pred_label stringclasses 2
values | pred_label_prob float64 0.5 1 | wiki_prob float64 0.25 1 | text stringlengths 142 1.01M | source stringlengths 39 45 |
|---|---|---|---|---|
__label__wiki | 0.528394 | 0.528394 | >Search for:
Client Login:
Not a client?
Request a Demo >
Having trouble logging in? Contact your administrator or email us.
By Emilie Mazzacurati
Founder & Chief Executive Officer
Email: emazzacurati@427mt.com
Phone: (415) 930-9090, ext: 1001
Stay up to date on climate science, climate risks disclosure and resilience ... | cc/2021-04/en_middle_0018.json.gz/line2 |
__label__wiki | 0.679786 | 0.679786 | Members of the Firm
Virtual Law Library
Practicing Law in a Grand Manner. For the Philippines, for the World...
MAIN OFFICES:
Suite 2205-B, 22nd Floor, Philippine Stock Exchange Centre, Tektite East Tower, Exchange Road, Ortigas Center, Pasig City, Metro Manila, Philippines
Tel. Nos. (632) 634-07-41/42/43/44/45
Fax No.... | cc/2021-04/en_middle_0018.json.gz/line3 |
__label__wiki | 0.547014 | 0.547014 | Spanish brand ZARA apologies for substandard products sold in China
posted 7 May 2011, 05:57 by Mpelembe [ updated 7 May 2011, 06:00 ]
ZARA Apologizes -- Spanish brand ZARA apologies for substandard products sold in China
China Central Television - As a response to some of its substandard products blacklisted by Chines... | cc/2021-04/en_middle_0018.json.gz/line11 |
__label__cc | 0.657746 | 0.342254 | News: DID A COMET CAUSE A FIRESTORM THAT DEVESTATED NORTH AMERICA 12,900 YEARS AGO?
The Cabal, A geoplutocratic dominance-and-control conspiracy organization
Atlantis Online > Forum > UFOs, Aliens & Future Science > UFO's > The Cabal, A geoplutocratic dominance-and-control conspiracy organization
Author Topic: The Caba... | cc/2021-04/en_middle_0018.json.gz/line24 |
__label__wiki | 0.719408 | 0.719408 | Australian Music Database
AC/DC released the Album Live in 1992. It was released through the Albert Productions label as catalogue number: APLP 472652
Live first charted on October 23rd, 1992, peaked at 1st position
2 Chart Listings
2 Known Chart Listings for Live
22nd of November 1992 1
29th of November 1992 1
Bitzer ... | cc/2021-04/en_middle_0018.json.gz/line25 |
__label__cc | 0.723326 | 0.276674 | Women's First League
ENEA Mini Basket League
EBLK Schedule
EBLK Table
EBLK Table Women's First League - Schedule
Women's First League - Table
EuroCup Schedule
EuroCup Table
Beginner Groups
Sports Championship Academic High School
Organizational and Financial Structure
Mass Events: Rules and Regulations
The First Team
T... | cc/2021-04/en_middle_0018.json.gz/line28 |
__label__cc | 0.715837 | 0.284163 | What's worked to cut greenhouse gas emissions, and Klein, etc.
Apparently there's going to be a parade, or a protest, or something in New York this weekend which caused Torontonian Naomi Klein to release a book that's getting lots of attention in prospective marching circles.
The Economist does a good job, with the gra... | cc/2021-04/en_middle_0018.json.gz/line30 |
__label__wiki | 0.691981 | 0.691981 | Fabelbuch für die Jugend
Gesammelt und bearbeitet von Julius Hoffmann
1880. Julius Hoffmann. Stuttgart
Aesop and others.
Here is a sturdy book in very good condition featuring a strong chromolithograph pasted onto its cloth cover: King Lion is seated on a raised dias, surrounded by various animals and with an arch behi... | cc/2021-04/en_middle_0018.json.gz/line43 |
__label__cc | 0.64624 | 0.35376 | Donnie J Burgess dot com
In the Shadow of Angels
In the Shadow of Angels Q & A
Review it!
Through the Eyes of Mister Bearsley
TThis page is for some notes about the book, and as such it should be noted that this page will contain spoilers.
Spoiler Alert. Do not read on if you haven’t read the book.
The idea for this bo... | cc/2021-04/en_middle_0018.json.gz/line52 |
__label__cc | 0.684187 | 0.315813 | Columbia Shutdown Could Add to Jam
by Mitch Lies
Capital Press, November 16, 2009
Pressure to move wheat through Portland next fall could be greater than most years, given that barge transportation on the Columbia River system is expected to be shut down from December 2010 to April 2011.
The U.S. Army Corps of Engineer... | cc/2021-04/en_middle_0018.json.gz/line61 |
__label__wiki | 0.758851 | 0.758851 | グランツーリスモ5
［TGS 2010］全タイトルがプレイアブル。「グランツーリスモ5」「PlayStation Move」の体験希望者が殺到。ソニー・コンピュータエンタテインメントブース速報
(C)Sony Computer Entertainment Inc. Manufacturers, cars, names, brands and associated imagery featured in this game in some cases include trademarks and/or copyrighted materials of their respective owners. All rights reserv... | cc/2021-04/en_middle_0018.json.gz/line68 |
__label__cc | 0.714723 | 0.285277 | All The Past Advice
A Random Bit of Advice
Just Fun Sized Advice
The Best of Dear Coquette
CQ’s Book Lists
CQ’s Twitter
On pause
On premium services
On fun-sized advice
On violence and change
On being a safe friend
On participating in democracy
On more fun-sized advice
Dear Coquette
Shady advice from a raging bitch who... | cc/2021-04/en_middle_0018.json.gz/line69 |
__label__cc | 0.740757 | 0.259243 | Programs Graduate Programs Financial Aid Online Options Why Devry Apply Now >>
For Today’s Modern World. @@logo
Degree and Certificate Programs for a Diverse and Evolving Industry.
We offer a range of health degrees and certificates.
Get More Info on DeVry Health Programs
Gain skills healthcare employers seek when sear... | cc/2021-04/en_middle_0018.json.gz/line73 |
__label__wiki | 0.683801 | 0.683801 | Carly Fiorina Schedule & Appearances
Carly Fiorina Schedule and Appearances
Politician/Business Executive
Carly started out as a secretary for a small real estate business. She typed, filed paperwork and answered the phone. Eventually she would become a leader in technology, business and charity. In just fifteen years ... | cc/2021-04/en_middle_0018.json.gz/line77 |
__label__cc | 0.544517 | 0.455483 | Published: 1 September 2011
Publisher: Short Books
The Baskerville Legacy
by John O’Connell
When a young journalist, Bertram Fletcher Robinson, meets his writer hero Arthur Conan Doyle on a troop ship coming back from South Africa, he is delighted – especially when the creator of Sherlock Holmes suggests they collabora... | cc/2021-04/en_middle_0018.json.gz/line79 |
__label__cc | 0.55716 | 0.44284 | Map and Data Resources
Haiti at Columbia
Earth Institute Collection
South Department Agricultural Document Collection
Haiti GeoPortal at CIESIN
Haiti Document Resources
The Earth Institute has produced and compiled publications on a range of themes and sectors. Documents produced by Earth Institute and its partners rel... | cc/2021-04/en_middle_0018.json.gz/line81 |
__label__wiki | 0.694907 | 0.694907 | The Main Rooms
The Researcher's Study
Moakley's book, article & now correspondence with Panofsky
Conver/Noblet & Sola-Busca pips
Oregon USA
Re: Moakley's book: text and discussion
#31 by mikeh
Thanks, Steve and Alain, to both of you for that careful work. Very helpful. There are some more recent books on Greek divinati... | cc/2021-04/en_middle_0018.json.gz/line87 |
__label__wiki | 0.934251 | 0.934251 | Chaser bin on tracks entered for prestigious Henty award
Shannon McNab, of Davimac, has entered a chaser bin on tracks in the Henty Machine of the Year Award.
The first Australian designed and built chaser bin with tracks and a unique cushion hitch offered by NSW manufacturer Davimac is the first entry in the 2015 Hent... | cc/2021-04/en_middle_0018.json.gz/line90 |
__label__wiki | 0.559037 | 0.559037 | Home > Update | Killed in her sleep - St Bess woman murdered by estranged boyfriend
Published:Tuesday | January 14, 2020 | 12:00 AMHopeton Bucknor/Gleaner Writer [1]
WESTERN BUREAU:
The kitchen knife used in the preparation of Sunday dinner at Neville Sinclair’s home in Brinkley district, St Elizabeth, became an instru... | cc/2021-04/en_middle_0018.json.gz/line93 |
__label__cc | 0.675073 | 0.324927 | NYC: April 2011 Archives
ABC No Rio benefit May 3
just like those in the Chauvet-Pont-d'Arc Cave, maybe these walls belong to the ages (detail of 1998 mural done by Chris Benfield to which other artists later made additions - customary practice in the ABC No Rio space - but those elements are not shown here)
Barry and ... | cc/2021-04/en_middle_0018.json.gz/line95 |
__label__cc | 0.654001 | 0.345999 | Workers Were Allowed To Return To New York Offices This Week. Almost None Of Them Did.
FDNY Firefighters Get Help Fighting Their Foreclosures
The exodus of New York City's endangered middle class
NYC Blockchain Center Opens As City Sticks With Crypto Plan
New York City Capital-Spending Cut Risks Its Infrastructure, Bui... | cc/2021-04/en_middle_0018.json.gz/line99 |
__label__wiki | 0.830054 | 0.830054 | InDepthNH.org (http://indepthnh.org/2020/12/30/safety-concerns-prompt-sununu-to-cancel-inauguration-ceremony/)
Safety Concerns Prompt Sununu to Cancel Inauguration Ceremony
By GARRY RAYNO, InDepthNH.org | December 30, 2020
Paula Tracy file photo
Gov. Chris Sununu
CONCORD — Gov. Chris Sununu today cancelled his inaugura... | cc/2021-04/en_middle_0018.json.gz/line100 |
__label__wiki | 0.774701 | 0.774701 | Massachusetts home where Lizzie Borden’s parents were axed to death selling for $2M
How to navigate the real estate market during a pandemic
Broker Rogers Healy shares house hunting tips and the best areas to buy.
Real estate is so hot right now, there’s not even a discount for a (possibly) haunted home.
The Massachuse... | cc/2021-04/en_middle_0018.json.gz/line105 |
__label__cc | 0.591667 | 0.408333 | updated artists
newly selected artists
staff needed
search | A-Z artists
Artists CV artwork
Ralph Shephard - Landscapes
I was born in 1954 in Leeds, West Yorkshire. From being very young I can always remember having a burning desire to be creative, and would draw, paint or sculpt, given an opportunity. As a child I was... | cc/2021-04/en_middle_0018.json.gz/line112 |
__label__cc | 0.698788 | 0.301212 | Legislative Update April 28, 2017
By Gina Powers | Advocacy, Capitol Insights
Legislative Update April 28, 2017 The Senate met in session Thursday morning, clearing their calendar of more than 20 bills in an effort to set the stage for the budget...
Dianne Mercier Honored as Manchester Citizen of the year
By Lauren Get... | cc/2021-04/en_middle_0018.json.gz/line114 |
__label__cc | 0.551281 | 0.448719 | Are You a Social Media Landlord or Renter?
January 14th, 2015 2 Comments
Do you own social media channels?
Think again, chances are you are simple renting a presence but somebody else is making the rules. Hence, one of the trends in social media marketing in 2015 is a turn to truly owned vs. rented social channels.
Evi... | cc/2021-04/en_middle_0018.json.gz/line117 |
__label__cc | 0.633619 | 0.366381 | Lenses for less than $400 that have a generic focus motor, have a 100mm or longer focal length and have a f/4 or faster aperture
Wildlife lens
Landscape lens
Travel lens
Sony Alpha
Canon EF (Full-frame)
Sony Alpha (Full-frame)
Sigma SA
Sony Alpha DT
< f/2.8
< 35mm
Panasonic O.I.S.
Canon IS
Panasonic MEGA O.I.S.
Sigma O... | cc/2021-04/en_middle_0018.json.gz/line123 |
__label__wiki | 0.553229 | 0.553229 | THE WALKING DEAD EPISODE 2.12 BETTER ANGELS
by BigSolo | Mar 16, 2012 | Movies and TV | 0 comments
I just got done watching the latest episode of The Walking Dead called Better Angels. Yeah I know I am a little late on watching this episode and writing this up, but things came up. So to recap a little from the last epi... | cc/2021-04/en_middle_0018.json.gz/line125 |
__label__wiki | 0.995058 | 0.995058 | Last Updated: Thursday, 27 January, 2005, 22:47 GMT
Blast kills Bangladesh politician
The attack on the rally sparked riots
A grenade attack on a political rally in north-eastern Bangladesh has killed a prominent member of the opposition Awami League and four other people.
Shah AMS Kibria, a former finance minister, di... | cc/2021-04/en_middle_0018.json.gz/line132 |
__label__wiki | 0.872697 | 0.872697 | GATEWAY PUBLIC RELEASE 2.3b
September 1st, 2014, 20:41 Posted By: wraggster
Early this week we released our latest Gateway OMEGA 2.3b firmware to our beta testers.
We have received a lot of positive feedback from our beta testers and we would like to thank them for taking the time to test the latest update.
Our beta te... | cc/2021-04/en_middle_0018.json.gz/line134 |
__label__cc | 0.704514 | 0.295486 | Tag: 上海后花园1314论坛
EPA sends $2 million in brownfield clean-up funds to Vermont
Vermont s congressional delegation announced today $2 million in Brownfields grants for the state. Senators Patrick Leahy (D-Vt.) and Bernie Sanders (I-Vt.) and Congressman Peter Welch (D-Vt.) said the Environmental Protection Agency funding,... | cc/2021-04/en_middle_0018.json.gz/line136 |
__label__wiki | 0.849299 | 0.849299 | HT Politics
Briefing 2016
heraldtribune.com
Medical marijuana fight heats up
By Lloyd Dunkelberger , Herald-Tribune
/ Friday, May 30, 2014
Early polling shows that a ballot initiative to allow the use of medical marijuana should pass in the November general election.
But it has become clear this month that supporters o... | cc/2021-04/en_middle_0018.json.gz/line143 |
__label__cc | 0.742776 | 0.257224 | Philadelphia Phillies (28-20)
Adding one of the best free agents in free agency, Bryce Harper is looking to tear it up in a Phillies uniform. He and partner Rhys Hoskins are going to hit tons of bombs this year to produce tons of runs. The rotation is good enough to lead them to the postseason, but winning in the posts... | cc/2021-04/en_middle_0018.json.gz/line146 |
__label__cc | 0.742661 | 0.257339 | ProBargainHunter.com
News, Tips and Resources for Online Bargain Hunters
russ-love.com
Top Bargains
Amazon coupon codes
Cheapest car tires
TurboTax online deals
Smart price comparison
Free restaurant food
Hotels on the cheap
Digital photo prints
Amazon shopping hacks
One deal a day sites
Best rewards programs
Business ... | cc/2021-04/en_middle_0018.json.gz/line148 |
__label__wiki | 0.917579 | 0.917579 | Category: News & Resources
The South Hadley Selectboard voted last night to appoint Mead, Talerman & Costa, LLC as their new Town Counsel. We are thrilled to be on board!
April 3, 2019 April 3, 2019 MTCLawyersNews & Resources
On October 1, the Tyngsborough Board of Selectmen voted to appoint Mead, Talerman & Costa as T... | cc/2021-04/en_middle_0018.json.gz/line151 |
__label__cc | 0.674219 | 0.325781 | lumix gx850 specs
Home → Uncategorized → lumix gx850 specs
Although this is a reasonably short focal length, it makes for … Panasonic GX850 vs Panasonic GM1: Physical Specs and Body features Comparison Size and weight is a big decision factor when you are trying to find the ideal camera for your needs. The Panasonic Lu... | cc/2021-04/en_middle_0018.json.gz/line158 |
__label__cc | 0.674779 | 0.325221 | Lester bowie all the magic
View credits, reviews, tracks and shop for the Vinyl release of All The Magic! on Discogs/5(17). I Only Have Eyes for You. () All the Magic is the second album by Lester Bowie recorded for ECM. It was released in as a double LP with the first disc consisting of band performances and a second ... | cc/2021-04/en_middle_0018.json.gz/line168 |
__label__wiki | 0.869607 | 0.869607 | Bob Santamaria and Joop Beek
In a book, written in German about the Jesuit priest Franz [von] Magnis-Suseno, its author Heinz Schütte has included a chapter on Joop/Josephus Beek. He has the story of Beek as the founder of Realino in the 1950s. In 1959 he moved to Jakarta where he trained Catholic students to become po... | cc/2021-04/en_middle_0018.json.gz/line170 |
__label__wiki | 0.824315 | 0.824315 | Education Commercial Housing Health Arts & Culture Master Planning Private Homes Projects Map
The Practice Clients Awards The Team Publications Richard Murphy and Carlo Scarpa
Latest News Previous Newsletters
Replacement of an existing sports pavilion with a new fit for purpose facility
Sport has long been an integral ... | cc/2021-04/en_middle_0018.json.gz/line172 |
__label__wiki | 0.544446 | 0.544446 | Ride Earth
Adventures - motorcycles - gear - on planet Earth
Currently: Riding South
Previously: Ride North
Motorcycles Reviews
Ride Review: Ducati Multistrada 1200S (2015)
Post author By Sebastiaan de With
I must admit, I have always been attracted to Ducati bikes. My first bike in the US was a 1997 Ducati Monster 750... | cc/2021-04/en_middle_0018.json.gz/line173 |
__label__wiki | 0.574102 | 0.574102 | Open Access and Peer-reviewed
Home Journal Issues Guide for Authors Editorial Board Aims & Scope About Journal News & Announcements
RMJ. 2019; 44(3): 445-448
Utilization of antimicrobial agents for prophylaxis and treatment of bacterial infection in liver diseases and its complications
Farrah BILAL, Mudassar Iqbal ARAI... | cc/2021-04/en_middle_0018.json.gz/line174 |
__label__wiki | 0.537786 | 0.537786 | The domain within your query sequence starts at position 209 and ends at position 250; the E-value for the BBOX domain shown below is 9.59e-7.
PKGLMCPDHKEEVTHYCKTCQRLVCQLCRVRRTHSGHKITPV
B-Box-type zinc finger
This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc finger... | cc/2021-04/en_middle_0018.json.gz/line182 |
__label__wiki | 0.529665 | 0.529665 | Tennis Buzz
October 28, 1990: first WTA title for Jennifer Capriati
October 28, 2011 · Leave a Comment
Fourteen year old Jennifer Capriati wins the first of her 14 career singles titles, defeating Zina Garrison in the finals of the Puerto Rico Open in San Juan, Puerto Rico.
Capriati, however is not the youngest player ... | cc/2021-04/en_middle_0018.json.gz/line187 |
__label__cc | 0.538704 | 0.461296 | E-paper / View
Watching history in the making
By John Coulter (China Daily)
China's Shenzhou-9 soared from the launch pad into history on Saturday. The capsule carrying China's first female astronaut, Liu Yang, and her two male colleagues, Jing Haipeng and Liu Wang, blasted off from the Jiuquan Satellite Launch Center ... | cc/2021-04/en_middle_0018.json.gz/line190 |
__label__wiki | 0.792725 | 0.792725 | Barry White on campaigns, news, events & reviews
Category Archives: Public Service Broadcasting
Does the TV licence have a future – lessons from Sweden?
October 26, 2020 BBC, Europe, Government, Public Service BroadcastingBarry White
While the government is still deciding on whether to decriminalise non-payment of the ... | cc/2021-04/en_middle_0018.json.gz/line192 |
__label__wiki | 0.560105 | 0.560105 | THE THIRD RAIL Issue 13
Sin Mayonesa
Julio César Morales
On June 19, 1867, Emperor Maximilian stood with Generals Miramón and Mejía before a firing squad. Maximilian’s last words were, “I forgive everyone, and I ask everyone to forgive me. May my blood which is about to be shed, be for the good of the country. ¡Viva Mé... | cc/2021-04/en_middle_0018.json.gz/line194 |
__label__wiki | 0.812166 | 0.812166 | World Cup 2014: Netherlands scouting report
The Dutch have deployed an unusual 3-4-1-2 formation at this World Cup, creating one of the more fascinating tactical battles at this tournament
Post categories In Socceroos
Australia have a fine record in friendlies against the Netherlands, but this is their first clash at a... | cc/2021-04/en_middle_0018.json.gz/line197 |
__label__cc | 0.642001 | 0.357999 | Science and The Environment
Modern Culture
T. M. Doran original stories
You are here: Home / Posts / T. M. Doran original stories / A story about our common humanity
A story about our common humanity
T.M. Doran
TEDDY MADE HIS COFFEE ON A CAMP HEATER. He didn’t have the right oil so it took him a long time to get it ign... | cc/2021-04/en_middle_0018.json.gz/line199 |
__label__wiki | 0.693944 | 0.693944 | Are projected 17 spend shooting sacramento billion next
Per Colorado State Law logos cannot appear on personalized license plates.
Watt and Jadeveon Clowney.
That reprises a role that Upper Deck held from 2004.
Broadcast and online creative will include documentaries focusing on the history of the Stanley Cup; 100 icon... | cc/2021-04/en_middle_0018.json.gz/line200 |
__label__wiki | 0.832259 | 0.832259 | Tariff and trade risks during an acquisition
By Mr. George Zaharatos & Mr. Stephen Sangillo, Jr. & Ms. Elizabeth Shingler & Mr. William Lovallo
This recent paper looked at the intersection of M&A and tariffs, which can be imposed quickly and dramatically impact the target's EBITDA before closing or after.
Addressing tr... | cc/2021-04/en_middle_0018.json.gz/line201 |
__label__wiki | 0.563727 | 0.563727 | Home Forums > Main WW2 Talk Forum > Theatres of War > War Against Japan >
The 200 Aussies that defied a Jap Division
Discussion in 'War Against Japan' started by Macca, Mar 13, 2009.
Macca Member
I have just finished reading the most fascinating and surely little known accounts of the 2/2 Independent company Australian... | cc/2021-04/en_middle_0018.json.gz/line206 |
__label__wiki | 0.799841 | 0.799841 | Tuesday 7th May 2013 Connor Summers
BSTFC A Team defeated by Stanton Drew in last game of season
Bradley Stoke Town Football Club’s (BSTFC’s) season is nearly over now and Saturday afternoon was the last game for the A Team.
The team faced Stanton Drew in manager Chris Laslett’s last game in charge but things didn’t go... | cc/2021-04/en_middle_0018.json.gz/line218 |
__label__cc | 0.6759 | 0.3241 | Events & Directories
craft&design Online
Considering Self Employment
By Peter Mosely, craft&design; Business Editor
"It seems likely that most people will be portfolio workers for at least some of their working lives. The earlier they put their toe into the water with a bit of self-employment (on the edges at least) th... | cc/2021-04/en_middle_0018.json.gz/line228 |
__label__wiki | 0.793182 | 0.793182 | /Category: Editing
Annuli – Double-Blind No.2 nominated for 2020 Motion Awards
Motionographer, renowned online Motion Graphics networking platform, nominated the second Double-Blind Experiment for a 2020 Open Format – Experimental Motion Award. Double Blind No.2 is one of four nominees for this year’s Open Format -Expe... | cc/2021-04/en_middle_0018.json.gz/line229 |
__label__wiki | 0.787556 | 0.787556 | DoCoMoMo : New York | Tri-State
Documentation and Conservation of Buildings, Sites and Neighborhoods of the Modern Movement
Support DOCOMOMO
Donate @ NYCcharaties.org
News February 2017
Modern Houses Seeking New Owners
In the past we’ve highlighted listings from Trimoca.com, an online gallery of Modern houses on the ma... | cc/2021-04/en_middle_0018.json.gz/line243 |
__label__wiki | 0.566264 | 0.566264 | Hijri Perpetual Calendar Platinum
October 05, 2020: Following nomination for the Grand Prix d'Horlogerie de Genève 2020 in the Calendar and Astronomy category, Parmigiani Fleurier unveils the secrets, invisible at first glance, of their Hegirian Perpetual Calendar.
Parmigiani Fleurier, renowned for its fine craftsmansh... | cc/2021-04/en_middle_0018.json.gz/line245 |
__label__cc | 0.511005 | 0.488995 | The Dux Blog
RAD’s vAccess Shortlisted for Most Innovative NFV Product Strategy Award
MAHWAH, New Jersey, May 8, 2018 – RAD, the industry pioneer of network edge virtualization, today announced that its recently released vAccess VNF for network edge virtualization was selected as finalist for Light Reading’s Leading Li... | cc/2021-04/en_middle_0018.json.gz/line248 |
__label__cc | 0.746019 | 0.253981 | Top Five PJs in Frock Flicks
By Trystan L. Bass on April 24, 2020 in Top 5 Friday
It’s been about 60 days since I’ve worn a structured garment thanks to the San Francisco Bay Area starting a shelter-in-place order earlier than anywhere else in the U.S. Plus I’d just returned from Italy when it was hit hard with Coronav... | cc/2021-04/en_middle_0018.json.gz/line252 |
__label__wiki | 0.702577 | 0.702577 | Write for GAMINGtruth
GAMINGtruth Shop
Xbox 2ca243
PlayStation 1e4ba8
Wii 0198cd
PC 3b3938
News 000000
Reviews 000000
Editorials 000000
NavigationXboxXbox 360Xbox OnePlayStationPlayStation 3PlayStation 4WiiWiiWii UPCHandheldNewsReviewsPreviewsEditorials
Published on November 20th, 2010 | by Kyle Spencer, Editor
Assassi... | cc/2021-04/en_middle_0018.json.gz/line256 |
__label__wiki | 0.813806 | 0.813806 | Download Charlie Chaplin by Peter Ackroyd PDF
By Peter Ackroyd
A short but definitive new biography of 1 of film's maximum legends: excellent for readers who need to know extra concerning the iconic megastar yet who don't are looking to decide to a long work.
He was once the first actual icon of the silver monitor and ... | cc/2021-04/en_middle_0018.json.gz/line264 |
__label__wiki | 0.589194 | 0.589194 | International Skeptics Forum » General Topics » Conspiracies and Conspiracy Theories
Continuation JFK Conspiracy Theories VIII
23rd November 2020, 12:30 PM #81
Axxman300
Location: Central California Coast
Originally Posted by MicahJava
https://old.reddit.com/r/JFKeveryday...head_contents/
PDF version: https://drive.goo... | cc/2021-04/en_middle_0018.json.gz/line266 |
__label__cc | 0.577057 | 0.422943 | Music is a Language, Really!!
We were all set and ready to play; a dinner conversation using our instruments –harp, flute, violin and cello. Oh, how we wanted to experience the freedom of improvisation like our violinist; she was our role model. On gigs, our inspired quartet resonated as one voice whether we played cla... | cc/2021-04/en_middle_0018.json.gz/line271 |
__label__wiki | 0.653448 | 0.653448 | Events Interviews Tech
Oh! Colombo WTF Buzz with Danu Fashionably, Danu Pet & I W@W Bossing It Ms. Confidential
Balance for Better
Oh! Colombo
Buzz with Danu
Fashionably, Danu
Pet & I
W@W
Bossing It
Ms. Confidential
Buzz with Danu - Anura Fernando
Jun 25 2020. views 1573
Today on the Buzz I have a new entry into front ... | cc/2021-04/en_middle_0018.json.gz/line273 |
__label__cc | 0.723389 | 0.276611 | Cre8ive Abstract, Media, Popular Culture
Michael Jackson Abstract fan art
June 26, 2009 d dot b 3 Comments
Designed by WordLife 316
R.I.P. the King of Pop Michael Jackson (1958-2008), a lot of my current musical tastes, and even my moves in the clubs (when I get down) are heavily influenced by Michael. Some of the most... | cc/2021-04/en_middle_0018.json.gz/line274 |
__label__cc | 0.60392 | 0.39608 | Slot Games Online Cleopatra
Thus at rouge-et-noir we really must have one of the" refaits" allowed us, say the first, the trente-et-tin, though any other would suit us equally well: but even then we do not win what is on the "game" table; the refait may go against us, when the players save their stakes, and if we win w... | cc/2021-04/en_middle_0018.json.gz/line276 |
__label__cc | 0.703127 | 0.296873 | Extent Research
Report Details Table Of Contents Inquiry For Buying Request Sample
Global Patient Data Management Systems (PDMS) Market 2018 - Industry Research Report
Published Date : Oct-2018 | Format :PDF | Number of Pages : 91 | Publisher : Extense Research
This report focuses on the global Patient Data Management ... | cc/2021-04/en_middle_0018.json.gz/line279 |
__label__wiki | 0.829983 | 0.829983 | Winograd & Schwartz, P.C. Contact Us
Winograd & Schwartz, P.C.
Subject: Inquiry from findanimmigrationattorney.com
* Your Name: * Required
* Your Email Address: * Required Invalid Email
* Your Phone Number:
Invalid Phone Number * Required
* Your City: * Required
State: Select Alabama Alaska Arizona Arkansas California ... | cc/2021-04/en_middle_0018.json.gz/line280 |
__label__wiki | 0.775197 | 0.775197 | FEARSORE
New album "Wetworks" out on October 30th!
Inspired by and advised listening for fans of Swans, Godflesh, Pigface, Killing Joke, Copshootcop, Samael, Skinny Puppy, Paradise Lost, and Foetus, FEARSORE is the long-running creative project of one Wiley Wells. Wetworks is the assassination of the ever-prevailing st... | cc/2021-04/en_middle_0018.json.gz/line283 |
__label__wiki | 0.636714 | 0.636714 | Scrophulous white swellings, on the other hand, are always preceded by a pain, which is particularly confined to one point you of the articulation. (From con, and genus, of the same kind.) Of the same kind; concurring in capsules the same action. CONTRAINDICATIONS: Use in children with the exception of those with hyper... | cc/2021-04/en_middle_0018.json.gz/line286 |
__label__cc | 0.679425 | 0.320575 | Renegade Tribune
Honest, uncensored, and hard-hitting articles
Current Events and Politics
Philosophy and Insight
Race and Nationalism
Podcasts and Presentations
Christmas as a Solar Festival
December 19, 2019 December 19, 2019 renegade 3 Comments
By William Tyler Olcott
From Sun Lore of All Ages [1914]
BECAUSE of the ... | cc/2021-04/en_middle_0018.json.gz/line294 |
__label__cc | 0.654071 | 0.345929 | AS and A Level: Politics
Remove3 star+
Pressure Groups (2)
fewer than 1000 (22)
Marked by Teachers essays 54
Peer Reviewed essays 7
Outline how and why federalism has changed since the 1960s.
Marked by teacher: Jessica Jung 19/02/2012
Consider the view that the arguments for having an electoral college to elect the Pre... | cc/2021-04/en_middle_0018.json.gz/line296 |
__label__wiki | 0.670328 | 0.670328 | International Baccalaureate: World Literature
Remove2000-2999 words
4 star+ (1)
Peer Reviewed essays 10
Critical Analysis of After Apple Picking by Robert Frost
I shall try to give my own: The name of the poem itself is intriguing and somewhat ominous. The decision to call it "After Apple Picking" is telling. The use o... | cc/2021-04/en_middle_0018.json.gz/line297 |
__label__cc | 0.68183 | 0.31817 | Wendy Perriam on her forthcoming short story collection Bad Mothers Brilliant Lovers
By National Short Story Week on 21st November 2014 inRead short stories
The title may seem a tad blatant but, in my 35 years as a writer, I’ve been continually fascinated by the key influence parents exert over their children’s future ... | cc/2021-04/en_middle_0018.json.gz/line301 |
__label__wiki | 0.60263 | 0.60263 | Preparation to buy energy in dry season
The Nepal Electricity Authority (NEA) is set to start dialogue for power purchase agreement (PPA) for the dry season with four export-oriented projects. These projects have proposed to sell electricity during the dry season.
The board meeting of NEA on Saturday formed a committee... | cc/2021-04/en_middle_0018.json.gz/line302 |
__label__cc | 0.665923 | 0.334077 | 12th Mar2020
‘IT: Chapter 2’ Blu-ray Review
by Chris Thomas
Stars: Jessica Chastain, James McAvoy, Bill Hader, Isaiah Mustafa, Jay Ryan, James Ransone, Andy Bean, Bill Skarsgård | Written by Gary Dauberman | Directed by Andy Muschietti When I was about 10 I had a friend whose parents really didn’t seem too bothered wha... | cc/2021-04/en_middle_0018.json.gz/line303 |
__label__wiki | 0.99754 | 0.99754 | Home > More > Hot Links > Girl band Mamamoo drops roaring party music with retro concept
Girl band Mamamoo drops roaring party music with retro concept
K-pop divas Mamamoo returned with a new album Thursday, poised to smash the spring music scene with retro party vibes.
The seven-track record “White Wind” is the finale... | cc/2021-04/en_middle_0018.json.gz/line306 |
__label__cc | 0.643452 | 0.356548 | You are here: Home / Issues / Immigration / Rep. Gutierrez Plans to be Arrested in Front of The White House
Rep. Gutierrez Plans to be Arrested in Front of The White House
April 30, 2010 By latinovations Staff
Rep. Luis Gutierrez of Chicago, who has long been an outspoken immigration advocate, says he plans to get arre... | cc/2021-04/en_middle_0018.json.gz/line307 |
__label__wiki | 0.547723 | 0.547723 | AboutAdvertise With UsContactLemonade Magazine - HomepagePollsSubscribeThanks for Signing Up!
Aaron Mannari
Allisen Casares
Brandon Enyeart
Brian Palmer
Jade Conway
Jen Emmert
Michelle Miears
Mindy DeHaan
Sarah Draughon
Wyndi May
Vice President, Aaron’s Favorites 2017
Jan 03, 2018 - (0) comments - 2017, Alex Edwards, B... | cc/2021-04/en_middle_0018.json.gz/line309 |
__label__wiki | 0.937133 | 0.937133 | LESLEY TELFORD / INVERSO PRODUCTIONS
Inverso
Dance draws from quantum science in Lesley Telford's Spooky Action at a Distance
The Georgia Straight/ by Janet Smith on April 19th, 2017 at 12:56 PM
One of the clearest definitions of quantum entanglement—a phenomenon Albert Einstein dubbed “spooky action at a distance”—can... | cc/2021-04/en_middle_0018.json.gz/line310 |
__label__cc | 0.701545 | 0.298455 | Retire Here, Not There
July 31, 2020, 9:50 a.m. EDT
This is what personal finance apps should be doing to better serve older people (and maybe everyone)
Researchers surveying people over 50 revealed the fault may lie with the apps themselves
By Richard Eisenberg
This article is reprinted by permission from NextAvenue.o... | cc/2021-04/en_middle_0018.json.gz/line318 |
__label__cc | 0.576326 | 0.423674 | Prwebme
Press Releases For Businesses
Trade & Services
alsabbaq.com
Urban News
SWAROVSKI CRYSTAL WORLDS TO MESMERIZE VISITORS WITH NEW FAMILY ATTRACTION
From the idea of bringing a centuries old memory to the modern world, Spanish designer Jaime Hayon developed the concept of creating a unique carousel that will awe th... | cc/2021-04/en_middle_0018.json.gz/line327 |
__label__wiki | 0.569416 | 0.569416 | 3 of 9 Dimensions
review by Nick Ostrum
The indefatigable David Peck (PEK) is at it still. While the recent announcement of the retirement of long-time Leap of Faith percussionist Yuri Zbitnov might damper Evil Clown's output � indeed, Zbitnov was a key, creative driving force in numerous Leap of Faith projects � until... | cc/2021-04/en_middle_0018.json.gz/line329 |
__label__cc | 0.560824 | 0.439176 | The set list and reviews from Tori's February 20th concert in Boca Raton, FL
Updated Fri, Feb 21, 2003 - 4:20am ET
ToriNews
Toriphiles
RAINN
Entry Page
Tori performed A Case Of You (solo), Mary (with the band), Talula and Spark. If you were at the Boca Raton show, please email me with your reviews and/or set list or po... | cc/2021-04/en_middle_0018.json.gz/line337 |
__label__wiki | 0.549504 | 0.549504 | Tag Archives: byelections
Iain Dale calls Lib Dem candidate a “whore”
21 June 2009 politics and lifeapril pond, byelections, iain-dale, norfolk, norwichJames Graham
Iain Dale has taken the unusual decision to take Lib Dem candidate for Norwich North April Pond to task for putting herself forward after already being the... | cc/2021-04/en_middle_0018.json.gz/line338 |
__label__cc | 0.60151 | 0.39849 | Leadership crisis at Uber – More trouble for the firm already in hot waters
Zahra Hassan
It seems that things are not going to take a change for betterment anytime soon at Uber. After a number of scandals and controversies, now the online cab hailing service is under serious leadership crises. The chief executive of Ub... | cc/2021-04/en_middle_0018.json.gz/line339 |
__label__wiki | 0.729696 | 0.729696 | PDP, Industry Players Count Gains Of Edo Modular Refinery, Obaseki’s Pro-business Posture
August 22, 2020 Greg Abolo 0 Comments
R-L (front row): Project Director, Edo Modular Refinery, Tian Tim; Senior Special Assistant to President Mohammadu Buhari on Niger Delta Affairs, Mr. Edobor Iyamu; representative of the Chairm... | cc/2021-04/en_middle_0018.json.gz/line340 |
__label__wiki | 0.54352 | 0.54352 | The Rebel Radio Podcast
EPISODE 214 - ROAD HOUSE
Dalton is a cooler, a specialized bouncer with skills that few men have. When he is asked to come to a small corrupt town to save a bar, he gets into more than he bargained for all while taking care of business. Patrick Swayze stars in the film that has maintained a cult... | cc/2021-04/en_middle_0018.json.gz/line341 |
__label__cc | 0.669878 | 0.330122 | You are here : Home » our adventures » coast to coast 2002 » C2C Resources
Between the six of us we carried at least one copy of each of the three guidebooks and each of the two different maps. That’s five different resources to point the way. However, small and larger parts of the Coast to Coast route are constantly b... | cc/2021-04/en_middle_0018.json.gz/line344 |
__label__cc | 0.711843 | 0.288157 | Review Policy & Rating System
Reviews: The Eleanor Ames Series
I became a Julie Cross fan via her Juniper Falls series (book 1, book 2), and I finally got around to reading her Eleanor Ames series. I sort of thought I would enjoy them, since I like Cross' writing, but I didn't expect to like them as much as I did.
Chas... | cc/2021-04/en_middle_0018.json.gz/line347 |
__label__wiki | 0.968945 | 0.968945 | Top Stories RSS
Iran allows Taliban to open office in country to ‘tackle’ America
ByThe Editor World News Tomorrow
WORLD NEWS TOMORROW – Iran has allowed the Taliban to open an office in eastern Iran, and has discussed providing them with surface-to-air missiles, raising the potential for cooperation with the insurgent... | cc/2021-04/en_middle_0018.json.gz/line350 |
__label__cc | 0.670612 | 0.329388 | “Learning to Write Superhero Stories”
Start Reading!
Five More Mistakes First-Time Novelists Make (#41-45)
Published by B. McKenzie at 2:50 pm under Character Development,Common Mistakes of First Time Authors,Word Choice,Writing Articles
This short article will help beginning novelists avoid another five common mistake... | cc/2021-04/en_middle_0018.json.gz/line354 |
__label__cc | 0.709898 | 0.290102 | The Broadway Malyan scenarios – more details from the Council
November 30, -0001 by Wildcat
The Council’s unveiling of Broadway Malyan’s three scenario / plans for Twickenham Riverside were not presented with enough detail. TRTG believe the community needs additional information to make informed and considered comments... | cc/2021-04/en_middle_0018.json.gz/line364 |
__label__cc | 0.682202 | 0.317798 | Based on a more realistic portrayal of "Arthur" than has ever been presented onscreen. The film will focus on the history and politics of the ...
Country: USA, Ireland, UK
Genres: Action, History, Drama, War, Adventure
Actors: Clive Owen, Ioan Gruffudd, Mads Mikkelsen, Joel Edgerton, Hugh Dancy, Ray Winstone, Ray Steve... | cc/2021-04/en_middle_0018.json.gz/line366 |
__label__wiki | 0.533085 | 0.533085 | Flexible Workplace Timeline
Future Of Work®
SINCE ∙ 2003
5 Office of the Future Predictions and Impacts
Published on June 26, 2013 - By Mike Sullivan
Office of the future
Increasingly mobile. Tech-enabled. Anywhere and anytime. Virtual assistants.
These are among the buzzwords that describe the office of the future. So... | cc/2021-04/en_middle_0018.json.gz/line394 |
__label__cc | 0.564019 | 0.435981 | Grad Program AU
Better Business, Better World
The UN’s new Global Goals for Sustainable Development could lead to greater, more widely shared prosperity for all by 2030. But how to convince more businesses to engage with the sustainable development agenda? Our client, a global leadership forum, asked us to quantify how... | cc/2021-04/en_middle_0018.json.gz/line396 |
__label__wiki | 0.891802 | 0.891802 | “The Lamb was written during a time of intense paranoia after a home invasion, deaths of loved ones and general violence around me and my friends,” says Lillie West, the Chicago-based songwriter behind Lala Lala. “I began to frequently and vividly imagine the end of the world, eventually becoming too frightened to leav... | cc/2021-04/en_middle_0018.json.gz/line409 |
__label__wiki | 0.966501 | 0.966501 | Home›News Now›Mahathir Mohamad, 92, world oldest PM takes over in Malaysia
Mahathir Mohamad, 92, world oldest PM takes over in Malaysia
Mahathir Mohamad celebrates with his coalition leaders during a press conference in Kuala Lumpur on May 10. (CNN)
London, May 10, 2018 (AltAfrika)-Veteran Malaysian politician Mahathir... | cc/2021-04/en_middle_0018.json.gz/line410 |
__label__wiki | 0.529691 | 0.529691 | Daddy's car
Little Johnny watched his daddy's car pass by the school playground and go into the woods. Curious, he followed the car and saw Daddy and Aunt Jane in a passionate embrace. Little Johnny found this so exciting that he could hardly contain himself as he ran home and started to tell his mother. 'Mommy, I was ... | cc/2021-04/en_middle_0018.json.gz/line413 |
__label__cc | 0.714639 | 0.285361 | Indie Dev of the Day and Giveaway: Day 6
Like so many of the other developers we have featured on our Indie Dev of the Day, the developers, sometimes against all odds have dug their way to the top. Image and Form did that quite literally with Steamworld Dig, their claim to fame hit that is now available on many differe... | cc/2021-04/en_middle_0018.json.gz/line421 |
__label__cc | 0.715634 | 0.284366 | Collecting and Use of EU Passenger Name Record Agreed
On 4 December 2015 the Council accepted the compromise textual content agreed with the European Parliament on the proposal for a directive on the usage of passenger title document (PNR) information for the prevention, detection, investigation and prosecution of terr... | cc/2021-04/en_middle_0018.json.gz/line422 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.