pred_label stringclasses 2
values | pred_label_prob float64 0.5 1 | wiki_prob float64 0.25 1 | text stringlengths 183 1M | source stringlengths 39 45 |
|---|---|---|---|---|
__label__cc | 0.665368 | 0.334632 | Crime and chiaroscuro: Introduction
This will begin an ongoing series looking at how prominent of a light-dark contrast there is in the visual culture of rising vs. falling-crime periods.
Homicide rates in Europe began their centuries-long decline starting between 1450 and 1550, and lasting up through the present. Stil... | cc/2020-05/en_middle_0069.json.gz/line4 |
__label__cc | 0.715319 | 0.284681 | Blog > Illustration > Maya Stepien: Going Dutch
Illustration, Member News February 23, 2016
Maya Stepien: Going Dutch
Amsterdam-based ADC Member "never gets bored" with her career in illustration
ADC’s Illustration Month — along with the month itself — is drawing to a close, but not without us showcasing a few more ADC... | cc/2020-05/en_middle_0069.json.gz/line5 |
__label__cc | 0.542864 | 0.457136 | Policy-related
News Release (436)
Home>Policy-related News Release>Global
Sustainability certification as a pillar to promote Indonesian coffee competitiveness (18) 2020-01-16
Author: A Wahyudi, S Wulandari, A Aunillah, and JC Alouw IOP Conf. Series: Earth and Environmental Science 418 (2020) 012009 In addition to crop... | cc/2020-05/en_middle_0069.json.gz/line14 |
__label__wiki | 0.514116 | 0.514116 | The explanation of the improvement is where easy. Drug - this opinion is now abandoned by recent pathologists, who look upon the beait as itself a primary seat of rbeomatio inflammation, and it is as commonly afieoted by rheumatism during the continuance of the disease in the joints as at its termination; and Dr. And a... | cc/2020-05/en_middle_0069.json.gz/line16 |
__label__wiki | 0.986183 | 0.986183 | Judges Order Closed Session Amid Contradictory Coup Claims
Thread: Judges Order Closed Session Amid Contradictory Coup Claims
The contradictory testimony of a former soldier about his involvement in an attempted overthrow of Pol Pot led judges at the Khmer Rouge tribunal to close proceedings to the public on Thursday, ... | cc/2020-05/en_middle_0069.json.gz/line17 |
__label__cc | 0.560187 | 0.439813 | Resources + Courses
Brewing in the Cities
Brewing in the Cities Shorts
A Veiled Truth
(The Hunted #2.5)
Amazon, B&N, Kobo, iBooks, Inktera, Oyster
Add the book on Goodreads
A 31,000 word novella set in The Hunted world
She’s about to learn life isn’t like her controlled experiments.
Edie Brown is a lab rat, dedicated t... | cc/2020-05/en_middle_0069.json.gz/line29 |
__label__wiki | 0.809491 | 0.809491 | HOMEPAGE >> BLOG >> Copper Gap Looms as Demand for EV Tech Continues to Surge
Copper Gap Looms as Demand for EV Tech Continues to Surge
By Sandra Wirtz | Posted: May 3, 2018 at 2:03 pm
While just a few short years ago, Rare Earth Element coverage dominated non-fuel mineral resource news cycles, it is the metals and min... | cc/2020-05/en_middle_0069.json.gz/line31 |
__label__wiki | 0.673516 | 0.673516 | Subscribe to my mailing list for updates
Kimbrough & Company
Buy The New Album
Midnight Blue Chicago
The Elec Tet
While most bands seem to exist as self-sustaining music creating machines, The Elec Tet has favored a more "collective" approach to the creative process. Originally conceived as a tribute project, Chicago b... | cc/2020-05/en_middle_0069.json.gz/line33 |
__label__cc | 0.739173 | 0.260827 | It's the Season
From all the staff here at S?nnet Beskerming we wish all our readers a very merry Christmas and a happy New Year. We hope that the security advice and reporting that we have provided to you this year has helped you avoid difficulties, and that it is allowing you to have a peaceful break over the Chr....... | cc/2020-05/en_middle_0069.json.gz/line35 |
__label__wiki | 0.839349 | 0.839349 | The Boom and Bust of Lehman Brothers Is Dramatic, but Not Good Theater
‘The Lehman Trilogy’ promises to tell the rise and fall of an American banking institution, but it is woefully lacking when it comes to charting the disaster that finished it off.
Benedict Nightingale
Updated Jul. 13, 2018 7:57AM ET / Published Jul.... | cc/2020-05/en_middle_0069.json.gz/line44 |
__label__cc | 0.701119 | 0.298881 | PartyPOP > Party Themes > Mardi Gras
Home > Themes > Mardi Gras
This year's company picnic was the best yet. We usually have an ordinary get together at a park or restaurant, but this time the bosses went all out and organized a Mardi Gras themed party.
It took place in the office parking lot. Several tents were brough... | cc/2020-05/en_middle_0069.json.gz/line52 |
__label__cc | 0.730299 | 0.269701 | 100% Design, Culture, Film & Photography, Literature, Music, Music
By Jo Phillips
“He was like a funnel. It was like someone was pouring songs into him and they just continued to spill out of him. Instead of water it was songs.”
Ever think of the colour purple without thinking of Prince? Impossible. Seductive, erotic a... | cc/2020-05/en_middle_0069.json.gz/line59 |
__label__cc | 0.627478 | 0.372522 | Robert Campbell's Home Page
Welcome to my Web pages. This one was last updated on September 10, 2019.
Who Is Robert Campbell, anyway?
I'm a Professor Emeritus in the Psychology Department at Clemson University. I retired in May 2019. I taught at Clemson University for 28 years; before that, I spent five and a half at t... | cc/2020-05/en_middle_0069.json.gz/line73 |
__label__wiki | 0.627352 | 0.627352 | The unintended consequences of green energy: or, why Oakville is in Napanee
by Stephen E. Aplin • September 17, 2018 • 1 Comment
As of around mid-August 2018, a former chief of staff of a former Ontario premier had spent four months in jail for his part in a fiasco known as the Gas Plant Scandal. This fiasco involved t... | cc/2020-05/en_middle_0069.json.gz/line75 |
__label__cc | 0.686324 | 0.313676 | Carrie Lamanna
practicing the art of resistance writing
Righteous Rage
Colorado State, Come Get Your White People
May 15, 2018 By Carrie Lamanna Leave a Comment
Some of you know that I live in Fort Collins, Colorado, but only those of you who are bored enough to read my C.V. know that I worked at Colorado State Univers... | cc/2020-05/en_middle_0069.json.gz/line76 |
__label__cc | 0.602171 | 0.397829 | Texas Charter School Association
Joliet No Longer in Running for Private Immigrant Detention Center
June 5, 2013 1126 Views Baylor University, Dan Patrick, David Dunn, Eastern U.S., GSA, Health Care Risk Management, Texas Charter School Association
JOLIET, Ill. — The Corrections Corporation of American (CCA) announced ... | cc/2020-05/en_middle_0069.json.gz/line91 |
__label__cc | 0.705226 | 0.294774 | Corvid Corner
All about Corvids (Crows, Ravens, Magpies, Rooks, Jays, etc)
Corvid Videos
Copyright © 2020 CorvidCorner.com.
Corvidae in The Bird Book by Chester A. Reed
Posted on March 4, 2013 by MegLeave a comment on Corvidae in The Bird Book by Chester A. Reed
CROWS, JAYS, MAGPIES, ETC. Family CORVIDÆ.
Magpie.
475. M... | cc/2020-05/en_middle_0069.json.gz/line92 |
__label__cc | 0.548246 | 0.451754 | The Cricket Thread, Mark 2
By SirFozzie, July 14, 2013 in SPORTS
SirFozzie 424
Evansville Crimson Giant
Holy shit what a finish, England beat Australia by 14 runs as Australia's last stand falls just short (the final wicket partnership in the two innings nearly provided half of Australia's runs in total)
Been watching ... | cc/2020-05/en_middle_0069.json.gz/line99 |
__label__cc | 0.672538 | 0.327462 | 2014 SHOT Show, Last Day
2014 SHOT Show, Final Day:
The 2014 SHOT Show is now over.
Mood was apprehensive, but upbeat. General consensus is that no federal gun legislation is likely during the balance of the BHO Administration.
Interesting to see that there were a number of manufacturers of gun-making machinery represe... | cc/2020-05/en_middle_0069.json.gz/line100 |
__label__wiki | 0.684978 | 0.684978 | 18-1597-EL-GRD
IN THE MATTER OF THE POWERFORWARD DATA AND MODERN GRID WORKGROUP
OPEN-OPEN
EL-ELECTRIC
GRD-SmartGrid and Advance Metering Applications
12/13/2019 Report Data and Modern Grid Workgroup (DWG) Final Report electronically filed by Mr. Ronald J Chebra on behalf of EnerNex, LLC. 45
11/26/2019 Notice of Withdra... | cc/2020-05/en_middle_0069.json.gz/line107 |
__label__wiki | 0.681666 | 0.681666 | A Friday Musical Interlude
The actual title is "Talking Vietnam Pot Luck Blues"
The Perfect Slice
To the rest of the country this might refer to your half assed golf game, but in The City it means pizza. And in this NY Times article, the perfect slice is served up in Brooklyn, at $5 per.
Di Fara, one of the most acclai... | cc/2020-05/en_middle_0069.json.gz/line114 |
__label__wiki | 0.543864 | 0.543864 | Fearmongering..
From the Brady Campaign:
If they think bankrolling someone to spy on gun violence victims who are trying to strengthen the tragically weak gun laws in the country is acceptable, what else might they be doing?
Well, they're not paying private investigators to try and entrap firearm dealers. They're not i... | cc/2020-05/en_middle_0069.json.gz/line118 |
__label__wiki | 0.73227 | 0.73227 | Argument: There is insufficient political will for military intervention in Darfur
Brooks Lindsay (Talk | contribs)
← Previous diff Current revision (20:00, 15 July 2010) (edit)
Lenkahabetinova (Talk | contribs)
(→Parent debate)
==Parent debate== ==Parent debate==
- *[[Debate:Darfur, military intervention in]] + *[[Deb... | cc/2020-05/en_middle_0069.json.gz/line119 |
__label__wiki | 0.6246 | 0.6246 | 2020 Q1 TV DISCUSSION
TV 2020 Q1 TV DISCUSSION
By RIPPA, January 1 in MOVIES & TV
I was looking for a trailer to start this thread off and I don't think this ever came up
Hits Jan 31
Ragnarok A Norwegian series that blends legends of Norse mythology with a coming-of-age drama, set in the fictional town of Edda where no... | cc/2020-05/en_middle_0069.json.gz/line120 |
__label__wiki | 0.710366 | 0.710366 | 54% of NHIS approved budget released so far – Official
The Minister of Health, Osagie Ehanire has said that only N15.2 billion of the N28 billion allocated to fund the National Health Insurance Scheme (NHIS) in the 2019 budget has been disbursed.
Mr Ehanire made this known at a two-day investigative hearing organised b... | cc/2020-05/en_middle_0069.json.gz/line127 |
__label__cc | 0.510924 | 0.489076 | 6 Sound Settings
Figure 6.1: The sound settings screen
The sound settings menu offers a selection of sound settings you may change to customise your listening experience.
6.1 Volume
6.2 Bass
6.3 Volume Limit
6.4 Treble
6.5 Balance
6.6 Channels
6.7 Stereo Width
6.8 Crossfeed
6.9 Equalizer
6.10 Dithering
6.11 Timestretch... | cc/2020-05/en_middle_0069.json.gz/line130 |
__label__cc | 0.592645 | 0.407355 | Asian firms and the restructuring of global value chains
Azmeh, Shamel and Nadvi, Khalid (2014) Asian firms and the restructuring of global value chains. International Business Review, 23 (4). pp. 708-717. ISSN 0969-5931
Identification Number: 10.1016/j.ibusrev.2014.03.007
Asian trans-national garment manufacturers are... | cc/2020-05/en_middle_0069.json.gz/line133 |
__label__cc | 0.545249 | 0.454751 | Guest Review: Dead West Omnibus Vol. 1 by Tim Marq...
GIVEAWAY: The Weird West bundle curated by Blair M...
BLOG TOUR AND GIVEAWAY: The Gate of Futures Past b...
Mini-reviews: The Devils of Cardona by Matthew Car...
"Click Here to Start" by Denis Markell (Reviewed b...
BLOG TOUR: Read an Excerpt of Chapter 1 of Spellbr... | cc/2020-05/en_middle_0069.json.gz/line137 |
__label__wiki | 0.760908 | 0.760908 | The Politics of Hanging Kasab
A Final Goodbye to 26/11?
Counterpunch, November 22
They dug a pit right there and buried him. They wanted no trouble. When people in charge of running a nation get worried about a terrorist who has been in their custody for four years and was on death row, it is time to pause.
The Governm... | cc/2020-05/en_middle_0069.json.gz/line138 |
__label__wiki | 0.830535 | 0.830535 | 3.00pm Wednesday 26th December 2018
Lynch 15 Carver 7, 76
Wilson 61, 65
Lynch 15
Carver 7, 76
14 Tom Peers (for 11, 57 mins)
16 Jack Banister (for 9, 69 mins)
1 Tony McMillan
6 Stephen Jordan
12 Jake Cottrell (for 7, 69 mins)
14 James Hooper (for 4, 77 mins)
15 Courtney Meppen-Walter (for 6, 40 mins)
FC United beaten b... | cc/2020-05/en_middle_0069.json.gz/line139 |
__label__wiki | 0.579795 | 0.579795 | News/ Blog
Group Relations Event for the Silver Generation
sam_TF 26th June 2017 Friday 20 October, Home Page, Thursday 19 October, Transacting with the future, Tuesday 17 October, Wednesday 18 October
A group relations event for people aged 70-years or older was held over four mornings – Tuesday 17th October to Friday... | cc/2020-05/en_middle_0069.json.gz/line140 |
__label__wiki | 0.656741 | 0.656741 | Not only Garmin Asus, Dell was interested in launching mobile phones based on Android operating system. Dell Streak, also known as the Dell Mini 5 will present the design tablet device with a larger screen size, which is five inches such as apple ipad
"Dell Streak will be present with a combination of traditional smart... | cc/2020-05/en_middle_0069.json.gz/line148 |
__label__wiki | 0.737972 | 0.737972 | North Edinburgh, between Silverknowes
and West Pilton, close to the Firth of Forth
Graeme Charles Munro
Graeme wrote:
"I remember living in Pennywell during the 'war years. We had backgreen concerts and gas lamps in the street, and in the house. I remember:
- the army barracks along the road, firing big guns at planes,... | cc/2020-05/en_middle_0069.json.gz/line152 |
__label__wiki | 0.928095 | 0.928095 | Mixx Facebook Twitter Digg delicious reddit MySpace StumbleUpon
Future of online news may be 'hyperlocal'
As newspapers hemorrhage writers, "hyperlocal" Web sites try to fill the void
The sites tend to focus online on local and community issues
Observers say those topics have been ignored by big media companies
The sit... | cc/2020-05/en_middle_0069.json.gz/line153 |
__label__cc | 0.553727 | 0.446273 | Editor-in-Chief Nilufar R. Avezova
Dr. Sci. (Physical-Technical Institute of SPA “Physics-Sun” of Uzbekistan Academy of Sciences, Tashkent, Uzbekistan)
Deputy Editor-in-Chief Romen A. Zakhidov
Acad., Dr. Sci. (“Scientific and Technical Center” Ltd. under JSC «Uzbekenergo», Tashkent, Uzbekistan)
Yorkin S. Abbasov
Dr. Sc... | cc/2020-05/en_middle_0069.json.gz/line164 |
__label__cc | 0.657208 | 0.342792 | Copywriting Testimonials
Interview: Mathilde Allibe, CEO of SECRETCAPE
SECRETCAPE is the Mayfair-based design and architecture firm that creates multi-million pound interiors for royals, billionaires and celebrities. Gina Baksa meets its founder and visionary CEO, Mathilde Allibe
As elegant and enigmatic as the Secretc... | cc/2020-05/en_middle_0069.json.gz/line186 |
__label__cc | 0.721121 | 0.278879 | I love my Order dearly, but one can refer to deficiencies in one's own 'family,' and I freely admit that the homely, moving images Franciscans have given to popular devotion can make the divine Logos fade into the shadows of a carpenter's shop alone. :) It is not that I do not find popular images of the infancy narrati... | cc/2020-05/en_middle_0069.json.gz/line187 |
__label__cc | 0.676889 | 0.323111 | I B B Y T A R A F D A R
Home » PORTFOLIO » Unanimous Games Logo Design
Based out of New York City, Unanimous Games is a full service esports company bridging the gap between the esports industry and the entertainment world.
Unanimous Games specialises in developing branded content, sponsored activations, data analytics... | cc/2020-05/en_middle_0069.json.gz/line191 |
__label__cc | 0.745667 | 0.254333 | united press international (115)
bottomer, fred (35)
acme photo (25)
acme newspictures (new york, n.y.) (19)
bartimole, roldo (17)
tepley, paul (10)
culek, timothy (8)
nash, john (7)
cleveland browns (football team : 1946-1995) (283)
brown, jim (39)
new york giants (football team) (31)
cleveland browns (football team :... | cc/2020-05/en_middle_0069.json.gz/line196 |
__label__wiki | 0.872272 | 0.872272 | humel, chuck (photographer) (28)
cleveland state university. office of information services. (2)
long, stephen (1)
mastroianni, tony (1)
on campus (cleveland state university) (1)
quinn, lorry (1)
rude, stephan (1)
towns, martha (1)
8.5 x 11 in. (5)
theatrical productions (42)
the consequences of being wilde (21)
memor... | cc/2020-05/en_middle_0069.json.gz/line197 |
__label__wiki | 0.745369 | 0.745369 | Your source for great indie RPGs
Back to back: indie RPGs to fund
Posted in November 6, 2013 ¬ 2:29 pmh.Craig Stern4 Comments »
It’s been a while since we last did a Back to Back! So let’s find out: what’s new in the world of indie RPG crowdfunding?
The casualty rate on campaigns from our last edition was incredibly hi... | cc/2020-05/en_middle_0069.json.gz/line201 |
__label__wiki | 0.787156 | 0.787156 | Voice Talent/ Actress
Jamie Johns: "You are a talent bomb!"
Jill Jensen is an outstanding jazz vocalist
accompanied by jazz guitarist Jack Grassel.
The duo is known as
Jack and Jill Jazz
See them perform:
http://www.youtube.com/watch?v=Za6HuaJtrAQ
See her schedule for performance information.
May 17, 2012 Shepherd Expr... | cc/2020-05/en_middle_0069.json.gz/line205 |
__label__wiki | 0.705953 | 0.705953 | Miami New Times: A Miami Clinic Supplies Drugs to Sports' Biggest Names
Open the neat spreadsheet and scroll past the listing of local developers, prominent attorneys, and personal trainers. You'll find a lengthy list of nicknames: Mostro, Al Capone, El Cacique, Samurai, Yukon, Mohamad, Felix Cat, and D.R.
Then check o... | cc/2020-05/en_middle_0069.json.gz/line217 |
__label__cc | 0.681178 | 0.318822 | Blood Test Reveals the Time Inside You
By Elizabeth Preston on Monday, August 27, 2012
Like flowers opening and closing with the sun, our bodies have a rhythm that follows the daily turning of the earth. Processes speed up and slow down; hormones rise and fall; we feel wakeful or tired. But our internal clocks aren't a... | cc/2020-05/en_middle_0069.json.gz/line223 |
__label__cc | 0.519279 | 0.480721 | 2014/07/11 - Winston Farm; Saugerties, NY, US
Satin In A Coffin
A Different City
Sugar Boats
Cowboy Dan
Shit Luck
3rd Planet
The Good Times Are Killing Me
Tiny Cities Made Of Ashes
Fly Trapped In A Jar
The Hudson Project
1994 | 1995 | 1996 | 1997 | 1998 | 1999 | 2000 | 2001 | 2002 | 2003 | 2004 | 2005 | 2006 | 2007 | 2... | cc/2020-05/en_middle_0069.json.gz/line228 |
__label__wiki | 0.768173 | 0.768173 | Julius Baer expands its presence in Italy with the opening of an office in Rome
Thursday, 09. December 2010 07:00
Julius Baer Group Ltd. /
Processed and transmitted by Thomson Reuters.
The issuer is solely responsible for the content of this announcement.
Milan, 9 December 2010 --- Julius Baer, the leading Swiss privat... | cc/2020-05/en_middle_0069.json.gz/line231 |
__label__wiki | 0.956058 | 0.956058 | Keltron bags new defence order worth Rs 8.37 Crs
Semi High-Speed Rail Line: Aerial survey commences in Kannur
CIAL registers Rs.166.92 cr net profit, pays Rs.33.49 cr dividend to Kerala Government
Tamara Hospitality Group launches its first 5-star hotel in Kerala
Trivandrum’s Chalai Bazaar gets a digital tribute
Muthoo... | cc/2020-05/en_middle_0069.json.gz/line237 |
__label__cc | 0.5761 | 0.4239 | BIOGRAPHICAL SKETCH
Frank Odasz, M.A., President and CEO, Lone Eagle Consulting, Dillon, Montana
Born in Cody, Wyoming, in 1952, Frank Odasz has been a carpenter, oil field roughneck, dude ranch manager, college professor and is now a “Lone Eagle” – that is, an independent instructional entrepreneur living on a ranch e... | cc/2020-05/en_middle_0069.json.gz/line243 |
__label__cc | 0.624101 | 0.375899 | LROC updates image tally of human artifacts on the Moon
Luna 17, the spacecraft that carried the Lunokhod-1 rover to the surface of the Moon; debarking ramps for the rover tracks around the lander are visible, extending southeast, to the right. LROC Narrow Angle Camera (NAC) frame M175502049RE, LRO orbit 10998, Novembe... | cc/2020-05/en_middle_0069.json.gz/line249 |
__label__wiki | 0.682373 | 0.682373 | Mosaic Wellness raises USD 10 million from Matrix Partners India and others
26th November 2019. Mumbai: Mosaic Wellness announced today that it has raised USD 10 million from Matrix Partners India, Sequoia Capital, SAIF Partners as well as a host of prominent angel investors such as Kunal Shah, Jitendra Gupta, Jaydeep ... | cc/2020-05/en_middle_0069.json.gz/line254 |
__label__cc | 0.60526 | 0.39474 | Memoirs of General Andrew Jackson : together with the letter of Mr. Secretary Adams, in vindication of the execution of Arbuthnot & Ambrister, and the other public acts of Gen. Jackson in Florida
The Resource Memoirs of General Andrew Jackson : together with the letter of Mr. Secretary Adams, in vindication of the exec... | cc/2020-05/en_middle_0069.json.gz/line258 |
__label__cc | 0.698348 | 0.301652 | OIO Project delivers Physician-Customizable Forms, Schedules, and Workflows
Imagine a new U.S. federal law mandating that all physicians practicing in the U.S.A. must use DHS2004 form to document each encounter with their patients. How much inefficiency would this introduce into the medical workflow? Can a single form ... | cc/2020-05/en_middle_0069.json.gz/line261 |
__label__wiki | 0.783537 | 0.783537 | Land Rover would like to use cookies to store information on your computer to improve our website and to enable us to advertise to you those products and services which we believe may be of interest to you. One of the cookies we use is essential for parts of the site to work and has already been sent. You may delete an... | cc/2020-05/en_middle_0069.json.gz/line262 |
__label__wiki | 0.648244 | 0.648244 | Tag Archive | "Mauresmo"
Tags: Agnieszka Radwanska, All England Club, Azarenka, Bartoli, Eastbourne, Henin, Kvitova, Lisicki, Mauresmo, Osaka, Seles, Serena, Sharapova, Stephens, Venus, Williams, Wimbledon, WTA
Bartoli Joins the Majors Club by Winning Wimbledon
Without questions, this denouement to the ladies’ draw was... | cc/2020-05/en_middle_0069.json.gz/line266 |
__label__cc | 0.539943 | 0.460057 | Additive’s Time is Now
Additive manufacturing has already caught the attention of governments across the Middle East and North Africa, who are looking at ways to promote adoption of the technology in their countries.
It’s also very much on the minds of the private sector as well, says Moemen Kassem, general manager, sa... | cc/2020-05/en_middle_0069.json.gz/line267 |
__label__cc | 0.746467 | 0.253533 | KLASS Home
About KLASS
Testing and Linkage to Care
Empowerment and Literacy
Policy Advice and Legal Support
enquiries@myklass.org
2 Notable Humanitarians, On The How, Where & Why We Are Closer To Ending AIDS
Homepage News 2 Notable Humanitarians, On The How, Where & Why We Are Closer To Ending AIDS
The first step, acco... | cc/2020-05/en_middle_0069.json.gz/line271 |
__label__wiki | 0.5082 | 0.5082 | Home › World premiere for Byton's M-Byte SUV in Frankfurt
World premiere for Byton's M-Byte SUV in Frankfurt
Byton, the Chinese premium brand for smart electric vehicles, unveiled its first vehicle, the M-Byte SUV at the IAA Frankfurt. With the innovative M-Byte cockpit, centered around the 48-inch-wide curved Display ... | cc/2020-05/en_middle_0069.json.gz/line273 |
__label__wiki | 0.884979 | 0.884979 | More info on London Midland
London Midland: Map
Categories: Train operating companies > Go-Ahead Group companies > Companies established in 2008
A map of the London Midland Network
London Midland Express route map
London Midland City route map
London Midland is a train operating company in the United Kingdom . Legally ... | cc/2020-05/en_middle_0069.json.gz/line275 |
__label__wiki | 0.766152 | 0.766152 | Wikipedia Information
Showing 1 - 1 of 1 annotations associated with Bentley, Wes
Mendes, Sam; Bening, Annette; Birch, Thora; Bentley, Wes; Cooper, Chris; Spacey, Kevin; Suvari, Mena
Last Updated: Aug-15-2000
Nixon, Lois LaCivita
Human Worth
Lesbian/Gay/Bisexual/Transgender Issues
American Beauty, a story about Lester ... | cc/2020-05/en_middle_0069.json.gz/line276 |
__label__cc | 0.736412 | 0.263588 | Published: May 6th, 2013
Enter the world of Will Lesterall, a boy who's grown up in the safety of his father's castle. Tales of the outside world ruled by warring kings and creatures of nightmare have never seemed a threat, yet on the night celebrating the two hundredth year of the sacred Pact that has kept Fort Lester... | cc/2020-05/en_middle_0069.json.gz/line280 |
__label__wiki | 0.862216 | 0.862216 | Russian Oil Majors Raise Output From Refineries
By Iain Pocock
LONDON -- Shipments from the former Soviet Union of gasoline, naphtha and other light products are set to keep rising as Russian oil companies upgrade their refineries to tap into surging global demand for the high-value fuels and to diversify their assets,... | cc/2020-05/en_middle_0069.json.gz/line283 |
__label__wiki | 0.615446 | 0.615446 | Onco Actu du 10 janvier 2017
1.1 Biologie - Gènes
Researchers reveal how cancer cells cope with genetic chaos [The Francis Crick Institute]
Scientists have uncovered how tumours are able to grow despite significant damage to the structure and number of their chromosomes - the storage units of DNA - according to two new... | cc/2020-05/en_middle_0069.json.gz/line284 |
__label__cc | 0.500534 | 0.499466 | Delroy Wilson Radio
Play All Top Tracks
Rain From The Skies - Original
Miss Grace
Better Must Come
Never Will Conquer Me - Original
Reggae Legends: Delroy Wilson
Not many vocalists could claim to have had hits in the Ska, Rock Steady, Roots Reggae, Lovers Rock and Dancehall eras, but the late Delroy Wilson did just tha... | cc/2020-05/en_middle_0069.json.gz/line288 |
__label__wiki | 0.531651 | 0.531651 | You are here: Home / Pageant News / Miss Central Massachusetts Beauty Pageant 2012 invites applicants
Miss Central Massachusetts Beauty Pageant 2012 invites applicants
Miss Central Massachusetts Beauty Pageant 2012
Divisions winners will advance to participate as a delegates representing Central Massachusetts at the Mi... | cc/2020-05/en_middle_0069.json.gz/line292 |
__label__cc | 0.508943 | 0.491057 | It Takes a Rocket Scientist...
Picture day! Keeping the text to a minimum , because this amazing photograph truly speaks for itself (well, that and I have writer's block... but this is still tremendously cool).
The Saturn V, at just under 50 meters, remains the largest rocket ever built by the human race... which is no... | cc/2020-05/en_middle_0069.json.gz/line296 |
__label__cc | 0.728157 | 0.271843 | The solar spectrum extends on a broad range wavelengths, since the tenth of nanometer (nm) until the meter. In the visible one - with 390 to 760 Nm, it radiates with a maximum around 450 Nm, i.e. in blue. Let us not mistake! The Sun is not blue for as much! The mixture of all the colors, the absorption of the light by ... | cc/2020-05/en_middle_0069.json.gz/line297 |
__label__cc | 0.687952 | 0.312048 | Rookie Blue News
Rookie Blue Reviews
Rookie Blue Spoilers
Rookie Blue Watch Online
Rookie Blue Episode Guide
Rookie Blue Quotes
Rookie Blue Cast
Rookie Blue Pictures
Rookie Blue Videos
Rookie Blue Round Tables
Follow Rookie Blue
Rookie Blue Twitter
Rookie Blue Round Table: Nick's Romantic Options
Christine Orlando at J... | cc/2020-05/en_middle_0069.json.gz/line299 |
__label__wiki | 0.540027 | 0.540027 | View DONNIE MCCLURKIN "THERE IS GOD"
Words from the Publisher
Path TV
Path Shows
Path Radio
The Gospel View
Musicians Spotlight
Spirit Food
Path Store
Login with your username/password to get unlimited article access.
Sign-Up with your username/password to get unlimited article access.
Registration confirmation will be... | cc/2020-05/en_middle_0069.json.gz/line304 |
__label__cc | 0.747813 | 0.252187 | 1300 block of Girard: the crappiest block in the neighborhood?
The other day I was walking along Girard, and noticed that the northern side of the 1300 block is really in bad shape: out of 7 buildings, 1 is abandoned and being renovated (slowly), another is empty and being renovated, two are in pretty bad shape, and 1 ... | cc/2020-05/en_middle_0069.json.gz/line307 |
__label__wiki | 0.528993 | 0.528993 | Babies have logical reasoning before age one, study finds
By Carol Clark | eScienceCommons | Nov. 18, 2015
Science, Research, Emory College, Psychology
Human infants are capable of deductive problem solving as early as 10 months of age, a new study finds. The journal Developmental Science is publishing the research, sh... | cc/2020-05/en_middle_0069.json.gz/line308 |
__label__wiki | 0.65533 | 0.65533 | — Albums
— EP & Mixtapes
— Electronic
— Hip Hop
— Pop
— R&B
— Behind The Scenes
— Live Performances
— Music Videos
EP & Mixtapes
Mac Miller – “Headaches + Migraines” (ft. Dave East)
Natalie Barman, 04.21.16 @ 10:00am EST
Singles Dave East, Headaches + Migraines, Mac Miller
As most of America celebrated 4/20, Mac Miller... | cc/2020-05/en_middle_0069.json.gz/line310 |
__label__cc | 0.668659 | 0.331341 | Noahide Ancient Path
"O L-RD, Who are my power and my strength and my refuge in the day of trouble, to You nations will come from the ends of the earth and say, 'Only lies have our fathers handed down to us, emptiness in which there is nothing of any avail! Can a man make gods for himself, and they are no gods? 'Theref... | cc/2020-05/en_middle_0069.json.gz/line311 |
__label__wiki | 0.781019 | 0.781019 | Friday, 1 June, 2007
MODERNISTS do not have faith in the existence of a heaven, or a hell and the like; they expect proof of everything.
An advocate from Madurai once asked Bhagavan if there were devatas and bhutas really.
Bhagavan: Yes. Yet their lokas like our own are only relative truths.
Advocate: So, are Siva and ... | cc/2020-05/en_middle_0069.json.gz/line326 |
__label__wiki | 0.661429 | 0.661429 | Death and Flying at the Vancouver International Dance Festival
My colleague Rob Kitsos's latest work, a duet created with and for dancers Jane Osborne and Kim Stevenson (both of them former students of Rob's), debuted last night at the Roundhouse as part of this year's Vancouver International Dance Festival. Death and ... | cc/2020-05/en_middle_0069.json.gz/line329 |
__label__cc | 0.644602 | 0.355398 | Home→NBA→Philadelphia 76ers→Devin Booker shoots down the Sixers
← Irving leads Celtics past Embiid-less Sixers
PFB 014 – 2017 NFL Week 14 Plays →
Devin Booker shoots down the Sixers
Posted on December 4, 2017 by Sean Kennedy
https://twitter.com/sixers/status/937870004778930176
Phoenix 115, Philadelphia 101 – Box Score
... | cc/2020-05/en_middle_0069.json.gz/line334 |
__label__cc | 0.551509 | 0.448491 | Labour pledges ‘moral mission’ to save lives this Christmas and end rough sleeping
Jeremy Corbyn, Leader of the Labour Party, and John Healey, Shadow Housing Secretary, have criticised the Conservatives for being “directly responsible” for people living and dying on the country’s streets, and pledged a national “moral ... | cc/2020-05/en_middle_0069.json.gz/line342 |
__label__cc | 0.643264 | 0.356736 | Sunspots & Climate
Roanoke Times, 4/29/07, Pg Horiz 5: Very large article and graphics: Airplanes, Oil rigs, Astronauts, Satellites. By R. Schmid at AP.
Isn’t it interesting that with all the details in this large article about those who are concerned about the earth-impacts of sunspot-cycles the author “forgot” to men... | cc/2020-05/en_middle_0069.json.gz/line350 |
__label__cc | 0.567213 | 0.432787 | FamilySearch Updates: USA Materials in ME, IA, CA, and WA
The following databases are showing as updated on FamilySearch since our last update:
Maine, Nathan Hale Cemetery Collection, ca. 1780-1980
Iowa, County Death Records, 1880-1992
California, San Francisco Passenger Lists, 1893-1953
Washington, County Records, 180... | cc/2020-05/en_middle_0069.json.gz/line355 |
__label__cc | 0.703002 | 0.296998 | Archives Selecionar o mês janeiro 2020 (10) dezembro 2019 (18) novembro 2019 (20) outubro 2019 (20) setembro 2019 (22) agosto 2019 (22) julho 2019 (15) junho 2019 (20) maio 2019 (18) abril 2019 (14) março 2019 (16) fevereiro 2019 (20) janeiro 2019 (18) dezembro 2018 (12) novembro 2018 (26) outubro 2018 (29) setembro 20... | cc/2020-05/en_middle_0069.json.gz/line359 |
__label__wiki | 0.500025 | 0.500025 | Campaign Information
War of the Burning Sky is a 4th edition Dungeons & Dragons campaign based on the D&D 3.5 adventure path published by ENPublishing. It has been substantially changed and adapted by Robin Monogue (Zinovia on ENWorld) with assistance from the ENWorld community. For more information on War of the Burni... | cc/2020-05/en_middle_0069.json.gz/line360 |
__label__wiki | 0.670208 | 0.670208 | Manchester United, News
Man Utd Reportedly Hold No Interest In Elegant Defender
July 27, 2014 Spoughts Leave a comment
Manchester United are reportedly not targeting a move for Feyenoord’s Dutch defender Stefan de Vrij, despite consistent rumours that Louis van Gaal was interested in bringing his national team stalwart... | cc/2020-05/en_middle_0069.json.gz/line364 |
__label__wiki | 0.590624 | 0.590624 | Shakshat Virtual Lab
INDIAN INSTITUTE OF TECHNOLOGY GUWAHATI
Sampling and signal reconstruction
Procedure for Sampling experiment
Exp-4(a) Sampling of band limited signal : Nyquist theorem
Exp-4(b) Sampling of non bandlimited signal : Anti aliasing filter
Exp-4(c) Signal reconstruction from its samples
Exp-4(d) Frequen... | cc/2020-05/en_middle_0069.json.gz/line365 |
__label__cc | 0.66152 | 0.33848 | Home » Newswire » Hidden from history: Indigenous women’s activism in Saskatchewan – The Conversation CA
Hidden from history: Indigenous women’s activism in Saskatchewan – The Conversation CA
by ahnationtalk on January 14, 201999 Views
Although Indigenous activism in Canada has a long history, the origin stories of off... | cc/2020-05/en_middle_0069.json.gz/line368 |
__label__wiki | 0.691658 | 0.691658 | The domain within your query sequence starts at position 715 and ends at position 748; the E-value for the EGF domain shown below is 1.32e-5.
QCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTCT
Epidermal growth factor-like domain.
A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth fac... | cc/2020-05/en_middle_0069.json.gz/line369 |
__label__wiki | 0.940084 | 0.940084 | Drake King In the North
Whether you call him Drizzy Drake, the Boy, 6 God, Do Right and Kill Everything or one of the several adopted names he's cooked up, Drake ha...
Tap, Tap Coalition 'Loud on Planet X' Merges Indie Music and Indie Gaming
You may've seen Fucked Up's Damian Abraham rip his shirt off and jump into the... | cc/2020-05/en_middle_0069.json.gz/line371 |
__label__wiki | 0.922448 | 0.922448 | Fractious LP eyes big pie EDITORIAL 07/30/2010
Fractious LP eyes big pie
The Liberal Party (LP) is trying to throw its weight around in the ongoing tussle at the Senate for prime committee posts with its members seeking to corner the most sought-after chairmanships, drawing the comment from Sen. Joker Arroyo that it wa... | cc/2020-05/en_middle_0069.json.gz/line390 |
__label__cc | 0.516246 | 0.483754 | Teamsters Reveal CP’s True Intentions
Laval, QC, April 14, 2018 – In a press release replete with fabrication and innuendo, Canadian Pacific (CP) last night claimed it was trying to negotiate in good faith with the Teamsters Canada Rail Conference (TCRC). The reality is that the company is attempting to manufacture a c... | cc/2020-05/en_middle_0069.json.gz/line393 |
__label__wiki | 0.656702 | 0.656702 | ATI RADEON 9700 PRO 8X AGP DRIVER
The first thing you’ll probably be wondering about is the floppy drive power connector on the right hand side of the card. See details for additional description. To outsiders this seemed like a bad idea; but when the ‘R’ Radeon Pro was officially announced in July the world was in sto... | cc/2020-05/en_middle_0069.json.gz/line394 |
__label__cc | 0.733366 | 0.266634 | Home > Learning > Programmes and courses > Search for a programme
BackProgrammes and courses
Search for a programme
Semester and examination dates
Why choose Massey?
Academic Advice events
Meet the Academic Advisers
Planning your study
Internal students
Programme types
Changing and withdrawing from study
Maximum studen... | cc/2020-05/en_middle_0069.json.gz/line395 |
__label__wiki | 0.923648 | 0.923648 | 上海千花网,爱上海,上海419论坛 – Powered by Sydnie Asad!
Category: dejkrcbh
dejkrcbh
Strangled man ID’d by mother
The man who was strangled to death on Saturday night on Church Street, Queenstown, Georgetown, after being involved in a fight with another man has been identified as 32-year-old Jason Jabharry Bowen.According to Police... | cc/2020-05/en_middle_0069.json.gz/line400 |
__label__wiki | 0.992372 | 0.992372 | Top 10 Best Known Art Images
Top 10 Best Known Art Images Top 10 Best Known Art Images (10) The Scream (9) Persistence Of Memory (8) Sunflowers (7) The Great Wave Off Kanagawa (6) Blue Willow…
Top 10 Silver Producers By Country
Top 10 Silver Producers By Country Top 10 Silver Producers By Country (10) Argentina (9) Rus... | cc/2020-05/en_middle_0069.json.gz/line401 |
__label__cc | 0.651721 | 0.348279 | Somalis giving birth in Sweden: a challenge to culture and gender specific values and behaviours.
Wiklund, H
Umeå University, Faculty of Medicine, Department of Clinical Sciences, Obstetrics and Gynaecology.
Aden, A S
Högberg, U
Wikman, M
Dahlgren, L
2000 (English)In: Midwifery, ISSN 0266-6138, E-ISSN 1532-3099, Vol. 1... | cc/2020-05/en_middle_0069.json.gz/line403 |
__label__cc | 0.639424 | 0.360576 | UNC Councillors
— Top Menu —HomeAnnouncementsDocumentsEventsGov’t AchievementsUNC Councillors
— Main Menu —HomeAbout UNC- Political Leader- UNC Founder- UNC NatexContactGallery- Projects- Video GalleryLinksMeet The CandidatesNews- Commentary- Letters- Press Releases- Speeches- TestimoniesVolunteerYouth ArmKamla2015
Abo... | cc/2020-05/en_middle_0069.json.gz/line404 |
__label__cc | 0.708002 | 0.291998 | Meet Your Neighbors
Wash Park Open House
Tiny Changes
KRISTEN HATGI SINK: HONEY
ArtCulture0 Comments 0
THRU AUGUST 26
– MCA Denver
Honey is an exhibition of new work by Denver-based photographer Kristen Hatgi Sink. Sink has created a series of videos featuring the exhibition’s eponymous sticky substance—dripping and po... | cc/2020-05/en_middle_0069.json.gz/line405 |
__label__wiki | 0.664515 | 0.664515 | As Solar Industry Expands, Arizona's Corporate Commission Eases Restrictions
By Lauren Gilger, Mark Brodie
Published: Thursday, October 31, 2019 - 1:57pm
Updated: Thursday, October 31, 2019 - 6:16pm
corp-comm-solar-show-20191031.mp3
Download mp3 (16.11 MB)
storyblocks.com
Kayenta I and Kayenta II combined will produce ... | cc/2020-05/en_middle_0069.json.gz/line409 |
__label__wiki | 0.69253 | 0.69253 | Tag: 上海楼凤FB
Mumbai India – Reported by Elite Traveler the Pr
Mumbai, India – Reported by Elite Traveler, the Private Jet Lifestyle MagazineTaj Hotels, Resorts and Palaces has added another authentic Indian palace to its luxury hospitality portfolio. Newly resplendent after 10 years of sensitive renovation, Taj Falaknum... | cc/2020-05/en_middle_0069.json.gz/line410 |
__label__wiki | 0.62822 | 0.62822 | Syria: Reports that the US air-strike on Saturday killed hundreds of Russian mercenaries
(Deir Ezzor) It was reported over the weekend that the US carried out airstrikes on Syrian militia who had had decided to cross into SDF (Kurdish) territory in which grab an oil field which just happened to be there. The story goes... | cc/2020-05/en_middle_0069.json.gz/line412 |
__label__cc | 0.612555 | 0.387445 | A Bout
Cross Words
Horror Scopes
Sukodu
THE TRUTHA BoutBook MarksCross WordsHorror ScopesSukodu
NewsOpinionWeatherMusicAdvertisementsGalleriesFirst edition
Breaking News: ITV to merge with Press Association...
You Are Here: Home » News » Cameron Bald Patch ‘Should Definitely Not Be Used As a Metaphor’
Cameron Bald Patc... | cc/2020-05/en_middle_0069.json.gz/line413 |
__label__cc | 0.552443 | 0.447557 | thecowponies.com
OLD COUNTRY • ALT COUNTRY • COW PUNK • ORIGINALS by JOHN GRAHAM
BAND + PHOTOS
The Cow Ponies is a Milwaukee-based band founded by music veteran John Graham in 2015. Our set list includes both original music written by John (guitar, vocals) and Tom T (bass, vocals), along with old country, alt country, ... | cc/2020-05/en_middle_0069.json.gz/line415 |
__label__wiki | 0.826576 | 0.826576 | Printable Version of This Page
Lobby moves, new hires, new projects, and more
The first unmarked envelope of 2020 from a campaign – or at least, tangentially connected to a campaign – has arrived at the Quorum Report offices. Primary season must be really be starting now. “Stressed out, getting fat, it’s campaign seaso... | cc/2020-05/en_middle_0069.json.gz/line416 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.