pred_label stringclasses 2
values | pred_label_prob float64 0.5 1 | wiki_prob float64 0.25 1 | text stringlengths 113 974k | source stringlengths 39 45 |
|---|---|---|---|---|
__label__wiki | 0.665441 | 0.665441 | Buy Hudson River School
posters online. Click here!
Frederick Church
Asher B. Durand
John F. Kensett
(Thomas Moran)
Books on the Hudson River School
Painters of Faith
by Gene Veith.
American Paradise: The World of the Hudson River School
Metropolitan Museum of Art exhibition catalog.
by Trewin Copplestone.
Knights of t... | cc/2020-05/en_middle_0096.json.gz/line5 |
__label__cc | 0.651527 | 0.348473 | Service Employees International Union Oral Histories
The collections consists of 31 interviews. Transcripts exist for all but the Andy Stern interview. Audio recordings exist for all but the following interviews: Cooper, Eliaser, Glenn (UCLA), Hannon, Levey (individual), Liebes, Neal, and Smiley. The Pat Ford interview... | cc/2020-05/en_middle_0096.json.gz/line7 |
__label__wiki | 0.627203 | 0.627203 | Home | Updates | Join | Donate
About AWTW
Bringing Pompeii back to life
There are few ancient places that have the fascination of Pompeii. Corinna Lotz reviews a spectacular British Museum exhibition
Pompeii, Bay of Naples, Italy, 2012
Herculaneum, Bay of Naples, Italy, 2012
Pompeii has exercised a huge influence on th... | cc/2020-05/en_middle_0096.json.gz/line8 |
__label__cc | 0.701605 | 0.298395 | Text Detail
Iterated Nonlinear Functions as a Sound-Generating Engine
Di Scipio, A. 2001. "Iterated Nonlinear Functions as a Sound-Generating Engine." Leonardo 34(3): pp. 249-254.
Di Scipio, Agostino
Copyright 1996-2013 Christopher Ariza.
“The danger is great of letting oneself be trapped by the tools and of becoming s... | cc/2020-05/en_middle_0096.json.gz/line10 |
__label__cc | 0.694807 | 0.305193 | Gamma, not Omega
It appears the Chateau was correct. Andreas Lubitz was an embittered and heartbroken Gamma male, not a rage-filled Omega:
Maria told the German newspaper Bild: "We got to know each other last year on a flight and exchanged numbers, then stayed in contact. We met in hotels, but it was difficult because ... | cc/2020-05/en_middle_0096.json.gz/line14 |
__label__wiki | 0.828629 | 0.828629 | Max Planck Institute for Mathematics in the Sciences, Sofja Kovalevskaja Research Group
[PD] Postdoc
[PDRNAWORLD] Postdoc (2020/03/01)
IFW Dresden, Institute for Theoretical Solid State Physics
[PHD1] PhD Student
Max Planck Institute for Gravitational Physics, Astrophysical and Cosmological Relativity
[POSTDOC1] Four-y... | cc/2020-05/en_middle_0096.json.gz/line17 |
__label__cc | 0.504296 | 0.495704 | Alternate Best Supporting Actor 1975: Leon Vitali in Barry Lyndon
Leon Vitali did not receive an Oscar nomination for portraying Lord Bullingdon in Barry Lyndon.
Barry Lyndon tells the misadventures of a Irishman who attempts to move up the social latter during the 18th Century. It has plenty of great moments, but it i... | cc/2020-05/en_middle_0096.json.gz/line20 |
__label__wiki | 0.592406 | 0.592406 | People and their Memories
Handsworth
Entertainment and Sport
Books and Poems
Wartime Aston
Groups and Associations
Research and Thanks to Sheridan. contact http://www.teasmade.com
It seems quite likely that young Frank would have followed his father and eldest brother into the gun making trade. Chris Upton, Senior Lect... | cc/2020-05/en_middle_0096.json.gz/line21 |
__label__wiki | 0.749754 | 0.749754 | Melkite Icons
The following article is about Orthodox and Greek Catholic iconography in the Middle East is taken from the November/December 1971 Saudi Aramco World, of all places. Actually, though, being Saudis, they like to throw their money around, so if you send them a request, they'll subscribe you to their magazin... | cc/2020-05/en_middle_0096.json.gz/line25 |
__label__cc | 0.667836 | 0.332164 | Nevezis brush aside Liepaja/Triobet
KEDAINIAI – In the last game of the month, Nevezis registered a confident 92-75 victory against the visiting Liepaja/Triobet at home on Thursday evening in Group B action.
The win allowed the Lithuanian side to improve to a 3-0 record in the BBL, while the team from Liepaja lost for ... | cc/2020-05/en_middle_0096.json.gz/line28 |
__label__cc | 0.59899 | 0.40101 | Definition of long rail
Long rail
Same as side rail.
Billiards Pool Table Billiard Ball Standard Size 2-1/4" Full 16 Piece Balls Set
18d 3m 24s
Aramith Billiards Continental Pool Table Ball Set
Marble Swirl Pool Table Billiard Ball Set Reg Size New
5d 21h 17m 8s
24 Random Essential Billiards Terms
Soft break
A break sh... | cc/2020-05/en_middle_0096.json.gz/line36 |
__label__cc | 0.743376 | 0.256624 | Besserman Law Divorce & Family Lawyer > Custody
Celebrity Chef Gloria De Laurentiis Ordered to Pay Child Support
in Custody, Divorce, Local Attorney
Celebrity chef Gloria De Laurentiis has finalized her divorce to designer Todd Thompson. The couple was married for 11 years and have a 7-year-old daughter. The couple wil... | cc/2020-05/en_middle_0096.json.gz/line38 |
__label__cc | 0.511996 | 0.488004 | The University of Toronto Go Club Third Open
Saturday, March 10, 2018 - Sunday, March 11, 2018
Director: Bruno Pereira and Alex Tseng
Location: East Common Room, Hart House, 7 Hart House Cir, Toronto, ON M5S 3H3
Update (03/11):
Photos from the tournament can be found here: https://www.flickr.com/photos/144726185@N05/se... | cc/2020-05/en_middle_0096.json.gz/line44 |
__label__cc | 0.634074 | 0.365926 | Forum home Expat/Repat: The Practicalities UK Legislation
Latest Message from British Expat:
Kay and Dave wish all our British Expat readers a happy, healthy and prosperous 2020!
What if the UK leaves the EU?
This forum is for all the aspects of UK law that may affect expats - tax, social security, health, pensions, ci... | cc/2020-05/en_middle_0096.json.gz/line45 |
__label__cc | 0.663813 | 0.336187 | The Buell Foundation is Hiring: Office Manager
The Office Manager will play a crucial role in maintaining a welcoming, productive, and supportive office environment that contributes to the overall success of the Buell Foundation. The Office Manager is the first point of contact for the Foundation and will also oversee ... | cc/2020-05/en_middle_0096.json.gz/line46 |
__label__cc | 0.618542 | 0.381458 | Thanks to Bryan for hosting the Logline/Hook line Blogfest! Follow the link to read all the other entries!
Since I’m out of town this weekend, I’m posting this up today. I won’t be able to look at the other entries or reply to comments until Monday.
Here are my five (well, six, but 2 aren’t serious) hooks from my WIP S... | cc/2020-05/en_middle_0096.json.gz/line55 |
__label__wiki | 0.50712 | 0.50712 | Nick's Flick Picks: The Blog
A film blog under the influence
The Fifties 2014: Actor, Actress, Director, Picture
NICK'S PICKS:
Macon Blair, Blue Ruin: Communicates the everyman quality of the character without condescending to him. Never turns into a killing machine.
Jim Broadbent, Le Week-end: Just as he was nearing M... | cc/2020-05/en_middle_0096.json.gz/line60 |
__label__cc | 0.618949 | 0.381051 | Fall OI speakers at UC Berkeley
The Program in Open Innovation has replaced the Center for Open Innovation at UC Berkeley. It’s still headed by Henry Chesbrough (with Solomon Darwin holding the reins during his globetrotting) at the same location with the same website, but apparently it’s now bigger and better than eve... | cc/2020-05/en_middle_0096.json.gz/line62 |
__label__cc | 0.617859 | 0.382141 | You are here / South Africa Travel News / Destinations / South Africa’s national symbols – a guide for dummies
Now reading: South Africa’s national symbols – a guide for dummies
South Africa’s national symbols – a guide for dummies
I’m prepared to bet the average person knows our national flag, our national flower (kin... | cc/2020-05/en_middle_0096.json.gz/line65 |
__label__wiki | 0.970466 | 0.970466 | Is The Tea Party's Latest Move Illegal?
A Tea Party Super PAC is breaking new ground in the Senate primary in Tennessee, but does its apparent domination of Joe Carr’s campaign break the rules?
Harrison McClary/Reuters
In the final, frenzied days before an election, most U.S. Senate campaigns jam the calendar with vote... | cc/2020-05/en_middle_0096.json.gz/line68 |
__label__wiki | 0.786072 | 0.786072 | Posts by Topic: Eric Stults RSS feed
Esmil Rogers returns, as Rockies hoping for pitching relief
By Troy E. Renck
[media-credit name=”Barry Gutierrez, The Associated Press” align=”aligncenter” width=”495″] [/media-credit]
Rockies' Esmil Rogers throws in the Coors Field bullpen during rehab before a game against the Bre... | cc/2020-05/en_middle_0096.json.gz/line72 |
__label__cc | 0.556043 | 0.443957 | Computational Organic Chemistry Video made for Career Day
Posted on May 31, 2013 by Luanne Johnson | Leave a reply
PhD Candidate, Ryne Johnston made a video about Computational Organic Chemistry for Career Day. Check out the link below.
http://www.youtube.com/watch?v=fcIGAFMygk8
Undergraduate of the Quarter – Spring 20... | cc/2020-05/en_middle_0096.json.gz/line76 |
__label__wiki | 0.674489 | 0.674489 | wilson, lisa (427)
macdonald, natasha (363)
squires, allen (236)
squires, pearl (236)
barrett, terra (174)
braye, crystal (159)
jarvis, dale (150)
society of united fishermen (n.l.). lodge no. 2, winterton (117)
sansome, otto (86)
pomeroy, julie (77)
640300-640800 (52)
image/tiff application/pdf (17740)
image/jpeg (212... | cc/2020-05/en_middle_0096.json.gz/line78 |
__label__wiki | 0.955985 | 0.955985 | Queensryche Tour Dates & Concert Tickets
Queensryche Tour Dates and Concert Tickets
Queensrÿche first burst onto the music scene in 1982 with the release of their self-titled 4 song EP Queensrÿche. They very quickly gained international recognition and performed to sold out audiences around the world. With the follow u... | cc/2020-05/en_middle_0096.json.gz/line82 |
__label__cc | 0.715149 | 0.284851 | Perspective Legendary Liberals Shame! Religion Help!
Home > Shame!
Approval Ratings in Liberaland
by John F. Tamburo, Editor in Chief, Publisher
Originally Posted: 11/4/2005 12:43:41 PM
OK, we Conservatives say that we’ve solidified behind President Bush after he picked Sam Alito to replace Harriet Miers, who withdrew ... | cc/2020-05/en_middle_0096.json.gz/line83 |
__label__wiki | 0.676137 | 0.676137 | Future Table of Contents
AACC Learning Lab
Clinical Case Studies
Clinical Chemistry Guide to Scientific Writing
Clinical Chemistry Guide to Manuscript Review
Translated Content
Research ArticleProteomics and Protein Markers
Quantification of Thyroglobulin, a Low-Abundance Serum Protein, by Immunoaffinity Peptide Enrich... | cc/2020-05/en_middle_0096.json.gz/line91 |
__label__cc | 0.537956 | 0.462044 | McLoone’s New Ale House in Asbury
The boardwalk in Asbury Park will soon have an ale house all its own. Restrauateur Tim McLoone has temporarily closed down both his establishments on the boardwalk, Tim McLoone’s Supper Club and the Asbury Grille. McLoone said this week that improvements to the upstairs Supper Club wil... | cc/2020-05/en_middle_0096.json.gz/line94 |
__label__wiki | 0.51229 | 0.51229 | Location : Castries
PrimeGate Music
Community Fundrazr
News UpdatesUpdated: 01:00 PM
All Categories Entertainment Health Technology Travel Style Money Weather World Sports
Nikola Jokic's Nuggets dismantle the Cavs, get one step closer to playoffs
Portland's got 12 left, but despite having one in hand and sitting just o... | cc/2020-05/en_middle_0096.json.gz/line97 |
__label__wiki | 0.615738 | 0.615738 | All Fields Title Author Subject Call Number ISBN/ISSN Publisher
SHOW DIGITISED ITEMS ONLY
Collection: Ceannt and O'Brennan Papers, 1851-1953. >> ... >> Copy letter from Wiliam J. Walsh, Archbishop of Dublin to Laurence...
Copy letter from Wiliam J. Walsh, Archbishop of Dublin to Laurence O'Neill, Mayor of Dublin in rel... | cc/2020-05/en_middle_0096.json.gz/line99 |
__label__cc | 0.61001 | 0.38999 | http://www.cclme.org
DIVISION 42 TOTAL MAXIMUM DAILY LOADS (TMDLS)
2-OAR_340-042.txt - OAR - 8/15/2006 0:00:00 - Regulation - OR
Loading (50 kb)...'
Oregon Regulations
CHAP 340 DIVISION 42 TOTAL MAXIMUM DAILY LOADS (TMDLS)
The Oregon Administrative Rules contain OARs filed through July 14, 2006
Policy, Purpose and Effe... | cc/2020-05/en_middle_0096.json.gz/line100 |
__label__wiki | 0.606163 | 0.606163 | "The Vatican Cellars" by Andre Gide
This is a book by the author of The Immoralist whose plot I have totally forgotten but whose haunting images and poetic prose remain with me.
The plot here is strangely constructed. Book One (30 pages) is about Anthime, a crippled vivisectionist and freemason who, despite living in R... | cc/2020-05/en_middle_0096.json.gz/line101 |
__label__cc | 0.666275 | 0.333725 | Disasters Engineered
HD / 10 x 60'
SWR Media, Intermission Film & DCD Rights in association with Dash Pictures for Discovery UK
Scientists study the world as it is, politicians debate the world they want, but engineers create the world that has never been. Industrialisation, water distribution, electrification, automat... | cc/2020-05/en_middle_0096.json.gz/line104 |
__label__cc | 0.636223 | 0.363777 | Swatantra Rock
Eka Live
The Genesis Of Swatantra Rock
Music Production (Eka’s Production Work)
Eka does a fair bit of music production work, including composing, producing, arranging and writing original music content for various brands, events and television.
Times of India Earth Care Awards 2011 & 2012 – Eka has prod... | cc/2020-05/en_middle_0096.json.gz/line110 |
__label__wiki | 0.864326 | 0.864326 | Gallery view Page image PDF of section (4.0 MB)
The Wisconsin Blue Book, 1923
Mack, John G. D.
The four Wisconsin capitols, pp. [41]-52 PDF (4.0 MB)
THE FOUR WISCONSIN CAPITOLS
By JOHN G. D. MACK
Wisconsin territory was created by act of congress April 20, 1836,
including under this act the area of the states of Wiscon... | cc/2020-05/en_middle_0096.json.gz/line113 |
__label__wiki | 0.908725 | 0.908725 | - 2 -
of anti- Jewish propaganda in the Soviet Union.
•Write to your Senators and Congressman, urging
them to publicly express their condemnation of
this travesty of justice and to call for release
of the unjustly imprisoned Jews, and to denounce
the oppressive treatment of Soviet Jews by the
Soviet regime and to pre... | cc/2020-05/en_middle_0096.json.gz/line114 |
__label__wiki | 0.955105 | 0.955105 | Album Review FEELS - Post Earth
A terrific out-and-out rock record.
Label: Wichita
Released: 22nd February 2019
Some bands sound like more than the sum of their parts. FEELS are one of them. On paper, there’s nothing especially new about their sound; melodic guitars and playful vocals are at the forefront, with a sensi... | cc/2020-05/en_middle_0096.json.gz/line119 |
__label__wiki | 0.532392 | 0.532392 | The Del Fi's aka The Vells (2) aka The Del-Phis (1) aka ....
Par dion1 le 6 February 2008 à 11:14
Gloria Jean Williamson, Martha Reeves, Rosalind Ashford, Annette Beard
The Del-Phis (1) (Detroit)
aka The Del Fi's aka The Vells (2) aka The Fayettes
aka Martha & The Vandellas
Gloria Jean Williamson (Lead)
Martha Reeves (... | cc/2020-05/en_middle_0096.json.gz/line122 |
__label__cc | 0.651005 | 0.348995 | CEC Funding & Support
Opportunity Area (Derby)
Careers Local
LMI, Strategies & Research
D2N2 Employability Activities
The D2N2 Employability Framework
D2N2 Enterprise Adviser Network
Education Provider Directory
Career Fairs & Enterprise Activities
Employability Toolkit & Resources
About D2N2 & Stakeholders
*|MC:SUBJEC... | cc/2020-05/en_middle_0096.json.gz/line127 |
__label__cc | 0.740266 | 0.259734 | Maze Racers: Building a Labyrinth
by Sean J. | published Tuesday, May 10, 2016
Maze Racers is an interesting concept for a game…really it’s more of a toy than a game, but a toy that makes you think in a very strategic and creative way.
The main idea is that both players will get a magnetic board broken up into four dif... | cc/2020-05/en_middle_0096.json.gz/line129 |
__label__wiki | 0.888095 | 0.888095 | 'You absolutely don't need four preseason games': Why shortening makes sense
164dKevin Seifert
Does the NFL need four preseason games? (1:48)
Josina Anderson, Damien Woody and Mike Tannenbaum react to Roger Goodell questioning the necessity of four preseason games. (1:48)
Kevin SeifertESPN Staff Writer
ESPN.com nationa... | cc/2020-05/en_middle_0096.json.gz/line132 |
__label__cc | 0.729877 | 0.270123 | Exercising with Your Baby
Category: Newsletter Library, Pregnancy & Parenting
From biking and hiking to walking and jogging, today's parents are keeping fit and bonding with their babies in the process. With an array of products unheard of a generation ago— like baby carriers, joggers and trailers— even the tiniest amo... | cc/2020-05/en_middle_0096.json.gz/line133 |
__label__wiki | 0.585371 | 0.585371 | [ News | History | Links | Credits ]
A comprehensive guide to Mattel's Fashion Avenue™ line of clothing for Barbie®, her family, and friends, from 1995 to 2004
1995 Fashions
NOTE: Fashions were not officially divided into categories in 1995, but I have grouped them for ease of reference.
Trend City
Sweet/Charm
NOTE: In... | cc/2020-05/en_middle_0096.json.gz/line141 |
__label__wiki | 0.83087 | 0.83087 | Mike Glyer's news of science fiction fandom
2019 Recommended SF/F Page
About File770.com
Best Series, Editor, and Artist Hugos: Eligible Works from 2019
Brackets From The File 770 Honeycomb
Carl Slaughter Interview List
Fourth of Sierra Madre
Glow-in-the-Dark Comedy
Is Your Club Dead Yet?
Kyra’s Best Science Fiction an... | cc/2020-05/en_middle_0096.json.gz/line143 |
__label__cc | 0.520364 | 0.479636 | " amendments"
Egypt - Politics
Egyptian parliament initially approves amendments to central depository and registration law
The law aims to streamline the performance of the stock market and create a more friendly investment climate
Business - Economy
Egypt's parliament to discuss amendments to law to enhance stock per... | cc/2020-05/en_middle_0096.json.gz/line150 |
__label__cc | 0.738528 | 0.261472 | How to Define a Form
Forms are defined using the Create a New Form page, or from one of the Examples pages. Forms can later be modified using the Edit a Form Definition page. This document describes the form definition inputs and options. (Please read at least the Required Fields section below, but after that you do no... | cc/2020-05/en_middle_0096.json.gz/line154 |
__label__wiki | 0.953639 | 0.953639 | NCAAFNCAAF
Transfer TrackerTransfer Tracker
Bowl ResultsBowl Results
College Football PlayoffCollege Football Playoff
College Pick'emCollege Pick'em
SEC NetworkSEC Network
Dallas Colleges Report
How TCU pulled off the impossible in Alamo Bowl comeback
4yMax Olson
TCU rallies from 31-0 deficit, stuns Oregon in triple OT... | cc/2020-05/en_middle_0096.json.gz/line178 |
__label__cc | 0.616594 | 0.383406 | insurance and pension news Monday, January 20, 2020
Africa Re wins 2018 NAIPCO Insurance Development Promoter Award
September 5, 2019 6:45 am by admin
From right: Deputy Managing Director/COO, African Reinsurance Corporation (Africa Re) Ken Aghoghovbia, receiving award of the 2018 NAIPCO Insurance Development Promoter ... | cc/2020-05/en_middle_0096.json.gz/line179 |
__label__cc | 0.584975 | 0.415025 | Strong partnerships are key to linking growth and opportunity
For cross-sector anti-poverty programs to be effective, stakeholders need to develop partnerships to understand the needs of businesses and industries in the area.
Weekly Briefing, February 22 – 26
Our weekly briefing keeps you up to date on the latest insig... | cc/2020-05/en_middle_0096.json.gz/line182 |
__label__cc | 0.622279 | 0.377721 | Browsing: News
January 17, 2020 0 Summoning Shadows – The Sound Of Extinction
Skugghûg (old norse, lit. “having shadows in one’s mind”) is an upcoming major musical work by Norwegian media artist Gisle Martens Meyer, based on the sound of extinction. Premiere is planned for spring 2021. The project is a multi-medial cr... | cc/2020-05/en_middle_0096.json.gz/line183 |
__label__cc | 0.711838 | 0.288162 | Snow obscured my view as my driver slowed the car on an icy curve. The road normally used to reach the Great Wall was closed due to winter storms, but my guide had suggested we try an alternate route to a newer section of the wall. We were close, he told me, but the wall was not yet visible through the white haze of sn... | cc/2020-05/en_middle_0096.json.gz/line187 |
__label__wiki | 0.587485 | 0.587485 | By Lisa M. Wieland, Wabash Valley Astronomical Society
(This article appeared in the March 2009 edition of the Astronomical League 's "Reflector" magazine. The text below is the orignal, before editing by the Reflector editor, but with slight editing by John Mahony. Pictures are at the bottom. A pdf file of the Sky Tre... | cc/2020-05/en_middle_0096.json.gz/line192 |
__label__cc | 0.674937 | 0.325063 | INC - PGI Chandigarh
PGI Workshop on Costing of Health Care Services in India
Chandigarh,10.12.19-The Department of Community Medicine and School of Public Health began a four day National Workshop on Costing of Healthcare Services from December 10th-13th, 2019 in collaboration with Department of Health Research, Minis... | cc/2020-05/en_middle_0096.json.gz/line193 |
__label__cc | 0.583001 | 0.416999 | Jennifer Greidus
© 2017 Jennifer Greidus
I bused tables on Saturday nights at Fancy’s Bar. Place was busy all the time. Draft beers were cheap and they fried a mean pickle. It was a favorite haunt, even for folks a few towns over, cause the women who ran there didn’t want to get married. Sometimes there was karaoke. So... | cc/2020-05/en_middle_0096.json.gz/line199 |
__label__cc | 0.71663 | 0.28337 | Molecules and Cells
Pages.108-114
Korean Society for Molecular and Cellular Biology (한국분자세포생물학회)
Identification of Putative MAPK Kinases in Oryza minuta and O. sativa Responsive to Biotic Stresses
You, Min Kyoung (School of Life Sciences and Biotechnology, Korea University) ;
Oh, Seung-Ick (School of Life Sciences and ... | cc/2020-05/en_middle_0096.json.gz/line204 |
__label__cc | 0.707724 | 0.292276 | When feminism is incompatible with skepticism #2
April 4, 2014 April 4, 2014 Justin Vacula blogosphere, gender, philosophy
Photo: Getty Images/DiatoZen
A response to a recent piece titled “TIME Magazine is Wrong. Rape Culture Does Exist” published in The Humanist by feminist Ashley Jordan
I will not discuss all of the ... | cc/2020-05/en_middle_0096.json.gz/line209 |
__label__cc | 0.686629 | 0.313371 | KMBC — Car Chases Can’t Outrun Helicopters
Authorities say that on Monday, 39-year-old Jeffery Haywood led police on a chase through Kansas City.
The chase began when Haywood, who was wanted for felony warrants in both Kansas and Missouri, fled from police along with a female passenger.
Posted in Johnson County | No Co... | cc/2020-05/en_middle_0096.json.gz/line212 |
__label__cc | 0.681244 | 0.318756 | Monckton returns to Australia, book now… :-) »
« James Lovelock partly recants
Each electric car could add costs of $2000 per year for “our” electricity network
What was that Ms Gillard said about not wanting to “gold plate” our electricity networks? The Australian Energy Market Commission (AEMC) released a warning in ... | cc/2020-05/en_middle_0096.json.gz/line213 |
__label__wiki | 0.622125 | 0.622125 | Sökresultat - Brian Larson
1001 Illustrations That Connect
Delivering Business Intelligence with Microsoft SQL Server 2016, Fourth Edition
av Brian Larson
Master the powerful BI tools available in Microsoft SQL Server 2016Enable informed, timely decision making across any type of organization using the expert tips and ... | cc/2020-05/en_middle_0096.json.gz/line219 |
__label__wiki | 0.738234 | 0.738234 | Rokajax search
Lopez Companies
Promos and Offers
Lopez Group Companies
Employee News
Message from Lopez
Meet the Executive
ABS Lingkod Kapamilya
Sagip Kapamilya
OML Climate Change Center
Knowledge Channel
Lopez Museum
Kapamilya Entertainment
Power Plant Mall Finds
ABS-CBN Publications
Lifelong Wellness
Lopez Values
7 L... | cc/2020-05/en_middle_0096.json.gz/line234 |
__label__wiki | 0.608207 | 0.608207 | Daniel Hannan – A Reckoning?
I made a flippant aside on MEP Daniel Hannan last week, then spotted fellow Lib Dem blogger Mark Thompson taking a diametrically opposite view. I did the Liberal thing and chipped in to argue; forced to think harder about what I was writing, I came up with something more thorough and rather... | cc/2020-05/en_middle_0096.json.gz/line236 |
__label__wiki | 0.65634 | 0.65634 | Five Year Strategic Plan
Priority Initiatives
CDC Media Campaign (TIPS)
Programs & Issues
Alternative Tobacco Products
Counter-Marketing
Menthol Cigarettes
Smoke-Free Environments
Fact Sheets & Other Publications
Presentations & Webinars
Surgeon General’s Report—Preventing Tobacco Use Among Youth and Young Adults
CDC’s... | cc/2020-05/en_middle_0096.json.gz/line238 |
__label__cc | 0.526898 | 0.473102 | 20/20 Hindsight: Mets Sweep Marlins Like Good Teams Do
The Mets are three games over .500 for the first time since April 23rd. They are now just one game behind in the Wild Card race, and they are eight games out in the division. Things are much more interesting in Queens.
1. The Mets went 14-2 against an easy stretch ... | cc/2020-05/en_middle_0096.json.gz/line242 |
__label__cc | 0.707054 | 0.292946 | Minimum requirement, maximum effort: partnership’s mantra yielding results
Minimum requirement, maximum effort. That’s the approach I said we would be taking at the launch of Bradford’s economic growth strategy in March 2018. I said we wanted to create a movement in Bradford and make sure everyone is pointing in the sa... | cc/2020-05/en_middle_0096.json.gz/line244 |
__label__cc | 0.715733 | 0.284267 | Firearms Finishes
OGRE VIDEO
Terminal Ballistics
The Old MadOgre.com
The Uprising Saga
10/31/2013 MadOgre 20 Comments
Breakfast Burritos. I’m a huge breakfast guy. The whole “Most Important Meal Of The Day” is a tradition that I follow. Those are words I live by. Yes, I live by those words. And they have never failed m... | cc/2020-05/en_middle_0096.json.gz/line245 |
__label__cc | 0.688414 | 0.311586 | Amazon acquires flash-based cloud storage startup E8 Storage – TechCrunch
Amazon has acquired Isreali storage tech startup E8 Storage, as first reported to Reuters, CNBC and Globes and confirmed by TechCrunch. The acquisition will bring the team and technology from E8 in to Amazon’s existing Amazon Web Services center ... | cc/2020-05/en_middle_0096.json.gz/line248 |
__label__wiki | 0.896164 | 0.896164 | Cloudflare will stop service to 8chan, which CEO Matthew Prince describes as a ‘cesspool of hate’ – TechCrunch
Website infrastructure and security services provider Cloudflare will stop providing service to 8chan, wrote Matthew Prince in a blog post, describing the site as a “cesspool of hate.” Service will be terminat... | cc/2020-05/en_middle_0096.json.gz/line249 |
__label__cc | 0.596655 | 0.403345 | Pat Brandemihl
#6 Midfielder - Grand Valley State
Hometown: Detroit, MI
High School: Catholic Central
Eligibility: Freshman
2019 Grand Valley State 6 2 4 1 0 0 0 - 0
03/07/2019 Florida Gulf Coast W 11-7 0 1 0 0 0
03/24/2019 Western Michigan W 14-10 0 0 0 0 0
03/09/2019 @ Central Conn. State W 19-4 0 1 1 0 0
03/08/2019 ... | cc/2020-05/en_middle_0096.json.gz/line253 |
__label__wiki | 0.763734 | 0.763734 | Dave and the Tooth Fairy
Verna Wilkins and Carl Pearce
(Studio Press)
32pp, PICTURE BOOK, 978-1787415409, RRP £6.99, Paperback
Buy "Dave and the Tooth Fairy" on Amazon
This classic picture book was first published in 1993 by Tamarind Press and was greatly welcomed at that time for its diversity as it featured two BAME ... | cc/2020-05/en_middle_0096.json.gz/line258 |
__label__cc | 0.735035 | 0.264965 | On the Road in Cameroon, 2008
This piece was written in 2008 and since then has languished on a hard disc. It has been rescued after turning up in a disk search for another file entirely, so has been converted to HTML and made available online for historical interest! Processed in Somié March 2016
Fieldwork Diary
It wa... | cc/2020-05/en_middle_0096.json.gz/line261 |
__label__wiki | 0.725217 | 0.725217 | Minnesota Newspapers Directory
Minnesota Newspapers: A Complete Directory
MN Newspaper Websites
Advertise Statewide
Meadow Area News
Grand Meadow, Minnesota
Address: PO Box 509 | Grand Meadow, MN 55936
Email: evans@frontiernet.net
Website: www.meadowareanews.com
County: Mower
Publication: Weekly on Wednesdays
Approx. C... | cc/2020-05/en_middle_0096.json.gz/line266 |
__label__cc | 0.570444 | 0.429556 | The Australian miraDry Team consists of the nations leading experts in sweating disorders. We are not cosmetic doctors- we represent the premier group of hyperhidrosis specialist nurses and consultant Specialists. This ensures that your treatment is conducted to the very highest medical standards.
Additionally, our tea... | cc/2020-05/en_middle_0096.json.gz/line272 |
__label__cc | 0.744408 | 0.255592 | Black Ginger Extract Improves Erectile Dysfunction, Sexual Satisfaction, in New Pilot Study
ORIGINAL ARTICLE: http :// www.nutritionaloutlook.com/ herbs-botanicals/ black-ginger-extract-improves-erectile-dysfunction-sexual-satisfaction-new-pilot-study
Results from a new pilot study1 published in the Journal of Integrat... | cc/2020-05/en_middle_0096.json.gz/line277 |
__label__cc | 0.668333 | 0.331667 | Spring Break inspiration
From National Geographic:
From National Geographic Sea of StarsPhotograph by Doug Perrine, Alamy
Pinpricks of light on the shore seem to mirror stars above in an undated picture taken on Vaadhoo Island in the Maldives.
The biological light, or bioluminescence, in the waves is the product of mar... | cc/2020-05/en_middle_0096.json.gz/line284 |
__label__wiki | 0.748087 | 0.748087 | Montblanc Cultural Foundation
Academic Lectures
Public Talks and Panels
Committee and Jury Memberships
The Montblanc Cultural Foundation, based in Hamburg, was founded in 1992 with a mission to promote innovative thinking through supporting the arts worldwide. Its core initiatives include the globally recognized Montbl... | cc/2020-05/en_middle_0096.json.gz/line285 |
__label__cc | 0.676428 | 0.323572 | EHX Electro Harmonix Little Big Muff Pi Distortion Fuzz Sustainer Guitar Pedal
Electro Harmonix Little Big Muff Pi Guitar Effects Pedal. ELECTRO HARMONIX LITTLE BIG MUFF PI DISTORTION SUSTAINER GUITAR EFFECTS PEDAL. Introducing the Little Big Muff pedal from Electro Harmonix. Back in 1968, guitar amps were intentionall... | cc/2020-05/en_middle_0096.json.gz/line286 |
__label__wiki | 0.90937 | 0.90937 | Photo: Christopher Harting
MIT announces updates on fact-finding and reviews of external engagements
Efforts also advance to protect whistleblowers, identify charity to benefit survivors of sexual abuse.
Steve Bradt | MIT News Office
Kimberly Allen
Email: allenkc@mit.edu
Members of MIT’s senior leadership have announce... | cc/2020-05/en_middle_0096.json.gz/line287 |
__label__wiki | 0.787286 | 0.787286 | Toggle News & Features only:
News | Features
Follow @SoxProspects
SP on Facebook
Subscribe to SP News
SP Videos on YouTube
Join the SP Forum
Donate to SP
SoxProspects News Staff
Chris Hatfield
Ian Cundall
James Dunne
Jim Crowell
Will Woodward
Harry Burnham
Nick Rabasco
Shawn McGrath
Zachary Bohn
Connor Sullivan
Mark Ha... | cc/2020-05/en_middle_0096.json.gz/line288 |
__label__cc | 0.699437 | 0.300563 | PennyStockProphet - UBIQ - 26-Cent Tech Pick Could Soar on 8.5M In... May 09, 2016 16:56
Promoter: Penny Stock Prophet Paying Party: Microcap Innovations
UBIQ $10000 UNKNOWN
PSP Free Members,
Congrats on our most recent pick IMSC, which is now up over 125% from our alert price of .33 cents last month.
We have another ... | cc/2020-05/en_middle_0096.json.gz/line290 |
__label__cc | 0.691978 | 0.308022 | New Hampshire Recovery Hub Blog
Welcome to the New Hampshire Recovery Hub Blog. We collect stories and musings from a variety of people working in and impacted by substance use recovery and related services. Visit or subscribe for enlightening, inspiring, and informative contributions on recovery topics from your neigh... | cc/2020-05/en_middle_0096.json.gz/line297 |
__label__cc | 0.715541 | 0.284459 | A Happy Christmas and a Good New Year
I would like to wish all my readers a happy Christmas and a very good 2008 and hope you have enjoyed reading my blog and to my Chinese readers - nee how.
I leave you with another set of potential award winning pictures taken yesterday at Three Sisters. I think I will call them 'Win... | cc/2020-05/en_middle_0096.json.gz/line300 |
__label__cc | 0.591671 | 0.408329 | Home / Automotive Reviews /
By B. Schaffer / 27 October 2018 / Comments are Disabled
By Barbara & Bill Schaffer
With more than 100 different crossover/SUV models offered in the U.S., the shopping process can be downright daunting. We’ve been impressed by many of the utilitarian vehicles and one of our favorites in the ... | cc/2020-05/en_middle_0096.json.gz/line301 |
__label__wiki | 0.644571 | 0.644571 | Hafu Comic
Personality. Find a comic under a certain number of subscribers (the number will be decided as described below). You'll need an HTML5 capable browser to see this content. Glyn Dillon's return to comics after several years doing storyboards for movies and TV marks the first long-form comic he's ever written, ... | cc/2020-05/en_middle_0096.json.gz/line305 |
__label__cc | 0.679507 | 0.320493 | Make Stories Come Alive with Jodi Harvey – Brown
Brunswick House is Filled With Unexpected Treasures
Gardening Is The Best Medicine For The Mind
A Conversation With Film-Maker Oliver Park
10 Signs You Were Born To Be An Interior Stylist
By Ziggy Mooz on February 8, 2016
Ah the life of an interior stylist. It’s not all ... | cc/2020-05/en_middle_0096.json.gz/line306 |
__label__wiki | 0.508309 | 0.508309 | The Spectacular 1st Annual PiTB Free Agency Day Meta-LiveBlog Spectacular!
Posted by Harrison Mooney
<a href="http://www.coveritlive.com/mobile.php/option=com_mobile/task=viewaltcast/altcast_code=3b49f3dc52" >The Spectacular 1st Annual PiTB Free Agency Day M... | cc/2020-05/en_middle_0096.json.gz/line310 |
__label__wiki | 0.504506 | 0.504506 | The Right Word: The End of Racism?
Benjamin Franklin´s wife Deborah entering his study to find him in a compromising position with a comely young maid exclaimed, “Ben I’m surprised at you!”
Venerable Ben replied, “My Dear you were amazed ---- I was surprised.”
America’s first postmaster, premier scientist, inventor and... | cc/2020-05/en_middle_0096.json.gz/line323 |
__label__cc | 0.60155 | 0.39845 | Rick Freeman, P.C.
Trial Law Specialist Serving all of Texas
Austin & Round Rock Offices
Personal Injury & Death Claims
Commercial & Business Litigation
18 WHEELER ACCIDENTS
DEFECTIVE PRODUCTS INJURIES
PREMISES DEFECT INJURIES
DEFECTIVE TIRE ACCIDENTS
SEXUAL EXPLOITATION INJURIES
For 35 years Rick Freeman has specializ... | cc/2020-05/en_middle_0096.json.gz/line324 |
__label__cc | 0.690877 | 0.309123 | PHOTOGRAPHY BY ERIK TANNER
STYLING & WORDS BY ELIZABETH CABRAL
Jenelle Manzi has trained her entire life to be a part of the world-renowned New York City Ballet, and while this highly disciplined career can be all consuming, she realized that her purpose has gone far beyond her identity as a ballet dancer. It lies in t... | cc/2020-05/en_middle_0096.json.gz/line331 |
__label__cc | 0.730249 | 0.269751 | Move Over Salesforce, SAP Hybris YaaS Is Staking Claim - Forbes
At last week’s SAP SAP hybris 2015 Global Customer Days in Munich, Germany, hybris, an omni-channel customer engagement and commerce vendor, unveiled a number of announcements including its latest application, hybris Marketing. hybris’ vision is to “delive... | cc/2020-05/en_middle_0096.json.gz/line333 |
__label__wiki | 0.607516 | 0.607516 | The Rolling Stones | ScottSlucher.com
Warning: Parameter 2 to wp_hide_post_Public::query_posts_join() expected to be a reference, value given in /homepages/20/d387371247/htdocs/wordpress/wp-includes/class-wp-hook.php on line 288
ScottSlucher.com
He was so young and beautiful
What’s the best way to break a heart?
The Ba... | cc/2020-05/en_middle_0096.json.gz/line337 |
__label__wiki | 0.508895 | 0.508895 | Russian private law
The blog is about different aspects of Russian private law, namely about the law of real estate, contract law, consumer law, housing law, law on biotechnologies and, finally, family law.
The privacy and the law of proof
An audio of a conversation between parties to a contract can undoubtedly be a pr... | cc/2020-05/en_middle_0096.json.gz/line339 |
__label__cc | 0.501548 | 0.498452 | Ptelea trifoliata L.
Family: Rutaceae
Common Hoptree, more...hoptree
Max Licher
Gleason & Cronquist
Martin and Hutchins 1980, Kearney and Peebles 1969, Wiggins 1964, Correll and Johnston 1970, Carter 2012, Allred and Ivey 2012
Common Name: common hoptree Duration: Perennial Nativity: Native Lifeform: Tree Wetland Statu... | cc/2020-05/en_middle_0096.json.gz/line352 |
__label__cc | 0.538657 | 0.461343 | The product - StablevaX™
StablevaX™ is a patented disruptive technology – a game changer in the world of vaccines.
Stablepharma has so far identified over 90 vaccines suitable to use with the StablevaX™ technology.
View list of patents
Patented product
and complies with the WHO protocols
StablevaX™ meets the criteria f... | cc/2020-05/en_middle_0096.json.gz/line356 |
__label__cc | 0.517696 | 0.482304 | STeVE’s Celebrity Pals
STeVE’s Celebrity Pals Nov 1, 2018 10:11:15 GMT via mobile
Post by aquaholic2017 on Nov 1, 2018 10:11:15 GMT
A new thread for all of STeVE’s celebrity friends in one place. The first name drop shout out is to an actress on some new FBI show, a subject STeVE is familiar with.
shokhead:
Boy, these ... | cc/2020-05/en_middle_0096.json.gz/line362 |
__label__wiki | 0.808924 | 0.808924 | The domain within your query sequence starts at position 27 and ends at position 290; the E-value for the Carb_anhydrase domain shown below is 6.61e-125.
WRFQHSCAEEHSNCARHPLWTGPVSSAEGTRQSPINIQWKDSVYDPQLAPLRVSYDAASC
RYLWNTGYFFQVEFDDSCEDSGISGGPLGNHYRLKQFHFHWGATDEWGSEHAVDGHTYPA
ELHLVHWNSTKYENYKKASVGENGLAVIGVFLKLGAHHQALQKL... | cc/2020-05/en_middle_0096.json.gz/line374 |
__label__wiki | 0.539751 | 0.539751 | Sam Rolfes – Progress Bar Video Design
Commissions > Johann Lurf – Pyramid Flare
Johann Lurf – Pyramid Flare
Pyramid Flare from Sonic Acts on Vimeo.
Pyramid Flare is a work by Johann Lurf, commissioned by Sonic Acts for Vertical Cinema (2013). Among the most mysterious man-made structures ever built, the pyramids still... | cc/2020-05/en_middle_0096.json.gz/line376 |
__label__wiki | 0.505076 | 0.505076 | Madonna on Her MTV Awards Like A Virgin Performance "'My Underpants Were Showing, I Didn't Mean To"
Madonna - Like A Virgin by Millabba
Posted by soul88 at 5:09 PM No comments: Links to this post
Labels: 1984, jay Leno, mtv awards, Tonight Show
ABC Nightline: Jonah Hill Sheds Clown Image — and Pounds
Labels: brad pitt,... | cc/2020-05/en_middle_0096.json.gz/line377 |
__label__wiki | 0.848202 | 0.848202 | Melungeons and Redbones - Are they Lumbee Indians?
Below are some of the articles written on the research of the Redbones, Croatan and Melungeons in the latter part of the 1800s into the 1900s. Written by men working with the Smithsonian, historians, doctors etc., they make it clear these three groups were related. The... | cc/2020-05/en_middle_0096.json.gz/line378 |
__label__wiki | 0.783419 | 0.783419 | Home Sports NFL roundup: Jones rallies Giants past Bucs in debut
NFL roundup: Jones rallies Giants past Bucs in debut
on: September 23, 2019 In: Sports
Rookie quarterback Daniel Jones led the Saquon Barkley-less New York Giants on a game-winning drive in the final two minutes in his first career start to defeat the hos... | cc/2020-05/en_middle_0096.json.gz/line386 |
__label__cc | 0.6663 | 0.3337 | Guy Mettan: Jewish russophobia has never existed and still does not exist today
25121 Views July 20, 2016 126 Comments Guest Analyses The Saker
Note by the Saker: Guy Mettan has kindly accepted my invitation to reply to some of the critical comments I made in my review of his excellent book ““The West vs Russia – a tho... | cc/2020-05/en_middle_0096.json.gz/line387 |
__label__cc | 0.50377 | 0.49623 | Topiary in the United Kingdom
British Topiary Gardens
Listing gardens in Great Britain with significant topiary
Gardens by County
National Trust Gardens
Growing Topiary
How to Grow Topiary
Which Plants to use?
Belton House
Grantham, Lincolnshire, NG32 2LS
Grantham is probably best known for two people. Margaret Thatche... | cc/2020-05/en_middle_0096.json.gz/line388 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.