupport::Notifications.instrument("request.searchkick", event) do super(records) end end end end module SearchkickWithInstrumentation def multi_search(searches) event = { name: "Multi Search", count: searches.size } ActiveSupport::Notifications.instrument("request.searchkick", event) do super end end def perform_items(items) if callbacks_value == :bulk event = { name: "Bulk", count: items.size } ActiveSupport::Notifications.instrument("request.searchkick", event) do super end else super end end end # https://github.com/rails/rails/blob/master/activerecord/lib/active_record/log_subscriber.rb class LogSubscriber < ActiveSupport::LogSubscriber def self.runtime=(value) Thread.current[:searchkick_runtime] = value end def self.runtime Thread.current[:searchkick_runtime] ||= 0 end def self.reset_runtime rt = runtime self.runtime = 0 rt end def search(event) self.class.runtime += event.duration return unless logger.debug? payload = event.payload name = "#{payload[:name]} (#{event.duration.round(1)}ms)" type = payload[:query][:type] index = payload[:query][:index].is_a?(Array) ? payload[:query][:index].join(",") : payload[:query][:index] # no easy way to tell which host the client will use host = Searchkick.client.transport.hosts.first debug " #{color(name, YELLOW, true)} curl #{host[:protocol]}://#{host[:host]}:#{host[:port]}/#{CGI.escape(index)}#{type ? "/#{type.map { |t| CGI.escape(t) }.join(',')}" : ''}/_search?pretty -d '#{payload[:query][:body].to_json}'" end def request(event) self.class.runtime += event.duration return unless logger.debug? payload = event.payload name = "#{payload[:name]} (#{event.duration.round(1)}ms)" debug " #{color(name, YELLOW, true)} #{payload.except(:name).to_json}" end end # https://github.com/rails/rails/blob/master/activerecord/lib/active_record/railties/controller_runtime.rb module ControllerRuntime extend ActiveSupport::Concern protected attr_internal :searchkick_runtime def process_action(action, *args) # We also need to reset the runtime before each action # because of queries in middleware or in cases we are streaming # and it won't be cleaned up by the method below. Searchkick::LogSubscriber.reset_runtime super end def cleanup_view_runtime searchkick_rt_before_render = Searchkick::LogSubscriber.reset_runtime runtime = super searchkick_rt_after_render = Searchkick::LogSubscriber.reset_runtime self.searchkick_runtime = searchkick_rt_before_render + searchkick_rt_after_render runtime - searchkick_rt_after_render end def append_info_to_payload(payload) super payload[:searchkick_runtime] = (searchkick_runtime || 0) + Searchkick::LogSubscriber.reset_runtime end module ClassMethods def log_process_action(payload) messages = super runtime = payload[:searchkick_runtime] messages << ("Searchkick: %.1fms" % runtime.to_f) if runtime.to_f > 0 messages end end end end Searchkick::Query.send(:prepend, Searchkick::QueryWithInstrumentation) Searchkick::Index.send(:prepend, Searchkick::IndexWithInstrumentation) Searchkick.singleton_class.send(:prepend, Searchkick::SearchkickWithInstrumentation) Searchkick::LogSubscriber.attach_to :searchkick ActiveSupport.on_load(:action_controller) do include Searchkick::ControllerRuntime end Added separate event for multi search # based on https://gist.github.com/mnutt/566725 require "active_support/core_ext/module/attr_internal" module Searchkick module QueryWithInstrumentation def execute_search name = searchkick_klass ? "#{searchkick_klass.name} Search" : "Search" event = { name: name, query: params } ActiveSupport::Notifications.instrument("search.searchkick", event) do super end end end module IndexWithInstrumentation def store(record) event = { name: "#{record.searchkick_klass.name} Store", id: search_id(record) } if Searchkick.callbacks_value == :bulk super else ActiveSupport::Notifications.instrument("request.searchkick", event) do super end end end def remove(record) name = record && record.searchkick_klass ? "#{record.searchkick_klass.name} Remove" : "Remove" event = { name: name, id: search_id(record) } if Searchkick.callbacks_value == :bulk super else ActiveSupport::Notifications.instrument("request.searchkick", event) do super end end end def import(records) if records.any? event = { name: "#{records.first.searchkick_klass.name} Import", count: records.size } ActiveSupport::Notifications.instrument("request.searchkick", event) do super(records) end end end end module SearchkickWithInstrumentation def multi_search(searches) event = { name: "Multi Search", body: searches.flat_map { |q| [q.params.except(:body).to_json, q.body.to_json] }.map { |v| "#{v}\n" }.join } ActiveSupport::Notifications.instrument("multi_search.searchkick", event) do super end end def perform_items(items) if callbacks_value == :bulk event = { name: "Bulk", count: items.size } ActiveSupport::Notifications.instrument("request.searchkick", event) do super end else super end end end # https://github.com/rails/rails/blob/master/activerecord/lib/active_record/log_subscriber.rb class LogSubscriber < ActiveSupport::LogSubscriber def self.runtime=(value) Thread.current[:searchkick_runtime] = value end def self.runtime Thread.current[:searchkick_runtime] ||= 0 end def self.reset_runtime rt = runtime self.runtime = 0 rt end def search(event) self.class.runtime += event.duration return unless logger.debug? payload = event.payload name = "#{payload[:name]} (#{event.duration.round(1)}ms)" type = payload[:query][:type] index = payload[:query][:index].is_a?(Array) ? payload[:query][:index].join(",") : payload[:query][:index] # no easy way to tell which host the client will use host = Searchkick.client.transport.hosts.first debug " #{color(name, YELLOW, true)} curl #{host[:protocol]}://#{host[:host]}:#{host[:port]}/#{CGI.escape(index)}#{type ? "/#{type.map { |t| CGI.escape(t) }.join(',')}" : ''}/_search?pretty -d '#{payload[:query][:body].to_json}'" end def request(event) self.class.runtime += event.duration return unless logger.debug? payload = event.payload name = "#{payload[:name]} (#{event.duration.round(1)}ms)" debug " #{color(name, YELLOW, true)} #{payload.except(:name).to_json}" end def multi_search(event) self.class.runtime += event.duration return unless logger.debug? payload = event.payload name = "#{payload[:name]} (#{event.duration.round(1)}ms)" # no easy way to tell which host the client will use host = Searchkick.client.transport.hosts.first debug " #{color(name, YELLOW, true)} curl #{host[:protocol]}://#{host[:host]}:#{host[:port]}/_msearch?pretty -d '#{payload[:body]}'" end end # https://github.com/rails/rails/blob/master/activerecord/lib/active_record/railties/controller_runtime.rb module ControllerRuntime extend ActiveSupport::Concern protected attr_internal :searchkick_runtime def process_action(action, *args) # We also need to reset the runtime before each action # because of queries in middleware or in cases we are streaming # and it won't be cleaned up by the method below. Searchkick::LogSubscriber.reset_runtime super end def cleanup_view_runtime searchkick_rt_before_render = Searchkick::LogSubscriber.reset_runtime runtime = super searchkick_rt_after_render = Searchkick::LogSubscriber.reset_runtime self.searchkick_runtime = searchkick_rt_before_render + searchkick_rt_after_render runtime - searchkick_rt_after_render end def append_info_to_payload(payload) super payload[:searchkick_runtime] = (searchkick_runtime || 0) + Searchkick::LogSubscriber.reset_runtime end module ClassMethods def log_process_action(payload) messages = super runtime = payload[:searchkick_runtime] messages << ("Searchkick: %.1fms" % runtime.to_f) if runtime.to_f > 0 messages end end end end Searchkick::Query.send(:prepend, Searchkick::QueryWithInstrumentation) Searchkick::Index.send(:prepend, Searchkick::IndexWithInstrumentation) Searchkick.singleton_class.send(:prepend, Searchkick::SearchkickWithInstrumentation) Searchkick::LogSubscriber.attach_to :searchkick ActiveSupport.on_load(:action_controller) do include Searchkick::ControllerRuntime end
module Seek module AssetsCommon require 'net/ftp' #required to get the icon_filename_for_key include ImagesHelper def url_response_code asset_url url = URI.parse(asset_url) code="" if (["http","https"].include?(url.scheme)) Net::HTTP.start(url.host, url.port) do |http| code = http.head(url.request_uri).code end elsif (url.scheme=="ftp") username = 'anonymous' password = nil username, password = url.userinfo.split(/:/) if url.userinfo begin ftp = Net::FTP.new(url.host) ftp.login(username,password) ftp.getbinaryfile(url.path, '/dev/null', 20) { break } ftp.close code="200" rescue Net::FTPPermError code="401" rescue Errno::ECONNREFUSED,SocketError code="404" end else raise Seek::IncompatibleProtocolException.new("Only http, https and ftp protocols are supported") end return code end def test_asset_url c = self.controller_name.downcase symb=c.singularize.to_sym icon_filename=icon_filename_for_key("error") code="" msg="" asset_url=params[symb][:data_url] begin code = url_response_code(asset_url) if code == "200" icon_filename=icon_filename_for_key("tick") msg="The URL was accessed successfully" elsif code == "302" icon_filename=icon_filename_for_key("warn") msg="The url responded with a <b>redirect</b>. It can still be used, but content type and filename may not be recorded.<br/>You will also not be able to make a copy. When a user downloads this file, they will be redirected to the URL." elsif code == "401" icon_filename=icon_filename_for_key("warn") msg="The url responded with <b>unauthorized</b>.<br/> It can still be used, but content type and filename will not be recorded.<br/>You will also not be able to make a copy. When a user downloads this file, they will be redirected to the URL." elsif code == "404" msg="Nothing was found at the URL you provided. You can test the link by opening in another window or tab:<br/><a href=#{asset_url} target='_blank'>#{asset_url}</a>" else msg="There was a problem accessing the URL. You can test the link by opening in another window or tab:<br/><a href=#{asset_url} target='_blank'>#{asset_url}</a>" end rescue Seek::IncompatibleProtocolException=>e msg = e.message rescue Exception=>e msg="There was a problem accessing the URL. You can test the link by opening in another window or tab:<br/><a href=#{asset_url}>#{asset_url}</a>" end image = "<img src='/images/#{icon_filename}'/>" render :update do |page| page.replace_html "test_url_result_icon",image if msg.length>0 page.replace_html "test_url_msg",msg page.show 'test_url_msg' page.visual_effect :highlight,"test_url_msg" if code=="302" || code=="401" page['local_copy'].checked=false page['local_copy'].disable else page['local_copy'].enable end end end end def download_jerm_asset asset project=asset.project project.decrypt_credentials downloader=Jerm::DownloaderFactory.create project.name resource_type = asset.class.name.split("::")[0] #need to handle versions, e.g. Sop::Version data_hash = downloader.get_remote_data asset.content_blob.url,project.site_username,project.site_password, resource_type send_file data_hash[:data_tmp_path], :filename => data_hash[:filename] || asset.original_filename, :content_type => data_hash[:content_type] || asset.content_type, :disposition => 'attachment' end def download_via_url asset code = url_response_code(asset.content_blob.url) if (["302","401"].include?(code)) redirect_to(asset.content_blob.url,:target=>"_blank") elsif code=="404" flash[:error]="This item is referenced at a remote location, which is currently unavailable" redirect_to asset.parent,:version=>asset.version else downloader=RemoteDownloader.new data_hash = downloader.get_remote_data asset.content_blob.url send_file data_hash[:data_tmp_path], :filename => data_hash[:filename] || asset.original_filename, :content_type => data_hash[:content_type] || asset.content_type, :disposition => 'attachment' end end def handle_data render_action_on_error=:new c = self.controller_name.downcase symb=c.singularize.to_sym if (params[symb][:data]).blank? && (params[symb][:data_url]).blank? flash.now[:error] = "Please select a file to upload or provide a URL to the data." if render_action_on_error respond_to do |format| format.html do set_parameters_for_sharing_form render :action => render_action_on_error end end end return false elsif !(params[symb][:data]).blank? && (params[symb][:data]).size == 0 && (params[symb][:data_url]).blank? flash.now[:error] = "The file that you are uploading is empty. Please check your selection and try again!" if render_action_on_error respond_to do |format| format.html do set_parameters_for_sharing_form render :action => render_action_on_error end end end return false else #upload takes precendence if both params are present begin if !(params[symb][:data]).blank? # store properties and contents of the file temporarily and remove the latter from params[], # so that when saving main object params[] wouldn't contain the binary data anymore params[symb][:content_type] = (params[symb][:data]).content_type params[symb][:original_filename] = (params[symb][:data]).original_filename @tmp_io_object = params[symb][:data] elsif !(params[symb][:data_url]).blank? make_local_copy = params[symb][:local_copy]=="1" @data_url=params[symb][:data_url] code = url_response_code @data_url if (code == "200") downloader=RemoteDownloader.new data_hash = downloader.get_remote_data @data_url,nil,nil,nil,make_local_copy @tmp_io_object=File.open data_hash[:data_tmp_path],"r" if make_local_copy params[symb][:content_type] = data_hash[:content_type] params[symb][:original_filename] = data_hash[:filename] elsif (["302","401"].include?(code)) params[symb][:content_type] = "" params[symb][:original_filename] = "" else flash.now[:error] = "Processing the URL responded with a response code (#{code}), indicating the URL is inaccessible." if render_action_on_error respond_to do |format| format.html do set_parameters_for_sharing_form render :action => render_action_on_error end end end return false end end rescue Seek::IncompatibleProtocolException=>e flash.now[:error] = e.message if render_action_on_error respond_to do |format| format.html do set_parameters_for_sharing_form render :action => render_action_on_error end end end return false rescue Exception=>e flash.now[:error] = "Unable to read from the URL." if render_action_on_error respond_to do |format| format.html do set_parameters_for_sharing_form render :action => render_action_on_error end end end return false end params[symb].delete 'data_url' params[symb].delete 'data' params[symb].delete 'local_copy' return true end end def handle_download asset if asset.content_blob.url.blank? if asset.content_blob.file_exists? send_file asset.content_blob.filepath, :filename => asset.original_filename, :content_type => asset.content_type, :disposition => 'attachment' else send_data asset.content_blob.data, :filename => asset.original_filename, :content_type => asset.content_type, :disposition => 'attachment' end else if asset.contributor.nil? #A jerm generated resource download_jerm_asset asset else if asset.content_blob.file_exists? send_file asset.content_blob.filepath, :filename => asset.original_filename, :content_type => asset.content_type, :disposition => 'attachment' else download_via_url asset end end end end end end report error correctly when url is unreachable module Seek module AssetsCommon require 'net/ftp' #required to get the icon_filename_for_key include ImagesHelper def url_response_code asset_url url = URI.parse(asset_url) code="" if (["http","https"].include?(url.scheme)) Net::HTTP.start(url.host, url.port) do |http| code = http.head(url.request_uri).code end elsif (url.scheme=="ftp") username = 'anonymous' password = nil username, password = url.userinfo.split(/:/) if url.userinfo begin ftp = Net::FTP.new(url.host) ftp.login(username,password) ftp.getbinaryfile(url.path, '/dev/null', 20) { break } ftp.close code="200" rescue Net::FTPPermError code="401" rescue Errno::ECONNREFUSED,SocketError,Errno::EHOSTUNREACH code="404" end else raise Seek::IncompatibleProtocolException.new("Only http, https and ftp protocols are supported") end return code end def test_asset_url c = self.controller_name.downcase symb=c.singularize.to_sym icon_filename=icon_filename_for_key("error") code="" msg="" asset_url=params[symb][:data_url] begin code = url_response_code(asset_url) if code == "200" icon_filename=icon_filename_for_key("tick") msg="The URL was accessed successfully" elsif code == "302" icon_filename=icon_filename_for_key("warn") msg="The url responded with a <b>redirect</b>. It can still be used, but content type and filename may not be recorded.<br/>You will also not be able to make a copy. When a user downloads this file, they will be redirected to the URL." elsif code == "401" icon_filename=icon_filename_for_key("warn") msg="The url responded with <b>unauthorized</b>.<br/> It can still be used, but content type and filename will not be recorded.<br/>You will also not be able to make a copy. When a user downloads this file, they will be redirected to the URL." elsif code == "404" msg="Nothing was found at the URL you provided. You can test the link by opening in another window or tab:<br/><a href=#{asset_url} target='_blank'>#{asset_url}</a>" else msg="There was a problem accessing the URL. You can test the link by opening in another window or tab:<br/><a href=#{asset_url} target='_blank'>#{asset_url}</a>" end rescue Seek::IncompatibleProtocolException=>e msg = e.message rescue Exception=>e msg="There was a problem accessing the URL. You can test the link by opening in another window or tab:<br/><a href=#{asset_url}>#{asset_url}</a>" end image = "<img src='/images/#{icon_filename}'/>" render :update do |page| page.replace_html "test_url_result_icon",image if msg.length>0 page.replace_html "test_url_msg",msg page.show 'test_url_msg' page.visual_effect :highlight,"test_url_msg" if code=="302" || code=="401" page['local_copy'].checked=false page['local_copy'].disable else page['local_copy'].enable end end end end def download_jerm_asset asset project=asset.project project.decrypt_credentials downloader=Jerm::DownloaderFactory.create project.name resource_type = asset.class.name.split("::")[0] #need to handle versions, e.g. Sop::Version data_hash = downloader.get_remote_data asset.content_blob.url,project.site_username,project.site_password, resource_type send_file data_hash[:data_tmp_path], :filename => data_hash[:filename] || asset.original_filename, :content_type => data_hash[:content_type] || asset.content_type, :disposition => 'attachment' end def download_via_url asset code = url_response_code(asset.content_blob.url) if (["302","401"].include?(code)) redirect_to(asset.content_blob.url,:target=>"_blank") elsif code=="404" flash[:error]="This item is referenced at a remote location, which is currently unavailable" redirect_to asset.parent,:version=>asset.version else downloader=RemoteDownloader.new data_hash = downloader.get_remote_data asset.content_blob.url send_file data_hash[:data_tmp_path], :filename => data_hash[:filename] || asset.original_filename, :content_type => data_hash[:content_type] || asset.content_type, :disposition => 'attachment' end end def handle_data render_action_on_error=:new c = self.controller_name.downcase symb=c.singularize.to_sym if (params[symb][:data]).blank? && (params[symb][:data_url]).blank? flash.now[:error] = "Please select a file to upload or provide a URL to the data." if render_action_on_error respond_to do |format| format.html do set_parameters_for_sharing_form render :action => render_action_on_error end end end return false elsif !(params[symb][:data]).blank? && (params[symb][:data]).size == 0 && (params[symb][:data_url]).blank? flash.now[:error] = "The file that you are uploading is empty. Please check your selection and try again!" if render_action_on_error respond_to do |format| format.html do set_parameters_for_sharing_form render :action => render_action_on_error end end end return false else #upload takes precendence if both params are present begin if !(params[symb][:data]).blank? # store properties and contents of the file temporarily and remove the latter from params[], # so that when saving main object params[] wouldn't contain the binary data anymore params[symb][:content_type] = (params[symb][:data]).content_type params[symb][:original_filename] = (params[symb][:data]).original_filename @tmp_io_object = params[symb][:data] elsif !(params[symb][:data_url]).blank? make_local_copy = params[symb][:local_copy]=="1" @data_url=params[symb][:data_url] code = url_response_code @data_url if (code == "200") downloader=RemoteDownloader.new data_hash = downloader.get_remote_data @data_url,nil,nil,nil,make_local_copy @tmp_io_object=File.open data_hash[:data_tmp_path],"r" if make_local_copy params[symb][:content_type] = data_hash[:content_type] params[symb][:original_filename] = data_hash[:filename] elsif (["302","401"].include?(code)) params[symb][:content_type] = "" params[symb][:original_filename] = "" else flash.now[:error] = "Processing the URL responded with a response code (#{code}), indicating the URL is inaccessible." if render_action_on_error respond_to do |format| format.html do set_parameters_for_sharing_form render :action => render_action_on_error end end end return false end end rescue Seek::IncompatibleProtocolException=>e flash.now[:error] = e.message if render_action_on_error respond_to do |format| format.html do set_parameters_for_sharing_form render :action => render_action_on_error end end end return false rescue Exception=>e flash.now[:error] = "Unable to read from the URL." if render_action_on_error respond_to do |format| format.html do set_parameters_for_sharing_form render :action => render_action_on_error end end end return false end params[symb].delete 'data_url' params[symb].delete 'data' params[symb].delete 'local_copy' return true end end def handle_download asset if asset.content_blob.url.blank? if asset.content_blob.file_exists? send_file asset.content_blob.filepath, :filename => asset.original_filename, :content_type => asset.content_type, :disposition => 'attachment' else send_data asset.content_blob.data, :filename => asset.original_filename, :content_type => asset.content_type, :disposition => 'attachment' end else if asset.contributor.nil? #A jerm generated resource download_jerm_asset asset else if asset.content_blob.file_exists? send_file asset.content_blob.filepath, :filename => asset.original_filename, :content_type => asset.content_type, :disposition => 'attachment' else download_via_url asset end end end end end end
module Serverspec VERSION = "0.5.0" end Bump up version module Serverspec VERSION = "0.5.1" end
module Serverspec VERSION = "2.37.0" end Bump up version [skip ci] module Serverspec VERSION = "2.37.1" end
module Sevenpages VERSION = "1.1.0" end Bump version module Sevenpages VERSION = "1.2.0" end
# # Cookbook Name:: automount # Provider:: automount # # Copyright (C) 2014 Nephila Graphic # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # action :disable do new_resource.updated_by_last_action(disable_direct) end action :enable do new_resource.updated_by_last_action(enable_direct) end private def mountline # generate the automount line options = [ "-fstype=#{new_resource.fstype}", new_resource.options ].flatten.join ',' case new_resource.device_type when :device target = ":#{new_resource.device}" when :uuid target = ":UUID=#{new_resource.device}" when :label target = ":LABEL=#{new_resource.device}" end line = "#{new_resource.mount_point} #{options} #{target}" line end def mount_status? # Check to see if there is a entry in /etc/auto.direct. Last entry for a volume wins. enabled = false ::File.foreach('/etc/auto.direct') do |line| case line when /^[#\s]/ next when /^\s*#{Regexp.escape(mountline)}\s*/ return :enabled when /^\s*#{Regexp.escape(new_resource.mount_point)}\s+/ Chef::Log.debug("Found conflicting mount point #{@new_resource.mount_point} in /etc/auto.direct") return :conflict end end if enabled return :enabled else return :missing end end # Returns true if changed, otherwise false. def enable_direct case mount_status? when :enabled Chef::Log.debug("#{new_resource} is already enabled - nothing to do") when :missing, :conflict if mount_status? == :conflict Chef::Log.error("#{@new_resource} is conflicting with existing mount at #{@new_resource.mount_point}") disable_direct end ::File.open('/etc/auto.direct', 'a') do |fstab| fstab.puts(mountline) Chef::Log.debug("#{@new_resource} is enabled at #{@new_resource.mount_point}") end return true else return false end end # Returns true if changed, otherwise false def disable_direct case mount_status? when :enabled, :conflict contents = [] found = false ::File.readlines('/etc/auto.direct').reverse_each do |line| if !found && line =~ /^\s*#{Regexp.escape(new_resource.mount_point)}\s+/ found = true Chef::Log.debug("#{@new_resource} is removed from fstab") next else contents << line end end ::File.open('/etc/auto.direct', 'w') do |fstab| contents.reverse_each { |line| fstab.puts line } end return true else Chef::Log.debug("#{@new_resource} is not enabled - nothing to do") return false end end Update default.rb Add target type "network." # # Cookbook Name:: automount # Provider:: automount # # Copyright (C) 2014 Nephila Graphic # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # action :disable do new_resource.updated_by_last_action(disable_direct) end action :enable do new_resource.updated_by_last_action(enable_direct) end private def mountline # generate the automount line options = [ "-fstype=#{new_resource.fstype}", new_resource.options ].flatten.join ',' case new_resource.device_type when :device target = ":#{new_resource.device}" when :uuid target = ":UUID=#{new_resource.device}" when :label target = ":LABEL=#{new_resource.device}" when :network + target = "#{new_resource.device}" end line = "#{new_resource.mount_point} #{options} #{target}" line end def mount_status? # Check to see if there is a entry in /etc/auto.direct. Last entry for a volume wins. enabled = false ::File.foreach('/etc/auto.direct') do |line| case line when /^[#\s]/ next when /^\s*#{Regexp.escape(mountline)}\s*/ return :enabled when /^\s*#{Regexp.escape(new_resource.mount_point)}\s+/ Chef::Log.debug("Found conflicting mount point #{@new_resource.mount_point} in /etc/auto.direct") return :conflict end end if enabled return :enabled else return :missing end end # Returns true if changed, otherwise false. def enable_direct case mount_status? when :enabled Chef::Log.debug("#{new_resource} is already enabled - nothing to do") when :missing, :conflict if mount_status? == :conflict Chef::Log.error("#{@new_resource} is conflicting with existing mount at #{@new_resource.mount_point}") disable_direct end ::File.open('/etc/auto.direct', 'a') do |fstab| fstab.puts(mountline) Chef::Log.debug("#{@new_resource} is enabled at #{@new_resource.mount_point}") end return true else return false end end # Returns true if changed, otherwise false def disable_direct case mount_status? when :enabled, :conflict contents = [] found = false ::File.readlines('/etc/auto.direct').reverse_each do |line| if !found && line =~ /^\s*#{Regexp.escape(new_resource.mount_point)}\s+/ found = true Chef::Log.debug("#{@new_resource} is removed from fstab") next else contents << line end end ::File.open('/etc/auto.direct', 'w') do |fstab| contents.reverse_each { |line| fstab.puts line } end return true else Chef::Log.debug("#{@new_resource} is not enabled - nothing to do") return false end end
use_inline_resources action :create do if new_resource.main_class && new_resource.jar raise "You can specify a main_class or a jar file but not both." end unless new_resource.main_class || new_resource.jar raise "You must specify main_class or jar" end template "#{node[:bluepill][:conf_dir]}/#{new_resource.service_name}.pill" do source 'service.pill.erb' cookbook 'java-service' variables ({ :name => new_resource.service_name, :java_command => java_command, :user => new_resource.user }) end bluepill_service new_resource.service_name do action [:enable, :load, :start] end end def java_command system_properties = new_resource.system_properties || node[new_resource.name]['java']['-D'] standard_options = new_resource.standard_options || node[new_resource.name]['java']['-'] non_standard_options = new_resource.non_standard_options || node[new_resource.name]['java']['-X'] hotspot_options = new_resource.hotspot_options || node[new_resource.name]['java']['-XX'] args = new_resource.args || node[new_resource.name]['java']['args'] JavaCommand.new(new_resource.main_class || new_resource.jar, { :classpath => new_resource.classpath, :system_properties => system_properties, :standard_options => standard_options, :non_standard_options => non_standard_options, :hotspot_options => hotspot_options, :args => args }) end fixing food critic violations in the provider use_inline_resources action :create do if new_resource.main_class && new_resource.jar raise 'You can specify a main_class or a jar file but not both.' end unless new_resource.main_class || new_resource.jar raise 'You must specify main_class or jar' end template "#{node['bluepill']['conf_dir']}/#{new_resource.service_name}.pill" do source 'service.pill.erb' cookbook 'java-service' variables ({ :name => new_resource.service_name, :java_command => java_command, :user => new_resource.user }) end bluepill_service new_resource.service_name do action [:enable, :load, :start] end end def java_command system_properties = new_resource.system_properties || node[new_resource.name]['java']['-D'] standard_options = new_resource.standard_options || node[new_resource.name]['java']['-'] non_standard_options = new_resource.non_standard_options || node[new_resource.name]['java']['-X'] hotspot_options = new_resource.hotspot_options || node[new_resource.name]['java']['-XX'] args = new_resource.args || node[new_resource.name]['java']['args'] JavaCommand.new(new_resource.main_class || new_resource.jar, { :classpath => new_resource.classpath, :system_properties => system_properties, :standard_options => standard_options, :non_standard_options => non_standard_options, :hotspot_options => hotspot_options, :args => args }) end
# # Author:: Seth Chisamore (<schisamo@opscode.com>) # Cookbook Name:: windows # Provider:: package # # Copyright:: 2011, Opscode, Inc. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # if RUBY_PLATFORM =~ /mswin|mingw32|windows/ require 'win32/registry' end require 'chef/mixin/shell_out' require 'chef/mixin/language' include Chef::Mixin::ShellOut include Windows::Helper # the logic in all action methods mirror that of # the Chef::Provider::Package which will make # refactoring into core chef easy action :install do # If we specified a version, and it's not the current version, move to the specified version if @new_resource.version != nil && @new_resource.version != @current_resource.version install_version = @new_resource.version # If it's not installed at all, install it elsif @current_resource.version == nil install_version = candidate_version end if install_version Chef::Log.info("Installing #{@new_resource} version #{install_version}") status = install_package(@new_resource.package_name, install_version) if status @new_resource.updated_by_last_action(true) end end end action :upgrade do if @current_resource.version != candidate_version orig_version = @current_resource.version || "uninstalled" Chef::Log.info("Upgrading #{@new_resource} version from #{orig_version} to #{candidate_version}") status = upgrade_package(@new_resource.package_name, candidate_version) if status @new_resource.updated_by_last_action(true) end end end action :remove do if removing_package? Chef::Log.info("Removing #{@new_resource}") remove_package(@current_resource.package_name, @new_resource.version) @new_resource.updated_by_last_action(true) else end end def removing_package? if @current_resource.version.nil? false # nothing to remove elsif @new_resource.version.nil? true # remove any version of a package elsif @new_resource.version == @current_resource.version true # remove the version we have else false # we don't have the version we want to remove end end def expand_options(options) options ? " #{options}" : "" end # these methods are the required overrides of # a provider that extends from Chef::Provider::Package # so refactoring into core Chef should be easy def load_current_resource @current_resource = Chef::Resource::WindowsPackage.new(@new_resource.name) @current_resource.package_name(@new_resource.package_name) @current_resource.version(nil) unless current_installed_version.nil? @current_resource.version(current_installed_version) end @current_resource end def current_installed_version @current_installed_version ||= begin if installed_packages.include?(@new_resource.package_name) installed_packages[@new_resource.package_name][:version] end end end def candidate_version @candidate_version ||= begin @new_resource.version || 'latest' end end def install_package(name,version) Chef::Log.debug("Processing #{@new_resource} as a #{installer_type} installer.") install_args = [cached_file(@new_resource.source, @new_resource.checksum), expand_options(unattended_installation_flags), expand_options(@new_resource.options)] Chef::Log.info("Starting installation...this could take awhile.") Chef::Log.debug "Install command: #{ sprintf(install_command_template, *install_args) }" shell_out!(sprintf(install_command_template, *install_args), {:timeout => @new_resource.timeout, :returns => @new_resource.success_codes}) end def remove_package(name, version) uninstall_string = installed_packages[@new_resource.package_name][:uninstall_string] Chef::Log.info("Registry provided uninstall string for #{@new_resource} is '#{uninstall_string}'") uninstall_command = begin if uninstall_string =~ /msiexec/i "#{uninstall_string} /qn" else uninstall_string.gsub!('"','') "start \"\" /wait /d\"#{::File.dirname(uninstall_string)}\" #{::File.basename(uninstall_string)}#{expand_options(@new_resource.options)} /S" end end Chef::Log.info("Removing #{@new_resource} with uninstall command '#{uninstall_command}'") shell_out!(uninstall_command, {:returns => @new_resource.success_codes}) end private def install_command_template case installer_type when :msi "msiexec%2$s \"%1$s\"%3$s" else "start \"\" /wait \"%1$s\"%2$s%3$s & exit %%%%ERRORLEVEL%%%%" end end def uninstall_command_template case installer_type when :msi "msiexec %2$s %1$s" else "start \"\" /wait /d%1$s %2$s %3$s" end end # http://unattended.sourceforge.net/installers.php def unattended_installation_flags case installer_type when :msi # this is no-ui "/qn /i" when :installshield "/s /sms" when :nsis "/S /NCRC" when :inno #"/sp- /silent /norestart" "/verysilent /norestart" when :wise "/s" else end end def installed_packages @installed_packages || begin installed_packages = {} # Computer\HKEY_LOCAL_MACHINE\Software\Microsoft\Windows\CurrentVersion\Uninstall installed_packages.merge!(extract_installed_packages_from_key(::Win32::Registry::HKEY_LOCAL_MACHINE)) #rescue nil # 64-bit registry view # Computer\HKEY_LOCAL_MACHINE\Software\Wow6464Node\Microsoft\Windows\CurrentVersion\Uninstall installed_packages.merge!(extract_installed_packages_from_key(::Win32::Registry::HKEY_LOCAL_MACHINE, (::Win32::Registry::Constants::KEY_READ | 0x0100))) #rescue nil # 32-bit registry view # Computer\HKEY_LOCAL_MACHINE\Software\Wow6432Node\Microsoft\Windows\CurrentVersion\Uninstall installed_packages.merge!(extract_installed_packages_from_key(::Win32::Registry::HKEY_LOCAL_MACHINE, (::Win32::Registry::Constants::KEY_READ | 0x0200))) #rescue nil # Computer\HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Uninstall installed_packages.merge!(extract_installed_packages_from_key(::Win32::Registry::HKEY_CURRENT_USER)) #rescue nil installed_packages end end def extract_installed_packages_from_key(hkey = ::Win32::Registry::HKEY_LOCAL_MACHINE, desired = ::Win32::Registry::Constants::KEY_READ) uninstall_subkey = 'Software\Microsoft\Windows\CurrentVersion\Uninstall' packages = {} begin ::Win32::Registry.open(hkey, uninstall_subkey, desired) do |reg| reg.each_key do |key, wtime| begin k = reg.open(key, desired) display_name = k["DisplayName"] rescue nil version = k["DisplayVersion"] rescue "NO VERSION" uninstall_string = k["UninstallString"] rescue nil if display_name packages[display_name] = {:name => display_name, :version => version, :uninstall_string => uninstall_string} end rescue ::Win32::Registry::Error end end end rescue ::Win32::Registry::Error end packages end def installer_type @installer_type || begin if @new_resource.installer_type @new_resource.installer_type else basename = ::File.basename(cached_file(@new_resource.source, @new_resource.checksum)) if basename.split(".").last.downcase == "msi" # Microsoft MSI :msi else # search the binary file for installer type contents = ::Kernel.open(::File.expand_path(cached_file(@new_resource.source)), "rb") {|io| io.read } # TODO limit data read in case contents when /inno/i # Inno Setup :inno when /wise/i # Wise InstallMaster :wise when /nsis/i # Nullsoft Scriptable Install System :nsis else # if file is named 'setup.exe' assume installshield if basename == "setup.exe" :installshield else raise Chef::Exceptions::AttributeNotFound, "installer_type could not be determined, please set manually" end end end end end end Making change to uninstall string to honor exit code. # # Author:: Seth Chisamore (<schisamo@opscode.com>) # Cookbook Name:: windows # Provider:: package # # Copyright:: 2011, Opscode, Inc. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # if RUBY_PLATFORM =~ /mswin|mingw32|windows/ require 'win32/registry' end require 'chef/mixin/shell_out' require 'chef/mixin/language' include Chef::Mixin::ShellOut include Windows::Helper # the logic in all action methods mirror that of # the Chef::Provider::Package which will make # refactoring into core chef easy action :install do # If we specified a version, and it's not the current version, move to the specified version if @new_resource.version != nil && @new_resource.version != @current_resource.version install_version = @new_resource.version # If it's not installed at all, install it elsif @current_resource.version == nil install_version = candidate_version end if install_version Chef::Log.info("Installing #{@new_resource} version #{install_version}") status = install_package(@new_resource.package_name, install_version) if status @new_resource.updated_by_last_action(true) end end end action :upgrade do if @current_resource.version != candidate_version orig_version = @current_resource.version || "uninstalled" Chef::Log.info("Upgrading #{@new_resource} version from #{orig_version} to #{candidate_version}") status = upgrade_package(@new_resource.package_name, candidate_version) if status @new_resource.updated_by_last_action(true) end end end action :remove do if removing_package? Chef::Log.info("Removing #{@new_resource}") remove_package(@current_resource.package_name, @new_resource.version) @new_resource.updated_by_last_action(true) else end end def removing_package? if @current_resource.version.nil? false # nothing to remove elsif @new_resource.version.nil? true # remove any version of a package elsif @new_resource.version == @current_resource.version true # remove the version we have else false # we don't have the version we want to remove end end def expand_options(options) options ? " #{options}" : "" end # these methods are the required overrides of # a provider that extends from Chef::Provider::Package # so refactoring into core Chef should be easy def load_current_resource @current_resource = Chef::Resource::WindowsPackage.new(@new_resource.name) @current_resource.package_name(@new_resource.package_name) @current_resource.version(nil) unless current_installed_version.nil? @current_resource.version(current_installed_version) end @current_resource end def current_installed_version @current_installed_version ||= begin if installed_packages.include?(@new_resource.package_name) installed_packages[@new_resource.package_name][:version] end end end def candidate_version @candidate_version ||= begin @new_resource.version || 'latest' end end def install_package(name,version) Chef::Log.debug("Processing #{@new_resource} as a #{installer_type} installer.") install_args = [cached_file(@new_resource.source, @new_resource.checksum), expand_options(unattended_installation_flags), expand_options(@new_resource.options)] Chef::Log.info("Starting installation...this could take awhile.") Chef::Log.debug "Install command: #{ sprintf(install_command_template, *install_args) }" shell_out!(sprintf(install_command_template, *install_args), {:timeout => @new_resource.timeout, :returns => @new_resource.success_codes}) end def remove_package(name, version) uninstall_string = installed_packages[@new_resource.package_name][:uninstall_string] Chef::Log.info("Registry provided uninstall string for #{@new_resource} is '#{uninstall_string}'") uninstall_command = begin if uninstall_string =~ /msiexec/i "#{uninstall_string} /qn" else uninstall_string.gsub!('"','') "start \"\" /wait /d\"#{::File.dirname(uninstall_string)}\" #{::File.basename(uninstall_string)}#{expand_options(@new_resource.options)} /S & exit %%%%ERRORLEVEL%%%%" end end Chef::Log.info("Removing #{@new_resource} with uninstall command '#{uninstall_command}'") shell_out!(uninstall_command, {:returns => @new_resource.success_codes}) end private def install_command_template case installer_type when :msi "msiexec%2$s \"%1$s\"%3$s" else "start \"\" /wait \"%1$s\"%2$s%3$s & exit %%%%ERRORLEVEL%%%%" end end # http://unattended.sourceforge.net/installers.php def unattended_installation_flags case installer_type when :msi # this is no-ui "/qn /i" when :installshield "/s /sms" when :nsis "/S /NCRC" when :inno #"/sp- /silent /norestart" "/verysilent /norestart" when :wise "/s" else end end def installed_packages @installed_packages || begin installed_packages = {} # Computer\HKEY_LOCAL_MACHINE\Software\Microsoft\Windows\CurrentVersion\Uninstall installed_packages.merge!(extract_installed_packages_from_key(::Win32::Registry::HKEY_LOCAL_MACHINE)) #rescue nil # 64-bit registry view # Computer\HKEY_LOCAL_MACHINE\Software\Wow6464Node\Microsoft\Windows\CurrentVersion\Uninstall installed_packages.merge!(extract_installed_packages_from_key(::Win32::Registry::HKEY_LOCAL_MACHINE, (::Win32::Registry::Constants::KEY_READ | 0x0100))) #rescue nil # 32-bit registry view # Computer\HKEY_LOCAL_MACHINE\Software\Wow6432Node\Microsoft\Windows\CurrentVersion\Uninstall installed_packages.merge!(extract_installed_packages_from_key(::Win32::Registry::HKEY_LOCAL_MACHINE, (::Win32::Registry::Constants::KEY_READ | 0x0200))) #rescue nil # Computer\HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Uninstall installed_packages.merge!(extract_installed_packages_from_key(::Win32::Registry::HKEY_CURRENT_USER)) #rescue nil installed_packages end end def extract_installed_packages_from_key(hkey = ::Win32::Registry::HKEY_LOCAL_MACHINE, desired = ::Win32::Registry::Constants::KEY_READ) uninstall_subkey = 'Software\Microsoft\Windows\CurrentVersion\Uninstall' packages = {} begin ::Win32::Registry.open(hkey, uninstall_subkey, desired) do |reg| reg.each_key do |key, wtime| begin k = reg.open(key, desired) display_name = k["DisplayName"] rescue nil version = k["DisplayVersion"] rescue "NO VERSION" uninstall_string = k["UninstallString"] rescue nil if display_name packages[display_name] = {:name => display_name, :version => version, :uninstall_string => uninstall_string} end rescue ::Win32::Registry::Error end end end rescue ::Win32::Registry::Error end packages end def installer_type @installer_type || begin if @new_resource.installer_type @new_resource.installer_type else basename = ::File.basename(cached_file(@new_resource.source, @new_resource.checksum)) if basename.split(".").last.downcase == "msi" # Microsoft MSI :msi else # search the binary file for installer type contents = ::Kernel.open(::File.expand_path(cached_file(@new_resource.source)), "rb") {|io| io.read } # TODO limit data read in case contents when /inno/i # Inno Setup :inno when /wise/i # Wise InstallMaster :wise when /nsis/i # Nullsoft Scriptable Install System :nsis else # if file is named 'setup.exe' assume installshield if basename == "setup.exe" :installshield else raise Chef::Exceptions::AttributeNotFound, "installer_type could not be determined, please set manually" end end end end end end
# # Cookbook Name:: newrelic # Provider:: sysmond # # Author:: Kirill Kouznetsov <agon.smith@gmail.com> # # Copyright 2013, Kirill Kouznetsov # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # action :install do nr_repo = apt_repository "newrelic" do distribution node['newrelic']['apt']['di uri node['newrelic']['apt']['repo']stribution'] components node['newrelic']['apt']['components'] key node['newrelic']['apt']['keyfile'] end nr_pack = package node['newrelic']['package_name'] if nr_repo.updated_by_last_action? or nr_pack.updated_by_last_action? new_resource.updated_by_last_action(true) end end action :configure do all_newrelic_res = run_context.resource_collection.all_resources.select do |resource| resource.resource_name == new_resource.resource_name end bad_invocations = all_newrelic_res.select do |resource| resource.key != all_newrelic_res.first.key end.count if bad_invocations > 0 Chef::Log.warn("Resource #{new_resource} was invoked with different license keys for #{bad_invocations+1} times. This can break your system configuration!!! Please, be careful!!!") end directory "/var/run/newrelic" do owner "newrelic" group "newrelic" end directory "/etc/newrelic" do owner "root" group "root" mode 00755 action :create end nr_temp = template "/etc/newrelic/nrsysmond.cfg" do source "nrsysmond.cfg.erb" owner "root" group "newrelic" mode "640" variables( :license_key => new_resource.key ) notifies :restart, "service[newrelic-sysmond]" end nr_serv = service "newrelic-sysmond" do supports :status => true, :restart => true, :reload => true action [ :enable, :start ] end if nr_temp.updated_by_last_action? or nr_serv.updated_by_last_action? new_resource.updated_by_last_action(true) end end action :disable do nr_serv = service "newrelic-sysmond" do supports :status => true, :restart => true, :reload => true action [ :disable, :stop ] end if nr_serv.updated_by_last_action? new_resource.updated_by_last_action(true) end end action :uninstall do nr_pack = package node['newrelic']['package_name'] do action :uninstall end if nr_pack.updated_by_last_action? new_resource.updated_by_last_action(true) end end # vim: ts=2 sts=2 sw=2 et sta Fix misspelling in sysmond provider. # # Cookbook Name:: newrelic # Provider:: sysmond # # Author:: Kirill Kouznetsov <agon.smith@gmail.com> # # Copyright 2013, Kirill Kouznetsov # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # action :install do nr_repo = apt_repository "newrelic" do distribution node['newrelic']['apt']['distribution'] uri node['newrelic']['apt']['repo'] components node['newrelic']['apt']['components'] key node['newrelic']['apt']['keyfile'] end nr_pack = package node['newrelic']['package_name'] if nr_repo.updated_by_last_action? or nr_pack.updated_by_last_action? new_resource.updated_by_last_action(true) end end action :configure do all_newrelic_res = run_context.resource_collection.all_resources.select do |resource| resource.resource_name == new_resource.resource_name end bad_invocations = all_newrelic_res.select do |resource| resource.key != all_newrelic_res.first.key end.count if bad_invocations > 0 Chef::Log.warn("Resource #{new_resource} was invoked with different license keys for #{bad_invocations+1} times. This can break your system configuration!!! Please, be careful!!!") end directory "/var/run/newrelic" do owner "newrelic" group "newrelic" end directory "/etc/newrelic" do owner "root" group "root" mode 00755 action :create end nr_temp = template "/etc/newrelic/nrsysmond.cfg" do source "nrsysmond.cfg.erb" owner "root" group "newrelic" mode "640" variables( :license_key => new_resource.key ) notifies :restart, "service[newrelic-sysmond]" end nr_serv = service "newrelic-sysmond" do supports :status => true, :restart => true, :reload => true action [ :enable, :start ] end if nr_temp.updated_by_last_action? or nr_serv.updated_by_last_action? new_resource.updated_by_last_action(true) end end action :disable do nr_serv = service "newrelic-sysmond" do supports :status => true, :restart => true, :reload => true action [ :disable, :stop ] end if nr_serv.updated_by_last_action? new_resource.updated_by_last_action(true) end end action :uninstall do nr_pack = package node['newrelic']['package_name'] do action :uninstall end if nr_pack.updated_by_last_action? new_resource.updated_by_last_action(true) end end # vim: ts=2 sts=2 sw=2 et sta
module Sidewalk class UriMatch attr_reader :parts, :parameters, :controller def initialize parts = [], parameters = {}, controller = nil unless parts.is_a?(Array) && parameters.is_a?(Hash) raise ArgumentError.new( 'Sidewalk::UriMatch([parts], {parameters}, controller)' ) end @parts, @parameters, @controller = parts, parameters, controller end end end [ci skip] docs for UriMatch module Sidewalk # Information on a +URI+ +=>+ {Controller} match. # # These are generated by {UriMapper}. class UriMatch # The URL path, divided into regexp-matches. # # The URI map is a tree; this tells you what was matched at each level # of the tree. attr_reader :parts # Any named captures from the match. attr_reader :parameters # What the URL maps to. # # This should be an instance of {Controller}, or a +Proc+. attr_reader :controller def initialize parts = [], parameters = {}, controller = nil unless parts.is_a?(Array) && parameters.is_a?(Hash) raise ArgumentError.new( 'Sidewalk::UriMatch([parts], {parameters}, controller)' ) end @parts, @parameters, @controller = parts, parameters, controller end end end
module Similarweb VERSION = "0.0.1" end version bump module Similarweb VERSION = "0.0.2" end
require "simple_xlsx_reader/version" require 'nokogiri' require 'zip/zip' require 'zip/zipfilesystem' require 'date' module SimpleXlsxReader def self.open(file_path) Document.new(file_path).to_hash end class Document attr_reader :file_path def initialize(file_path) @file_path = file_path end def sheets @sheets ||= Mapper.new(xml).load_sheets end def to_hash sheets.inject({}) {|acc, sheet| acc[sheet.name] = sheet.rows; acc} end def xml Xml.load(file_path) end class Xml attr_accessor :workbook, :shared_strings, :sheets, :styles def self.load(file_path) self.new.tap do |xml| Zip::ZipFile.open(file_path) do |zip| xml.workbook = Nokogiri::XML(zip.read('xl/workbook.xml')) xml.shared_strings = Nokogiri::XML(zip.read('xl/sharedStrings.xml')) xml.styles = Nokogiri::XML(zip.read('xl/styles.xml')) xml.sheets = [] i = 0 loop do i += 1 break if !zip.file.file?("xl/worksheets/sheet#{i}.xml") xml.sheets << Nokogiri::XML(zip.read("xl/worksheets/sheet#{i}.xml")) end end end end end class Mapper < Struct.new(:xml) def load_sheets sheet_toc.map do |(sheet_name, sheet_number)| Sheet.new(sheet_name, rows_on_sheet(sheet_number)) end end # Table of contents for the sheets, ex. {'Authors' => 0, ...} def sheet_toc xml.workbook.xpath('/xmlns:workbook/xmlns:sheets/xmlns:sheet'). inject({}) do |acc, sheet| acc[sheet.attributes['name'].value] = sheet.attributes['sheetId'].value.to_i - 1 # keep things 0-indexed acc end end def rows_on_sheet(number) xml.sheets[number]. xpath("/xmlns:worksheet/xmlns:sheetData/xmlns:row").map do |xrow| xrow.children.map do |xcell| type = xcell.attributes['t'] && xcell.attributes['t'].value # If not the above, attempt to determine from a custom style type ||= xcell.attributes['s'] && style_types[xcell.attributes['s'].value.to_i] self.class.cast(xcell.text, type, shared_strings: shared_strings) end end end # Excel doesn't record types for some cells, only its display style, so # we have to back out the type from that style. # # Some of these styles can be determined from a known set (see NumFmtMap), # while others are 'custom' and we have to make a best guess. # # This is the array of types corresponding to the styles a spreadsheet # uses, and includes both the known style types and the custom styles. # # Note that the xml sheet cells that use this don't reference the # numFmtId, but instead the array index of a style in the stored list of # only the styles used in the spreadsheet (which can be either known or # custom). Hence this style types array, rather than a map of numFmtId to # type. def style_types @style_types ||= xml.styles.xpath('/xmlns:styleSheet/xmlns:cellXfs/xmlns:xf').map {|xstyle| style_type_by_num_fmt_id(xstyle.attributes['numFmtId'].value)} end # Finds the type we think a style is; For example, fmtId 14 is a date # style, so this would return :date def style_type_by_num_fmt_id(id) return nil if id.nil? id = id.to_i if id > 164 # custom style, arg! custom_style_types[id] else # we should know this one NumFmtMap[id] end end # Map of (numFmtId > 164) (custom styles) to our best guess at the type # ex. {165 => :date_time} def custom_style_types @custom_style_types ||= xml.styles.xpath('/xmlns:styleSheet/xmlns:numFmts/xmlns:numFmt'). inject({}) do |acc, xstyle| acc[xstyle.attributes['numFmtId'].value.to_i] = determine_custom_style_type(xstyle.attributes['formatCode'].value) acc end end # This is the least deterministic part of reading xlsx files. Due to # custom styles, you can't know for sure when a date is a date other than # looking at its format and gessing. It's not impossible to guess right, # though. # # http://stackoverflow.com/questions/4948998/determining-if-an-xlsx-cell-is-date-formatted-for-excel-2007-spreadsheets def determine_custom_style_type(string) return :float if string[0] == '_' return :float if string[0] == ' 0' # Looks for one of ymdhis outside of meta-stuff like [Red] return :date_time if string =~ /(^|\])[^\[]*[ymdhis]/i return :unsupported end ## # The heart of typecasting. The ruby type is determined either explicitly # from the cell xml or implicitly from the cell style, and this # method expects that work to have been done already. This, then, # takes the type we determined it to be and casts the cell value # to that type. # # types: # - s: shared string (see #shared_string) # - n: number (cast to a float) # - b: boolean # - str: string # - inlineStr: string # - ruby symbol: for when type has been determined by style # # options: # - shared_strings: needed for 's' (shared string) type def self.cast(value, type, options = {}) return nil if value.nil? || value.empty? case type ## # There are few built-in types ## when 's' # shared string options[:shared_strings][value.to_i] when 'n' # number value.to_f when 'b' value.to_i == 1 when 'str' value when 'inlineStr' value ## # Type can also be determined by a style, # detected earlier and cast here by its standardized symbol ## when :string, :unsupported value when :fixnum value.to_i when :float value.to_f when :percentage value.to_f / 100 # the trickiest. note that all these formats can vary on # whether they actually contain a date, time, or datetime. when :date, :time, :date_time days_since_1900, fraction_of_24 = value.split('.') # http://stackoverflow.com/questions/10559767/how-to-convert-ms-excel-date-from-float-to-date-format-in-ruby date = Date.new(1899, 12, 30) + days_since_1900.to_i if fraction_of_24 # there is a time associated fraction_of_24 = "0.#{fraction_of_24}".to_f military = fraction_of_24 * 24 hour = military.truncate minute = ((military % 1) * 60).truncate return Time.utc(date.year, date.month, date.day, hour, minute) else return date end when :bignum if defined?(BigDecimal) BigDecimal.new(value) else value.to_f end ## # Beats me ## else value end end # Map of non-custom numFmtId to casting symbol NumFmtMap = { 0 => :string, # General 1 => :fixnum, # 0 2 => :float, # 0.00 3 => :fixnum, # #,##0 4 => :float, # #,##0.00 5 => :unsupported, # $#,##0_);($#,##0) 6 => :unsupported, # $#,##0_);[Red]($#,##0) 7 => :unsupported, # $#,##0.00_);($#,##0.00) 8 => :unsupported, # $#,##0.00_);[Red]($#,##0.00) 9 => :percentage, # 0% 10 => :percentage, # 0.00% 11 => :bignum, # 0.00E+00 12 => :unsupported, # # ?/? 13 => :unsupported, # # ??/?? 14 => :date, # mm-dd-yy 15 => :date, # d-mmm-yy 16 => :date, # d-mmm 17 => :date, # mmm-yy 18 => :time, # h:mm AM/PM 19 => :time, # h:mm:ss AM/PM 20 => :time, # h:mm 21 => :time, # h:mm:ss 22 => :date_time, # m/d/yy h:mm 37 => :unsupported, # #,##0 ;(#,##0) 38 => :unsupported, # #,##0 ;[Red](#,##0) 39 => :unsupported, # #,##0.00;(#,##0.00) 40 => :unsupported, # #,##0.00;[Red](#,##0.00) 45 => :time, # mm:ss 46 => :time, # [h]:mm:ss 47 => :time, # mmss.0 48 => :bignum, # ##0.0E+0 49 => :unsupported # @ } # For performance reasons, excel uses an optional SpreadsheetML feature # that puts all strings in a separate xml file, and then references # them by their index in that file. def shared_strings @shared_strings ||= xml.shared_strings. xpath('/xmlns:sst/xmlns:si/xmlns:t/text()').map(&:to_s) end end class Sheet < Struct.new(:name, :rows) def headers rows[0] end def data rows[1..-1] end def to_a data end end end end Make #open return a document rather than a hash Since sheets can have load errors, and possibly other important features, we should give them a document rather than a simple hash. The advantage of using ::open now, other than functioning as a primary interface, is that it will parse the file immediately, where Document#new doesn't open the document until something tries to access the sheets. require "simple_xlsx_reader/version" require 'nokogiri' require 'zip/zip' require 'zip/zipfilesystem' require 'date' module SimpleXlsxReader def self.open(file_path) Document.new(file_path).tap(&:sheets) end class Document attr_reader :file_path def initialize(file_path) @file_path = file_path end def sheets @sheets ||= Mapper.new(xml).load_sheets end def to_hash sheets.inject({}) {|acc, sheet| acc[sheet.name] = sheet.rows; acc} end def xml Xml.load(file_path) end class Xml attr_accessor :workbook, :shared_strings, :sheets, :styles def self.load(file_path) self.new.tap do |xml| Zip::ZipFile.open(file_path) do |zip| xml.workbook = Nokogiri::XML(zip.read('xl/workbook.xml')) xml.shared_strings = Nokogiri::XML(zip.read('xl/sharedStrings.xml')) xml.styles = Nokogiri::XML(zip.read('xl/styles.xml')) xml.sheets = [] i = 0 loop do i += 1 break if !zip.file.file?("xl/worksheets/sheet#{i}.xml") xml.sheets << Nokogiri::XML(zip.read("xl/worksheets/sheet#{i}.xml")) end end end end end class Mapper < Struct.new(:xml) def load_sheets sheet_toc.map do |(sheet_name, sheet_number)| Sheet.new(sheet_name, rows_on_sheet(sheet_number)) end end # Table of contents for the sheets, ex. {'Authors' => 0, ...} def sheet_toc xml.workbook.xpath('/xmlns:workbook/xmlns:sheets/xmlns:sheet'). inject({}) do |acc, sheet| acc[sheet.attributes['name'].value] = sheet.attributes['sheetId'].value.to_i - 1 # keep things 0-indexed acc end end def rows_on_sheet(number) xml.sheets[number]. xpath("/xmlns:worksheet/xmlns:sheetData/xmlns:row").map do |xrow| xrow.children.map do |xcell| type = xcell.attributes['t'] && xcell.attributes['t'].value # If not the above, attempt to determine from a custom style type ||= xcell.attributes['s'] && style_types[xcell.attributes['s'].value.to_i] self.class.cast(xcell.text, type, shared_strings: shared_strings) end end end # Excel doesn't record types for some cells, only its display style, so # we have to back out the type from that style. # # Some of these styles can be determined from a known set (see NumFmtMap), # while others are 'custom' and we have to make a best guess. # # This is the array of types corresponding to the styles a spreadsheet # uses, and includes both the known style types and the custom styles. # # Note that the xml sheet cells that use this don't reference the # numFmtId, but instead the array index of a style in the stored list of # only the styles used in the spreadsheet (which can be either known or # custom). Hence this style types array, rather than a map of numFmtId to # type. def style_types @style_types ||= xml.styles.xpath('/xmlns:styleSheet/xmlns:cellXfs/xmlns:xf').map {|xstyle| style_type_by_num_fmt_id(xstyle.attributes['numFmtId'].value)} end # Finds the type we think a style is; For example, fmtId 14 is a date # style, so this would return :date def style_type_by_num_fmt_id(id) return nil if id.nil? id = id.to_i if id > 164 # custom style, arg! custom_style_types[id] else # we should know this one NumFmtMap[id] end end # Map of (numFmtId > 164) (custom styles) to our best guess at the type # ex. {165 => :date_time} def custom_style_types @custom_style_types ||= xml.styles.xpath('/xmlns:styleSheet/xmlns:numFmts/xmlns:numFmt'). inject({}) do |acc, xstyle| acc[xstyle.attributes['numFmtId'].value.to_i] = determine_custom_style_type(xstyle.attributes['formatCode'].value) acc end end # This is the least deterministic part of reading xlsx files. Due to # custom styles, you can't know for sure when a date is a date other than # looking at its format and gessing. It's not impossible to guess right, # though. # # http://stackoverflow.com/questions/4948998/determining-if-an-xlsx-cell-is-date-formatted-for-excel-2007-spreadsheets def determine_custom_style_type(string) return :float if string[0] == '_' return :float if string[0] == ' 0' # Looks for one of ymdhis outside of meta-stuff like [Red] return :date_time if string =~ /(^|\])[^\[]*[ymdhis]/i return :unsupported end ## # The heart of typecasting. The ruby type is determined either explicitly # from the cell xml or implicitly from the cell style, and this # method expects that work to have been done already. This, then, # takes the type we determined it to be and casts the cell value # to that type. # # types: # - s: shared string (see #shared_string) # - n: number (cast to a float) # - b: boolean # - str: string # - inlineStr: string # - ruby symbol: for when type has been determined by style # # options: # - shared_strings: needed for 's' (shared string) type def self.cast(value, type, options = {}) return nil if value.nil? || value.empty? case type ## # There are few built-in types ## when 's' # shared string options[:shared_strings][value.to_i] when 'n' # number value.to_f when 'b' value.to_i == 1 when 'str' value when 'inlineStr' value ## # Type can also be determined by a style, # detected earlier and cast here by its standardized symbol ## when :string, :unsupported value when :fixnum value.to_i when :float value.to_f when :percentage value.to_f / 100 # the trickiest. note that all these formats can vary on # whether they actually contain a date, time, or datetime. when :date, :time, :date_time days_since_1900, fraction_of_24 = value.split('.') # http://stackoverflow.com/questions/10559767/how-to-convert-ms-excel-date-from-float-to-date-format-in-ruby date = Date.new(1899, 12, 30) + days_since_1900.to_i if fraction_of_24 # there is a time associated fraction_of_24 = "0.#{fraction_of_24}".to_f military = fraction_of_24 * 24 hour = military.truncate minute = ((military % 1) * 60).truncate return Time.utc(date.year, date.month, date.day, hour, minute) else return date end when :bignum if defined?(BigDecimal) BigDecimal.new(value) else value.to_f end ## # Beats me ## else value end end # Map of non-custom numFmtId to casting symbol NumFmtMap = { 0 => :string, # General 1 => :fixnum, # 0 2 => :float, # 0.00 3 => :fixnum, # #,##0 4 => :float, # #,##0.00 5 => :unsupported, # $#,##0_);($#,##0) 6 => :unsupported, # $#,##0_);[Red]($#,##0) 7 => :unsupported, # $#,##0.00_);($#,##0.00) 8 => :unsupported, # $#,##0.00_);[Red]($#,##0.00) 9 => :percentage, # 0% 10 => :percentage, # 0.00% 11 => :bignum, # 0.00E+00 12 => :unsupported, # # ?/? 13 => :unsupported, # # ??/?? 14 => :date, # mm-dd-yy 15 => :date, # d-mmm-yy 16 => :date, # d-mmm 17 => :date, # mmm-yy 18 => :time, # h:mm AM/PM 19 => :time, # h:mm:ss AM/PM 20 => :time, # h:mm 21 => :time, # h:mm:ss 22 => :date_time, # m/d/yy h:mm 37 => :unsupported, # #,##0 ;(#,##0) 38 => :unsupported, # #,##0 ;[Red](#,##0) 39 => :unsupported, # #,##0.00;(#,##0.00) 40 => :unsupported, # #,##0.00;[Red](#,##0.00) 45 => :time, # mm:ss 46 => :time, # [h]:mm:ss 47 => :time, # mmss.0 48 => :bignum, # ##0.0E+0 49 => :unsupported # @ } # For performance reasons, excel uses an optional SpreadsheetML feature # that puts all strings in a separate xml file, and then references # them by their index in that file. def shared_strings @shared_strings ||= xml.shared_strings. xpath('/xmlns:sst/xmlns:si/xmlns:t/text()').map(&:to_s) end end class Sheet < Struct.new(:name, :rows) def headers rows[0] end def data rows[1..-1] end def to_a data end end end end
module Pacer class BlockVertexFilterPipe < AbstractPipe def initialize(back, block) @back = back @block = block end def processNextStart() while s = starts.next path = VertexFilterPath.new(s, back) return s if yield path end end end class Path include Enumerable class << self def vertex_path(name) end def edge_path(name) end def path(name) end end def initialize(pipe, back = nil) @back = back @pipe = pipe end def back @back end def root? @back.nil? end def each @pipe.to_enum(:each) end # bias is the chance the element will be returned from 0 to 1 (0% to 100%) def random(bias = 0.5) self.class.new(RandomFilterPipe.new(bias), self) end def uniq self.class.new(DuplicateFilterPipe.new, self) end def [](prop_or_subset) case prop_or_subset when String, Symbol # could use PropertyPipe but that would mean supporting objects that I don't think # would have much purpose. map do |element| element[prop_or_subset] end when Fixnum self.class.new(RangeFilterPipe.new(prop_or_subset, prop_or_subset), self) when Range end_index = prop_or_subset.end end_index -= 1 if prop_or_subset.exclude_end? self.class.new(RangeFilterPipe.new(prop_or_subset.begin, end_index), self) when Array end end protected def filter_pipe(pipe, args_array, block) return pipe if args_array.empty? and block.nil? pipe = args_array.select { |arg| arg.is_a? Hash }.inject(pipe) do |p, hash| hash.inject(p) do |p2, (key, value)| new_pipe = PropertyFilterPipe.new(key.to_s, value.to_s, ComparisonFilterPipe::Filter::EQUAL) new_pipe.set_start p2 new_pipe end end if block new_pipe = BlockFilterPipe.new(block) new_pipe.set_start pipe pipe = new_pipe end pipe end end class GraphPath < Path def vertexes(*args, &block) pipe = GraphElementPipe.new(GraphElementPipe.ElementType.VERTEX); VertexPath.new(filter_pipe(pipe, args, block), self) end def edges(*args, &block) pipe = GraphElementPipe.new(GraphElementPipe.ElementType.EDGE); EdgePath.new(filter_pipe(pipe, args, block), self) end end class EdgePath < Path def out_v(*args, &block) pipe = VertexEdgePipe.new(VertexEdgePipe.Step.OUT_VERTEX) VertexPath.new(filter_pipe(pipe, args, block), self) end def in_v(*args, &block) pipe = VertexEdgePipe.new(VertexEdgePipe.Step.IN_VERTEX) VertexPath.new(filter_pipe(pipe, args, block), self) end def both_v(*args, &block) pipe = VertexEdgePipe.new(VertexEdgePipe.Step.BOTH_VERTICES) VertexPath.new(filter_pipe(pipe, args, block), self) end protected def filter_pipe(pipe, args_array, block) labels = args_array.select { |arg| arg.is_a? Symbol or arg.is_a? String } if labels.empty? super else new_pipe = labels.inject(pipe) do |label| p = LabelFilterPipe.new(label.to_s, ComparisonFilterPipe::Filter::EQUAL) p.set_start pipe p end super(new_pipe, args_array - labels, block) end end end class VertexPath < Path def out_e(*args, &block) pipe = EdgeVertexPipe.new(EdgeVertexPipe.Step.OUT_EDGES) EdgePath.new(filter_pipe(pipe, args, block), self) end def in_e(*args, &block) pipe = EdgeVertexPipe.new(EdgeVertexPipe.Step.IN_EDGES) EdgePath.new(filter_pipe(pipe, args, block), self) end def both_e(*args, &block) pipe = EdgeVertexPipe.new(EdgeVertexPipe.Step.BOTH_EDGES) EdgePath.new(filter_pipe(pipe, args, block), self) end end end Set start for each pipe. It looks like pipes are not immutable so they need to be created later or paths will not be reusable. module Pacer class BlockVertexFilterPipe < AbstractPipe def initialize(back, block) @back = back @block = block end def processNextStart() while s = starts.next path = VertexFilterPath.new(s, back) return s if yield path end end end class SingleElementPipe < AbstractPipe def initialize(element) @element = element end def processNextStart() element, @element = @element, nil element end end class Path include Enumerable class << self def vertex_path(name) end def edge_path(name) end def path(name) end end def initialize(pipe, back = nil) @back = back if pipe.is_a? Pipe @pipe = pipe else end end def back @back end def root? @back.nil? end def each @pipe.to_enum(:each) end # bias is the chance the element will be returned from 0 to 1 (0% to 100%) def random(bias = 0.5) self.class.new(RandomFilterPipe.new(bias), self) end def uniq self.class.new(DuplicateFilterPipe.new, self) end def [](prop_or_subset) case prop_or_subset when String, Symbol # could use PropertyPipe but that would mean supporting objects that I don't think # would have much purpose. map do |element| element[prop_or_subset] end when Fixnum self.class.new(RangeFilterPipe.new(prop_or_subset, prop_or_subset), self) when Range end_index = prop_or_subset.end end_index -= 1 if prop_or_subset.exclude_end? self.class.new(RangeFilterPipe.new(prop_or_subset.begin, end_index), self) when Array end end protected def filter_pipe(pipe, args_array, block) return pipe if args_array.empty? and block.nil? pipe = args_array.select { |arg| arg.is_a? Hash }.inject(pipe) do |p, hash| hash.inject(p) do |p2, (key, value)| new_pipe = PropertyFilterPipe.new(key.to_s, value.to_s, ComparisonFilterPipe::Filter::EQUAL) new_pipe.set_start p2 new_pipe end end if block new_pipe = BlockFilterPipe.new(block) new_pipe.set_start pipe pipe = new_pipe end pipe end end class GraphPath < Path def vertexes(*filters, &block) pipe = GraphElementPipe.new(GraphElementPipe.ElementType.VERTEX); VertexPath.new(filter_pipe(pipe, filters, block), self) end def edges(*filters, &block) pipe = GraphElementPipe.new(GraphElementPipe.ElementType.EDGE); EdgePath.new(filter_pipe(pipe, filters, block), self) end end class EdgePath < Path def out_v(*filters, &block) pipe = VertexEdgePipe.new(VertexEdgePipe.Step.OUT_VERTEX) pipe.set_start = @pipe VertexPath.new(filter_pipe(pipe, filters, block), self) end def in_v(*filters, &block) pipe = VertexEdgePipe.new(VertexEdgePipe.Step.IN_VERTEX) pipe.set_start = @pipe VertexPath.new(filter_pipe(pipe, filters, block), self) end def both_v(*filters, &block) pipe = VertexEdgePipe.new(VertexEdgePipe.Step.BOTH_VERTICES) pipe.set_start = @pipe VertexPath.new(filter_pipe(pipe, filters, block), self) end def virtices(*filters) raise "Can't call virtices for EdgePath." end def edges(*filters, &block) EdgePath.new(filter_pipe(@pipe, filters, block), back) end protected def filter_pipe(pipe, args_array, block) labels = args_array.select { |arg| arg.is_a? Symbol or arg.is_a? String } if labels.empty? super else new_pipe = labels.inject(pipe) do |label| p = LabelFilterPipe.new(label.to_s, ComparisonFilterPipe::Filter::EQUAL) p.set_start pipe p end super(new_pipe, args_array - labels, block) end end end class VertexPath < Path def out_e(*filters, &block) pipe = EdgeVertexPipe.new(EdgeVertexPipe.Step.OUT_EDGES) pipe.set_start = @pipe EdgePath.new(filter_pipe(pipe, filters, block), self) end def in_e(*filters, &block) pipe = EdgeVertexPipe.new(EdgeVertexPipe.Step.IN_EDGES) pipe.set_start = @pipe EdgePath.new(filter_pipe(pipe, filters, block), self) end def both_e(*filters, &block) pipe = EdgeVertexPipe.new(EdgeVertexPipe.Step.BOTH_EDGES) pipe.set_start = @pipe EdgePath.new(filter_pipe(pipe, filters, block), self) end def virtices(*filters, &block) VertexPath.new(filter_pipe(@pipe, filters, block), back) end def edges(*filters, &block) raise "Can't call edges for VertexPath." end end end
# coding: utf-8 Gem::Specification.new do |s| s.platform = Gem::Platform::RUBY s.name = 'spree_gateway' s.version = '3.0.0.beta' s.summary = 'Additional Payment Gateways for Spree Commerce' s.description = s.summary s.author = 'Spree Commerce' s.email = 'gems@spreecommerce.com' s.homepage = 'http://www.spreecommerce.com' s.license = %q{BSD-3} s.files = `git ls-files`.split("\n") s.test_files = `git ls-files -- spec/*`.split("\n") s.require_path = 'lib' s.requirements << 'none' s.add_dependency 'spree_core', '~> 3.0.0.beta' s.add_development_dependency 'braintree' s.add_development_dependency 'capybara' s.add_development_dependency 'coffee-rails', '~> 4.0.0' s.add_development_dependency 'database_cleaner', '1.2.0' s.add_development_dependency 'factory_girl', '~> 4.4' s.add_development_dependency 'ffaker' s.add_development_dependency 'guard-rspec' s.add_development_dependency 'launchy' s.add_development_dependency 'mysql2' s.add_development_dependency 'pg' s.add_development_dependency 'poltergeist', '~> 1.5.0' s.add_development_dependency 'pry' s.add_development_dependency 'rspec-activemodel-mocks' s.add_development_dependency 'rspec-rails', '~> 2.99' s.add_development_dependency 'sass-rails', '~> 4.0.2' s.add_development_dependency 'selenium-webdriver' s.add_development_dependency 'simplecov' s.add_development_dependency 'sqlite3' end Bump spree for master branch. # coding: utf-8 Gem::Specification.new do |s| s.platform = Gem::Platform::RUBY s.name = 'spree_gateway' s.version = '3.0.0.beta' s.summary = 'Additional Payment Gateways for Spree Commerce' s.description = s.summary s.author = 'Spree Commerce' s.email = 'gems@spreecommerce.com' s.homepage = 'http://www.spreecommerce.com' s.license = %q{BSD-3} s.files = `git ls-files`.split("\n") s.test_files = `git ls-files -- spec/*`.split("\n") s.require_path = 'lib' s.requirements << 'none' s.add_dependency 'spree_core', '~> 3.1.0.beta' s.add_development_dependency 'braintree' s.add_development_dependency 'capybara' s.add_development_dependency 'coffee-rails', '~> 4.0.0' s.add_development_dependency 'database_cleaner', '1.2.0' s.add_development_dependency 'factory_girl', '~> 4.4' s.add_development_dependency 'ffaker' s.add_development_dependency 'guard-rspec' s.add_development_dependency 'launchy' s.add_development_dependency 'mysql2' s.add_development_dependency 'pg' s.add_development_dependency 'poltergeist', '~> 1.5.0' s.add_development_dependency 'pry' s.add_development_dependency 'rspec-activemodel-mocks' s.add_development_dependency 'rspec-rails', '~> 2.99' s.add_development_dependency 'sass-rails', '~> 4.0.2' s.add_development_dependency 'selenium-webdriver' s.add_development_dependency 'simplecov' s.add_development_dependency 'sqlite3' end
# -*- encoding: utf-8 -*- $:.push File.expand_path("../lib", __FILE__) require "devise_paypal/version" Gem::Specification.new do |s| s.name = "devise_paypal" s.version = DevisePaypal::VERSION s.platform = Gem::Platform::RUBY s.authors = ["David Wilkie"] s.email = ["dwilkie@gmail.com"] s.homepage = "http://github.com/dwilkie/devise_paypal" s.summary = %q{Signup or login using Paypal} s.description = %q{Signup or login using Paypal's Authorization or Permissions api's} s.rubyforge_project = "devise_paypal" s.add_runtime_dependency "paypal-ipn", > "0.0.1" s.files = `git ls-files`.split("\n") s.test_files = `git ls-files -- {test,spec,features}/*`.split("\n") s.executables = `git ls-files -- bin/*`.split("\n").map{ |f| File.basename(f) } s.require_paths = ["lib"] end Fixed bug in gemfile # -*- encoding: utf-8 -*- $:.push File.expand_path("../lib", __FILE__) require "devise_paypal/version" Gem::Specification.new do |s| s.name = "devise_paypal" s.version = DevisePaypal::VERSION s.platform = Gem::Platform::RUBY s.authors = ["David Wilkie"] s.email = ["dwilkie@gmail.com"] s.homepage = "http://github.com/dwilkie/devise_paypal" s.summary = %q{Signup or login using Paypal} s.description = %q{Signup or login using Paypal's Authorization or Permissions api's} s.rubyforge_project = "devise_paypal" s.add_runtime_dependency "paypal-ipn", ">0.0.1" s.files = `git ls-files`.split("\n") s.test_files = `git ls-files -- {test,spec,features}/*`.split("\n") s.executables = `git ls-files -- bin/*`.split("\n").map{ |f| File.basename(f) } s.require_paths = ["lib"] end
require 'rubycas-client' require 'sinatra/base' require 'active_support/core_ext' module Sinatra module CAS module Client module Helpers def authenticated? if session[settings.username_session_key] puts "User is already identified as #{session[settings.username_session_key]}" if settings.console_debugging return true end end def authenticate puts "Running CAS filter for request #{request.fullpath}..." if settings.console_debugging client = CASClient::Client.new( cas_base_url: settings.cas_base_url, force_ssl_verification: settings.verify_ssl ) ticket = params[:ticket] cas_login_url = client.add_service_to_login_url(settings.service_url) if ticket if ticket =~ /^PT-/ st = CASClient::ProxyTicket.new(ticket, settings.service_url, false) puts "User has a ticket (proxy ticket)! #{st.inspect}" if settings.console_debugging else st = CASClient::ServiceTicket.new(ticket, settings.service_url, false) puts "User has a ticket (service ticket)! #{st.inspect}" if settings.console_debugging end client.validate_service_ticket(st) unless st.has_been_validated? if st.is_valid? puts 'ticket is valid' if settings.console_debugging if settings.console_debugging session[settings.username_session_key] = st.user puts "user logged as #{session[settings.username_session_key]}" if settings.console_debugging redirect settings.service_url else puts 'ticket is not valid' if settings.console_debugging session[settings.username_session_key] = nil redirect cas_login_url end else puts 'No ticket, redirecting to login server' if settings.console_debugging session[settings.username_session_key] redirect cas_login_url end end end def self.registered(app) app.helpers CAS::Client::Helpers #TODO: setup defaults options app.set :cas_base_url, 'https://login.example.com/cas' app.set :service_url, 'https://localhost/' app.set :verify_ssl, false app.set :console_debugging, false app.set :username_session_key, :cas_user app.enable :sessions end end end register CAS::Client end check for session require 'rubycas-client' require 'sinatra/base' require 'active_support/core_ext' module Sinatra module CAS module Client module Helpers def authenticated? if session[settings.username_session_key] puts "User is already identified as #{session[settings.username_session_key]}" if settings.console_debugging return true end end def authenticate puts "Running CAS filter for request #{request.fullpath}..." if settings.console_debugging client = CASClient::Client.new( cas_base_url: settings.cas_base_url, force_ssl_verification: settings.verify_ssl ) ticket = params[:ticket] cas_login_url = client.add_service_to_login_url(settings.service_url) if ticket if ticket =~ /^PT-/ st = CASClient::ProxyTicket.new(ticket, settings.service_url, false) puts "User has a ticket (proxy ticket)! #{st.inspect}" if settings.console_debugging else st = CASClient::ServiceTicket.new(ticket, settings.service_url, false) puts "User has a ticket (service ticket)! #{st.inspect}" if settings.console_debugging end client.validate_service_ticket(st) unless st.has_been_validated? if st.is_valid? puts 'ticket is valid' if settings.console_debugging if settings.console_debugging session[settings.username_session_key] = st.user puts "user logged as #{session[settings.username_session_key]}" if settings.console_debugging redirect settings.service_url else puts 'ticket is not valid' if settings.console_debugging session[settings.username_session_key] = nil redirect cas_login_url end else puts 'No ticket, redirecting to login server' if settings.console_debugging session[settings.username_session_key] redirect cas_login_url end end end def self.registered(app) app.helpers CAS::Client::Helpers #TODO: setup defaults options app.set :cas_base_url, 'https://login.example.com/cas' app.set :service_url, 'https://localhost/' app.set :verify_ssl, false app.set :console_debugging, false app.set :username_session_key, :cas_user app.set :session_key, :rack.session unless env.include?(options[:session_key]): fail "you need to set up a session middleware *before* #{self.class}" end #app.enable :sessions end end end register CAS::Client end
require 'nokogiri' require 'psych' module SippyCup # # A representation of a SippyCup scenario from a manifest or created in code. Allows building a scenario from a set of basic primitives, and then exporting to SIPp scenario files, including the XML scenario and PCAP audio. # class Scenario USER_AGENT = "SIPp/sippy_cup" VALID_DTMF = %w{0 1 2 3 4 5 6 7 8 9 0 * # A B C D}.freeze MSEC = 1_000 # # Build a scenario based on either a manifest string or a file handle. Manifests are supplied in YAML format. # All manifest keys can be overridden by passing in a Hash of corresponding values. # # @param [String, File] manifest The YAML manifest # @param [Hash] options Options to override (see #initialize) # # @return [SippyCup::Scenario] # # @example Parse a manifest string # manifest = <<-MANIFEST # source: 192.168.1.1 # destination: 192.168.1.2 # steps: # - invite # - wait_for_answer # - ack_answer # - sleep 3 # - wait_for_hangup # MANIFEST # Scenario.from_manifest(manifest) # # @example Parse a manifest file by path # File.open("/my/manifest.yml") { |f| Scenario.from_manifest(f) } # # or # Scenario.from_manifest(File.read("/my/manifest.yml")) # # @example Override keys from the manifest # Scenario.from_manifest(manifest, source: '192.168.12.1') # def self.from_manifest(manifest, options = {}) args = ActiveSupport::HashWithIndifferentAccess.new(Psych.safe_load(manifest)).symbolize_keys.merge options name = args.delete :name steps = args.delete :steps scenario = Scenario.new name, args scenario.build steps scenario end # @return [Hash] The options the scenario was created with, either from a manifest or passed as overrides attr_reader :scenario_options # @return [Array<Hash>] a collection of errors encountered while building the scenario. attr_reader :errors # # Create a scenario instance # # @param [String] name The scenario's name # @param [Hash] args options to customise the scenario # @option options [String] :filename The name of the files to be saved to disk # @option options [String] :source The source IP/hostname with which to invoke SIPp # @option options [String] :destination The target system at which to direct traffic # @option options [String] :from_user The SIP user from which traffic should appear # @option options [Integer] :rtcp_port The RTCP (media) port to bind to locally # @option options [Array<String>] :steps A collection of steps # # @yield [scenario] Builder block to construct scenario # @yieldparam [Scenario] scenario the initialized scenario instance # def initialize(name, args = {}, &block) parse_args args @scenario_options = args.merge name: name @rtcp_port = args[:rtcp_port] @filename = args[:filename] || name.downcase.gsub(/\W+/, '_') @filename = File.expand_path @filename, Dir.pwd @media = Media.new '127.0.0.255', 55555, '127.255.255.255', 5060 @errors = [] instance_eval &block if block_given? end # @return [true, false] the validity of the scenario. Will be false if errors were encountered while building the scenario from a manifest def valid? @errors.size.zero? end # # Build the scenario steps provided # # @param [Array<String>] steps A collection of steps to build the scenario # def build(steps) raise ArgumentError, "Must provide scenario steps" unless steps steps.each_with_index do |step, index| begin instruction, arg = step.split ' ', 2 if arg && !arg.empty? # Strip leading/trailing quotes if present arg.gsub!(/^'|^"|'$|"$/, '') self.__send__ instruction, arg else self.__send__ instruction end rescue => e @errors << {step: index + 1, message: "#{step}: #{e.message}"} end end end # # Send an invite message # # Uses the :rtcp_port option the Scenario was created with to specify RTCP ports in SDP, or defaults to dynamic binding # # @param [Hash] opts A set of options to modify the message # @option opts [Integer] :retrans # @option opts [String] :headers Extra headers to place into the INVITE def invite(opts = {}) opts[:retrans] ||= 500 rtp_string = @rtcp_port ? "m=audio #{@rtcp_port.to_i - 1} RTP/AVP 0 101\na=rtcp:#{@rtcp_port}\n" : "m=audio [media_port] RTP/AVP 0 101\n" headers = opts.delete :headers rtp_string = @rtcp_port ? "m=audio #{@rtcp_port.to_i - 1} RTP/AVP 0 101\na=rtcp:#{@rtcp_port}\n" : "m=audio [media_port] RTP/AVP 0 101\n" # FIXME: The DTMF mapping (101) is hard-coded. It would be better if we could # get this from the DTMF payload generator msg = <<-INVITE INVITE sip:[service]@[remote_ip]:[remote_port] SIP/2.0 Via: SIP/2.0/[transport] [local_ip]:[local_port];branch=[branch] From: "#{@from_user}" <sip:#{@from_user}@[local_ip]>;tag=[call_number] To: <sip:[service]@[remote_ip]:[remote_port]> Call-ID: [call_id] CSeq: [cseq] INVITE Contact: <sip:#{@from_user}@[local_ip]:[local_port];transport=[transport]> Max-Forwards: 100 User-Agent: #{USER_AGENT} Content-Type: application/sdp Content-Length: [len] #{headers} v=0 o=user1 53655765 2353687637 IN IP[local_ip_type] [local_ip] s=- c=IN IP[media_ip_type] [media_ip] t=0 0 #{rtp_string} a=rtpmap:0 PCMU/8000 a=rtpmap:101 telephone-event/8000 a=fmtp:101 0-15 INVITE send msg, opts end # # Send a REGISTER message with the specified credentials # # @param [String] user the user to register as. May be given as a full SIP URI (sip:user@domain.com), in email-address format (user@domain.com) or as a simple username ('user'). If no domain is supplied, the source IP from SIPp will be used. # @param [optional, String, nil] password the password to authenticate with. # @param [Hash] opts A set of options to modify the message # # @example Register with authentication # s.register 'frank@there.com', 'abc123' # # @example Register without authentication or a domain # s.register 'frank' # def register(user, password = nil, opts = {}) opts[:retrans] ||= 500 user, domain = parse_user user msg = if password register_auth domain, user, password else register_message domain, user end send msg, opts end # # Sets an expectation for a SIP 100 message from the remote party # # @param [Hash] opts A set of options to modify the expectation # @option opts [true, false] :optional Wether or not receipt of the message is optional. Defaults to true. # def receive_trying(opts = {}) handle_response 100, opts end alias :receive_100 :receive_trying # # Sets an expectation for a SIP 180 message from the remote party # # @param [Hash] opts A set of options to modify the expectation # @option opts [true, false] :optional Wether or not receipt of the message is optional. Defaults to true. # def receive_ringing(opts = {}) handle_response 180, opts end alias :receive_180 :receive_ringing # # Sets an expectation for a SIP 183 message from the remote party # # @param [Hash] opts A set of options to modify the expectation # @option opts [true, false] :optional Wether or not receipt of the message is optional. Defaults to true. # def receive_progress(opts = {}) handle_response 183, opts end alias :receive_183 :receive_progress # # Sets an expectation for a SIP 200 message from the remote party # # @param [Hash] opts A set of options to modify the expectation # @option opts [true, false] :optional Wether or not receipt of the message is optional. Defaults to true. # def receive_answer(opts = {}) options = { response: 200, rrs: true, # Record Record Set: Make the Route headers available via [route] later rtd: true # Response Time Duration: Record the response time } recv options.merge(opts) end alias :receive_200 :receive_answer # # Shortcut that sets expectations for optional SIP 100, 180 and 183, followed by a required 200. # # @param [Hash] opts A set of options to modify the expectations # def wait_for_answer(opts = {}) receive_trying({optional: true}.merge opts) receive_ringing({optional: true}.merge opts) receive_progress({optional: true}.merge opts) receive_answer opts end # # Acknowledge a received answer message (SIP 200) and start media playback # # @param [Hash] opts A set of options to modify the message parameters # def ack_answer(opts = {}) msg = <<-BODY ACK [next_url] SIP/2.0 Via: SIP/2.0/[transport] [local_ip]:[local_port];branch=[branch] From: "#{@from_user}" <sip:#{@from_user}@[local_ip]>;tag=[call_number] [last_To:] Call-ID: [call_id] CSeq: [cseq] ACK Contact: <sip:#{@from_user}@[local_ip]:[local_port];transport=[transport]> Max-Forwards: 100 User-Agent: #{USER_AGENT} Content-Length: 0 [routes] BODY send msg, opts start_media end # # Insert a pause into the scenario and its media of the specified duration # # @param [Numeric] seconds The duration of the pause in seconds # def sleep(seconds) milliseconds = (seconds.to_f * MSEC).to_i pause milliseconds @media << "silence:#{milliseconds}" end # # Send DTMF digits # # @param [String] DTMF digits to send. Must be 0-9, *, # or A-D # # @example Send a single DTMF digit # send_digits '1' # # @example Enter a pin number # send_digits '1234' # def send_digits(digits) delay = (0.250 * MSEC).to_i # FIXME: Need to pass this down to the media layer digits.split('').each do |digit| raise ArgumentError, "Invalid DTMF digit requested: #{digit}" unless VALID_DTMF.include? digit @media << "dtmf:#{digit}" @media << "silence:#{delay}" end pause delay * 2 * digits.size end # # Send a BYE message # # @param [Hash] opts A set of options to modify the message parameters # def send_bye(opts = {}) msg = <<-MSG BYE [next_url] SIP/2.0 [last_Via:] From: "#{@from_user}" <sip:#{@from_user}@[local_ip]>;tag=[call_number] [last_To:] [last_Call-ID] CSeq: [cseq] BYE Contact: <sip:#{@from_user}@[local_ip]:[local_port];transport=[transport]> Max-Forwards: 100 User-Agent: #{USER_AGENT} Content-Length: 0 [routes] MSG send msg, opts end # # Expect to receive a BYE message # # @param [Hash] opts A set of options to modify the expectation # def receive_bye(opts = {}) recv opts.merge request: 'BYE' end # # Acknowledge a received BYE message # # @param [Hash] opts A set of options to modify the message parameters # def ack_bye(opts = {}) msg = <<-ACK SIP/2.0 200 OK [last_Via:] [last_From:] [last_To:] [last_Call-ID:] [last_CSeq:] Contact: <sip:#{@from_user}@[local_ip]:[local_port];transport=[transport]> Max-Forwards: 100 User-Agent: #{USER_AGENT} Content-Length: 0 [routes] ACK send msg, opts end # # Shortcut to set an expectation for a BYE and acknowledge it when received # # @param [Hash] opts A set of options to modify the expectation # def wait_for_hangup(opts = {}) receive_bye(opts) ack_bye(opts) end # # Dump the scenario to a SIPp XML string # # @return [String] the SIPp XML scenario def to_xml doc.to_xml end # # Compile the scenario and its media to disk # # Writes the SIPp scenario file to disk at {filename}.xml, and the PCAP media to {filename}.pcap. # {filename} is taken from the :filename option when creating the scenario, or falls back to a down-snake-cased version of the scenario name. # # @example Export a scenario to a specified filename # scenario = Scenario.new 'Test Scenario', filename: 'my_scenario' # scenario.compile! # Leaves files at my_scenario.xml and my_scenario.pcap # # @example Export a scenario to a calculated filename # scenario = Scenario.new 'Test Scenario' # scenario.compile! # Leaves files at test_scenario.xml and test_scenario.pcap # def compile! print "Compiling scenario to #{@filename}.xml..." File.open "#{@filename}.xml", 'w' do |file| file.write doc.to_xml end puts "done." print "Compiling media to #{@filename}.pcap..." compile_media.to_file filename: "#{@filename}.pcap" puts "done." end private #TODO: SIPS support? def parse_user(user) user.slice! 0, 4 if user =~ /sip:/ user = user.split(":")[0] user, domain = user.split("@") domain ||= "[remote_ip]" [user, domain] end def doc @doc ||= begin Nokogiri::XML::Builder.new do |xml| xml.scenario name: @scenario_options[:name] end.doc end end def scenario_node @scenario_node = doc.xpath('//scenario').first end def parse_args(args) raise ArgumentError, "Must include source IP:PORT" unless args.keys.include? :source raise ArgumentError, "Must include destination IP:PORT" unless args.keys.include? :destination @from_addr, @from_port = args[:source].split ':' @to_addr, @to_port = args[:destination].split ':' @from_user = args[:from_user] || "sipp" end def compile_media @media.compile! end def register_message(domain, user, opts = {}) <<-BODY REGISTER sip:#{domain} SIP/2.0 Via: SIP/2.0/[transport] [local_ip]:[local_port];branch=[branch] From: <sip:#{user}@#{domain}>;tag=[call_number] To: <sip:#{user}@#{domain}> Call-ID: [call_id] CSeq: [cseq] REGISTER Contact: <sip:#{@from_user}@[local_ip]:[local_port];transport=[transport]> Max-Forwards: 10 Expires: 120 User-Agent: #{USER_AGENT} Content-Length: 0 BODY end def register_auth(domain, user, password, opts = {}) recv response: '401', auth: true, optional: false <<-AUTH REGISTER sip:#{domain} SIP/2.0 Via: SIP/2.0/[transport] [local_ip]:[local_port];branch=[branch] From: <sip:#{user}@#{domain}>;tag=[call_number] To: <sip:#{user}@#{domain}> Call-ID: [call_id] CSeq: [cseq] REGISTER Contact: <sip:#{@from_user}@[local_ip]:[local_port];transport=[transport]> Max-Forwards: 20 Expires: 3600 [authentication username=#{user} password=#{password}] User-Agent: #{USER_AGENT} Content-Length: 0 AUTH end def start_media nop = Nokogiri::XML::Node.new 'nop', doc action = Nokogiri::XML::Node.new 'action', doc nop << action exec = Nokogiri::XML::Node.new 'exec', doc exec['play_pcap_audio'] = "#{@filename}.pcap" action << exec scenario_node << nop end def pause(msec) pause = Nokogiri::XML::Node.new 'pause', doc pause['milliseconds'] = msec.to_i scenario_node << pause end def send(msg, opts = {}) send = Nokogiri::XML::Node.new 'send', doc opts.each do |k,v| send[k.to_s] = v end send << "\n" send << Nokogiri::XML::CDATA.new(doc, msg) send << "\n" #Newlines are required before and after CDATA so SIPp will parse properly scenario_node << send end def recv(opts = {}) raise ArgumentError, "Receive must include either a response or a request" unless opts.keys.include?(:response) || opts.keys.include?(:request) recv = Nokogiri::XML::Node.new 'recv', doc opts.each do |k,v| recv[k.to_s] = v end scenario_node << recv end def optional_recv(opts) opts[:optional] = true if opts[:optional].nil? recv opts end def handle_response(code, opts) optional_recv opts.merge(response: code) end end end Fix duplicate line and doc newline issue require 'nokogiri' require 'psych' module SippyCup # # A representation of a SippyCup scenario from a manifest or created in code. Allows building a scenario from a set of basic primitives, and then exporting to SIPp scenario files, including the XML scenario and PCAP audio. # class Scenario USER_AGENT = "SIPp/sippy_cup" VALID_DTMF = %w{0 1 2 3 4 5 6 7 8 9 0 * # A B C D}.freeze MSEC = 1_000 # # Build a scenario based on either a manifest string or a file handle. Manifests are supplied in YAML format. # All manifest keys can be overridden by passing in a Hash of corresponding values. # # @param [String, File] manifest The YAML manifest # @param [Hash] options Options to override (see #initialize) # # @return [SippyCup::Scenario] # # @example Parse a manifest string # manifest = <<-MANIFEST # source: 192.168.1.1 # destination: 192.168.1.2 # steps: # - invite # - wait_for_answer # - ack_answer # - sleep 3 # - wait_for_hangup # MANIFEST # Scenario.from_manifest(manifest) # # @example Parse a manifest file by path # File.open("/my/manifest.yml") { |f| Scenario.from_manifest(f) } # # or # Scenario.from_manifest(File.read("/my/manifest.yml")) # # @example Override keys from the manifest # Scenario.from_manifest(manifest, source: '192.168.12.1') # def self.from_manifest(manifest, options = {}) args = ActiveSupport::HashWithIndifferentAccess.new(Psych.safe_load(manifest)).symbolize_keys.merge options name = args.delete :name steps = args.delete :steps scenario = Scenario.new name, args scenario.build steps scenario end # @return [Hash] The options the scenario was created with, either from a manifest or passed as overrides attr_reader :scenario_options # @return [Array<Hash>] a collection of errors encountered while building the scenario. attr_reader :errors # # Create a scenario instance # # @param [String] name The scenario's name # @param [Hash] args options to customise the scenario # @option options [String] :filename The name of the files to be saved to disk # @option options [String] :source The source IP/hostname with which to invoke SIPp # @option options [String] :destination The target system at which to direct traffic # @option options [String] :from_user The SIP user from which traffic should appear # @option options [Integer] :rtcp_port The RTCP (media) port to bind to locally # @option options [Array<String>] :steps A collection of steps # # @yield [scenario] Builder block to construct scenario # @yieldparam [Scenario] scenario the initialized scenario instance # def initialize(name, args = {}, &block) parse_args args @scenario_options = args.merge name: name @rtcp_port = args[:rtcp_port] @filename = args[:filename] || name.downcase.gsub(/\W+/, '_') @filename = File.expand_path @filename, Dir.pwd @media = Media.new '127.0.0.255', 55555, '127.255.255.255', 5060 @errors = [] instance_eval &block if block_given? end # @return [true, false] the validity of the scenario. Will be false if errors were encountered while building the scenario from a manifest def valid? @errors.size.zero? end # # Build the scenario steps provided # # @param [Array<String>] steps A collection of steps to build the scenario # def build(steps) raise ArgumentError, "Must provide scenario steps" unless steps steps.each_with_index do |step, index| begin instruction, arg = step.split ' ', 2 if arg && !arg.empty? # Strip leading/trailing quotes if present arg.gsub!(/^'|^"|'$|"$/, '') self.__send__ instruction, arg else self.__send__ instruction end rescue => e @errors << {step: index + 1, message: "#{step}: #{e.message}"} end end end # # Send an invite message # # Uses the :rtcp_port option the Scenario was created with to specify RTCP ports in SDP, or defaults to dynamic binding # # @param [Hash] opts A set of options to modify the message # @option opts [Integer] :retrans # @option opts [String] :headers Extra headers to place into the INVITE # def invite(opts = {}) opts[:retrans] ||= 500 rtp_string = @rtcp_port ? "m=audio #{@rtcp_port.to_i - 1} RTP/AVP 0 101\na=rtcp:#{@rtcp_port}\n" : "m=audio [media_port] RTP/AVP 0 101\n" headers = opts.delete :headers # FIXME: The DTMF mapping (101) is hard-coded. It would be better if we could # get this from the DTMF payload generator msg = <<-INVITE INVITE sip:[service]@[remote_ip]:[remote_port] SIP/2.0 Via: SIP/2.0/[transport] [local_ip]:[local_port];branch=[branch] From: "#{@from_user}" <sip:#{@from_user}@[local_ip]>;tag=[call_number] To: <sip:[service]@[remote_ip]:[remote_port]> Call-ID: [call_id] CSeq: [cseq] INVITE Contact: <sip:#{@from_user}@[local_ip]:[local_port];transport=[transport]> Max-Forwards: 100 User-Agent: #{USER_AGENT} Content-Type: application/sdp Content-Length: [len] #{headers} v=0 o=user1 53655765 2353687637 IN IP[local_ip_type] [local_ip] s=- c=IN IP[media_ip_type] [media_ip] t=0 0 #{rtp_string} a=rtpmap:0 PCMU/8000 a=rtpmap:101 telephone-event/8000 a=fmtp:101 0-15 INVITE send msg, opts end # # Send a REGISTER message with the specified credentials # # @param [String] user the user to register as. May be given as a full SIP URI (sip:user@domain.com), in email-address format (user@domain.com) or as a simple username ('user'). If no domain is supplied, the source IP from SIPp will be used. # @param [optional, String, nil] password the password to authenticate with. # @param [Hash] opts A set of options to modify the message # # @example Register with authentication # s.register 'frank@there.com', 'abc123' # # @example Register without authentication or a domain # s.register 'frank' # def register(user, password = nil, opts = {}) opts[:retrans] ||= 500 user, domain = parse_user user msg = if password register_auth domain, user, password else register_message domain, user end send msg, opts end # # Sets an expectation for a SIP 100 message from the remote party # # @param [Hash] opts A set of options to modify the expectation # @option opts [true, false] :optional Wether or not receipt of the message is optional. Defaults to true. # def receive_trying(opts = {}) handle_response 100, opts end alias :receive_100 :receive_trying # # Sets an expectation for a SIP 180 message from the remote party # # @param [Hash] opts A set of options to modify the expectation # @option opts [true, false] :optional Wether or not receipt of the message is optional. Defaults to true. # def receive_ringing(opts = {}) handle_response 180, opts end alias :receive_180 :receive_ringing # # Sets an expectation for a SIP 183 message from the remote party # # @param [Hash] opts A set of options to modify the expectation # @option opts [true, false] :optional Wether or not receipt of the message is optional. Defaults to true. # def receive_progress(opts = {}) handle_response 183, opts end alias :receive_183 :receive_progress # # Sets an expectation for a SIP 200 message from the remote party # # @param [Hash] opts A set of options to modify the expectation # @option opts [true, false] :optional Wether or not receipt of the message is optional. Defaults to true. # def receive_answer(opts = {}) options = { response: 200, rrs: true, # Record Record Set: Make the Route headers available via [route] later rtd: true # Response Time Duration: Record the response time } recv options.merge(opts) end alias :receive_200 :receive_answer # # Shortcut that sets expectations for optional SIP 100, 180 and 183, followed by a required 200. # # @param [Hash] opts A set of options to modify the expectations # def wait_for_answer(opts = {}) receive_trying({optional: true}.merge opts) receive_ringing({optional: true}.merge opts) receive_progress({optional: true}.merge opts) receive_answer opts end # # Acknowledge a received answer message (SIP 200) and start media playback # # @param [Hash] opts A set of options to modify the message parameters # def ack_answer(opts = {}) msg = <<-BODY ACK [next_url] SIP/2.0 Via: SIP/2.0/[transport] [local_ip]:[local_port];branch=[branch] From: "#{@from_user}" <sip:#{@from_user}@[local_ip]>;tag=[call_number] [last_To:] Call-ID: [call_id] CSeq: [cseq] ACK Contact: <sip:#{@from_user}@[local_ip]:[local_port];transport=[transport]> Max-Forwards: 100 User-Agent: #{USER_AGENT} Content-Length: 0 [routes] BODY send msg, opts start_media end # # Insert a pause into the scenario and its media of the specified duration # # @param [Numeric] seconds The duration of the pause in seconds # def sleep(seconds) milliseconds = (seconds.to_f * MSEC).to_i pause milliseconds @media << "silence:#{milliseconds}" end # # Send DTMF digits # # @param [String] DTMF digits to send. Must be 0-9, *, # or A-D # # @example Send a single DTMF digit # send_digits '1' # # @example Enter a pin number # send_digits '1234' # def send_digits(digits) delay = (0.250 * MSEC).to_i # FIXME: Need to pass this down to the media layer digits.split('').each do |digit| raise ArgumentError, "Invalid DTMF digit requested: #{digit}" unless VALID_DTMF.include? digit @media << "dtmf:#{digit}" @media << "silence:#{delay}" end pause delay * 2 * digits.size end # # Send a BYE message # # @param [Hash] opts A set of options to modify the message parameters # def send_bye(opts = {}) msg = <<-MSG BYE [next_url] SIP/2.0 [last_Via:] From: "#{@from_user}" <sip:#{@from_user}@[local_ip]>;tag=[call_number] [last_To:] [last_Call-ID] CSeq: [cseq] BYE Contact: <sip:#{@from_user}@[local_ip]:[local_port];transport=[transport]> Max-Forwards: 100 User-Agent: #{USER_AGENT} Content-Length: 0 [routes] MSG send msg, opts end # # Expect to receive a BYE message # # @param [Hash] opts A set of options to modify the expectation # def receive_bye(opts = {}) recv opts.merge request: 'BYE' end # # Acknowledge a received BYE message # # @param [Hash] opts A set of options to modify the message parameters # def ack_bye(opts = {}) msg = <<-ACK SIP/2.0 200 OK [last_Via:] [last_From:] [last_To:] [last_Call-ID:] [last_CSeq:] Contact: <sip:#{@from_user}@[local_ip]:[local_port];transport=[transport]> Max-Forwards: 100 User-Agent: #{USER_AGENT} Content-Length: 0 [routes] ACK send msg, opts end # # Shortcut to set an expectation for a BYE and acknowledge it when received # # @param [Hash] opts A set of options to modify the expectation # def wait_for_hangup(opts = {}) receive_bye(opts) ack_bye(opts) end # # Dump the scenario to a SIPp XML string # # @return [String] the SIPp XML scenario def to_xml doc.to_xml end # # Compile the scenario and its media to disk # # Writes the SIPp scenario file to disk at {filename}.xml, and the PCAP media to {filename}.pcap. # {filename} is taken from the :filename option when creating the scenario, or falls back to a down-snake-cased version of the scenario name. # # @example Export a scenario to a specified filename # scenario = Scenario.new 'Test Scenario', filename: 'my_scenario' # scenario.compile! # Leaves files at my_scenario.xml and my_scenario.pcap # # @example Export a scenario to a calculated filename # scenario = Scenario.new 'Test Scenario' # scenario.compile! # Leaves files at test_scenario.xml and test_scenario.pcap # def compile! print "Compiling scenario to #{@filename}.xml..." File.open "#{@filename}.xml", 'w' do |file| file.write doc.to_xml end puts "done." print "Compiling media to #{@filename}.pcap..." compile_media.to_file filename: "#{@filename}.pcap" puts "done." end private #TODO: SIPS support? def parse_user(user) user.slice! 0, 4 if user =~ /sip:/ user = user.split(":")[0] user, domain = user.split("@") domain ||= "[remote_ip]" [user, domain] end def doc @doc ||= begin Nokogiri::XML::Builder.new do |xml| xml.scenario name: @scenario_options[:name] end.doc end end def scenario_node @scenario_node = doc.xpath('//scenario').first end def parse_args(args) raise ArgumentError, "Must include source IP:PORT" unless args.keys.include? :source raise ArgumentError, "Must include destination IP:PORT" unless args.keys.include? :destination @from_addr, @from_port = args[:source].split ':' @to_addr, @to_port = args[:destination].split ':' @from_user = args[:from_user] || "sipp" end def compile_media @media.compile! end def register_message(domain, user, opts = {}) <<-BODY REGISTER sip:#{domain} SIP/2.0 Via: SIP/2.0/[transport] [local_ip]:[local_port];branch=[branch] From: <sip:#{user}@#{domain}>;tag=[call_number] To: <sip:#{user}@#{domain}> Call-ID: [call_id] CSeq: [cseq] REGISTER Contact: <sip:#{@from_user}@[local_ip]:[local_port];transport=[transport]> Max-Forwards: 10 Expires: 120 User-Agent: #{USER_AGENT} Content-Length: 0 BODY end def register_auth(domain, user, password, opts = {}) recv response: '401', auth: true, optional: false <<-AUTH REGISTER sip:#{domain} SIP/2.0 Via: SIP/2.0/[transport] [local_ip]:[local_port];branch=[branch] From: <sip:#{user}@#{domain}>;tag=[call_number] To: <sip:#{user}@#{domain}> Call-ID: [call_id] CSeq: [cseq] REGISTER Contact: <sip:#{@from_user}@[local_ip]:[local_port];transport=[transport]> Max-Forwards: 20 Expires: 3600 [authentication username=#{user} password=#{password}] User-Agent: #{USER_AGENT} Content-Length: 0 AUTH end def start_media nop = Nokogiri::XML::Node.new 'nop', doc action = Nokogiri::XML::Node.new 'action', doc nop << action exec = Nokogiri::XML::Node.new 'exec', doc exec['play_pcap_audio'] = "#{@filename}.pcap" action << exec scenario_node << nop end def pause(msec) pause = Nokogiri::XML::Node.new 'pause', doc pause['milliseconds'] = msec.to_i scenario_node << pause end def send(msg, opts = {}) send = Nokogiri::XML::Node.new 'send', doc opts.each do |k,v| send[k.to_s] = v end send << "\n" send << Nokogiri::XML::CDATA.new(doc, msg) send << "\n" #Newlines are required before and after CDATA so SIPp will parse properly scenario_node << send end def recv(opts = {}) raise ArgumentError, "Receive must include either a response or a request" unless opts.keys.include?(:response) || opts.keys.include?(:request) recv = Nokogiri::XML::Node.new 'recv', doc opts.each do |k,v| recv[k.to_s] = v end scenario_node << recv end def optional_recv(opts) opts[:optional] = true if opts[:optional].nil? recv opts end def handle_response(code, opts) optional_recv opts.merge(response: code) end end end
module Skywriter module Resource def self.property(name, **options) property_definitions << PropertyDefinition.new(name, options) end attr_reader :logical_name def initialize(logical_name, **options) @logical_name = logical_name @options = options.freeze end def as_json Thread.current[:skywriter_as_json_context] = self { logical_name => { 'Type' => type, 'Properties' => properties.as_json, 'DependsOn' => all_dependencies, } } ensure Thread.current[:skywriter_as_json_context] = nil end def to_json(*) as_json.to_json end def type @type ||= self.class.name.gsub("Skywriter::Resource", "AWS") end # @param with [:ref, :logical_name] How this pointer should be # rendered in JSON. Use `:ref` to generate {"Ref": "foo"}, # and `:logical_name` to generate "foo" def as_pointer(with: :ref) case with when :ref Skywriter::Resource::RefPointer.new(self) when :logical_name Skywriter::Resource::LogicalNamePointer.new(self) else raise ArgumentError, "Unrecognized 'with' value '#{with}'" end end def register_dependency(dependency) magical_dependencies << dependency.logical_name end private attr_reader :options def all_dependencies (additional_dependencies + magical_dependencies).to_a end def additional_dependencies Set.new(Array(options[:additional_dependencies])) end def magical_dependencies @magical_dependencies ||= Set.new end def properties @properties ||= property_definitions.each_with_object({}) do |property_definition, hash| if (value = options[property_definition.key]) hash[property_definition.name] = value end end end def self.property_definitions @property_definitions ||= [] end def property_definitions self.class.property_definitions end end class PropertyDefinition attr_reader :name, :key def initialize(name, **options) @name = name.to_s @key = name.to_s.underscore.to_sym end end end Refactor into a module module Skywriter module Resource module DSL def property(name, **options) property_definitions << PropertyDefinition.new(name, options) end def property_definitions @property_definitions ||= [] end class PropertyDefinition attr_reader :name, :key def initialize(name, **options) @name = name.to_s @key = name.to_s.underscore.to_sym end end end attr_reader :logical_name def initialize(logical_name, **options) @logical_name = logical_name @options = options.freeze end def as_json Thread.current[:skywriter_as_json_context] = self { logical_name => { 'Type' => type, 'Properties' => properties.as_json, 'DependsOn' => all_dependencies, } } ensure Thread.current[:skywriter_as_json_context] = nil end def to_json(*) as_json.to_json end def type @type ||= self.class.name.gsub("Skywriter::Resource", "AWS") end # @param with [:ref, :logical_name] How this pointer should be # rendered in JSON. Use `:ref` to generate {"Ref": "foo"}, # and `:logical_name` to generate "foo" def as_pointer(with: :ref) case with when :ref Skywriter::Resource::RefPointer.new(self) when :logical_name Skywriter::Resource::LogicalNamePointer.new(self) else raise ArgumentError, "Unrecognized 'with' value '#{with}'" end end def register_dependency(dependency) magical_dependencies << dependency.logical_name end private attr_reader :options def self.included(base) base.extend(DSL) end def all_dependencies (additional_dependencies + magical_dependencies).to_a end def additional_dependencies Set.new(Array(options[:additional_dependencies])) end def magical_dependencies @magical_dependencies ||= Set.new end def properties @properties ||= property_definitions.each_with_object({}) do |property_definition, hash| if (value = options[property_definition.key]) hash[property_definition.name] = value end end end def property_definitions self.class.property_definitions end end end
module SMTPMachine module Router def self.included(base) # :nodoc: base.extend ClassMethods end module ClassMethods attr_accessor :routes def reset! self.routes = {} end def ehlo(regex, options = {}, &block) add_route(:ehlo, regex, options, &block) end def mail_from(regex, options = {}, &block) add_route(:from, regex, options, &block) end def rcpt_to(regex, options = {}, &block) add_route(:to, regex, options, &block) end def data(regex, options = {}, &block) add_route(:data, regex, options, &block) end def map(regex, options = {}, &block) add_route(:to, regex) { true } add_route(:data, regex, ({:match => :to}).merge(options), &block) end def add_route(action, regex, options = {}, &block) match_against = options[:match] || action define_method "__email #{action} #{regex}", &block unbound_method = instance_method("__email #{action} #{regex}") block = lambda { unbound_method.bind(self).call } (routes[action] ||= []). push([regex, match_against, block]).last end end attr_accessor :routes def initialize self.routes = {} super end def route! compile_routes match = false routes.each do |block| catch(:pass) do res = instance_eval(&block) match ||= res end end match end private def compile_routes self.routes = (self.class.routes[action] || []).select { |r, m, _| return true unless r if action == m r =~ payload else !([context.send(m)].flatten.grep(r)).empty? end }.map {|_,_,b| b} end # Pass control to the next matching route. def pass throw :pass end # Exit the current block, halts any further processing of the request def halt throw :halt end # Rejects the email immediately def reject throw :halt, false end end end clean up/clarify router a tad module SMTPMachine module Router def self.included(base) # :nodoc: base.extend ClassMethods end module ClassMethods attr_accessor :routes def reset! self.routes = {} end def ehlo(regex, options = {}, &block) add_route(:ehlo, regex, options, &block) end def mail_from(regex, options = {}, &block) add_route(:from, regex, options, &block) end def rcpt_to(regex, options = {}, &block) add_route(:to, regex, options, &block) end def data(regex, options = {}, &block) add_route(:data, regex, options, &block) end def map(regex, options = {}, &block) add_route(:to, regex) { true } add_route(:data, regex, ({:match => :to}).merge(options), &block) end def add_route(action, regex, options = {}, &block) match_against = options[:match] || action define_method "__email #{action} #{regex}", &block unbound_method = instance_method("__email #{action} #{regex}") block = lambda { unbound_method.bind(self).call } (routes[action] ||= []). push([regex, match_against, block]).last end end attr_accessor :routes def initialize self.routes = {} super end def route! compile_routes match = false routes.each do |block| catch(:pass) do res = instance_eval(&block) match ||= res end end match end private def compile_routes self.routes = (self.class.routes[action] || []).select do |regex, match_action, _| return true unless regex if action == match_action regex =~ payload else !([context.send(match_action)].flatten.grep(regex)).empty? end end.map {|_,_,b| b} end # Pass control to the next matching route. def pass throw :pass end # Exit the current block, halts any further processing of the request def halt throw :halt end # Rejects the email immediately def reject throw :halt, false end end end
module SocmapAdf VERSION = "0.0.4" end 0.0.5 module SocmapAdf VERSION = "0.0.5" end
# encoding: utf-8 module Sponges class Supervisor attr_reader :store, :name, :options def initialize(name, options, store, block) @name, @options, @store, @block = name, options, store, block store.on_fork store.register Process.pid @children_seen = 0 end def start options[:size].times do fork_children end trap_signals at_exit do Sponges.logger.info "Supervisor exits." end Sponges.logger.info "Supervisor started, waiting for messages." sleep rescue Exception => exception Sponges.logger.error exception kill_them_all(:INT) raise exception end private def fork_children name = children_name pid = fork do $PROGRAM_NAME = name Sponges::Hook.after_fork @block.call end Sponges.logger.info "Supervisor create a child with #{pid} pid." store.add_children pid end def children_name "#{name}_child_#{@children_seen +=1}" end def trap_signals (Sponges::SIGNALS + [:HUP]).each do |signal| trap(signal) do handle_signal signal end end trap(:TTIN) do Sponges.logger.warn "Supervisor increment child's pool by one." fork_children end trap(:TTOU) do Sponges.logger.warn "Supervisor decrement child's pool by one." if store.children_pids.first kill_one(store.children_pids.first, :HUP) store.delete_children(children_pids.first) else Sponges.logger.warn "No more child to kill." end end trap(:CHLD) do store.children_pids.each do |pid| begin dead = Process.waitpid(pid.to_i, Process::WNOHANG) if dead Sponges.logger.warn "Child #{dead} died. Restarting a new one..." store.delete_children dead Sponges::Hook.on_chld fork_children end rescue Errno::ECHILD => e # Don't panic end end end end def handle_signal(signal) Sponges.logger.info "Supervisor received #{signal} signal." kill_them_all(signal) Process.waitall Sponges.logger.info "Children shutdown complete." Sponges.logger.info "Supervisor shutdown. Exiting..." pid = store.supervisor_pid store.clear(name) Process.kill :USR1, pid.to_i end def kill_them_all(signal) store.children_pids.each do |pid| kill_one(pid.to_i, signal) end end def kill_one(pid, signal) begin Process.kill signal, pid Process.waitpid pid Sponges.logger.info "Child #{pid} receive a #{signal} signal." rescue Errno::ESRCH => e # Don't panic end end end end Various fixes on decrement Signed-off-by: chatgris <f9469d12bf3d131e7aae80be27ccfe58aa9db1f1@af83.com> # encoding: utf-8 module Sponges class Supervisor attr_reader :store, :name, :options def initialize(name, options, store, block) @name, @options, @store, @block = name, options, store, block store.on_fork store.register Process.pid @children_seen = 0 end def start options[:size].times do fork_children end trap_signals at_exit do Sponges.logger.info "Supervisor exits." end Sponges.logger.info "Supervisor started, waiting for messages." sleep rescue Exception => exception Sponges.logger.error exception kill_them_all(:INT) raise exception end private def fork_children name = children_name pid = fork do $PROGRAM_NAME = name Sponges::Hook.after_fork @block.call end Sponges.logger.info "Supervisor create a child with #{pid} pid." store.add_children pid end def children_name "#{name}_child_#{@children_seen +=1}" end def trap_signals (Sponges::SIGNALS + [:HUP]).each do |signal| trap(signal) do handle_signal signal end end trap(:TTIN) do Sponges.logger.warn "Supervisor increment child's pool by one." fork_children end trap(:TTOU) do Sponges.logger.warn "Supervisor decrement child's pool by one." if store.children_pids.first kill_one(store.children_pids.first, :HUP) store.delete_children(store.children_pids.first) else Sponges.logger.warn "No more child to kill." end end trap(:CHLD) do store.children_pids.each do |pid| begin dead = Process.waitpid(pid.to_i, Process::WNOHANG) if dead Sponges.logger.warn "Child #{dead} died. Restarting a new one..." store.delete_children dead Sponges::Hook.on_chld fork_children end rescue Errno::ECHILD => e # Don't panic end end end end def handle_signal(signal) Sponges.logger.info "Supervisor received #{signal} signal." kill_them_all(signal) Process.waitall Sponges.logger.info "Children shutdown complete." Sponges.logger.info "Supervisor shutdown. Exiting..." pid = store.supervisor_pid store.clear(name) Process.kill :USR1, pid.to_i end def kill_them_all(signal) store.children_pids.each do |pid| kill_one(pid.to_i, signal) end end def kill_one(pid, signal) begin Process.kill signal, pid Process.waitpid pid Sponges.logger.info "Child #{pid} receive a #{signal} signal." rescue Errno::ESRCH, Errno::ECHILD, SignalException => e # Don't panic end end end end
require "spring/configuration" require "spring/application_watcher" require "spring/commands" require "set" module Spring class << self attr_accessor :application_watcher end self.application_watcher = ApplicationWatcher.new class Application WATCH_INTERVAL = 0.2 attr_reader :manager, :watcher def initialize(manager, watcher = Spring.application_watcher) @manager = manager @watcher = watcher @setup = Set.new end def start require Spring.application_root_path.join("config", "application") # The test environment has config.cache_classes = true set by default. # However, we don't want this to prevent us from performing class reloading, # so this gets around that. Rails::Application.initializer :initialize_dependency_mechanism, group: :all do ActiveSupport::Dependencies.mechanism = :load end require Spring.application_root_path.join("config", "environment") watcher.add_files $LOADED_FEATURES watcher.add_files ["Gemfile", "Gemfile.lock"].map { |f| "#{Rails.root}/#{f}" } watcher.add_globs Rails.application.paths["config/initializers"].map { |p| "#{Rails.root}/#{p}/*.rb" } run end def run loop do watch_application serve manager.recv_io(UNIXSocket) end end def watch_application until IO.select([manager], [], [], WATCH_INTERVAL) exit if watcher.stale? end end def serve(client) streams = 3.times.map { client.recv_io } args_length = client.gets.to_i args = args_length.times.map { client.read(client.gets.to_i) } command = Spring.command(args.shift) setup command ActionDispatch::Reloader.cleanup! ActionDispatch::Reloader.prepare! pid = fork { Process.setsid [STDOUT, STDERR, STDIN].zip(streams).each { |a, b| a.reopen(b) } IGNORE_SIGNALS.each { |sig| trap(sig, "DEFAULT") } invoke_after_fork_callbacks command.call(args) } manager.puts pid _, status = Process.wait2 pid ensure streams.each(&:close) if streams client.puts(status ? status.exitstatus : 1) client.close end # The command might need to require some files in the # main process so that they are cached. For example a test command wants to # load the helper file once and have it cached. # # FIXME: The watcher.add_files will reset the watcher, which may mean that # previous changes to already-loaded files are missed. def setup(command) return if @setup.include?(command.class) @setup << command.class if command.respond_to?(:setup) command.setup watcher.add_files $LOADED_FEATURES # loaded features may have changed end end def invoke_after_fork_callbacks Spring.after_fork_callbacks.each do |callback| callback.call end end end end Allow multiple commands to run at once E.g. if you have several terminals open and are running two test commands at once. Closes #78 require "spring/configuration" require "spring/application_watcher" require "spring/commands" require "set" module Spring class << self attr_accessor :application_watcher end self.application_watcher = ApplicationWatcher.new class Application WATCH_INTERVAL = 0.2 attr_reader :manager, :watcher def initialize(manager, watcher = Spring.application_watcher) @manager = manager @watcher = watcher @setup = Set.new end def start require Spring.application_root_path.join("config", "application") # The test environment has config.cache_classes = true set by default. # However, we don't want this to prevent us from performing class reloading, # so this gets around that. Rails::Application.initializer :initialize_dependency_mechanism, group: :all do ActiveSupport::Dependencies.mechanism = :load end require Spring.application_root_path.join("config", "environment") watcher.add_files $LOADED_FEATURES watcher.add_files ["Gemfile", "Gemfile.lock"].map { |f| "#{Rails.root}/#{f}" } watcher.add_globs Rails.application.paths["config/initializers"].map { |p| "#{Rails.root}/#{p}/*.rb" } run end def run loop do watch_application serve manager.recv_io(UNIXSocket) end end def watch_application until IO.select([manager], [], [], WATCH_INTERVAL) exit if watcher.stale? end end def serve(client) streams = 3.times.map { client.recv_io } args_length = client.gets.to_i args = args_length.times.map { client.read(client.gets.to_i) } command = Spring.command(args.shift) setup command ActionDispatch::Reloader.cleanup! ActionDispatch::Reloader.prepare! pid = fork { Process.setsid [STDOUT, STDERR, STDIN].zip(streams).each { |a, b| a.reopen(b) } IGNORE_SIGNALS.each { |sig| trap(sig, "DEFAULT") } invoke_after_fork_callbacks command.call(args) } manager.puts pid # Wait in a separate thread so we can run multiple commands at once Thread.new { _, status = Process.wait2 pid streams.each(&:close) client.puts(status.exitstatus) client.close } rescue => e streams.each(&:close) if streams client.puts(1) client.close raise end # The command might need to require some files in the # main process so that they are cached. For example a test command wants to # load the helper file once and have it cached. # # FIXME: The watcher.add_files will reset the watcher, which may mean that # previous changes to already-loaded files are missed. def setup(command) return if @setup.include?(command.class) @setup << command.class if command.respond_to?(:setup) command.setup watcher.add_files $LOADED_FEATURES # loaded features may have changed end end def invoke_after_fork_callbacks Spring.after_fork_callbacks.each do |callback| callback.call end end end end
module SQLParser VERSION = '0.8' end fix(in_predicate): IN() predicate accepts a value list with one element module SQLParser VERSION = '0.9' end
require 'cli/name_version_pair' require 'cli/client/export_release_client' require 'json' module Bosh::Cli::Command module Release class ExportRelease < Base usage 'export release' desc 'Export the compiled release to a tarball. Release should be in the form of {name}/{version} and stemcell should be in the form of {operating system name}/{stemcell version}' def export(release, stemcell) auth_required deployment_required manifest = Bosh::Cli::Manifest.new(deployment, director) manifest.load release = Bosh::Cli::NameVersionPair.parse(release) stemcell = Bosh::Cli::NameVersionPair.parse(stemcell) stemcell_os = stemcell.name client = Bosh::Cli::Client::ExportReleaseClient.new(director) status, task_id = client.export(manifest.name, release.name, release.version, stemcell_os, stemcell.version) task_report(status, task_id) task_result_file = director.get_task_result_log(task_id) task_result = JSON.parse(task_result_file) tarball_blobstore_id = task_result['blobstore_id'] tarball_sha1 = task_result['sha1'] tarball_file_name = "release-#{release.name}-#{release.version}-on-#{stemcell_os}-stemcell-#{stemcell.version}.tgz" tarball_file_path = File.join(Dir.pwd, tarball_file_name) nl progress_renderer.start(tarball_file_name, "downloading...") tmpfile = director.download_resource(tarball_blobstore_id) File.open(tarball_file_path, "wb") do |file| file << File.open(tmpfile).read end progress_renderer.finish(tarball_file_name, "downloaded") if file_checksum(tarball_file_path) != tarball_sha1 err("Checksum mismatch for downloaded blob `#{tarball_file_path}'") end end # Returns file SHA1 checksum # @param [String] path File path def file_checksum(path) Digest::SHA1.file(path).hexdigest end end end end cli should exit with error without trying to fetch compiled release tarball if director task did not succeed [#99659682] https://www.pivotaltracker.com/story/show/99659682 Signed-off-by: Sukhil Suresh <7738644c72471621b3fc113c0e37dedf152ad781@pivotal.io> require 'cli/name_version_pair' require 'cli/client/export_release_client' require 'json' module Bosh::Cli::Command module Release class ExportRelease < Base usage 'export release' desc 'Export the compiled release to a tarball. Release should be in the form of {name}/{version} and stemcell should be in the form of {operating system name}/{stemcell version}' def export(release, stemcell) auth_required deployment_required manifest = Bosh::Cli::Manifest.new(deployment, director) manifest.load release = Bosh::Cli::NameVersionPair.parse(release) stemcell = Bosh::Cli::NameVersionPair.parse(stemcell) stemcell_os = stemcell.name client = Bosh::Cli::Client::ExportReleaseClient.new(director) status, task_id = client.export(manifest.name, release.name, release.version, stemcell_os, stemcell.version) if status != :done task_report(status, task_id) return end task_result_file = director.get_task_result_log(task_id) task_result = JSON.parse(task_result_file) tarball_blobstore_id = task_result['blobstore_id'] tarball_sha1 = task_result['sha1'] tarball_file_name = "release-#{release.name}-#{release.version}-on-#{stemcell_os}-stemcell-#{stemcell.version}.tgz" tarball_file_path = File.join(Dir.pwd, tarball_file_name) nl progress_renderer.start(tarball_file_name, "downloading...") tmpfile = director.download_resource(tarball_blobstore_id) File.open(tarball_file_path, "wb") do |file| file << File.open(tmpfile).read end progress_renderer.finish(tarball_file_name, "downloaded") if file_checksum(tarball_file_path) != tarball_sha1 err("Checksum mismatch for downloaded blob `#{tarball_file_path}'") end task_report(status, task_id, "Exported Release `#{release.name.make_green}/#{release.version.make_green}` for `#{stemcell_os.make_green}/#{stemcell.version.make_green}`") end # Returns file SHA1 checksum # @param [String] path File path def file_checksum(path) Digest::SHA1.file(path).hexdigest end end end end
# # Cookbook Name:: docker # Provider:: image # # Copyright 2013, Brian Flad # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # require 'chef/mixin/shell_out' include Chef::Mixin::ShellOut def load_current_resource @current_resource = Chef::Resource::DockerImage.new(new_resource) di = shell_out("docker images -a") if di.stdout.include?(new_resource.image_name) di.stdout.each_line do |di_line| next unless di_line.include?(new_resource.image_name) image_info = di_line.split(%r{\s\s+}) @current_resource.installed(true) @current_resource.repository(image_info[0]) @current_resource.installed_tag(image_info[1]) @current_resource.id(image_info[2]) break end end @current_resource end action :pull do unless installed? pull_args = "" pull_args += " -registry #{new_resource.registry}" if new_resource.registry pull_args += " -t #{new_resource.tag}" if new_resource.tag shell_out("docker pull #{new_resource.image_name} #{pull_args}") new_resource.updated_by_last_action(true) end end action :build do unless installed? full_image_name = new_resource.image_name full_image_name += ":#{new_resource.tag}" if new_resource.tags shell_out("docker build -t #{full_image_name} - < #{new_resource.dockerfile}") new_resource.updated_by_last_action(true) end end action :remove do remove if @current_resource.installed new_resource.updated_by_last_action(true) end def remove shell_out("docker rmi #{new_resource.image_name}") end def installed? @current_resource.installed && tag_match end def tag_match # if the tag is specified, we need to check if it matches what # is installed already if new_resource.tag @current_resource.installed_tag == new_resource.tag else # the tag matches otherwise because it's installed true end end syntax fix # # Cookbook Name:: docker # Provider:: image # # Copyright 2013, Brian Flad # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # require 'chef/mixin/shell_out' include Chef::Mixin::ShellOut def load_current_resource @current_resource = Chef::Resource::DockerImage.new(new_resource) di = shell_out("docker images -a") if di.stdout.include?(new_resource.image_name) di.stdout.each_line do |di_line| next unless di_line.include?(new_resource.image_name) image_info = di_line.split(%r{\s\s+}) @current_resource.installed(true) @current_resource.repository(image_info[0]) @current_resource.installed_tag(image_info[1]) @current_resource.id(image_info[2]) break end end @current_resource end action :pull do unless installed? pull_args = "" pull_args += " -registry #{new_resource.registry}" if new_resource.registry pull_args += " -t #{new_resource.tag}" if new_resource.tag shell_out("docker pull #{new_resource.image_name} #{pull_args}") new_resource.updated_by_last_action(true) end end action :build do unless installed? full_image_name = new_resource.image_name full_image_name += ":#{new_resource.tag}" if new_resource.tag shell_out("docker build -t #{full_image_name} - < #{new_resource.dockerfile}") new_resource.updated_by_last_action(true) end end action :remove do remove if @current_resource.installed new_resource.updated_by_last_action(true) end def remove shell_out("docker rmi #{new_resource.image_name}") end def installed? @current_resource.installed && tag_match end def tag_match # if the tag is specified, we need to check if it matches what # is installed already if new_resource.tag @current_resource.installed_tag == new_resource.tag else # the tag matches otherwise because it's installed true end end
ucsc-genome-browser: 278 Install a mirror of the UCSC Genome Browser. require 'formula' class UcscGenomeBrowser < Formula homepage 'http://genome.ucsc.edu' url 'http://hgdownload.cse.ucsc.edu/admin/jksrc.v278.zip' sha1 '54bc2972ac02651dcc991b8c1e063a9d3a264568' head 'git://genome-source.cse.ucsc.edu/kent.git' keg_only <<-EOF.undent The UCSC Genome Browser installs many commands, and some conflict with other packages. EOF depends_on :libpng depends_on :mysql def install ENV.j1 machtype = `uname -m`.chomp user = `whoami`.chomp mkdir prefix/"cgi-bin-#{user}" mkdir prefix/"htdocs-#{user}" cd 'src/lib' do system 'make', "MACHTYPE=#{machtype}" end cd 'src/jkOwnLib' do system 'make', "MACHTYPE=#{machtype}" end cd 'src' do system 'make', "MACHTYPE=#{machtype}", "BINDIR=#{bin}", "SCRIPTS=#{bin}/scripts", "CGI_BIN=#{prefix}/cgi-bin", "DOCUMENTROOT=#{prefix}/htdocs", "PNGLIB=-L#{HOMEBREW_PREFIX}/lib -lpng", "MYSQLLIBS=-lmysqlclient -lz", "MYSQLINC=#{HOMEBREW_PREFIX}/include" end mv "#{prefix}/cgi-bin-#{user}", prefix/'cgi-bin' mv "#{prefix}/htdocs-#{user}", prefix/'htdocs' end # Todo: Best would be if this formula would put a complete working # apache virtual site into #{share} and instruct the user to just # do a symlink. def caveats; <<-EOF.undent To complete the installation of the UCSC Genome Browser, follow these instructions: http://genomewiki.ucsc.edu/index.php/Browser_Installation To complete a minimal installation, follow these directions: # Configure the Apache web server. # Warning! This command will overwrite your existing web site. # HELP us to improve these instructions so that a new virtual site is created. rsync -avzP rsync://hgdownload.cse.ucsc.edu/htdocs/ /Library/WebServer/Documents/ sudo cp -a #{prefix}/cgi-bin/* /Library/WebServer/CGI-Executables/ sudo mkdir /Library/WebServer/CGI-Executables/trash sudo wget https://gist.github.com/raw/4626128 -O /Library/WebServer/CGI-Executables/hg.conf mkdir /usr/local/apache ln -s /Library/WebServer/Documents /usr/local/apache/htdocs sudo apachectl start # Configure the MySQL database. cd #{HOMEBREW_PREFIX}/opt/mysql && mysqld_safe & mysql -uroot -proot -e "create user 'hguser'@'localhost' identified by 'hguser';" rsync -avzP rsync://hgdownload.cse.ucsc.edu/mysql/hgcentral/ #{HOMEBREW_PREFIX}/var/mysql/hgcentral/ mysql -uroot -proot -e "grant all privileges on hgcentral.* to 'hguser'@'localhost'" mysql -uroot -proot -e "create database hgFixed" mysql -uroot -proot -e "grant select on hgFixed.* to 'hguser'@'localhost'" Point your browser to http://localhost/cgi-bin/hgGateway EOF end end
#!/usr/local/bin/ruby18 require File.dirname(__FILE__) + "/../config/environment" unless defined?(RAILS_ROOT) # If you're using RubyGems and mod_ruby, this require should be changed to an absolute path one, like: # "/usr/local/lib/ruby/gems/1.8/gems/rails-0.8.0/lib/dispatcher" -- otherwise performance is severely impaired require "dispatcher" ADDITIONAL_LOAD_PATHS.reverse.each { |dir| $:.unshift(dir) if File.directory?(dir) } if defined?(Apache::RubyRun) Dispatcher.dispatch Remove the dispatch.rb file, we're not using it
# -*- coding: utf-8 -*- # FDF V1.3 fdfAnalysisModule do description { "This is an analysis module for CopyPeste." } author { "Team Algo" } usage { 'Just run it!' } init { Fdf.new() } impl { require 'json' require File.join(CopyPeste::Require::Path.base, 'algorithms') require File.join(CopyPeste::Require::Path.copy_peste, 'DbHdlr') require File.join(CopyPeste::Require::Path.analysis, 'fdf/config_handler/Ignored_class') class Fdf attr_accessor :options attr_accessor :show def initialize @options = { "e" => { helper: "sort by extension.", allowed: [0, 1], value: 1 }, "s" => { helper: "sort by size.", allowed: [0, 1], value: 1 }, "p" => { helper: "minimum percentage of similarity between 2 files", allowed: [*60..100], value: 100 } } @mongo = DbHdlr.new() @c_res = "Scoring" @c_file = "Fichier" @results = { module: "FDF", options: "List of duplicated files", timestamp: Time.now.getutc, type: "array", header: ["first", "second", "score"], references: [@c_file, @c_file, nil], transformation: [], rows: [] } @ignored_conf = Ignored_class.new() end # Look at the different rules and chose the right way to sort files # # @param [Array] Array of files to sort # @Return [Hash] return an hash of all the files sorted def sort_files_with_rules(documents) documents.each do |extension, files| @show.call "\tSorting extension '#{extension}' per size." files.sort_by {|file| file[:value]} documents[extension] = files end documents end # Extract path and name of each files and concat them. # # @param [Array][Array][Hash] take an Array of Array of hash. [files by extension][one file][hash of the file] # @Return [Array] return a file array with their full path and size def to_doc(file) return { path: file["path"] + "/" + file["name"], size: file["size"], name: file["name"] } end # Get files from the database that will be analysed # # @Return [Array] return a file Array with the full file path : Array[0] = /home/test/expemple.c def get_doc_to_analyse documents = {} query = {name: {"$nin" => @ignored_conf.ignored_ext}} # get all extensions extensions = @mongo.get_data("Extension", query, nil) # for each extension extensions.each do |extension| extension["_id"] = BSON::ObjectId.from_string extension["_id"]["$oid"] @show.call "\tRetrieving files with extension: '#{extension["name"]}'." query = {ext: extension["_id"], name: {"$nin" => @ignored_conf.ignored_files }} # get all corresponding files files = @mongo.get_data(@c_file, query) documents[extension["name"]] = [] # save each file, formated, in the good extension files.each {|file| documents[extension["name"]] << to_doc(file)} end documents end # Save pair of file compared by fdupes/levenshtein, and there result # This Hash is saved in an Array # # @param [Hash] files and distance between their titles # @param [Int] result of comparison algorim # @return def save_result_data(file_d, similarity) result_data = [ file_d[:files][0], #first file file_d[:files][1], #second file similarity #their similarity score ] @results[:rows] << result_data end # Open the two files and send there containt to fdupes algorithm # # @param [Array] File Array # @param [Integer] Loop position # @return [Integer] Return the percentage of difference between files def open_and_send(f1, f2) begin file1 = IO.read f1[:path] file2 = IO.read f2[:path] rescue => e # file doesn't exists, db have to be updated @show.call "\t[Error]: #{e} Please update your database" return nil end begin # if 100% similarity and files have the same size if @options["p"][:value] == 100 return nil if f1[:size] != f2[:size] return 100 - Algorithms.fdupes_match(file1, f1[:size], file2, f2[:size]) end Algorithms.diff(file1, file2) rescue => e @show.call "\t[Not treated]: #{f1[:path]} & #{f2[:path]}: #{e}" end end # Send files to the fdupes algorithms # # @param [Array] File array containing levenshtein's results def check_files_similarity(documents) duplicated_files = {} # for each extension documents.each do |extension, files| next if files.length < 2 @show.call "\tSearching for duplication with extension: '#{extension}'." # iterate all files to find duplications (files.length - 1).times do |i| f1 = files[i] #@show.call "\tSearching if file #{f1[:name]} is duplicated" ((i + 1)..(files.length - 1)).each do |j| f2 = files[j] # stop loop if size is required but files aren't of the same size break if @options["s"][:value] == 1 && f1[:size] != f2[:size] # allow little differences in filenames next if Algorithms.levenshtein(f1[:name], f2[:name]) > 1 result = open_and_send(f1, f2) next if result == nil f3 = f2.clone f3[:similarity] = result if (@options["p"][:value] == 100 && result == 100) || (result >= @options["p"][:value]) if duplicated_files.key?(f1[:path]) duplicated_files[f1[:path]] << f3 else duplicated_files[f1[:path]] = [f3] end end end end end @results[:rows] = duplicated_files end # Function used to initialize and run the fdf # and get the list of file to analyse. def run(*) @show.call "Get all files from database..." files = get_doc_to_analyse @show.call "Done." @show.call "Sort files depending on options..." sorted_file = sort_files_with_rules files @show.call "Done." @show.call "Searching for duplicated files..." check_files_similarity sorted_file @show.call "Done." @show.call "Saving analyse results in database..." @mongo.ins_data(@c_res, @results) @show.call "Done, everything worked fine!" @show.call "You can now run generate_result to extract interesting informations." end end } end This commit ref #984 - Do not take into account 0 size files # -*- coding: utf-8 -*- # FDF V1.3 fdfAnalysisModule do description { "This is an analysis module for CopyPeste." } author { "Team Algo" } usage { 'Just run it!' } init { Fdf.new() } impl { require 'json' require File.join(CopyPeste::Require::Path.base, 'algorithms') require File.join(CopyPeste::Require::Path.copy_peste, 'DbHdlr') require File.join(CopyPeste::Require::Path.analysis, 'fdf/config_handler/Ignored_class') class Fdf attr_accessor :options attr_accessor :show def initialize @options = { "e" => { helper: "sort by extension.", allowed: [0, 1], value: 1 }, "s" => { helper: "sort by size.", allowed: [0, 1], value: 1 }, "p" => { helper: "minimum percentage of similarity between 2 files", allowed: [*60..100], value: 100 } } @mongo = DbHdlr.new() @c_res = "Scoring" @c_file = "Fichier" @results = { module: "FDF", options: "List of duplicated files", timestamp: Time.now.getutc, type: "array", header: ["first", "second", "score"], references: [@c_file, @c_file, nil], transformation: [], rows: [] } @ignored_conf = Ignored_class.new() end # Look at the different rules and chose the right way to sort files # # @param [Array] Array of files to sort # @Return [Hash] return an hash of all the files sorted def sort_files_with_rules(documents) documents.each do |extension, files| @show.call "\tSorting extension '#{extension}' per size." files.sort_by {|file| file[:value]} documents[extension] = files end documents end # Extract path and name of each files and concat them. # # @param [Array][Array][Hash] take an Array of Array of hash. [files by extension][one file][hash of the file] # @Return [Array] return a file array with their full path and size def to_doc(file) return nil if file["size"] == 0 return { path: file["path"] + "/" + file["name"], size: file["size"], name: file["name"] } end # Get files from the database that will be analysed # # @Return [Array] return a file Array with the full file path : Array[0] = /home/test/expemple.c def get_doc_to_analyse documents = {} query = {name: {"$nin" => @ignored_conf.ignored_ext}} # get all extensions extensions = @mongo.get_data("Extension", query, nil) # for each extension extensions.each do |extension| extension["_id"] = BSON::ObjectId.from_string extension["_id"]["$oid"] @show.call "\tRetrieving files with extension: '#{extension["name"]}'." query = {ext: extension["_id"], name: {"$nin" => @ignored_conf.ignored_files }} # get all corresponding files files = @mongo.get_data(@c_file, query) documents[extension["name"]] = [] # save each file, formated, in the good extension files.each do |file| doc = to_doc(file) documents[extension["name"]] << doc if doc != nil end end documents end # Save pair of file compared by fdupes/levenshtein, and there result # This Hash is saved in an Array # # @param [Hash] files and distance between their titles # @param [Int] result of comparison algorim # @return def save_result_data(file_d, similarity) result_data = [ file_d[:files][0], #first file file_d[:files][1], #second file similarity #their similarity score ] @results[:rows] << result_data end # Open the two files and send there containt to fdupes algorithm # # @param [Array] File Array # @param [Integer] Loop position # @return [Integer] Return the percentage of difference between files def open_and_send(f1, f2) begin file1 = IO.read f1[:path] file2 = IO.read f2[:path] rescue => e # file doesn't exists, db have to be updated @show.call "\t[Error]: #{e} Please update your database" return nil end begin # if 100% similarity and files have the same size if @options["p"][:value] == 100 return nil if f1[:size] != f2[:size] return 100 - Algorithms.fdupes_match(file1, f1[:size], file2, f2[:size]) end Algorithms.diff(file1, file2) rescue => e @show.call "\t[Not treated]: #{f1[:path]} & #{f2[:path]}: #{e}" end end # Send files to the fdupes algorithms # # @param [Array] File array containing levenshtein's results def check_files_similarity(documents) duplicated_files = {} # for each extension documents.each do |extension, files| next if files.length < 2 @show.call "\tSearching for duplication with extension: '#{extension}'." # iterate all files to find duplications (files.length - 1).times do |i| f1 = files[i] #@show.call "\tSearching if file #{f1[:name]} is duplicated" ((i + 1)..(files.length - 1)).each do |j| f2 = files[j] # stop loop if size is required but files aren't of the same size break if @options["s"][:value] == 1 && f1[:size] != f2[:size] # allow little differences in filenames next if Algorithms.levenshtein(f1[:name], f2[:name]) > 1 result = open_and_send(f1, f2) next if result == nil f3 = f2.clone f3[:similarity] = result if (@options["p"][:value] == 100 && result == 100) || (result >= @options["p"][:value]) if duplicated_files.key?(f1[:path]) duplicated_files[f1[:path]] << f3 else duplicated_files[f1[:path]] = [f3] end end end end end @results[:rows] = duplicated_files end # Function used to initialize and run the fdf # and get the list of file to analyse. def run(*) @show.call "Get all files from database..." files = get_doc_to_analyse @show.call "Done." @show.call "Sort files depending on options..." sorted_file = sort_files_with_rules files @show.call "Done." @show.call "Searching for duplicated files..." check_files_similarity sorted_file @show.call "Done." @show.call "Saving analyse results in database..." @mongo.ins_data(@c_res, @results) @show.call "Done, everything worked fine!" @show.call "You can now run generate_result to extract interesting informations." end end } end
# -*- coding: utf-8 -*- spsAnalysisModule do description { "This is an analysis module for CopyPeste." } author { "Team Algo" } usage { 'Just run it!' } init { Sps.new() } impl { require 'json' require 'parallel' require 'mongo' require File.join(CopyPeste::Require::Path.base, 'algorithms') require File.join(CopyPeste::Require::Path.analysis, 'fdf/config_handler/Ignored_class') class Sps attr_accessor :options attr_accessor :show def initialize @options = { "test" => { helper: "Option de test", allowed: [0, 1], value: 0 } } @options = options @ignored_conf = Ignored_class.new() end # Function called to start the Sps module def analyse(result) res = {} result_fdf = get_file_from_db result_fdf.results.each do |data| if data._type == "ArrayResult" key = data.header[0].split("/")[1] if key != nil if !res.has_key?(key) res[key] = {} end data.rows.each do |file| key2 = file[0].split("/")[1] if !res[key].has_key?(key2) && key != key2 res[key][key2] = [] res[key][key2] << file[1] elsif key != key2 res[key][key2] << file[1] end end end end end projects = get_file_projects compare_projects(res, projects) end def get_file_projects files = [] # extensions = Extension.not_in(name: @ignored_conf.ignored_exts).to_a # extensions.each do |extension| # puts extension # extension["_id"] = BSON::ObjectId.from_string extension.id mongo_files = FileSystem.all#where(ext: extension.id).not_in(name: @ignored_conf.ignored_files) mongo_files.each do |file| files << file["path"] end # end return get_num_files_project files end def get_num_files_project(files) projects = {} files.each do |file| key = file.split("/")[1] if !projects.has_key?(key) projects[key] = 1 else projects[key] += 1 end end projects end # This functions set the pourcent average of two projects # # @param [Array] Array containing all files similarities from two project # in pourcent def compare_projects(res, projects) puts "\n" res.each do |key, value| if value.keys[0] != nil average = 0.0 nb = 0 value[value.keys[0]].each do |num| average = average + Integer(num) end if projects[key].to_i > projects[value.keys[0]].to_i result = average/projects[key].to_f else result = average/projects[value.keys[0]].to_f end puts "average between "+key.to_s+" and "+value.keys[0].to_s+" = "+result.to_s+"%" end end puts "\n" end # This function get the documents to analyses def get_file_from_db begin ar = AnalyseResult.last return ar rescue @graph_com.cmd_return(@cmd, "Collection AnalyseResult doesn't exist", true) return nil end end # Function used to initialize and run the fdf def run(result) result.module_name = "Sps" result.options = @options analyse result @show.call "Done! Everything worked fine!" @show.call "You can now run generate_result to extract interesting informations." end end } end Update sps results # -*- coding: utf-8 -*- spsAnalysisModule do description { "This is an analysis module for CopyPeste." } author { "Team Algo" } usage { 'Just run it!' } init { Sps.new() } impl { require 'json' require 'parallel' require 'mongo' require File.join(CopyPeste::Require::Path.base, 'algorithms') require File.join(CopyPeste::Require::Path.analysis, 'fdf/config_handler/Ignored_class') class Sps attr_accessor :options attr_accessor :show def initialize @options = { "test" => { helper: "Option de test", allowed: [0, 1], value: 0 } } @options = options @results = { module: "SPS", options: "List of duplicated Project", timestamp: Time.now.getutc, data: [] } @ignored_conf = Ignored_class.new() end # Function called to start the Sps module def analyse(result) res = {} result_fdf = get_file_from_db result_fdf.results.each do |data| if data._type == "ArrayResult" key = data.header[0].split("/")[1] if key != nil if !res.has_key?(key) res[key] = {} end data.rows.each do |file| key2 = file[0].split("/")[1] if !res[key].has_key?(key2) && key != key2 res[key][key2] = [] res[key][key2] << file[1] elsif key != key2 res[key][key2] << file[1] end end end end end projects = get_file_projects compare_projects(res, projects, result) end def get_file_projects files = [] # extensions = Extension.not_in(name: @ignored_conf.ignored_exts).to_a # extensions.each do |extension| # puts extension # extension["_id"] = BSON::ObjectId.from_string extension.id mongo_files = FileSystem.all#where(ext: extension.id).not_in(name: @ignored_conf.ignored_files) mongo_files.each do |file| files << file["path"] end # end return get_num_files_project files end def get_num_files_project(files) projects = {} files.each do |file| key = file.split("/")[1] if !projects.has_key?(key) projects[key] = 1 else projects[key] += 1 end end projects end # This functions set the pourcent average of two projects # # @param [Array] Array containing all files similarities from two project # in pourcent def compare_projects(res, projects, results) puts "\n" res.each do |key, value| if value.keys[0] != nil average = 0.0 nb = 0 value[value.keys[0]].each do |num| average = average + Integer(num) end if projects[key].to_i > projects[value.keys[0]].to_i result = average/projects[key].to_f else result = average/projects[value.keys[0]].to_f end results.add_text(text: "average between #{key.to_s} and #{value.keys[0].to_s} = #{result.round(2).to_s}%") end end puts "\n" end # This function get the documents to analyses def get_file_from_db begin ar = AnalyseResult.last return ar rescue @graph_com.cmd_return(@cmd, "Collection AnalyseResult doesn't exist", true) return nil end end # Function used to initialize and run the fdf def run(result) result.module_name = "Sps" result.options = @options analyse result @show.call "Done! Everything worked fine!" @show.call "You can now run generate_result to extract interesting informations." end end } end
Pod::Spec.new do |s| s.name = "React" s.version = "0.21.0-rc" s.summary = "Build high quality mobile apps using React." s.description = <<-DESC React Native apps are built using the React JS framework, and render directly to native UIKit elements using a fully asynchronous architecture. There is no browser and no HTML. We have picked what we think is the best set of features from these and other technologies to build what we hope to become the best product development framework available, with an emphasis on iteration speed, developer delight, continuity of technology, and absolutely beautiful and fast products with no compromises in quality or capability. DESC s.homepage = "http://facebook.github.io/react-native/" s.license = "BSD" s.author = "Facebook" s.source = { :git => "https://github.com/facebook/react-native.git", :tag => "v#{s.version}" } s.default_subspec = 'Core' s.requires_arc = true s.platform = :ios, "7.0" s.preserve_paths = "cli.js", "Libraries/**/*.js", "lint", "linter.js", "node_modules", "package.json", "packager", "PATENTS", "react-native-cli" s.subspec 'Core' do |ss| ss.source_files = "React/**/*.{c,h,m,S}" ss.exclude_files = "**/__tests__/*", "IntegrationTests/*" ss.frameworks = "JavaScriptCore" end s.subspec 'ART' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/ART/**/*.{h,m}" ss.preserve_paths = "Libraries/ART/**/*.js" end s.subspec 'RCTActionSheet' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/ActionSheetIOS/*.{h,m}" ss.preserve_paths = "Libraries/ActionSheetIOS/*.js" end s.subspec 'RCTAdSupport' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/AdSupport/*.{h,m}" ss.preserve_paths = "Libraries/AdSupport/*.js" end s.subspec 'RCTCameraRoll' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/CameraRoll/*.{h,m}" ss.preserve_paths = "Libraries/CameraRoll/*.js" end s.subspec 'RCTGeolocation' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/Geolocation/*.{h,m}" ss.preserve_paths = "Libraries/Geolocation/*.js" end s.subspec 'RCTImage' do |ss| ss.dependency 'React/Core' ss.dependency 'React/RCTNetwork' ss.source_files = "Libraries/Image/*.{h,m}" ss.preserve_paths = "Libraries/Image/*.js" end s.subspec 'RCTNetwork' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/Network/*.{h,m}" ss.preserve_paths = "Libraries/Network/*.js" end s.subspec 'RCTPushNotification' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/PushNotificationIOS/*.{h,m}" ss.preserve_paths = "Libraries/PushNotificationIOS/*.js" end s.subspec 'RCTSettings' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/Settings/*.{h,m}" ss.preserve_paths = "Libraries/Settings/*.js" end s.subspec 'RCTText' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/Text/*.{h,m}" ss.preserve_paths = "Libraries/Text/*.js" end s.subspec 'RCTVibration' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/Vibration/*.{h,m}" ss.preserve_paths = "Libraries/Vibration/*.js" end s.subspec 'RCTWebSocket' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/WebSocket/*.{h,m}" ss.preserve_paths = "Libraries/WebSocket/*.js" end s.subspec 'RCTLinkingIOS' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/LinkingIOS/*.{h,m}" ss.preserve_paths = "Libraries/LinkingIOS/*.js" end s.subspec 'RCTTest' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/RCTTest/**/*.{h,m}" ss.preserve_paths = "Libraries/RCTTest/**/*.js" ss.frameworks = "XCTest" end end [React] Fix RCTTest to not pull in its own vendored FBSnapshotTestCase. https://github.com/facebook/react-native/issues/6126 Pod::Spec.new do |s| s.name = "React" s.version = "0.21.0-rc" s.summary = "Build high quality mobile apps using React." s.description = <<-DESC React Native apps are built using the React JS framework, and render directly to native UIKit elements using a fully asynchronous architecture. There is no browser and no HTML. We have picked what we think is the best set of features from these and other technologies to build what we hope to become the best product development framework available, with an emphasis on iteration speed, developer delight, continuity of technology, and absolutely beautiful and fast products with no compromises in quality or capability. DESC s.homepage = "http://facebook.github.io/react-native/" s.license = "BSD" s.author = "Facebook" s.source = { :git => "https://github.com/facebook/react-native.git", :tag => "v#{s.version}" } s.default_subspec = 'Core' s.requires_arc = true s.platform = :ios, "7.0" s.preserve_paths = "cli.js", "Libraries/**/*.js", "lint", "linter.js", "node_modules", "package.json", "packager", "PATENTS", "react-native-cli" s.subspec 'Core' do |ss| ss.source_files = "React/**/*.{c,h,m,S}" ss.exclude_files = "**/__tests__/*", "IntegrationTests/*" ss.frameworks = "JavaScriptCore" end s.subspec 'ART' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/ART/**/*.{h,m}" ss.preserve_paths = "Libraries/ART/**/*.js" end s.subspec 'RCTActionSheet' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/ActionSheetIOS/*.{h,m}" ss.preserve_paths = "Libraries/ActionSheetIOS/*.js" end s.subspec 'RCTAdSupport' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/AdSupport/*.{h,m}" ss.preserve_paths = "Libraries/AdSupport/*.js" end s.subspec 'RCTCameraRoll' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/CameraRoll/*.{h,m}" ss.preserve_paths = "Libraries/CameraRoll/*.js" end s.subspec 'RCTGeolocation' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/Geolocation/*.{h,m}" ss.preserve_paths = "Libraries/Geolocation/*.js" end s.subspec 'RCTImage' do |ss| ss.dependency 'React/Core' ss.dependency 'React/RCTNetwork' ss.source_files = "Libraries/Image/*.{h,m}" ss.preserve_paths = "Libraries/Image/*.js" end s.subspec 'RCTNetwork' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/Network/*.{h,m}" ss.preserve_paths = "Libraries/Network/*.js" end s.subspec 'RCTPushNotification' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/PushNotificationIOS/*.{h,m}" ss.preserve_paths = "Libraries/PushNotificationIOS/*.js" end s.subspec 'RCTSettings' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/Settings/*.{h,m}" ss.preserve_paths = "Libraries/Settings/*.js" end s.subspec 'RCTText' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/Text/*.{h,m}" ss.preserve_paths = "Libraries/Text/*.js" end s.subspec 'RCTVibration' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/Vibration/*.{h,m}" ss.preserve_paths = "Libraries/Vibration/*.js" end s.subspec 'RCTWebSocket' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/WebSocket/*.{h,m}" ss.preserve_paths = "Libraries/WebSocket/*.js" end s.subspec 'RCTLinkingIOS' do |ss| ss.dependency 'React/Core' ss.source_files = "Libraries/LinkingIOS/*.{h,m}" ss.preserve_paths = "Libraries/LinkingIOS/*.js" end s.subspec 'RCTTest' do |ss| ss.dependency 'React/Core' ss.dependency 'FBSnapshotTestCase' ss.source_files = "Libraries/RCTTest/*.{h,m}" ss.preserve_paths = "Libraries/RCTTest/*.js" ss.frameworks = "XCTest" end end
# -*- encoding: utf-8 -*- $:.push File.expand_path("../lib", __FILE__) require "punchblock/version" Gem::Specification.new do |s| s.name = %q{punchblock} s.version = Punchblock::VERSION s.platform = Gem::Platform::RUBY s.licenses = ["MIT"] s.authors = ["Jason Goecke", "Ben Klang", "Ben Langfeld"] s.email = %q{punchblock@adhearsion.com} s.homepage = %q{http://github.com/adhearsion/punchblock} s.summary = "Punchblock is a telephony middleware library" s.description = "Like Rack is to Rails and Sinatra, Punchblock provides a consistent API on top of several underlying third-party call control protocols." s.rubyforge_project = "punchblock" s.files = `git ls-files`.split("\n") s.test_files = `git ls-files -- {test,spec,features}/*`.split("\n") s.executables = `git ls-files -- bin/*`.split("\n").map{ |f| File.basename(f) } s.require_paths = ["lib"] s.required_rubygems_version = Gem::Requirement.new(">= 1.3.7") if s.respond_to? :required_rubygems_version= s.add_runtime_dependency %q<niceogiri>, ["~> 1.0"] s.add_runtime_dependency %q<blather>, [">= 0.7.0"] s.add_runtime_dependency %q<activesupport>, ["~> 3.0"] s.add_runtime_dependency %q<state_machine>, ["~> 1.0"] s.add_runtime_dependency %q<future-resource>, ["~> 1.0"] s.add_runtime_dependency %q<has-guarded-handlers>, ["~> 1.3"] s.add_runtime_dependency %q<celluloid>, [">= 0.11.1"] s.add_runtime_dependency %q<ruby_ami>, ["~> 1.2", ">= 1.2.1"] s.add_runtime_dependency %q<ruby_fs>, ["~> 1.0"] s.add_runtime_dependency %q<ruby_speech>, ["~> 1.0"] s.add_development_dependency %q<bundler>, ["~> 1.0"] s.add_development_dependency %q<rspec>, ["~> 2.7"] s.add_development_dependency %q<ci_reporter>, ["~> 1.6"] s.add_development_dependency %q<yard>, ["~> 0.6"] s.add_development_dependency %q<rake>, [">= 0"] s.add_development_dependency %q<mocha>, [">= 0"] s.add_development_dependency %q<i18n>, [">= 0"] s.add_development_dependency %q<countdownlatch>, [">= 0"] s.add_development_dependency %q<guard-rspec> s.add_development_dependency %q<ruby_gntp> end [UPDATE] Temporarily hold back ruby_ami and ruby_fs dependencies Celluloid 0.12.0 breaks everything # -*- encoding: utf-8 -*- $:.push File.expand_path("../lib", __FILE__) require "punchblock/version" Gem::Specification.new do |s| s.name = %q{punchblock} s.version = Punchblock::VERSION s.platform = Gem::Platform::RUBY s.licenses = ["MIT"] s.authors = ["Jason Goecke", "Ben Klang", "Ben Langfeld"] s.email = %q{punchblock@adhearsion.com} s.homepage = %q{http://github.com/adhearsion/punchblock} s.summary = "Punchblock is a telephony middleware library" s.description = "Like Rack is to Rails and Sinatra, Punchblock provides a consistent API on top of several underlying third-party call control protocols." s.rubyforge_project = "punchblock" s.files = `git ls-files`.split("\n") s.test_files = `git ls-files -- {test,spec,features}/*`.split("\n") s.executables = `git ls-files -- bin/*`.split("\n").map{ |f| File.basename(f) } s.require_paths = ["lib"] s.required_rubygems_version = Gem::Requirement.new(">= 1.3.7") if s.respond_to? :required_rubygems_version= s.add_runtime_dependency %q<niceogiri>, ["~> 1.0"] s.add_runtime_dependency %q<blather>, [">= 0.7.0"] s.add_runtime_dependency %q<activesupport>, ["~> 3.0"] s.add_runtime_dependency %q<state_machine>, ["~> 1.0"] s.add_runtime_dependency %q<future-resource>, ["~> 1.0"] s.add_runtime_dependency %q<has-guarded-handlers>, ["~> 1.3"] s.add_runtime_dependency %q<celluloid>, [">= 0.11.1"] s.add_runtime_dependency %q<ruby_ami>, ["~> 1.2", ">= 1.2.1", "< 1.2.2"] s.add_runtime_dependency %q<ruby_fs>, ["~> 1.0", "< 1.0.1"] s.add_runtime_dependency %q<ruby_speech>, ["~> 1.0"] s.add_development_dependency %q<bundler>, ["~> 1.0"] s.add_development_dependency %q<rspec>, ["~> 2.7"] s.add_development_dependency %q<ci_reporter>, ["~> 1.6"] s.add_development_dependency %q<yard>, ["~> 0.6"] s.add_development_dependency %q<rake>, [">= 0"] s.add_development_dependency %q<mocha>, [">= 0"] s.add_development_dependency %q<i18n>, [">= 0"] s.add_development_dependency %q<countdownlatch>, [">= 0"] s.add_development_dependency %q<guard-rspec> s.add_development_dependency %q<ruby_gntp> end
# coding: utf-8 lib = File.expand_path('../lib', __FILE__) $LOAD_PATH.unshift(lib) unless $LOAD_PATH.include?(lib) require 'configurator/version' Gem::Specification.new do |spec| spec.name = %q{configurator} spec.version = Configurator::VERSION spec.license = "MIT" spec.authors = ["Will Bryant"] spec.description = %q{Basic configuration loading} spec.email = ["william@tout.com"] spec.summary = %q{Basic configuration loading} spec.homepage = %q{http://github.com/will3216/configurator} spec.files = Dir.glob("lib/**/*") + [ "LICENSE.txt", "README.md", "Rakefile", "Gemfile", "configurator.gemspec", ] spec.executables = spec.files.grep(%r{^bin/}) { |f| File.basename(f) } spec.test_files = Dir.glob("spec/**/*") spec.require_paths = ["lib"] spec.add_development_dependency "bundler", "~> 1.6" spec.add_development_dependency "rake" spec.add_development_dependency "rspec" spec.add_development_dependency(%q<rails>, [">= 3.2"]) end Added Rails as a runtime dependency # coding: utf-8 lib = File.expand_path('../lib', __FILE__) $LOAD_PATH.unshift(lib) unless $LOAD_PATH.include?(lib) require 'configurator/version' Gem::Specification.new do |spec| spec.name = %q{configurator} spec.version = Configurator::VERSION spec.license = "MIT" spec.authors = ["Will Bryant"] spec.description = %q{Basic configuration loading} spec.email = ["william@tout.com"] spec.summary = %q{Basic configuration loading} spec.homepage = %q{http://github.com/will3216/configurator} spec.files = Dir.glob("lib/**/*") + [ "LICENSE.txt", "README.md", "Rakefile", "Gemfile", "configurator.gemspec", ] spec.executables = spec.files.grep(%r{^bin/}) { |f| File.basename(f) } spec.test_files = Dir.glob("spec/**/*") spec.require_paths = ["lib"] spec.add_development_dependency "bundler", "~> 1.6" spec.add_development_dependency "rake" spec.add_development_dependency "rspec" spec.add_runtime_dependency(%q<rails>, [">= 3.2"]) end
require 'rest_client' require 'chef/cookbook_loader' require 'chef/cache/checksum' require 'chef/sandbox' require 'chef/cookbook_version' require 'chef/cookbook/syntax_check' require 'chef/cookbook/file_system_file_vendor' class Chef class CookbookUploader class << self def upload_cookbook(cookbook) Chef::Log.info("Saving #{cookbook.name}") rest = Chef::REST.new(Chef::Config[:chef_server_url]) # Syntax Check validate_cookbook(cookbook) # Generate metadata.json from metadata.rb build_metadata(cookbook) # generate checksums of cookbook files and create a sandbox checksum_files = cookbook.checksums checksums = checksum_files.inject({}){|memo,elt| memo[elt.first]=nil ; memo} new_sandbox = rest.post_rest("/sandboxes", { :checksums => checksums }) Chef::Log.info("Uploading files") # upload the new checksums and commit the sandbox new_sandbox['checksums'].each do |checksum, info| if info['needs_upload'] == true Chef::Log.info("Uploading #{checksum_files[checksum]} (checksum hex = #{checksum}) to #{info['url']}") # Checksum is the hexadecimal representation of the md5, # but we need the base64 encoding for the content-md5 # header checksum64 = Base64.encode64([checksum].pack("H*")).strip timestamp = Time.now.utc.iso8601 file_contents = File.read(checksum_files[checksum]) # TODO - 5/28/2010, cw: make signing and sending the request streaming sign_obj = Mixlib::Authentication::SignedHeaderAuth.signing_object( :http_method => :put, :path => URI.parse(info['url']).path, :body => file_contents, :timestamp => timestamp, :user_id => rest.client_name ) headers = { 'content-type' => 'application/x-binary', 'content-md5' => checksum64, :accept => 'application/json' } headers.merge!(sign_obj.sign(OpenSSL::PKey::RSA.new(rest.signing_key))) begin RestClient::Request.execute(:method => :put, :url => info['url'], :headers => headers, :payload => file_contents) rescue RestClient::RequestFailed => e Chef::Log.error("Upload failed: #{e.message}\n#{e.response.body}") raise end else Chef::Log.debug("#{checksum_files[checksum]} has not changed") end end sandbox_url = new_sandbox['uri'] Chef::Log.debug("Committing sandbox") # Retry if S3 is claims a checksum doesn't exist (the eventual # in eventual consistency) retries = 0 begin rest.put_rest(sandbox_url, {:is_completed => true}) rescue Net::HTTPServerException => e if e.message =~ /^400/ && (retries += 1) <= 5 sleep 2 retry else raise end end # files are uploaded, so save the manifest cookbook.save Chef::Log.info("Upload complete!") end def build_metadata(cookbook) Chef::Log.debug("Generating metadata") kcm = Chef::Knife::CookbookMetadata.new kcm.config[:cookbook_path] = Chef::Config[:cookbook_path] kcm.name_args = [ cookbook.name.to_s ] kcm.run end def validate_cookbook(cookbook) syntax_checker = Chef::Cookbook::SyntaxCheck.for_cookbook(cookbook.name, @user_cookbook_path) Chef::Log.info("Validating ruby files") exit(1) unless syntax_checker.validate_ruby_files Chef::Log.info("Validating templates") exit(1) unless syntax_checker.validate_templates Chef::Log.info("Syntax OK") true end end end end Prevent double '/' in HTTP call to sandboxes require 'rest_client' require 'chef/cookbook_loader' require 'chef/cache/checksum' require 'chef/sandbox' require 'chef/cookbook_version' require 'chef/cookbook/syntax_check' require 'chef/cookbook/file_system_file_vendor' class Chef class CookbookUploader class << self def upload_cookbook(cookbook) Chef::Log.info("Saving #{cookbook.name}") rest = Chef::REST.new(Chef::Config[:chef_server_url]) # Syntax Check validate_cookbook(cookbook) # Generate metadata.json from metadata.rb build_metadata(cookbook) # generate checksums of cookbook files and create a sandbox checksum_files = cookbook.checksums checksums = checksum_files.inject({}){|memo,elt| memo[elt.first]=nil ; memo} new_sandbox = rest.post_rest("sandboxes", { :checksums => checksums }) Chef::Log.info("Uploading files") # upload the new checksums and commit the sandbox new_sandbox['checksums'].each do |checksum, info| if info['needs_upload'] == true Chef::Log.info("Uploading #{checksum_files[checksum]} (checksum hex = #{checksum}) to #{info['url']}") # Checksum is the hexadecimal representation of the md5, # but we need the base64 encoding for the content-md5 # header checksum64 = Base64.encode64([checksum].pack("H*")).strip timestamp = Time.now.utc.iso8601 file_contents = File.read(checksum_files[checksum]) # TODO - 5/28/2010, cw: make signing and sending the request streaming sign_obj = Mixlib::Authentication::SignedHeaderAuth.signing_object( :http_method => :put, :path => URI.parse(info['url']).path, :body => file_contents, :timestamp => timestamp, :user_id => rest.client_name ) headers = { 'content-type' => 'application/x-binary', 'content-md5' => checksum64, :accept => 'application/json' } headers.merge!(sign_obj.sign(OpenSSL::PKey::RSA.new(rest.signing_key))) begin RestClient::Request.execute(:method => :put, :url => info['url'], :headers => headers, :payload => file_contents) rescue RestClient::RequestFailed => e Chef::Log.error("Upload failed: #{e.message}\n#{e.response.body}") raise end else Chef::Log.debug("#{checksum_files[checksum]} has not changed") end end sandbox_url = new_sandbox['uri'] Chef::Log.debug("Committing sandbox") # Retry if S3 is claims a checksum doesn't exist (the eventual # in eventual consistency) retries = 0 begin rest.put_rest(sandbox_url, {:is_completed => true}) rescue Net::HTTPServerException => e if e.message =~ /^400/ && (retries += 1) <= 5 sleep 2 retry else raise end end # files are uploaded, so save the manifest cookbook.save Chef::Log.info("Upload complete!") end def build_metadata(cookbook) Chef::Log.debug("Generating metadata") kcm = Chef::Knife::CookbookMetadata.new kcm.config[:cookbook_path] = Chef::Config[:cookbook_path] kcm.name_args = [ cookbook.name.to_s ] kcm.run end def validate_cookbook(cookbook) syntax_checker = Chef::Cookbook::SyntaxCheck.for_cookbook(cookbook.name, @user_cookbook_path) Chef::Log.info("Validating ruby files") exit(1) unless syntax_checker.validate_ruby_files Chef::Log.info("Validating templates") exit(1) unless syntax_checker.validate_templates Chef::Log.info("Syntax OK") true end end end end
# # Author:: Adam Jacob (<adam@opscode.com>) # Copyright:: Copyright (c) 2008, 2009 Opscode, Inc. # License:: Apache License, Version 2.0 # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # require 'rubygems' require 'json' require 'chef' require 'chef/role' require 'chef/cookbook/metadata' require 'tempfile' require 'rake' desc "Update your repository from source control" task :update do puts "** Updating your repository" case $vcs when :svn sh %{svn up} when :git pull = false pull = true if File.join(TOPDIR, ".git", "remotes", "origin") IO.foreach(File.join(TOPDIR, ".git", "config")) do |line| pull = true if line =~ /\[remote "origin"\]/ end if pull sh %{git pull} else puts "* Skipping git pull, no origin specified" end else puts "* No SCM configured, skipping update" end end desc "Test your cookbooks for syntax errors" task :test_recipes do puts "** Testing your cookbooks for syntax errors" if File.exists?(TEST_CACHE) cache = JSON.load(open(TEST_CACHE).read) trap("INT") { puts "INT received, flushing test cache"; write_cache(cache) } else cache = {} end recipes = ["*cookbooks"].map { |folder| Dir[File.join(TOPDIR, folder, "**", "*.rb")] }.flatten recipes.each do |recipe| print "Testing recipe #{recipe}: " recipe_mtime = File.stat(recipe).mtime.to_s if cache.has_key?(recipe) if cache[recipe]["mtime"] == recipe_mtime puts "No modification since last test." next end else cache[recipe] = {} end sh %{ruby -c #{recipe}} do |ok, res| if ok cache[recipe]["mtime"] = recipe_mtime else write_cache(cache) raise "Syntax error in #{recipe}" end end end write_cache(cache) end desc "Test your templates for syntax errors" task :test_templates do puts "** Testing your cookbooks for syntax errors" if File.exists?(TEST_CACHE) cache = JSON.load(open(TEST_CACHE).read) trap("INT") { puts "INT received, flushing test cache"; write_cache(cache) } else cache = {} end templates = ["*cookbooks"].map { |folder| Dir[File.join(TOPDIR, folder, "**", "*.erb")] }.flatten templates.each do |template| print "Testing template #{template}: " template_mtime = File.stat(template).mtime.to_s if cache.has_key?(template) if cache[template]["mtime"] == template_mtime puts "No change since last test." next end else cache[template] = {} end sh %{erubis -x #{template} | ruby -c} do |ok, res| if ok cache[template]["mtime"] = template_mtime else write_cache(cache) raise "Syntax error in #{template}" end end end write_cache(cache) end desc "Test your cookbooks for syntax errors" task :test => [ :test_recipes , :test_templates ] def write_cache(cache) File.open(TEST_CACHE, "w") { |f| JSON.dump(cache, f) } end desc "Install the latest copy of the repository on this Chef Server" task :install => [ :update, :test, :metadata, :roles ] do puts "** Installing your cookbooks" directories = [ COOKBOOK_PATH, SITE_COOKBOOK_PATH, CHEF_CONFIG_PATH ] puts "* Creating Directories" directories.each do |dir| sh "sudo mkdir -p #{dir}" sh "sudo chown root #{dir}" end puts "* Installing new Cookbooks" sh "sudo rsync -rlP --delete --exclude '.svn' --exclude '.git*' cookbooks/ #{COOKBOOK_PATH}" puts "* Installing new Site Cookbooks" sh "sudo rsync -rlP --delete --exclude '.svn' --exclude '.git*' site-cookbooks/ #{SITE_COOKBOOK_PATH}" puts "* Installing new Node Roles" sh "sudo rsync -rlP --delete --exclude '.svn' --exclude '.git*' roles/ #{ROLE_PATH}" if File.exists?(File.join(File.dirname(__FILE__), "config", "server.rb")) puts "* Installing new Chef Server Config" sh "sudo cp config/server.rb #{CHEF_SERVER_CONFIG}" end if File.exists?(File.join(File.dirname(__FILE__), "config", "client.rb")) puts "* Installing new Chef Client Config" sh "sudo cp config/client.rb #{CHEF_CLIENT_CONFIG}" end end desc "By default, run rake test" task :default => [ :test ] desc "Create a new cookbook (with COOKBOOK=name, optional CB_PREFIX=site-)" task :new_cookbook do create_cookbook(File.join(TOPDIR, "#{ENV["CB_PREFIX"]}cookbooks")) create_readme(File.join(TOPDIR, "#{ENV["CB_PREFIX"]}cookbooks")) create_metadata(File.join(TOPDIR, "#{ENV["CB_PREFIX"]}cookbooks")) end def create_cookbook(dir) raise "Must provide a COOKBOOK=" unless ENV["COOKBOOK"] puts "** Creating cookbook #{ENV["COOKBOOK"]}" sh "mkdir -p #{File.join(dir, ENV["COOKBOOK"], "attributes")}" sh "mkdir -p #{File.join(dir, ENV["COOKBOOK"], "recipes")}" sh "mkdir -p #{File.join(dir, ENV["COOKBOOK"], "definitions")}" sh "mkdir -p #{File.join(dir, ENV["COOKBOOK"], "libraries")}" sh "mkdir -p #{File.join(dir, ENV["COOKBOOK"], "files", "default")}" sh "mkdir -p #{File.join(dir, ENV["COOKBOOK"], "templates", "default")}" unless File.exists?(File.join(dir, ENV["COOKBOOK"], "recipes", "default.rb")) open(File.join(dir, ENV["COOKBOOK"], "recipes", "default.rb"), "w") do |file| file.puts <<-EOH # # Cookbook Name:: #{ENV["COOKBOOK"]} # Recipe:: default # # Copyright #{Time.now.year}, #{COMPANY_NAME} # EOH case NEW_COOKBOOK_LICENSE when :apachev2 file.puts <<-EOH # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # EOH when :none file.puts <<-EOH # All rights reserved - Do Not Redistribute # EOH end end end end def create_readme(dir) raise "Must provide a COOKBOOK=" unless ENV["COOKBOOK"] puts "** Creating README for cookbook: #{ENV["COOKBOOK"]}" unless File.exists?(File.join(dir, ENV["COOKBOOK"], "README.rdoc")) open(File.join(dir, ENV["COOKBOOK"], "README.rdoc"), "w") do |file| file.puts <<-EOH = DESCRIPTION: = REQUIREMENTS: = ATTRIBUTES: = USAGE: EOH end end end def create_metadata(dir) raise "Must provide a COOKBOOK=" unless ENV["COOKBOOK"] puts "** Creating metadata for cookbook: #{ENV["COOKBOOK"]}" case NEW_COOKBOOK_LICENSE when :apachev2 license = "Apache 2.0" when :none license = "All rights reserved" end unless File.exists?(File.join(dir, ENV["COOKBOOK"], "metadata.rb")) open(File.join(dir, ENV["COOKBOOK"], "metadata.rb"), "w") do |file| if File.exists?(File.join(dir, ENV["COOKBOOK"], 'README.rdoc')) long_description = "long_description IO.read(File.join(File.dirname(__FILE__), 'README.rdoc'))" end file.puts <<-EOH maintainer "#{COMPANY_NAME}" maintainer_email "#{SSL_EMAIL_ADDRESS}" license "#{license}" description "Installs/Configures #{ENV["COOKBOOK"]}" #{long_description} version "0.1" EOH end end end desc "Create a new self-signed SSL certificate for FQDN=foo.example.com" task :ssl_cert do $expect_verbose = true fqdn = ENV["FQDN"] fqdn =~ /^(.+?)\.(.+)$/ hostname = $1 domain = $2 raise "Must provide FQDN!" unless fqdn && hostname && domain puts "** Creating self signed SSL Certificate for #{fqdn}" sh("(cd #{CADIR} && openssl genrsa 2048 > #{fqdn}.key)") sh("(cd #{CADIR} && chmod 644 #{fqdn}.key)") puts "* Generating Self Signed Certificate Request" tf = Tempfile.new("#{fqdn}.ssl-conf") ssl_config = <<EOH [ req ] distinguished_name = req_distinguished_name prompt = no [ req_distinguished_name ] C = #{SSL_COUNTRY_NAME} ST = #{SSL_STATE_NAME} L = #{SSL_LOCALITY_NAME} O = #{COMPANY_NAME} OU = #{SSL_ORGANIZATIONAL_UNIT_NAME} CN = #{fqdn} emailAddress = #{SSL_EMAIL_ADDRESS} EOH tf.puts(ssl_config) tf.close sh("(cd #{CADIR} && openssl req -config '#{tf.path}' -new -x509 -nodes -sha1 -days 3650 -key #{fqdn}.key > #{fqdn}.crt)") sh("(cd #{CADIR} && openssl x509 -noout -fingerprint -text < #{fqdn}.crt > #{fqdn}.info)") sh("(cd #{CADIR} && cat #{fqdn}.crt #{fqdn}.key > #{fqdn}.pem)") sh("(cd #{CADIR} && chmod 644 #{fqdn}.pem)") end desc "Build cookbook metadata.json from metadata.rb" task :metadata do Chef::Config[:cookbook_path] = [ File.join(TOPDIR, 'cookbooks'), File.join(TOPDIR, 'site-cookbooks') ] cl = Chef::CookbookLoader.new cl.each do |cookbook| if ENV['COOKBOOK'] next unless cookbook.name.to_s == ENV['COOKBOOK'] end cook_meta = Chef::Cookbook::Metadata.new(cookbook) Chef::Config.cookbook_path.each do |cdir| metadata_rb_file = File.join(cdir, cookbook.name.to_s, 'metadata.rb') metadata_json_file = File.join(cdir, cookbook.name.to_s, 'metadata.json') if File.exists?(metadata_rb_file) puts "Generating metadata for #{cookbook.name}" cook_meta.from_file(metadata_rb_file) File.open(metadata_json_file, "w") do |f| f.write(JSON.pretty_generate(cook_meta)) end end end end end desc "Build roles from roles/role_name.json from role_name.rb" task :roles do Chef::Config[:role_path] = File.join(TOPDIR, 'roles') Dir[File.join(TOPDIR, 'roles', '**', '*.rb')].each do |role_file| short_name = File.basename(role_file, '.rb') puts "Generating role JSON for #{short_name}" role = Chef::Role.new role.name(short_name) role.from_file(role_file) File.open(File.join(TOPDIR, 'roles', "#{short_name}.json"), "w") do |f| f.write(JSON.pretty_generate(role)) end end end Adding upload cookbook tasks # # Author:: Adam Jacob (<adam@opscode.com>) # Copyright:: Copyright (c) 2008, 2009 Opscode, Inc. # License:: Apache License, Version 2.0 # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # require 'rubygems' require 'json' require 'chef' require 'chef/role' require 'chef/cookbook/metadata' require 'tempfile' require 'rake' desc "Update your repository from source control" task :update do puts "** Updating your repository" case $vcs when :svn sh %{svn up} when :git pull = false pull = true if File.join(TOPDIR, ".git", "remotes", "origin") IO.foreach(File.join(TOPDIR, ".git", "config")) do |line| pull = true if line =~ /\[remote "origin"\]/ end if pull sh %{git pull} else puts "* Skipping git pull, no origin specified" end else puts "* No SCM configured, skipping update" end end desc "Test your cookbooks for syntax errors" task :test_recipes do puts "** Testing your cookbooks for syntax errors" if File.exists?(TEST_CACHE) cache = JSON.load(open(TEST_CACHE).read) trap("INT") { puts "INT received, flushing test cache"; write_cache(cache) } else cache = {} end recipes = ["*cookbooks"].map { |folder| Dir[File.join(TOPDIR, folder, "**", "*.rb")] }.flatten recipes.each do |recipe| print "Testing recipe #{recipe}: " recipe_mtime = File.stat(recipe).mtime.to_s if cache.has_key?(recipe) if cache[recipe]["mtime"] == recipe_mtime puts "No modification since last test." next end else cache[recipe] = {} end sh %{ruby -c #{recipe}} do |ok, res| if ok cache[recipe]["mtime"] = recipe_mtime else write_cache(cache) raise "Syntax error in #{recipe}" end end end write_cache(cache) end desc "Test your templates for syntax errors" task :test_templates do puts "** Testing your cookbooks for syntax errors" if File.exists?(TEST_CACHE) cache = JSON.load(open(TEST_CACHE).read) trap("INT") { puts "INT received, flushing test cache"; write_cache(cache) } else cache = {} end templates = ["*cookbooks"].map { |folder| Dir[File.join(TOPDIR, folder, "**", "*.erb")] }.flatten templates.each do |template| print "Testing template #{template}: " template_mtime = File.stat(template).mtime.to_s if cache.has_key?(template) if cache[template]["mtime"] == template_mtime puts "No change since last test." next end else cache[template] = {} end sh %{erubis -x #{template} | ruby -c} do |ok, res| if ok cache[template]["mtime"] = template_mtime else write_cache(cache) raise "Syntax error in #{template}" end end end write_cache(cache) end desc "Test your cookbooks for syntax errors" task :test => [ :test_recipes , :test_templates ] def write_cache(cache) File.open(TEST_CACHE, "w") { |f| JSON.dump(cache, f) } end desc "Install the latest copy of the repository on this Chef Server" task :install => [ :update, :test, :metadata, :roles ] do puts "** Installing your cookbooks" directories = [ COOKBOOK_PATH, SITE_COOKBOOK_PATH, CHEF_CONFIG_PATH ] puts "* Creating Directories" directories.each do |dir| sh "sudo mkdir -p #{dir}" sh "sudo chown root #{dir}" end puts "* Installing new Cookbooks" sh "sudo rsync -rlP --delete --exclude '.svn' --exclude '.git*' cookbooks/ #{COOKBOOK_PATH}" puts "* Installing new Site Cookbooks" sh "sudo rsync -rlP --delete --exclude '.svn' --exclude '.git*' site-cookbooks/ #{SITE_COOKBOOK_PATH}" puts "* Installing new Node Roles" sh "sudo rsync -rlP --delete --exclude '.svn' --exclude '.git*' roles/ #{ROLE_PATH}" if File.exists?(File.join(File.dirname(__FILE__), "config", "server.rb")) puts "* Installing new Chef Server Config" sh "sudo cp config/server.rb #{CHEF_SERVER_CONFIG}" end if File.exists?(File.join(File.dirname(__FILE__), "config", "client.rb")) puts "* Installing new Chef Client Config" sh "sudo cp config/client.rb #{CHEF_CLIENT_CONFIG}" end end desc "By default, run rake test" task :default => [ :test ] desc "Create a new cookbook (with COOKBOOK=name, optional CB_PREFIX=site-)" task :new_cookbook do create_cookbook(File.join(TOPDIR, "#{ENV["CB_PREFIX"]}cookbooks")) create_readme(File.join(TOPDIR, "#{ENV["CB_PREFIX"]}cookbooks")) create_metadata(File.join(TOPDIR, "#{ENV["CB_PREFIX"]}cookbooks")) end def create_cookbook(dir) raise "Must provide a COOKBOOK=" unless ENV["COOKBOOK"] puts "** Creating cookbook #{ENV["COOKBOOK"]}" sh "mkdir -p #{File.join(dir, ENV["COOKBOOK"], "attributes")}" sh "mkdir -p #{File.join(dir, ENV["COOKBOOK"], "recipes")}" sh "mkdir -p #{File.join(dir, ENV["COOKBOOK"], "definitions")}" sh "mkdir -p #{File.join(dir, ENV["COOKBOOK"], "libraries")}" sh "mkdir -p #{File.join(dir, ENV["COOKBOOK"], "files", "default")}" sh "mkdir -p #{File.join(dir, ENV["COOKBOOK"], "templates", "default")}" unless File.exists?(File.join(dir, ENV["COOKBOOK"], "recipes", "default.rb")) open(File.join(dir, ENV["COOKBOOK"], "recipes", "default.rb"), "w") do |file| file.puts <<-EOH # # Cookbook Name:: #{ENV["COOKBOOK"]} # Recipe:: default # # Copyright #{Time.now.year}, #{COMPANY_NAME} # EOH case NEW_COOKBOOK_LICENSE when :apachev2 file.puts <<-EOH # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # EOH when :none file.puts <<-EOH # All rights reserved - Do Not Redistribute # EOH end end end end def create_readme(dir) raise "Must provide a COOKBOOK=" unless ENV["COOKBOOK"] puts "** Creating README for cookbook: #{ENV["COOKBOOK"]}" unless File.exists?(File.join(dir, ENV["COOKBOOK"], "README.rdoc")) open(File.join(dir, ENV["COOKBOOK"], "README.rdoc"), "w") do |file| file.puts <<-EOH = DESCRIPTION: = REQUIREMENTS: = ATTRIBUTES: = USAGE: EOH end end end def create_metadata(dir) raise "Must provide a COOKBOOK=" unless ENV["COOKBOOK"] puts "** Creating metadata for cookbook: #{ENV["COOKBOOK"]}" case NEW_COOKBOOK_LICENSE when :apachev2 license = "Apache 2.0" when :none license = "All rights reserved" end unless File.exists?(File.join(dir, ENV["COOKBOOK"], "metadata.rb")) open(File.join(dir, ENV["COOKBOOK"], "metadata.rb"), "w") do |file| if File.exists?(File.join(dir, ENV["COOKBOOK"], 'README.rdoc')) long_description = "long_description IO.read(File.join(File.dirname(__FILE__), 'README.rdoc'))" end file.puts <<-EOH maintainer "#{COMPANY_NAME}" maintainer_email "#{SSL_EMAIL_ADDRESS}" license "#{license}" description "Installs/Configures #{ENV["COOKBOOK"]}" #{long_description} version "0.1" EOH end end end desc "Create a new self-signed SSL certificate for FQDN=foo.example.com" task :ssl_cert do $expect_verbose = true fqdn = ENV["FQDN"] fqdn =~ /^(.+?)\.(.+)$/ hostname = $1 domain = $2 raise "Must provide FQDN!" unless fqdn && hostname && domain puts "** Creating self signed SSL Certificate for #{fqdn}" sh("(cd #{CADIR} && openssl genrsa 2048 > #{fqdn}.key)") sh("(cd #{CADIR} && chmod 644 #{fqdn}.key)") puts "* Generating Self Signed Certificate Request" tf = Tempfile.new("#{fqdn}.ssl-conf") ssl_config = <<EOH [ req ] distinguished_name = req_distinguished_name prompt = no [ req_distinguished_name ] C = #{SSL_COUNTRY_NAME} ST = #{SSL_STATE_NAME} L = #{SSL_LOCALITY_NAME} O = #{COMPANY_NAME} OU = #{SSL_ORGANIZATIONAL_UNIT_NAME} CN = #{fqdn} emailAddress = #{SSL_EMAIL_ADDRESS} EOH tf.puts(ssl_config) tf.close sh("(cd #{CADIR} && openssl req -config '#{tf.path}' -new -x509 -nodes -sha1 -days 3650 -key #{fqdn}.key > #{fqdn}.crt)") sh("(cd #{CADIR} && openssl x509 -noout -fingerprint -text < #{fqdn}.crt > #{fqdn}.info)") sh("(cd #{CADIR} && cat #{fqdn}.crt #{fqdn}.key > #{fqdn}.pem)") sh("(cd #{CADIR} && chmod 644 #{fqdn}.pem)") end desc "Build cookbook metadata.json from metadata.rb" task :metadata do Chef::Config[:cookbook_path] = [ File.join(TOPDIR, 'cookbooks'), File.join(TOPDIR, 'site-cookbooks') ] cl = Chef::CookbookLoader.new cl.each do |cookbook| if ENV['COOKBOOK'] next unless cookbook.name.to_s == ENV['COOKBOOK'] end cook_meta = Chef::Cookbook::Metadata.new(cookbook) Chef::Config.cookbook_path.each do |cdir| metadata_rb_file = File.join(cdir, cookbook.name.to_s, 'metadata.rb') metadata_json_file = File.join(cdir, cookbook.name.to_s, 'metadata.json') if File.exists?(metadata_rb_file) puts "Generating metadata for #{cookbook.name}" cook_meta.from_file(metadata_rb_file) File.open(metadata_json_file, "w") do |f| f.write(JSON.pretty_generate(cook_meta)) end end end end end desc "Build roles from roles/role_name.json from role_name.rb" task :roles do Chef::Config[:role_path] = File.join(TOPDIR, 'roles') Dir[File.join(TOPDIR, 'roles', '**', '*.rb')].each do |role_file| short_name = File.basename(role_file, '.rb') puts "Generating role JSON for #{short_name}" role = Chef::Role.new role.name(short_name) role.from_file(role_file) File.open(File.join(TOPDIR, 'roles', "#{short_name}.json"), "w") do |f| f.write(JSON.pretty_generate(role)) end end end desc "Upload all cookbooks" task :upload_cookbooks => [ :metadata ] task :upload_cookbooks do Chef::Config[:cookbook_path] = [ File.join(TOPDIR, 'cookbooks'), File.join(TOPDIR, 'site-cookbooks') ] cl = Chef::CookbookLoader.new cl.each do |cookbook| cook_meta = Chef::Cookbook::Metadata.new(cookbook) upload_single_cookbook(cookbook.name.to_s, cook_meta.version) puts "* Uploaded #{cookbook.name.to_s}" end end desc "Upload a single cookbook" task :upload_cookbook => [ :metadata ] task :upload_cookbook, :cookbook do |t, args| upload_single_cookbook(args.cookbook) puts "* Uploaded #{args.cookbook}" end def upload_single_cookbook(cookbook_name, version=nil) require 'chef/streaming_cookbook_uploader' Chef::Log.level(:error) Mixlib::Authentication::Log.logger = Chef::Log.logger raise ArgumentError, "OPSCODE_KEY must be set to your API Key" unless ENV.has_key?("OPSCODE_KEY") raise ArgumentError, "OPSCODE_USER must be set to your Username" unless ENV.has_key?("OPSCODE_USER") Chef::Config.from_file("/etc/chef/client.rb") tarball_name = "#{cookbook_name}.tar.gz" temp_dir = File.join(Dir.tmpdir, "chef-upload-cookbooks") temp_cookbook_dir = File.join(temp_dir, cookbook_name) FileUtils.mkdir(temp_dir) FileUtils.mkdir(temp_cookbook_dir) child_folders = [ "cookbooks/#{cookbook_name}", "site-cookbooks/#{cookbook_name}" ] child_folders.each do |folder| file_path = File.join(TOPDIR, folder, ".") FileUtils.cp_r(file_path, temp_cookbook_dir) if File.directory?(file_path) end system("tar", "-C", temp_dir, "-czf", File.join(temp_dir, tarball_name), "./#{cookbook_name}") r = Chef::REST.new(Chef::Config[:chef_server_url], ENV['OPSCODE_USER'], ENV['OPSCODE_KEY']) begin cb = r.get_rest("cookbooks/#{cookbook_name}") cookbook_uploaded = true rescue Net::HTTPServerException cookbook_uploaded = false end puts "* Uploading #{cookbook_name} (#{cookbook_uploaded ? 'new version' : 'first time'})" if cookbook_uploaded Chef::StreamingCookbookUploader.put("#{Chef::Config[:chef_server_url]}/cookbooks/#{cookbook_name}/_content", ENV["OPSCODE_USER"], ENV["OPSCODE_KEY"], {:file => File.new(File.join(temp_dir, tarball_name)), :name => cookbook_name}) else Chef::StreamingCookbookUploader.post("#{Chef::Config[:chef_server_url]}/cookbooks", ENV["OPSCODE_USER"], ENV["OPSCODE_KEY"], {:file => File.new(File.join(temp_dir, tarball_name)), :name => cookbook_name}) end #delete temp files (e.g. /tmp/cookbooks and /tmp/cookbooks.tgz) FileUtils.rm_rf temp_dir end
# -*- encoding: utf-8 -*- lib = File.expand_path('../lib', __FILE__) $LOAD_PATH.unshift(lib) unless $LOAD_PATH.include?(lib) require 'has_publishing/version' Gem::Specification.new do |gem| gem.name = "has_publishing" gem.version = HasPublishing::VERSION gem.authors = ["Josh McArthur @ 3months"] gem.email = ["joshua.mcarthur@gmail.com"] gem.description = %q{Add ability to publish/embargo models} gem.summary = %q{Add publishing to your ActiveRecord models} gem.homepage = "https://github.com/3months/has_publishing" gem.files = `git ls-files`.split($/) gem.executables = gem.files.grep(%r{^bin/}).map{ |f| File.basename(f) } gem.test_files = gem.files.grep(%r{^(test|spec|features)/}) gem.require_paths = ["lib"] gem.add_dependency "activerecord" gem.add_dependency "activesupport" gem.add_development_dependency "debugger" gem.add_development_dependency "rspec-rails" gem.add_development_dependency "sqlite3" end Improve gem description # -*- encoding: utf-8 -*- lib = File.expand_path('../lib', __FILE__) $LOAD_PATH.unshift(lib) unless $LOAD_PATH.include?(lib) require 'has_publishing/version' Gem::Specification.new do |gem| gem.name = "has_publishing" gem.version = HasPublishing::VERSION gem.authors = ["Josh McArthur @ 3months"] gem.email = ["joshua.mcarthur@gmail.com"] gem.description = %q{Add ability to draft/publish/withdraw/embargo models} gem.summary = %q{Add publishing to your ActiveRecord models} gem.homepage = "https://github.com/3months/has_publishing" gem.files = `git ls-files`.split($/) gem.executables = gem.files.grep(%r{^bin/}).map{ |f| File.basename(f) } gem.test_files = gem.files.grep(%r{^(test|spec|features)/}) gem.require_paths = ["lib"] gem.add_dependency "activerecord" gem.add_dependency "activesupport" gem.add_development_dependency "debugger" gem.add_development_dependency "rspec-rails" gem.add_development_dependency "sqlite3" end
# -*- encoding: utf-8 -*- Gem::Specification.new do |s| s.name = %q{has_timestamps} s.version = "1.5.2" s.required_rubygems_version = Gem::Requirement.new(">= 0") if s.respond_to? :required_rubygems_version= s.authors = ["Seamus Abshere"] s.date = %q{2009-05-14} s.description = %q{has_timestamps is a Rails plugin that allows you to add named timestamps to ActiveRecord models without adding database columns.} s.email = %q{seamus@abshere.net} s.extra_rdoc_files = [ "README" ] s.files = [ "VERSION.yml", "examples/timestamp.rb", "init.rb", "lib/has_timestamps.rb", "rails/init.rb", "test/has_timestamps_test.rb", "test/test_helper.rb" ] s.homepage = %q{http://github.com/seamusabshere/has_timestamps} s.rdoc_options = ["--charset=UTF-8"] s.require_paths = ["lib"] s.rubygems_version = %q{1.3.3} s.summary = %q{Rails plugin to add named timestamps to ActiveRecord models.} s.test_files = [ "test/has_timestamps_test.rb" ] if s.respond_to? :specification_version then current_version = Gem::Specification::CURRENT_SPECIFICATION_VERSION s.specification_version = 3 if Gem::Version.new(Gem::RubyGemsVersion) >= Gem::Version.new('1.2.0') then else end else end end Regenerated gemspec for version 1.5.3 # -*- encoding: utf-8 -*- Gem::Specification.new do |s| s.name = %q{has_timestamps} s.version = "1.5.3" s.required_rubygems_version = Gem::Requirement.new(">= 0") if s.respond_to? :required_rubygems_version= s.authors = ["Seamus Abshere"] s.date = %q{2009-05-15} s.description = %q{has_timestamps is a Rails plugin that allows you to add named timestamps to ActiveRecord models without adding database columns.} s.email = %q{seamus@abshere.net} s.extra_rdoc_files = [ "README" ] s.files = [ "VERSION.yml", "examples/timestamp.rb", "init.rb", "lib/has_timestamps.rb", "rails/init.rb", "test/has_timestamps_test.rb", "test/test_helper.rb" ] s.homepage = %q{http://github.com/seamusabshere/has_timestamps} s.rdoc_options = ["--charset=UTF-8"] s.require_paths = ["lib"] s.rubygems_version = %q{1.3.3} s.summary = %q{Rails plugin to add named timestamps to ActiveRecord models.} s.test_files = [ "test/has_timestamps_test.rb" ] if s.respond_to? :specification_version then current_version = Gem::Specification::CURRENT_SPECIFICATION_VERSION s.specification_version = 3 if Gem::Version.new(Gem::RubyGemsVersion) >= Gem::Version.new('1.2.0') then else end else end end
require 'grape' module Api class TutorialEnrolmentsApi < Grape::API helpers AuthenticationHelpers helpers AuthorisationHelpers before do authenticated? end desc 'Enrol project in a tutorial' post '/units/:unit_id/tutorials/:tutorial_abbr/enrolments/:project_id' do unit = Unit.find(params[:unit_id]) unless authorise? current_user, unit, :change_tutorial error!({ error: 'Not authorised to change tutorial' }, 403) end tutorial = unit.tutorials.find_by(abbreviation: params[:tutorial_abbr]) error!({ error: "No tutorial with abbreviation #{params[:tutorial_abbr]} exists for the unit" }, 403) unless tutorial.present? project = Project.find(params[:project_id]) result = project.enrol_in(tutorial) if result.nil? error!({ error: 'No enrolment added' }, 403) else result end { enrolments: ActiveModel::ArraySerializer.new(project.tutorial_enrolments, each_serializer: TutorialEnrolmentSerializer) } end desc 'Delete an enrolment in the tutorial' delete '/units/:unit_id/tutorials/:tutorial_abbr/enrolments/:project_id' do unit = Unit.find(params[:unit_id]) unless authorise? current_user, unit, :change_tutorial error!({ error: 'Not authorised to change tutorials' }, 403) end tutorial = unit.tutorials.find_by(abbreviation: params[:tutorial_abbr]) error!({ error: "No tutorial with abbreviation #{params[:tutorial_abbr]} exists for the unit" }, 403) unless tutorial.present? tutorial_enrolment = tutorial.tutorial_enrolments.find_by(project_id: params[:project_id]) error!({ error: "Project not enrolled in the selected tutorial" }, 403) unless tutorial_enrolment.present? tutorial_enrolment.destroy { enrolments: ActiveModel::ArraySerializer.new(Project.find(params[:project_id]).tutorial_enrolments, each_serializer: TutorialEnrolmentSerializer) } end end end FIX: Ensure tutorial change check uses project require 'grape' module Api class TutorialEnrolmentsApi < Grape::API helpers AuthenticationHelpers helpers AuthorisationHelpers before do authenticated? end desc 'Enrol project in a tutorial' post '/units/:unit_id/tutorials/:tutorial_abbr/enrolments/:project_id' do unit = Unit.find(params[:unit_id]) project = unit.active_projects.find(params[:project_id]) unless authorise? current_user, project, :change_tutorial error!({ error: 'Not authorised to change tutorial' }, 403) end tutorial = unit.tutorials.find_by(abbreviation: params[:tutorial_abbr]) error!({ error: "No tutorial with abbreviation #{params[:tutorial_abbr]} exists for the unit" }, 403) unless tutorial.present? result = project.enrol_in(tutorial) if result.nil? error!({ error: 'No enrolment added' }, 403) else result end { enrolments: ActiveModel::ArraySerializer.new(project.tutorial_enrolments, each_serializer: TutorialEnrolmentSerializer) } end desc 'Delete an enrolment in the tutorial' delete '/units/:unit_id/tutorials/:tutorial_abbr/enrolments/:project_id' do unit = Unit.find(params[:unit_id]) project = unit.active_projects.find(params[:project_id]) unless authorise? current_user, project, :change_tutorial error!({ error: 'Not authorised to change tutorials' }, 403) end tutorial = unit.tutorials.find_by(abbreviation: params[:tutorial_abbr]) error!({ error: "No tutorial with abbreviation #{params[:tutorial_abbr]} exists for the unit" }, 403) unless tutorial.present? tutorial_enrolment = tutorial.tutorial_enrolments.find_by(project_id: params[:project_id]) error!({ error: "Project not enrolled in the selected tutorial" }, 403) unless tutorial_enrolment.present? tutorial_enrolment.destroy { enrolments: ActiveModel::ArraySerializer.new(Project.find(params[:project_id]).tutorial_enrolments, each_serializer: TutorialEnrolmentSerializer) } end end end
#!/usr/bin/ruby $outfile = { :config => open('output/include.config.hpp', 'w'), :config_SYSCTL => open('output/include.config_SYSCTL.cpp', 'w'), :config_register => open('output/include.config_register.cpp', 'w'), :config_unregister => open('output/include.config_unregister.cpp', 'w'), :config_default => open('output/include.config.default.hpp', 'w'), :remapcode_keyboardtype => open('output/include.remapcode_keyboardtype.hpp', 'w'), :remapcode_func => open('output/include.remapcode_func.cpp', 'w'), :remapcode_info => open('output/include.remapcode_info.cpp', 'w'), :remapcode_refresh_remapfunc_key => open('output/include.remapcode_refresh_remapfunc_key.cpp', 'w'), :remapcode_refresh_remapfunc_consumer => open('output/include.remapcode_refresh_remapfunc_consumer.cpp', 'w'), :remapcode_refresh_remapfunc_pointing => open('output/include.remapcode_refresh_remapfunc_pointing.cpp', 'w'), :remapcode_refresh_remapfunc_statusmessage => open('output/include.remapcode_refresh_remapfunc_statusmessage.cpp', 'w'), :remapcode_vk_config => open('output/include.remapcode_vk_config.cpp', 'w'), :keycode_vk_config => open('../keycode/data/include/KeyCode.VK_CONFIG.data', 'w'), } $func = { :key => [], :consumer => [], :pointing => [], } # ====================================================================== def getextrakey(key) case key when 'HOME' 'CURSOR_LEFT' when 'END' 'CURSOR_RIGHT' when 'PAGEUP' 'CURSOR_UP' when 'PAGEDOWN' 'CURSOR_DOWN' when 'FORWARD_DELETE' 'DELETE' else nil end end def preprocess(listAutogen) modify = false list = [] listAutogen.each do |autogen| if /VK_(COMMAND|CONTROL|SHIFT|OPTION)/ =~ autogen then key = $1 list << autogen.gsub(/VK_#{key}/, "ModifierFlag::#{key}_L") list << autogen.gsub(/VK_#{key}/, "ModifierFlag::#{key}_R") modify = true elsif /VK_MOD_CCOS_L/ =~ autogen then list << autogen.gsub(/VK_MOD_CCOS_L/, "ModifierFlag::COMMAND_L | ModifierFlag::CONTROL_L | ModifierFlag::OPTION_L | ModifierFlag::SHIFT_L") modify = true elsif /VK_MOD_CCS_L/ =~ autogen then list << autogen.gsub(/VK_MOD_CCS_L/, "ModifierFlag::COMMAND_L | ModifierFlag::CONTROL_L | ModifierFlag::SHIFT_L") modify = true elsif /VK_MOD_CCO_L/ =~ autogen then list << autogen.gsub(/VK_MOD_CCO_L/, "ModifierFlag::COMMAND_L | ModifierFlag::CONTROL_L | ModifierFlag::OPTION_L") modify = true elsif /FROMKEYCODE_(HOME|END|PAGEUP|PAGEDOWN|FORWARD_DELETE)\s*,\s*ModifierFlag::/ =~ autogen then key = $1 extrakey = getextrakey(key) list << autogen.gsub(/FROMKEYCODE_#{key}\s*,/, "KeyCode::#{key},") list << autogen.gsub(/FROMKEYCODE_#{key}\s*,/, "KeyCode::#{extrakey}, ModifierFlag::FN |") modify = true elsif /FROMKEYCODE_(HOME|END|PAGEUP|PAGEDOWN|FORWARD_DELETE)/ =~ autogen then key = $1 extrakey = getextrakey(key) list << autogen.gsub(/FROMKEYCODE_#{key}\s*,/, "KeyCode::#{key},") list << autogen.gsub(/FROMKEYCODE_#{key}\s*,/, "KeyCode::#{extrakey}, ModifierFlag::FN,") modify = true else list << autogen end end if modify then list = preprocess(list) end list end # ====================================================================== def parseautogen(name, lines, autogen_index) filter = [] code_key = [] code_consumer = [] code_pointing = [] code_variable = [] while true l = lines.shift break if l.nil? # -------------------------------------------------- next if /<\/?item>/ =~ l next if /<name>.+?<\/name>/ =~ l next if /<appendix>.+?<\/appendix>/ =~ l next if /<sysctl>.+?<\/sysctl>/ =~ l next if /<baseunit>.+?<\/baseunit>/ =~ l next if /<default>.+?<\/default>/ =~ l next if /<vk_config>.+?<\/vk_config>/ =~ l # -------------------------------------------------- if /<block>/ =~ l then block_code_key, block_code_consumer, block_code_pointing, block_code_variable, autogen_index = parseautogen(name, lines, autogen_index) code_key << block_code_key unless block_code_key.empty? code_consumer << block_code_consumer unless block_code_consumer.empty? code_pointing << block_code_pointing unless block_code_pointing.empty? code_variable += block_code_variable elsif /<\/block>/ =~ l then break # ================================================================================ elsif /<not>(.+?)<\/not>/ =~ l then $1.split(/,/).each do |f| filter << "if (remapParams.workspacedata.type == KeyRemap4MacBook_bridge::GetWorkspaceData::#{f.strip}) break;" end elsif /<only>(.+?)<\/only>/ =~ l then tmp = [] $1.split(/,/).each do |f| tmp << "(remapParams.workspacedata.type != KeyRemap4MacBook_bridge::GetWorkspaceData::#{f.strip})" end filter << "if (#{tmp.join(' && ')}) break;" elsif /<keyboardtype_not>(.+?)<\/keyboardtype_not>/ =~ l then $1.split(/,/).each do |f| filter << "if (remapParams.params.keyboardType == KeyboardType::#{f.strip}) break;" end elsif /<keyboardtype_only>(.+?)<\/keyboardtype_only>/ =~ l then tmp = [] $1.split(/,/).each do |f| tmp << "(remapParams.params.keyboardType != KeyboardType::#{f.strip})" end filter << "if (#{tmp.join(' && ')}) break;" elsif /<(inputmode|inputmodedetail)_not>(.+?)<\/(inputmode|inputmodedetail)_not>/ =~ l then inputmodetype = $1 $2.split(/,/).each do |f| filter << "if (remapParams.workspacedata.#{inputmodetype} == KeyRemap4MacBook_bridge::GetWorkspaceData::#{f.strip}) break;" end elsif /<(inputmode|inputmodedetail)_only>(.+?)<\/(inputmode|inputmodedetail)_only>/ =~ l then inputmodetype = $1 tmp = [] $2.split(/,/).each do |f| tmp << "(remapParams.workspacedata.#{inputmodetype} != KeyRemap4MacBook_bridge::GetWorkspaceData::#{f.strip})" end filter << "if (#{tmp.join(' && ')}) break;" # ================================================================================ elsif /<autogen>(.+?)<\/autogen>/ =~ l then autogen = $1 if /^--(.+?)-- (.+)$/ =~ autogen then type = $1 params = $2 autogen_index += 1 case type when 'SetKeyboardType' $outfile[:remapcode_keyboardtype] << "if (config.#{name}) {\n" $outfile[:remapcode_keyboardtype] << " keyboardType = #{params}.get();\n" $outfile[:remapcode_keyboardtype] << "}\n" when 'ShowStatusMessage' $outfile[:remapcode_refresh_remapfunc_statusmessage] << "if (config.#{name}) {\n" $outfile[:remapcode_refresh_remapfunc_statusmessage] << " statusmessage = #{params};\n" $outfile[:remapcode_refresh_remapfunc_statusmessage] << " isStatusMessageVisible = true;\n" $outfile[:remapcode_refresh_remapfunc_statusmessage] << "}\n" when 'KeyToKey' code_variable << ['RemapUtil::KeyToKey', "keytokey#{autogen_index}_"] code_key << "if (keytokey#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:key] << name when 'DoublePressModifier' code_variable << ['DoublePressModifier', "doublepressmodifier#{autogen_index}_"] code_key << "if (doublepressmodifier#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:key] << name when 'IgnoreMultipleSameKeyPress' code_variable << ['IgnoreMultipleSameKeyPress', "ignoremultiplesamekeypress#{autogen_index}_"] code_key << "if (ignoremultiplesamekeypress#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:key] << name when 'KeyToConsumer' code_variable << ['RemapUtil::KeyToConsumer', "keytoconsumer#{autogen_index}_"] code_key << "if (keytoconsumer#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:key] << name when 'KeyToPointingButton' code_variable << ['RemapUtil::KeyToPointingButton', "keytopointing#{autogen_index}_"] code_key << "if (keytopointing#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:key] << name when 'KeyOverlaidModifier' code_variable << ['KeyOverlaidModifier', "keyoverlaidmodifier#{autogen_index}_"] code_key << "if (keyoverlaidmodifier#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:key] << name when 'KeyOverlaidModifierWithRepeat' code_variable << ['KeyOverlaidModifier', "keyoverlaidmodifier#{autogen_index}_"] code_key << "if (keyoverlaidmodifier#{autogen_index}_.remapWithRepeat(remapParams, #{params})) break;" $func[:key] << name when 'ModifierHoldingKeyToKey' code_variable << ['ModifierHoldingKeyToKey', "modifierholdingkeytokey#{autogen_index}_"] code_key << "if (modifierholdingkeytokey#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:key] << name when 'ConsumerToKey' code_variable << ['RemapUtil::ConsumerToKey', "consumertokey#{autogen_index}_"] code_consumer << "if (consumertokey#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:consumer] << name when 'ConsumerToConsumer' code_variable << ['RemapUtil::ConsumerToConsumer', "consumertoconsumer#{autogen_index}_"] code_consumer << "if (consumertoconsumer#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:consumer] << name when 'PointingRelativeToScroll' code_variable << ['RemapUtil::PointingRelativeToScroll', "pointingrelativetoscroll#{autogen_index}_"] code_pointing << "if (pointingrelativetoscroll#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:pointing] << name when 'PointingButtonToPointingButton' code_variable << ['RemapUtil::PointingButtonToPointingButton', "pointingbuttontopointingbutton#{autogen_index}_"] code_pointing << "if (pointingbuttontopointingbutton#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:pointing] << name else print "%%% ERROR #{type} %%%\n#{l}\n" exit 1 end end elsif /<.+?>.+?<\/.+?>/ =~ l then print "%%% ERROR unknown command %%%\n#{l}\n" exit 1 end end # ====================================================================== result_code_key = '' result_code_consumer = '' result_code_pointing = '' unless code_key.empty? then result_code_key += " do {\n" filter.each do |f| result_code_key += " #{f}\n" end result_code_key += "\n" unless filter.empty? code_key.each do |line| result_code_key += " #{line}\n" end result_code_key += " } while (false);\n" end unless code_consumer.empty? then result_code_consumer += " do {\n" filter.each do |f| result_code_consumer += " #{f}\n" end result_code_consumer += "\n" unless filter.empty? code_consumer.each do |line| result_code_consumer += " #{line}\n" end result_code_consumer += " } while (false);\n" end unless code_pointing.empty? then result_code_pointing += " do {\n" code_pointing.each do |line| result_code_pointing += " #{line}\n" end result_code_pointing += " } while (false);\n" end return result_code_key, result_code_consumer, result_code_pointing, code_variable, autogen_index end # ---------------------------------------------------------------------- $stdin.read.scan(/<item>.+?<\/item>/m).each do |item| if /.*(<item>.+?<\/item>)/m =~ item then item = $1 end name = nil if /<sysctl>([^\.]+?)\.(.+?)<\/sysctl>/m =~ item then name = "#{$1}_#{$2}" $outfile[:config_SYSCTL] << "SYSCTL_PROC(_keyremap4macbook_#{$1}, OID_AUTO, #{$2}, CTLTYPE_INT|CTLFLAG_RW, &(config.#{name}), 0, refresh_remapfunc_handler, \"I\", \"\");\n" $outfile[:config_register] << "sysctl_register_oid(&sysctl__keyremap4macbook_#{name});\n" $outfile[:config_unregister] << "sysctl_unregister_oid(&sysctl__keyremap4macbook_#{name});\n" end next if name.nil? $outfile[:config] << "int #{name};\n" if /<default>(.+?)<\/default>/m =~ item then $outfile[:config_default] << "#{name} = #{$1};\n" end # check <name> num == 1 if item.scan(/<name>(.+?)<\/name>/m).size != 1 then print "%%% ERROR multiple <name> for #{name}\n" exit 1 end # ====================================================================== lines = item.split(/\n/) lines = preprocess(lines) code_key, code_consumer, code_pointing, code_variable, autogen_index = parseautogen(name, lines, 0) unless lines.empty? then print "%%% ERROR no </block> at #{name} %%%\n" end next if code_key.empty? && code_consumer.empty? && code_pointing.empty? && code_variable.empty? $outfile[:remapcode_func] << "class RemapClass_#{name} {\n" $outfile[:remapcode_func] << "public:\n" unless code_key.empty? then $outfile[:remapcode_func] << "static void remap_key(RemapParams &remapParams) {\n" $outfile[:remapcode_func] << code_key $outfile[:remapcode_func] << "}\n" end unless code_consumer.empty? then $outfile[:remapcode_func] << "static void remap_consumer(RemapConsumerParams &remapParams) {\n" $outfile[:remapcode_func] << code_consumer $outfile[:remapcode_func] << "}\n" end unless code_pointing.empty? then $outfile[:remapcode_func] << "static void remap_pointing(RemapPointingParams_relative &remapParams) {\n" $outfile[:remapcode_func] << code_pointing $outfile[:remapcode_func] << "}\n" end $outfile[:remapcode_func] << "\n" $outfile[:remapcode_func] << "private:\n" code_variable.each do |variable| $outfile[:remapcode_func] << " static #{variable[0]} #{variable[1]};\n" end $outfile[:remapcode_func] << "};\n" code_variable.each do |variable| $outfile[:remapcode_func] << "#{variable[0]} RemapClass_#{name}::#{variable[1]};\n" end $outfile[:remapcode_func] << "\n\n" if /<vk_config>true<\/vk_config>/ =~ item then $outfile[:remapcode_vk_config] << "if (params.key == KeyCode::VK_CONFIG_TOGGLE_#{name}) {\n" $outfile[:remapcode_vk_config] << " configitem = &(config.#{name});\n" $outfile[:remapcode_vk_config] << " type = TYPE_TOGGLE;\n" $outfile[:remapcode_vk_config] << "}\n" $outfile[:remapcode_vk_config] << "if (params.key == KeyCode::VK_CONFIG_FORCE_ON_#{name}) {\n" $outfile[:remapcode_vk_config] << " configitem = &(config.#{name});\n" $outfile[:remapcode_vk_config] << " type = TYPE_FORCE_ON;\n" $outfile[:remapcode_vk_config] << "}\n" $outfile[:remapcode_vk_config] << "if (params.key == KeyCode::VK_CONFIG_FORCE_OFF_#{name}) {\n" $outfile[:remapcode_vk_config] << " configitem = &(config.#{name});\n" $outfile[:remapcode_vk_config] << " type = TYPE_FORCE_OFF;\n" $outfile[:remapcode_vk_config] << "}\n" $outfile[:keycode_vk_config] << "VK_CONFIG_TOGGLE_#{name} --AUTO--\n" $outfile[:keycode_vk_config] << "VK_CONFIG_FORCE_ON_#{name} --AUTO--\n" $outfile[:keycode_vk_config] << "VK_CONFIG_FORCE_OFF_#{name} --AUTO--\n" end end $outfile[:remapcode_info] << "enum {\n" $outfile[:remapcode_info] << " MAXNUM_REMAPFUNC_KEY = #{$func[:key].uniq.count},\n" $outfile[:remapcode_info] << " MAXNUM_REMAPFUNC_CONSUMER = #{$func[:consumer].uniq.count},\n" $outfile[:remapcode_info] << " MAXNUM_REMAPFUNC_POINTING = #{$func[:pointing].uniq.count},\n" $outfile[:remapcode_info] << "};\n" $func[:key].uniq.each do |name| $outfile[:remapcode_refresh_remapfunc_key] << "if (config.#{name}) {\n" $outfile[:remapcode_refresh_remapfunc_key] << " listRemapFunc_key[listRemapFunc_key_size] = GeneratedCode::RemapClass_#{name}::remap_key;\n" $outfile[:remapcode_refresh_remapfunc_key] << " ++listRemapFunc_key_size;\n" $outfile[:remapcode_refresh_remapfunc_key] << "}\n" end $func[:consumer].uniq.each do |name| $outfile[:remapcode_refresh_remapfunc_consumer] << "if (config.#{name}) {\n" $outfile[:remapcode_refresh_remapfunc_consumer] << " listRemapFunc_consumer[listRemapFunc_consumer_size] = GeneratedCode::RemapClass_#{name}::remap_consumer;\n" $outfile[:remapcode_refresh_remapfunc_consumer] << " ++listRemapFunc_consumer_size;\n" $outfile[:remapcode_refresh_remapfunc_consumer] << "}\n" end $func[:pointing].uniq.each do |name| $outfile[:remapcode_refresh_remapfunc_pointing] << "if (config.#{name}) {\n" $outfile[:remapcode_refresh_remapfunc_pointing] << " listRemapFunc_pointing[listRemapFunc_pointing_size] = GeneratedCode::RemapClass_#{name}::remap_pointing;\n" $outfile[:remapcode_refresh_remapfunc_pointing] << " ++listRemapFunc_pointing_size;\n" $outfile[:remapcode_refresh_remapfunc_pointing] << "}\n" end $outfile.each do |name,file| file.close end update config/make-code @ kext #!/usr/bin/ruby $outfile = { :config => open('output/include.config.hpp', 'w'), :config_SYSCTL => open('output/include.config_SYSCTL.cpp', 'w'), :config_register => open('output/include.config_register.cpp', 'w'), :config_unregister => open('output/include.config_unregister.cpp', 'w'), :config_default => open('output/include.config.default.hpp', 'w'), :remapcode_keyboardtype => open('output/include.remapcode_keyboardtype.hpp', 'w'), :remapcode_func => open('output/include.remapcode_func.cpp', 'w'), :remapcode_info => open('output/include.remapcode_info.cpp', 'w'), :remapcode_refresh_remapfunc_key => open('output/include.remapcode_refresh_remapfunc_key.cpp', 'w'), :remapcode_refresh_remapfunc_consumer => open('output/include.remapcode_refresh_remapfunc_consumer.cpp', 'w'), :remapcode_refresh_remapfunc_pointing => open('output/include.remapcode_refresh_remapfunc_pointing.cpp', 'w'), :remapcode_refresh_remapfunc_statusmessage => open('output/include.remapcode_refresh_remapfunc_statusmessage.cpp', 'w'), :remapcode_vk_config => open('output/include.remapcode_vk_config.cpp', 'w'), :keycode_vk_config => open('../keycode/data/include/KeyCode.VK_CONFIG.data', 'w'), } $func = { :key => [], :consumer => [], :pointing => [], } # ====================================================================== def getextrakey(key) case key when 'HOME' 'CURSOR_LEFT' when 'END' 'CURSOR_RIGHT' when 'PAGEUP' 'CURSOR_UP' when 'PAGEDOWN' 'CURSOR_DOWN' when 'FORWARD_DELETE' 'DELETE' else nil end end def preprocess(listAutogen) modify = false list = [] listAutogen.each do |autogen| if /VK_(COMMAND|CONTROL|SHIFT|OPTION)/ =~ autogen then key = $1 list << autogen.gsub(/VK_#{key}/, "ModifierFlag::#{key}_L") list << autogen.gsub(/VK_#{key}/, "ModifierFlag::#{key}_R") modify = true elsif /VK_MOD_CCOS_L/ =~ autogen then list << autogen.gsub(/VK_MOD_CCOS_L/, "ModifierFlag::COMMAND_L | ModifierFlag::CONTROL_L | ModifierFlag::OPTION_L | ModifierFlag::SHIFT_L") modify = true elsif /VK_MOD_CCS_L/ =~ autogen then list << autogen.gsub(/VK_MOD_CCS_L/, "ModifierFlag::COMMAND_L | ModifierFlag::CONTROL_L | ModifierFlag::SHIFT_L") modify = true elsif /VK_MOD_CCO_L/ =~ autogen then list << autogen.gsub(/VK_MOD_CCO_L/, "ModifierFlag::COMMAND_L | ModifierFlag::CONTROL_L | ModifierFlag::OPTION_L") modify = true elsif /FROMKEYCODE_(HOME|END|PAGEUP|PAGEDOWN|FORWARD_DELETE)\s*,\s*ModifierFlag::/ =~ autogen then key = $1 extrakey = getextrakey(key) list << autogen.gsub(/FROMKEYCODE_#{key}\s*,/, "KeyCode::#{key},") list << autogen.gsub(/FROMKEYCODE_#{key}\s*,/, "KeyCode::#{extrakey}, ModifierFlag::FN |") modify = true elsif /FROMKEYCODE_(HOME|END|PAGEUP|PAGEDOWN|FORWARD_DELETE)/ =~ autogen then key = $1 extrakey = getextrakey(key) list << autogen.gsub(/FROMKEYCODE_#{key}\s*,/, "KeyCode::#{key},") list << autogen.gsub(/FROMKEYCODE_#{key}\s*,/, "KeyCode::#{extrakey}, ModifierFlag::FN,") modify = true else list << autogen end end if modify then list = preprocess(list) end list end # ====================================================================== def parseautogen(name, lines, autogen_index) filter = [] code_key = [] code_consumer = [] code_pointing = [] code_variable = [] while true l = lines.shift break if l.nil? # -------------------------------------------------- next if /<\/?item>/ =~ l next if /<name>.+?<\/name>/ =~ l next if /<appendix>.+?<\/appendix>/ =~ l next if /<sysctl>.+?<\/sysctl>/ =~ l next if /<baseunit>.+?<\/baseunit>/ =~ l next if /<default>.+?<\/default>/ =~ l next if /<vk_config>.+?<\/vk_config>/ =~ l # -------------------------------------------------- if /<block>/ =~ l then block_code_key, block_code_consumer, block_code_pointing, block_code_variable, autogen_index = parseautogen(name, lines, autogen_index) code_key << block_code_key unless block_code_key.empty? code_consumer << block_code_consumer unless block_code_consumer.empty? code_pointing << block_code_pointing unless block_code_pointing.empty? code_variable += block_code_variable elsif /<\/block>/ =~ l then break # ================================================================================ elsif /<not>(.+?)<\/not>/ =~ l then $1.split(/,/).each do |f| filter << "if (remapParams.workspacedata.type == KeyRemap4MacBook_bridge::GetWorkspaceData::#{f.strip}) break;" end elsif /<only>(.+?)<\/only>/ =~ l then tmp = [] $1.split(/,/).each do |f| tmp << "(remapParams.workspacedata.type != KeyRemap4MacBook_bridge::GetWorkspaceData::#{f.strip})" end filter << "if (#{tmp.join(' && ')}) break;" elsif /<keyboardtype_not>(.+?)<\/keyboardtype_not>/ =~ l then $1.split(/,/).each do |f| filter << "if (remapParams.params.keyboardType == KeyboardType::#{f.strip}) break;" end elsif /<keyboardtype_only>(.+?)<\/keyboardtype_only>/ =~ l then tmp = [] $1.split(/,/).each do |f| tmp << "(remapParams.params.keyboardType != KeyboardType::#{f.strip})" end filter << "if (#{tmp.join(' && ')}) break;" elsif /<(inputmode|inputmodedetail)_not>(.+?)<\/(inputmode|inputmodedetail)_not>/ =~ l then inputmodetype = $1 $2.split(/,/).each do |f| filter << "if (remapParams.workspacedata.#{inputmodetype} == KeyRemap4MacBook_bridge::GetWorkspaceData::#{f.strip}) break;" end elsif /<(inputmode|inputmodedetail)_only>(.+?)<\/(inputmode|inputmodedetail)_only>/ =~ l then inputmodetype = $1 tmp = [] $2.split(/,/).each do |f| tmp << "(remapParams.workspacedata.#{inputmodetype} != KeyRemap4MacBook_bridge::GetWorkspaceData::#{f.strip})" end filter << "if (#{tmp.join(' && ')}) break;" # ================================================================================ elsif /<autogen>(.+?)<\/autogen>/ =~ l then autogen = $1 if /^--(.+?)-- (.+)$/ =~ autogen then type = $1 params = $2 autogen_index += 1 case type when 'SetKeyboardType' $outfile[:remapcode_keyboardtype] << "if (config.#{name}) {\n" $outfile[:remapcode_keyboardtype] << " keyboardType = #{params}.get();\n" $outfile[:remapcode_keyboardtype] << "}\n" when 'ShowStatusMessage' $outfile[:remapcode_refresh_remapfunc_statusmessage] << "if (config.#{name}) {\n" $outfile[:remapcode_refresh_remapfunc_statusmessage] << " statusmessage = #{params};\n" $outfile[:remapcode_refresh_remapfunc_statusmessage] << " isStatusMessageVisible = true;\n" $outfile[:remapcode_refresh_remapfunc_statusmessage] << "}\n" when 'KeyToKey' code_variable << ['RemapUtil::KeyToKey', "keytokey#{autogen_index}_"] code_key << "if (keytokey#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:key] << name when 'DoublePressModifier' code_variable << ['DoublePressModifier', "doublepressmodifier#{autogen_index}_"] code_key << "if (doublepressmodifier#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:key] << name when 'IgnoreMultipleSameKeyPress' code_variable << ['IgnoreMultipleSameKeyPress', "ignoremultiplesamekeypress#{autogen_index}_"] code_key << "if (ignoremultiplesamekeypress#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:key] << name when 'KeyToConsumer' code_variable << ['RemapUtil::KeyToConsumer', "keytoconsumer#{autogen_index}_"] code_key << "if (keytoconsumer#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:key] << name when 'KeyToPointingButton' code_variable << ['RemapUtil::KeyToPointingButton', "keytopointing#{autogen_index}_"] code_key << "if (keytopointing#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:key] << name when 'KeyOverlaidModifier' code_variable << ['KeyOverlaidModifier', "keyoverlaidmodifier#{autogen_index}_"] code_key << "if (keyoverlaidmodifier#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:key] << name when 'KeyOverlaidModifierWithRepeat' code_variable << ['KeyOverlaidModifier', "keyoverlaidmodifier#{autogen_index}_"] code_key << "if (keyoverlaidmodifier#{autogen_index}_.remapWithRepeat(remapParams, #{params})) break;" $func[:key] << name when 'ModifierHoldingKeyToKey' code_variable << ['ModifierHoldingKeyToKey', "modifierholdingkeytokey#{autogen_index}_"] code_key << "if (modifierholdingkeytokey#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:key] << name when 'ConsumerToKey' code_variable << ['RemapUtil::ConsumerToKey', "consumertokey#{autogen_index}_"] code_consumer << "if (consumertokey#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:consumer] << name when 'ConsumerToConsumer' code_variable << ['RemapUtil::ConsumerToConsumer', "consumertoconsumer#{autogen_index}_"] code_consumer << "if (consumertoconsumer#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:consumer] << name when 'PointingRelativeToScroll' code_variable << ['RemapUtil::PointingRelativeToScroll', "pointingrelativetoscroll#{autogen_index}_"] code_pointing << "if (pointingrelativetoscroll#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:pointing] << name when 'PointingButtonToPointingButton' code_variable << ['RemapUtil::PointingButtonToPointingButton', "pointingbuttontopointingbutton#{autogen_index}_"] code_pointing << "if (pointingbuttontopointingbutton#{autogen_index}_.remap(remapParams, #{params})) break;" $func[:pointing] << name else print "%%% ERROR #{type} %%%\n#{l}\n" exit 1 end end elsif /<.+?>.+?<\/.+?>/ =~ l then print "%%% ERROR unknown command %%%\n#{l}\n" exit 1 end end # ====================================================================== result_code_key = '' result_code_consumer = '' result_code_pointing = '' unless code_key.empty? then result_code_key += " do {\n" filter.each do |f| result_code_key += " #{f}\n" end result_code_key += "\n" unless filter.empty? code_key.each do |line| result_code_key += " #{line}\n" end result_code_key += " } while (false);\n" end unless code_consumer.empty? then result_code_consumer += " do {\n" filter.each do |f| result_code_consumer += " #{f}\n" end result_code_consumer += "\n" unless filter.empty? code_consumer.each do |line| result_code_consumer += " #{line}\n" end result_code_consumer += " } while (false);\n" end unless code_pointing.empty? then result_code_pointing += " do {\n" code_pointing.each do |line| result_code_pointing += " #{line}\n" end result_code_pointing += " } while (false);\n" end return result_code_key, result_code_consumer, result_code_pointing, code_variable, autogen_index end # ---------------------------------------------------------------------- $stdin.read.scan(/<item>.+?<\/item>/m).each do |item| if /.*(<item>.+?<\/item>)/m =~ item then item = $1 end name = nil if /<sysctl>([^\.]+?)\.(.+?)<\/sysctl>/m =~ item then name = "#{$1}_#{$2}" $outfile[:config_SYSCTL] << "SYSCTL_PROC(_keyremap4macbook_#{$1}, OID_AUTO, #{$2}, CTLTYPE_INT|CTLFLAG_RW, &(config.#{name}), 0, refresh_remapfunc_handler, \"I\", \"\");\n" $outfile[:config_register] << "sysctl_register_oid(&sysctl__keyremap4macbook_#{name});\n" $outfile[:config_unregister] << "sysctl_unregister_oid(&sysctl__keyremap4macbook_#{name});\n" end next if name.nil? $outfile[:config] << "int #{name};\n" if /<default>(.+?)<\/default>/m =~ item then $outfile[:config_default] << "#{name} = #{$1};\n" end # check <name> num == 1 if item.scan(/<name>(.+?)<\/name>/m).size != 1 then print "%%% ERROR no <name> or multiple <name> for #{name}\n" exit 1 end # ====================================================================== lines = item.split(/\n/) lines = preprocess(lines) code_key, code_consumer, code_pointing, code_variable, autogen_index = parseautogen(name, lines, 0) unless lines.empty? then print "%%% ERROR no </block> at #{name} %%%\n" end next if code_key.empty? && code_consumer.empty? && code_pointing.empty? && code_variable.empty? $outfile[:remapcode_func] << "class RemapClass_#{name} {\n" $outfile[:remapcode_func] << "public:\n" unless code_key.empty? then $outfile[:remapcode_func] << "static void remap_key(RemapParams &remapParams) {\n" $outfile[:remapcode_func] << code_key $outfile[:remapcode_func] << "}\n" end unless code_consumer.empty? then $outfile[:remapcode_func] << "static void remap_consumer(RemapConsumerParams &remapParams) {\n" $outfile[:remapcode_func] << code_consumer $outfile[:remapcode_func] << "}\n" end unless code_pointing.empty? then $outfile[:remapcode_func] << "static void remap_pointing(RemapPointingParams_relative &remapParams) {\n" $outfile[:remapcode_func] << code_pointing $outfile[:remapcode_func] << "}\n" end $outfile[:remapcode_func] << "\n" $outfile[:remapcode_func] << "private:\n" code_variable.each do |variable| $outfile[:remapcode_func] << " static #{variable[0]} #{variable[1]};\n" end $outfile[:remapcode_func] << "};\n" code_variable.each do |variable| $outfile[:remapcode_func] << "#{variable[0]} RemapClass_#{name}::#{variable[1]};\n" end $outfile[:remapcode_func] << "\n\n" if /<vk_config>true<\/vk_config>/ =~ item then $outfile[:remapcode_vk_config] << "if (params.key == KeyCode::VK_CONFIG_TOGGLE_#{name}) {\n" $outfile[:remapcode_vk_config] << " configitem = &(config.#{name});\n" $outfile[:remapcode_vk_config] << " type = TYPE_TOGGLE;\n" $outfile[:remapcode_vk_config] << "}\n" $outfile[:remapcode_vk_config] << "if (params.key == KeyCode::VK_CONFIG_FORCE_ON_#{name}) {\n" $outfile[:remapcode_vk_config] << " configitem = &(config.#{name});\n" $outfile[:remapcode_vk_config] << " type = TYPE_FORCE_ON;\n" $outfile[:remapcode_vk_config] << "}\n" $outfile[:remapcode_vk_config] << "if (params.key == KeyCode::VK_CONFIG_FORCE_OFF_#{name}) {\n" $outfile[:remapcode_vk_config] << " configitem = &(config.#{name});\n" $outfile[:remapcode_vk_config] << " type = TYPE_FORCE_OFF;\n" $outfile[:remapcode_vk_config] << "}\n" $outfile[:keycode_vk_config] << "VK_CONFIG_TOGGLE_#{name} --AUTO--\n" $outfile[:keycode_vk_config] << "VK_CONFIG_FORCE_ON_#{name} --AUTO--\n" $outfile[:keycode_vk_config] << "VK_CONFIG_FORCE_OFF_#{name} --AUTO--\n" end end $outfile[:remapcode_info] << "enum {\n" $outfile[:remapcode_info] << " MAXNUM_REMAPFUNC_KEY = #{$func[:key].uniq.count},\n" $outfile[:remapcode_info] << " MAXNUM_REMAPFUNC_CONSUMER = #{$func[:consumer].uniq.count},\n" $outfile[:remapcode_info] << " MAXNUM_REMAPFUNC_POINTING = #{$func[:pointing].uniq.count},\n" $outfile[:remapcode_info] << "};\n" $func[:key].uniq.each do |name| $outfile[:remapcode_refresh_remapfunc_key] << "if (config.#{name}) {\n" $outfile[:remapcode_refresh_remapfunc_key] << " listRemapFunc_key[listRemapFunc_key_size] = GeneratedCode::RemapClass_#{name}::remap_key;\n" $outfile[:remapcode_refresh_remapfunc_key] << " ++listRemapFunc_key_size;\n" $outfile[:remapcode_refresh_remapfunc_key] << "}\n" end $func[:consumer].uniq.each do |name| $outfile[:remapcode_refresh_remapfunc_consumer] << "if (config.#{name}) {\n" $outfile[:remapcode_refresh_remapfunc_consumer] << " listRemapFunc_consumer[listRemapFunc_consumer_size] = GeneratedCode::RemapClass_#{name}::remap_consumer;\n" $outfile[:remapcode_refresh_remapfunc_consumer] << " ++listRemapFunc_consumer_size;\n" $outfile[:remapcode_refresh_remapfunc_consumer] << "}\n" end $func[:pointing].uniq.each do |name| $outfile[:remapcode_refresh_remapfunc_pointing] << "if (config.#{name}) {\n" $outfile[:remapcode_refresh_remapfunc_pointing] << " listRemapFunc_pointing[listRemapFunc_pointing_size] = GeneratedCode::RemapClass_#{name}::remap_pointing;\n" $outfile[:remapcode_refresh_remapfunc_pointing] << " ++listRemapFunc_pointing_size;\n" $outfile[:remapcode_refresh_remapfunc_pointing] << "}\n" end $outfile.each do |name,file| file.close end
Airbrake.configure do |config| config.api_key = 'api_key' end airbrake Airbrake.configure do |config| config.api_key = ENV["AIRBRAKE_API_KEY"] end
# Airbrake is an online tool that provides robust exception tracking in your Rails # applications. In doing so, it allows you to easily review errors, tie an error # to an individual piece of code, and trace the cause back to recent # changes. Airbrake enables for easy categorization, searching, and prioritization # of exceptions so that when errors occur, your team can quickly determine the # root cause. # # Configuration details: # https://github.com/airbrake/airbrake-ruby#configuration Airbrake.configure do |c| # You must set both project_id & project_key. To find your project_id and # project_key navigate to your project's General Settings and copy the values # from the right sidebar. # https://github.com/airbrake/airbrake-ruby#project_id--project_key c.project_id = ENV['AIRBRAKE_PROJECT_ID'] c.project_key = ENV['AIRBRAKE_API_KEY'] # Configures the root directory of your project. Expects a String or a # Pathname, which represents the path to your project. Providing this option # helps us to filter out repetitive data from backtrace frames and link to # GitHub files from our dashboard. # https://github.com/airbrake/airbrake-ruby#root_directory c.root_directory = Rails.root # By default, Airbrake Ruby outputs to STDOUT. In Rails apps it makes sense to # use the Rails' logger. # https://github.com/airbrake/airbrake-ruby#logger c.logger = Rails.logger # Configures the environment the application is running in. Helps the Airbrake # dashboard to distinguish between exceptions occurring in different # environments. By default, it's not set. # NOTE: This option must be set in order to make the 'ignore_environments' # option work. # https://github.com/airbrake/airbrake-ruby#environment c.environment = Rails.env # Setting this option allows Airbrake to filter exceptions occurring in # unwanted environments such as :test. By default, it is equal to an empty # Array, which means Airbrake Ruby sends exceptions occurring in all # environments. # NOTE: This option *does not* work if you don't set the 'environment' option. # https://github.com/airbrake/airbrake-ruby#ignore_environments c.ignore_environments = %w(test) # A list of parameters that should be filtered out of what is sent to # Airbrake. By default, all "password" attributes will have their contents # replaced. # https://github.com/airbrake/airbrake-ruby#blacklist_keys c.blacklist_keys = [/password/i] # Alternatively, you can integrate with Rails' filter_parameters. # Read more: https://goo.gl/gqQ1xS # c.blacklist_keys = Rails.application.config.filter_parameters end # If Airbrake doesn't send any expected exceptions, we suggest to uncomment the # line below. It might simplify debugging of background Airbrake workers, which # can silently die. # Thread.abort_on_exception = ['test', 'development'].include?(Rails.env) Configure airbrake so it ignores development Makes it easier to work on without having to set up airbrake environment. # Airbrake is an online tool that provides robust exception tracking in your Rails # applications. In doing so, it allows you to easily review errors, tie an error # to an individual piece of code, and trace the cause back to recent # changes. Airbrake enables for easy categorization, searching, and prioritization # of exceptions so that when errors occur, your team can quickly determine the # root cause. # # Configuration details: # https://github.com/airbrake/airbrake-ruby#configuration Airbrake.configure do |c| # You must set both project_id & project_key. To find your project_id and # project_key navigate to your project's General Settings and copy the values # from the right sidebar. # https://github.com/airbrake/airbrake-ruby#project_id--project_key c.project_id = ENV['AIRBRAKE_PROJECT_ID'] c.project_key = ENV['AIRBRAKE_API_KEY'] # Configures the root directory of your project. Expects a String or a # Pathname, which represents the path to your project. Providing this option # helps us to filter out repetitive data from backtrace frames and link to # GitHub files from our dashboard. # https://github.com/airbrake/airbrake-ruby#root_directory c.root_directory = Rails.root # By default, Airbrake Ruby outputs to STDOUT. In Rails apps it makes sense to # use the Rails' logger. # https://github.com/airbrake/airbrake-ruby#logger c.logger = Rails.logger # Configures the environment the application is running in. Helps the Airbrake # dashboard to distinguish between exceptions occurring in different # environments. By default, it's not set. # NOTE: This option must be set in order to make the 'ignore_environments' # option work. # https://github.com/airbrake/airbrake-ruby#environment c.environment = Rails.env # Setting this option allows Airbrake to filter exceptions occurring in # unwanted environments such as :test. By default, it is equal to an empty # Array, which means Airbrake Ruby sends exceptions occurring in all # environments. # NOTE: This option *does not* work if you don't set the 'environment' option. # https://github.com/airbrake/airbrake-ruby#ignore_environments c.ignore_environments = %w(development test) # A list of parameters that should be filtered out of what is sent to # Airbrake. By default, all "password" attributes will have their contents # replaced. # https://github.com/airbrake/airbrake-ruby#blacklist_keys c.blacklist_keys = [/password/i] # Alternatively, you can integrate with Rails' filter_parameters. # Read more: https://goo.gl/gqQ1xS # c.blacklist_keys = Rails.application.config.filter_parameters end # If Airbrake doesn't send any expected exceptions, we suggest to uncomment the # line below. It might simplify debugging of background Airbrake workers, which # can silently die. # Thread.abort_on_exception = ['test', 'development'].include?(Rails.env)
module CartoDB def self.session_domain APP_CONFIG[:session_domain] end def self.secret_token APP_CONFIG[:secret_token] end def self.domain @@domain ||= if Rails.env.production? `hostname -f`.strip elsif Rails.env.development? "vizzuality#{session_domain}" else "vizzuality#{session_domain}" end end def self.hostname @@hostname ||= if Rails.env.production? "https://#{domain}" elsif Rails.env.development? "http://#{domain}:3000" else "http://#{domain}:53716" end end def self.account_host APP_CONFIG[:account_host] end def self.account_path APP_CONFIG[:account_path] end module API VERSION_1 = "v1" end PUBLIC_DB_USER = 'publicuser' TILE_DB_USER = 'tileuser' GOOGLE_SRID = 3857 SRID = 4326 USER_REQUESTS_PER_DAY = 10000 TYPES = { "number" => ["smallint", /numeric\(\d+,\d+\)/, "integer", "bigint", "decimal", "numeric", "double precision", "serial", "big serial", "real"], "string" => ["varchar", "character varying", "text", /character\svarying\(\d+\)/, /char\s*\(\d+\)/, /character\s*\(\d+\)/], "date" => ["timestamp", "timestamp without time zone"], "boolean" => ["boolean"] } NEXT_TYPE = { "number" => "double precision", "string" => "text" } VALID_GEOMETRY_TYPES = %W{ multipolygon point multilinestring} POSTGRESQL_RESERVED_WORDS = %W{ ALL ANALYSE ANALYZE AND ANY ARRAY AS ASC ASYMMETRIC AUTHORIZATION BETWEEN BINARY BOTH CASE CAST CHECK COLLATE COLUMN CONSTRAINT CREATE CROSS CURRENT_DATE CURRENT_ROLE CURRENT_TIME CURRENT_TIMESTAMP CURRENT_USER DEFAULT DEFERRABLE DESC DISTINCT DO ELSE END EXCEPT FALSE FOR FOREIGN FREEZE FROM FULL GRANT GROUP HAVING ILIKE IN INITIALLY INNER INTERSECT INTO IS ISNULL JOIN LEADING LEFT LIKE LIMIT LOCALTIME LOCALTIMESTAMP NATURAL NEW NOT NOTNULL NULL OFF OFFSET OLD ON ONLY OR ORDER OUTER OVERLAPS PLACING PRIMARY REFERENCES RIGHT SELECT SESSION_USER SIMILAR SOME SYMMETRIC TABLE THEN TO TRAILING TRUE UNION UNIQUE USER USING VERBOSE WHEN WHERE } LAST_BLOG_POSTS_FILE_PATH = "#{Rails.root}/public/system/last_blog_posts.html" ERROR_CODES = { 1000 => 'File I/O error', 1001 => 'Unable to open file', 1002 => 'Unsupported file type', 1003 => 'Decompression error', 1004 => 'File encoding error', 2000 => 'File conversion errors', 3000 => 'Geometry error', 3004 => 'Unable to read SHP file', 3005 => 'SHP to PGSQL error', 3100 => 'Projection error', 3101 => 'Unsupported or missing projection', 3200 => 'Unsupported geometry type', 3201 => 'Geometry Collection not supported', 4000 => 'Raster errors', 4001 => 'Raster import error', 5000 => 'Database import error', 5001 => 'Empty table', 5002 => 'Reserved column names', 8000 => 'CartoDB account error', 8001 => 'Over account storage limit', 8002 => 'Over table limit', 99999 => 'Unknown' } end added the top error for OSM import errors module CartoDB def self.session_domain APP_CONFIG[:session_domain] end def self.secret_token APP_CONFIG[:secret_token] end def self.domain @@domain ||= if Rails.env.production? `hostname -f`.strip elsif Rails.env.development? "vizzuality#{session_domain}" else "vizzuality#{session_domain}" end end def self.hostname @@hostname ||= if Rails.env.production? "https://#{domain}" elsif Rails.env.development? "http://#{domain}:3000" else "http://#{domain}:53716" end end def self.account_host APP_CONFIG[:account_host] end def self.account_path APP_CONFIG[:account_path] end module API VERSION_1 = "v1" end PUBLIC_DB_USER = 'publicuser' TILE_DB_USER = 'tileuser' GOOGLE_SRID = 3857 SRID = 4326 USER_REQUESTS_PER_DAY = 10000 TYPES = { "number" => ["smallint", /numeric\(\d+,\d+\)/, "integer", "bigint", "decimal", "numeric", "double precision", "serial", "big serial", "real"], "string" => ["varchar", "character varying", "text", /character\svarying\(\d+\)/, /char\s*\(\d+\)/, /character\s*\(\d+\)/], "date" => ["timestamp", "timestamp without time zone"], "boolean" => ["boolean"] } NEXT_TYPE = { "number" => "double precision", "string" => "text" } VALID_GEOMETRY_TYPES = %W{ multipolygon point multilinestring} POSTGRESQL_RESERVED_WORDS = %W{ ALL ANALYSE ANALYZE AND ANY ARRAY AS ASC ASYMMETRIC AUTHORIZATION BETWEEN BINARY BOTH CASE CAST CHECK COLLATE COLUMN CONSTRAINT CREATE CROSS CURRENT_DATE CURRENT_ROLE CURRENT_TIME CURRENT_TIMESTAMP CURRENT_USER DEFAULT DEFERRABLE DESC DISTINCT DO ELSE END EXCEPT FALSE FOR FOREIGN FREEZE FROM FULL GRANT GROUP HAVING ILIKE IN INITIALLY INNER INTERSECT INTO IS ISNULL JOIN LEADING LEFT LIKE LIMIT LOCALTIME LOCALTIMESTAMP NATURAL NEW NOT NOTNULL NULL OFF OFFSET OLD ON ONLY OR ORDER OUTER OVERLAPS PLACING PRIMARY REFERENCES RIGHT SELECT SESSION_USER SIMILAR SOME SYMMETRIC TABLE THEN TO TRAILING TRUE UNION UNIQUE USER USING VERBOSE WHEN WHERE } LAST_BLOG_POSTS_FILE_PATH = "#{Rails.root}/public/system/last_blog_posts.html" ERROR_CODES = { 1000 => 'File I/O error', 1001 => 'Unable to open file', 1002 => 'Unsupported file type', 1003 => 'Decompression error', 1004 => 'File encoding error', 2000 => 'File conversion errors', 3000 => 'Geometry error', 3004 => 'Unable to read SHP file', 3005 => 'SHP to PGSQL error', 3100 => 'Projection error', 3101 => 'Unsupported or missing projection', 3200 => 'Unsupported geometry type', 3201 => 'Geometry Collection not supported', 4000 => 'Raster errors', 4001 => 'Raster import error', 5000 => 'Database import error', 5001 => 'Empty table', 5002 => 'Reserved column names', 6000 => 'OSM data import error', 8000 => 'CartoDB account error', 8001 => 'Over account storage limit', 8002 => 'Over table limit', 99999 => 'Unknown' } end
Geocoder.configure( # Geocoding options # timeout: 3, # geocoding service timeout (secs) lookup: :nominatim, # name of geocoding service (symbol) # ip_lookup: :ipinfo_io, # name of IP address geocoding service (symbol) # language: :en, # ISO-639 language code # use_https: false, # use HTTPS for lookup requests? (if supported) # http_proxy: nil, # HTTP proxy server (user:pass@host:port) # https_proxy: nil, # HTTPS proxy server (user:pass@host:port) # api_key: nil, # API key for geocoding service # cache: nil, # cache object (must respond to #[], #[]=, and #del) # cache_prefix: 'geocoder:', # prefix (string) to use for all cache keys # Exceptions that should not be rescued by default # (if you want to implement custom error handling); # supports SocketError and Timeout::Error # always_raise: [], # pickpoint: { api_key: ENV['PICKPOINT_API_KEY'] }, # bing: { api_key: ENV['BING_API_KEY'] } # Calculation options # units: :mi, # :km for kilometers or :mi for miles # distances: :linear # :spherical or :linear ) if Rails.env.test? Geocoder.configure(lookup: :test, ip_lookup: :test) Geocoder::Lookup::Test.set_default_stub( [ { 'coordinates' => [51.340620, -2.301420], 'address' => 'Freshford Station', 'state' => 'Somerset', 'state_code' => '', 'country' => 'United Kingdom', 'country_code' => 'UK' } ] ) end Configure postcodes.io as lookup service Geocoder.configure( # Geocoding options # timeout: 3, # geocoding service timeout (secs) # lookup: :nominatim, # name of geocoding service (symbol) lookup: :postcodes_io, # ip_lookup: :ipinfo_io, # name of IP address geocoding service (symbol) # language: :en, # ISO-639 language code # use_https: false, # use HTTPS for lookup requests? (if supported) # http_proxy: nil, # HTTP proxy server (user:pass@host:port) # https_proxy: nil, # HTTPS proxy server (user:pass@host:port) # api_key: nil, # API key for geocoding service # cache: nil, # cache object (must respond to #[], #[]=, and #del) # cache_prefix: 'geocoder:', # prefix (string) to use for all cache keys # Exceptions that should not be rescued by default # (if you want to implement custom error handling); # supports SocketError and Timeout::Error # always_raise: [], # pickpoint: { api_key: ENV['PICKPOINT_API_KEY'] }, # bing: { api_key: ENV['BING_API_KEY'] } # Calculation options # units: :mi, # :km for kilometers or :mi for miles # distances: :linear # :spherical or :linear ) if Rails.env.test? Geocoder.configure(lookup: :test, ip_lookup: :test) Geocoder::Lookup::Test.set_default_stub( [ { 'coordinates' => [51.340620, -2.301420], 'address' => 'Freshford Station', 'state' => 'Somerset', 'state_code' => '', 'country' => 'United Kingdom', 'country_code' => 'UK' } ] ) end
IntercomRails.config do |config| # == Intercom app_id # config.app_id = ENV["INTERCOM_APP_ID"] || "qvnmie0g" # == Intercom session_duration # # config.session_duration = 300000 # == Intercom secret key # This is required to enable secure mode, you can find it on your Setup # guide in the "Secure Mode" step. # # config.api_secret = "..." # == Enabled Environments # Which environments is auto inclusion of the Javascript enabled for # config.enabled_environments = ["development", "production"] # == Current user method/variable # The method/variable that contains the logged in user in your controllers. # If it is `current_user` or `@user`, then you can ignore this # # config.user.current = Proc.new { current_user } # config.user.current = [Proc.new { current_user }] # == Include for logged out Users # If set to true, include the Intercom messenger on all pages, regardless of whether # The user model class (set below) is present. Only available for Apps on the Acquire plan. # config.include_for_logged_out_users = true # == User model class # The class which defines your user model # # config.user.model = Proc.new { User } # == Lead/custom attributes for non-signed up users # Pass additional attributes to for potential leads or # non-signed up users as an an array. # Any attribute contained in config.user.lead_attributes can be used # as custom attribute in the application. # config.user.lead_attributes = %w(ref_data utm_source) # == Exclude users # A Proc that given a user returns true if the user should be excluded # from imports and Javascript inclusion, false otherwise. # # config.user.exclude_if = Proc.new { |user| user.deleted? } # == User Custom Data # A hash of additional data you wish to send about your users. # You can provide either a method name which will be sent to the current # user object, or a Proc which will be passed the current user. # # config.user.custom_data = { # :plan => Proc.new { |current_user| current_user.plan.name }, # :favorite_color => :favorite_color # } # == Current company method/variable # The method/variable that contains the current company for the current user, # in your controllers. 'Companies' are generic groupings of users, so this # could be a company, app or group. # # config.company.current = Proc.new { current_company } # # Or if you are using devise you can just use the following config # # config.company.current = Proc.new { current_user.company } # == Company Custom Data # A hash of additional data you wish to send about a company. # This works the same as User custom data above. # # config.company.custom_data = { # :number_of_messages => Proc.new { |app| app.messages.count }, # :is_interesting => :is_interesting? # } # == Company Plan name # This is the name of the plan a company is currently paying (or not paying) for. # e.g. Messaging, Free, Pro, etc. # # config.company.plan = Proc.new { |current_company| current_company.plan.name } # == Company Monthly Spend # This is the amount the company spends each month on your app. If your company # has a plan, it will set the 'total value' of that plan appropriately. # # config.company.monthly_spend = Proc.new { |current_company| current_company.plan.price } # config.company.monthly_spend = Proc.new { |current_company| (current_company.plan.price - current_company.subscription.discount) } # == Custom Style # By default, Intercom will add a button that opens the messenger to # the page. If you'd like to use your own link to open the messenger, # uncomment this line and clicks on any element with id 'Intercom' will # open the messenger. # # config.inbox.style = :custom # # If you'd like to use your own link activator CSS selector # uncomment this line and clicks on any element that matches the query will # open the messenger # config.inbox.custom_activator = '.intercom' end Include for logged out users IntercomRails.config do |config| # == Intercom app_id # config.app_id = ENV["INTERCOM_APP_ID"] || "qvnmie0g" # == Intercom session_duration # # config.session_duration = 300000 # == Intercom secret key # This is required to enable secure mode, you can find it on your Setup # guide in the "Secure Mode" step. # # config.api_secret = "..." # == Enabled Environments # Which environments is auto inclusion of the Javascript enabled for # config.enabled_environments = ["development", "production"] # == Current user method/variable # The method/variable that contains the logged in user in your controllers. # If it is `current_user` or `@user`, then you can ignore this # # config.user.current = Proc.new { current_user } # config.user.current = [Proc.new { current_user }] # == Include for logged out Users # If set to true, include the Intercom messenger on all pages, regardless of whether # The user model class (set below) is present. Only available for Apps on the Acquire plan. config.include_for_logged_out_users = true # == User model class # The class which defines your user model # # config.user.model = Proc.new { User } # == Lead/custom attributes for non-signed up users # Pass additional attributes to for potential leads or # non-signed up users as an an array. # Any attribute contained in config.user.lead_attributes can be used # as custom attribute in the application. # config.user.lead_attributes = %w(ref_data utm_source) # == Exclude users # A Proc that given a user returns true if the user should be excluded # from imports and Javascript inclusion, false otherwise. # # config.user.exclude_if = Proc.new { |user| user.deleted? } # == User Custom Data # A hash of additional data you wish to send about your users. # You can provide either a method name which will be sent to the current # user object, or a Proc which will be passed the current user. # # config.user.custom_data = { # :plan => Proc.new { |current_user| current_user.plan.name }, # :favorite_color => :favorite_color # } # == Current company method/variable # The method/variable that contains the current company for the current user, # in your controllers. 'Companies' are generic groupings of users, so this # could be a company, app or group. # # config.company.current = Proc.new { current_company } # # Or if you are using devise you can just use the following config # # config.company.current = Proc.new { current_user.company } # == Company Custom Data # A hash of additional data you wish to send about a company. # This works the same as User custom data above. # # config.company.custom_data = { # :number_of_messages => Proc.new { |app| app.messages.count }, # :is_interesting => :is_interesting? # } # == Company Plan name # This is the name of the plan a company is currently paying (or not paying) for. # e.g. Messaging, Free, Pro, etc. # # config.company.plan = Proc.new { |current_company| current_company.plan.name } # == Company Monthly Spend # This is the amount the company spends each month on your app. If your company # has a plan, it will set the 'total value' of that plan appropriately. # # config.company.monthly_spend = Proc.new { |current_company| current_company.plan.price } # config.company.monthly_spend = Proc.new { |current_company| (current_company.plan.price - current_company.subscription.discount) } # == Custom Style # By default, Intercom will add a button that opens the messenger to # the page. If you'd like to use your own link to open the messenger, # uncomment this line and clicks on any element with id 'Intercom' will # open the messenger. # # config.inbox.style = :custom # # If you'd like to use your own link activator CSS selector # uncomment this line and clicks on any element that matches the query will # open the messenger # config.inbox.custom_activator = '.intercom' end
# frozen_string_literal: true Mobility.configure do |config| # Sets the default backend to use in models. This can be overridden in models # by passing +backend: ...+ to +translates+. config.default_backend = :jsonb # By default, Mobility uses the +translates+ class method in models to # describe translated attributes, but you can configure this method to be # whatever you like. This may be useful if using Mobility alongside another # translation gem which uses the same method name. config.accessor_method = :translates # To query on translated attributes, you need to append a scope to your # model. The name of this scope is +i18n+ by default, but this can be changed # to something else. config.query_method = :i18n # Uncomment and remove (or add) items to (from) this list to completely # disable/enable plugins globally (so they cannot be used and are never even # loaded). Note that if you remove an item from the list, you will not be # able to use the plugin at all, and any options for the plugin will be # ignored by models. (In most cases, you probably don't want to change this.) # config.plugins = %i[ cache dirty fallbacks presence default attribute_methods fallthrough_accessors locale_accessors ] # The translation cache is on by default, but you can turn it off by # uncommenting this line. (This may be helpful in debugging.) # # config.default_options[:cache] = false # Dirty tracking is disabled by default. Uncomment this line to enable it. # If you enable this, you should also enable +locale_accessors+ by default # (see below). # config.default_options[:dirty] = true # No fallbacks are used by default. To define default fallbacks, uncomment # and set the default fallback option value here. A "true" value will use # whatever is defined by +I18n.fallbacks+ (if defined), or alternatively will # fallback to your +I18n.default_locale+. # config.default_options[:fallbacks] = true # The Presence plugin converts empty strings to nil when fetching and setting # translations. By default it is on, uncomment this line to turn it off. # # config.default_options[:presence] = false # Set a default value to use if the translation is nil. By default this is # off, uncomment and set a default to use it across all models (you probably # don't want to do that). # # config.default_options[:default] = ... # Uncomment to enable locale_accessors by default on models. A true value # will use the locales defined in I18n.available_locales. If you want # something else, pass an array of locales instead. # config.default_options[:locale_accessors] = true # Uncomment to enable fallthrough accessors by default on models. This will # allow you to call any method with a suffix like _en or _pt_br, and Mobility # will catch the suffix and convert it into a locale in +method_missing+. If # you don't need this kind of open-ended fallthrough behavior, it's better # to use locale_accessors instead (which define methods) since method_missing # is very slow. (You can use both fallthrough and locale accessor plugins # together without conflict.) # # Note: The dirty plugin enables fallthrough_accessors by default. # # config.default_options[:fallthrough_accessors] = true end Update mobility config to 1.0 style # frozen_string_literal: true Mobility.configure do # PLUGINS plugins do # Backend # # Sets the default backend to use in models. This can be overridden in models # by passing +backend: ...+ to +translates+. # # To default to a different backend globally, replace +:key_value+ by another # backend name. # backend :jsonb # ActiveRecord # # Defines ActiveRecord as ORM, and enables ActiveRecord-specific plugins. active_record # Accessors # # Define reader and writer methods for translated attributes. Remove either # to disable globally, or pass +reader: false+ or +writer: false+ to # +translates+ in any translated model. # reader writer # Backend Reader # # Defines reader to access the backend for any attribute, of the form # +<attribute>_backend+. # backend_reader # # Or pass an interpolation string to define a different pattern: # backend_reader "%s_translations" # Query # # Defines a scope on the model class which allows querying on # translated attributes. The default scope is named +i18n+, pass a different # name as default to change the global default, or to +translates+ in any # model to change it for that model alone. # query # Cache # # Comment out to disable caching reads and writes. # cache # Dirty # # Uncomment this line to include and enable globally: dirty # # Or uncomment this line to include but disable by default, and only enable # per model by passing +dirty: true+ to +translates+. # dirty false # Fallbacks # # Uncomment line below to enable fallbacks, using +I18n.fallbacks+. fallbacks # # Or uncomment this line to enable fallbacks with a global default. # fallbacks { :pt => :en } # Presence # # Converts blank strings to nil on reads and writes. Comment out to # disable. # presence # Default # # Set a default translation per attributes. When enabled, passing +default: # 'foo'+ sets a default translation string to show in case no translation is # present. Can also be passed a proc. # # default 'foo' # Fallthrough Accessors # # Uses method_missing to define locale-specific accessor methods like # +title_en+, +title_en=+, +title_fr+, +title_fr=+ for each translated # attribute. If you know what set of locales you want to support, it's # generally better to use Locale Accessors (or both together) since # +method_missing+ is very slow. (You can use both fallthrough and locale # accessor plugins together without conflict.) # fallthrough_accessors # Locale Accessors # # Uses +def+ to define accessor methods for a set of locales. By default uses # +I18n.available_locales+, but you can pass the set of locales with # +translates+ and/or set a global default here. # locale_accessors # # Or define specific defaults by uncommenting line below # locale_accessors [:en, :ja] # Attribute Methods # # Adds translated attributes to +attributes+ hash, and defines methods # +translated_attributes+ and +untranslated_attributes+ which return hashes # with translated and untranslated attributes, respectively. Be aware that # this plugin can create conflicts with other gems. # attribute_methods end end
Rails.application.config.middleware.use OmniAuth::Builder do provider :facebook, Rails.application.secrets.omniauth["facebook"]["app_id"], Rails.application.secrets.omniauth["facebook"]["app_secret"], scope: 'email', info_fields: 'name,email' provider :google_oauth2, Rails.application.secrets.omniauth["google"]["client_id"], Rails.application.secrets.omniauth["google"]["client_secret"], skip_jwt: true end Improve oauth config readability Rails.application.config.middleware.use OmniAuth::Builder do provider :facebook, Rails.application.secrets.omniauth["facebook"]["app_id"], Rails.application.secrets.omniauth["facebook"]["app_secret"], scope: 'email', info_fields: 'name,email' provider :google_oauth2, Rails.application.secrets.omniauth["google"]["client_id"], Rails.application.secrets.omniauth["google"]["client_secret"], skip_jwt: true end
Rails.application.config.middleware.use OmniAuth::Builder do provider :shopify, ShopifyApp.configuration.api_key, ShopifyApp.configuration.secret, # Example permission scopes - see http://docs.shopify.com/api/tutorials/oauth for full listing scope: ShopifyApp.configuration.scope, setup: lambda {|env| params = Rack::Utils.parse_query(env['QUERY_STRING']) site_url = "https://#{params['shop']}" env['omniauth.strategy'].options[:client_options][:site] = site_url redirect_uri = "https://devlopment-store.myshopify.com/admin/apps" } end commit
if !ENV['GITHUB_KEY'].present? || !ENV['GITHUB_SECRET'].present? puts "*" * 80 puts "ENV['GITHUB_KEY'] is NOT SET." puts "ENV['GITHUB_SECRET'] is NOT SET" puts "*" * 80 else puts "GITHUB_SECRET and GITHUB_KEY set" end Rails.application.config.middleware.use OmniAuth::Builder do # provider :developer unless Rails.env.production? require 'openid/store/filesystem' provider :github, ENV['GITHUB_KEY'], ENV['GITHUB_SECRET'] provider :openid, :store => OpenID::Store::Filesystem.new('/tmp') end add some instructions to the startup warning if !ENV['GITHUB_KEY'].present? || !ENV['GITHUB_SECRET'].present? puts "*" * 80 puts "ENV['GITHUB_KEY'] is NOT SET." puts "ENV['GITHUB_SECRET'] is NOT SET" puts "use " pust "$ source github.env.vars" puts "*" * 80 else puts "GITHUB_SECRET and GITHUB_KEY set" end Rails.application.config.middleware.use OmniAuth::Builder do # provider :developer unless Rails.env.production? require 'openid/store/filesystem' provider :github, ENV['GITHUB_KEY'], ENV['GITHUB_SECRET'] provider :openid, :store => OpenID::Store::Filesystem.new('/tmp') end
OmniAuth.config.logger = Rails.logger Rails.application.config.middleware.use OmniAuth::Builder do provider :facebook, '1517142275185874', 'APP-ID' end added app secret OmniAuth.config.logger = Rails.logger Rails.application.config.middleware.use OmniAuth::Builder do provider :facebook, '1517142275185874', 'b69b2474d3c149940a3c08ef83950800' end
module PublishingAPI # To be set in dev mode so that this can run when the draft content store isn't running. cattr_accessor :swallow_connection_errors def self.register_service(name:, client:) @services ||= {} @services[name] = client end def self.service(name) @services[name] || raise(ServiceNotRegisteredException.new(name)) end class ServiceNotRegisteredException < RuntimeError; end end PublishingAPI.register_service( name: :draft_content_store, client: ContentStoreWriter.new(Plek.find('draft-content-store')) ) PublishingAPI.register_service( name: :live_content_store, client: ContentStoreWriter.new(Plek.find('content-store')) ) if ENV['DISABLE_QUEUE_PUBLISHER'] || (Rails.env.test? && ENV['ENABLE_QUEUE_IN_TEST_MODE'].blank?) rabbitmq_config = { noop: true } elsif ENV["RABBITMQ_URL"] && ENV["RABBITMQ_EXCHANGE"] rabbitmq_config = { exchange: ENV["RABBITMQ_EXCHANGE"] } else rabbitmq_config = Rails.application.config_for(:rabbitmq).symbolize_keys end PublishingAPI.register_service( name: :queue_publisher, client: QueuePublisher.new(rabbitmq_config) ) if Rails.env.development? PublishingAPI.swallow_connection_errors = true end # Statsd "the process" listens on a port on the provided host for UDP # messages. Given that it's UDP, it's fire-and-forget and will not # block your application. You do not need to have a statsd process # running locally on your development environment. statsd_client = Statsd.new("localhost") statsd_client.namespace = "govuk.app.publishing-api" PublishingAPI.register_service(name: :statsd, client: statsd_client) Add bearer tokens for content store authentication module PublishingAPI # To be set in dev mode so that this can run when the draft content store isn't running. cattr_accessor :swallow_connection_errors def self.register_service(name:, client:) @services ||= {} @services[name] = client end def self.service(name) @services[name] || raise(ServiceNotRegisteredException.new(name)) end class ServiceNotRegisteredException < RuntimeError; end end PublishingAPI.register_service( name: :draft_content_store, client: ContentStoreWriter.new( Plek.find('draft-content-store'), { bearer_token: ENV['DRAFT_CONTENT_STORE_BEARER_TOKEN'] }, ) ) PublishingAPI.register_service( name: :live_content_store, client: ContentStoreWriter.new( Plek.find('content-store'), { bearer_token: ENV['CONTENT_STORE_BEARER_TOKEN'] }, ) ) if ENV['DISABLE_QUEUE_PUBLISHER'] || (Rails.env.test? && ENV['ENABLE_QUEUE_IN_TEST_MODE'].blank?) rabbitmq_config = { noop: true } elsif ENV["RABBITMQ_URL"] && ENV["RABBITMQ_EXCHANGE"] rabbitmq_config = { exchange: ENV["RABBITMQ_EXCHANGE"] } else rabbitmq_config = Rails.application.config_for(:rabbitmq).symbolize_keys end PublishingAPI.register_service( name: :queue_publisher, client: QueuePublisher.new(rabbitmq_config) ) if Rails.env.development? PublishingAPI.swallow_connection_errors = true end # Statsd "the process" listens on a port on the provided host for UDP # messages. Given that it's UDP, it's fire-and-forget and will not # block your application. You do not need to have a statsd process # running locally on your development environment. statsd_client = Statsd.new("localhost") statsd_client.namespace = "govuk.app.publishing-api" PublishingAPI.register_service(name: :statsd, client: statsd_client)